BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001G14

Length=631
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP03502.1|  unnamed protein product                                161   1e-44   Coffea canephora [robusta coffee]
ref|XP_010269540.1|  PREDICTED: uncharacterized protein OsI_027940      156   4e-44   Nelumbo nucifera [Indian lotus]
ref|XP_007050893.1|  HSP20-like chaperones superfamily protein is...    154   5e-43   Theobroma cacao [chocolate]
ref|XP_007050895.1|  HSP20-like chaperones superfamily protein is...    154   5e-43   
ref|XP_007050896.1|  HSP20-like chaperones superfamily protein is...    153   1e-42   
ref|XP_006444304.1|  hypothetical protein CICLE_v10022431mg             153   1e-42   
ref|XP_006444305.1|  hypothetical protein CICLE_v10022431mg             153   2e-42   Citrus clementina [clementine]
emb|CBI36840.3|  unnamed protein product                                153   2e-42   Vitis vinifera
gb|KJB22493.1|  hypothetical protein B456_004G052400                    152   3e-42   Gossypium raimondii
gb|KJB22494.1|  hypothetical protein B456_004G052400                    151   4e-42   Gossypium raimondii
ref|XP_008235058.1|  PREDICTED: uncharacterized protein OsI_027940      151   8e-42   Prunus mume [ume]
ref|XP_007201343.1|  hypothetical protein PRUPE_ppa011992mg             151   9e-42   Prunus persica
ref|NP_001241395.1|  uncharacterized protein LOC100796372               150   1e-41   Glycine max [soybeans]
ref|XP_002264898.1|  PREDICTED: uncharacterized protein OsI_02794...    150   1e-41   Vitis vinifera
ref|XP_010652179.1|  PREDICTED: uncharacterized protein OsI_02794...    150   1e-41   Vitis vinifera
ref|XP_003591549.1|  hypothetical protein MTR_1g088700                  151   2e-41   
ref|XP_011082475.1|  PREDICTED: uncharacterized protein OsI_02794...    149   5e-41   Sesamum indicum [beniseed]
gb|AES61800.2|  CS domain protein                                       149   6e-41   Medicago truncatula
ref|XP_008451590.1|  PREDICTED: uncharacterized protein OsI_027940      148   2e-40   Cucumis melo [Oriental melon]
ref|XP_004136034.1|  PREDICTED: uncharacterized protein OsI_02794...    148   2e-40   Cucumis sativus [cucumbers]
ref|XP_010556743.1|  PREDICTED: uncharacterized protein OsI_02794...    148   2e-40   Tarenaya hassleriana [spider flower]
ref|XP_010684508.1|  PREDICTED: uncharacterized protein OsI_027940      147   3e-40   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010556742.1|  PREDICTED: uncharacterized protein OsI_02794...    148   4e-40   Tarenaya hassleriana [spider flower]
ref|XP_004495968.1|  PREDICTED: uncharacterized protein OsI_02794...    146   7e-40   Cicer arietinum [garbanzo]
ref|XP_007050894.1|  HSP20-like chaperones superfamily protein is...    146   7e-40   
gb|KJB49925.1|  hypothetical protein B456_008G146000                    146   1e-39   Gossypium raimondii
gb|KJB49923.1|  hypothetical protein B456_008G146000                    145   2e-39   Gossypium raimondii
gb|KJB49924.1|  hypothetical protein B456_008G146000                    145   2e-39   Gossypium raimondii
gb|KHG16575.1|  hypothetical protein F383_01113                         145   2e-39   Gossypium arboreum [tree cotton]
ref|XP_009342151.1|  PREDICTED: uncharacterized protein OsI_02794...    145   2e-39   Pyrus x bretschneideri [bai li]
ref|XP_009342150.1|  PREDICTED: uncharacterized protein OsI_02794...    145   3e-39   Pyrus x bretschneideri [bai li]
ref|XP_009342102.1|  PREDICTED: uncharacterized protein OsI_02794...    144   5e-39   Pyrus x bretschneideri [bai li]
ref|XP_009342103.1|  PREDICTED: uncharacterized protein OsI_02794...    144   5e-39   Pyrus x bretschneideri [bai li]
gb|KDP28144.1|  hypothetical protein JCGZ_13915                         144   6e-39   Jatropha curcas
ref|XP_009799463.1|  PREDICTED: uncharacterized protein OsI_027940      142   3e-38   Nicotiana sylvestris
ref|XP_010259596.1|  PREDICTED: uncharacterized protein OsI_02794...    141   3e-38   Nelumbo nucifera [Indian lotus]
ref|XP_008386666.1|  PREDICTED: uncharacterized protein OsI_02794...    141   4e-38   
ref|XP_008386667.1|  PREDICTED: uncharacterized protein OsI_02794...    141   4e-38   
ref|XP_010522788.1|  PREDICTED: uncharacterized protein OsI_027940      140   2e-37   Tarenaya hassleriana [spider flower]
ref|XP_009385408.1|  PREDICTED: uncharacterized protein OsI_02794...    138   3e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009586785.1|  PREDICTED: uncharacterized protein OsI_02794...    139   4e-37   Nicotiana tomentosiformis
gb|KHN20406.1|  Hypothetical protein glysoja_039704                     141   4e-37   Glycine soja [wild soybean]
ref|XP_011079678.1|  PREDICTED: uncharacterized protein Os08g0359500    138   5e-37   Sesamum indicum [beniseed]
ref|XP_010922352.1|  PREDICTED: uncharacterized protein OsI_02794...    138   6e-37   Elaeis guineensis
ref|XP_011458724.1|  PREDICTED: uncharacterized protein Os08g0359...    139   7e-37   Fragaria vesca subsp. vesca
ref|XP_004290784.1|  PREDICTED: uncharacterized protein Os08g0359...    139   8e-37   Fragaria vesca subsp. vesca
gb|KHN43515.1|  Hypothetical protein glysoja_002098                     146   9e-37   Glycine soja [wild soybean]
ref|XP_008775907.1|  PREDICTED: uncharacterized protein OsI_02794...    137   1e-36   Phoenix dactylifera
gb|EPS74301.1|  hypothetical protein M569_00457                         137   2e-36   Genlisea aurea
gb|AGV54501.1|  zinc finger CCCH domain-containing protein              137   2e-36   Phaseolus vulgaris [French bean]
ref|XP_006659323.1|  PREDICTED: uncharacterized protein Os08g0359...    137   3e-36   Oryza brachyantha
ref|XP_011458722.1|  PREDICTED: uncharacterized protein OsI_02794...    139   3e-36   Fragaria vesca subsp. vesca
ref|XP_011458721.1|  PREDICTED: uncharacterized protein OsI_02794...    139   5e-36   Fragaria vesca subsp. vesca
ref|XP_007163102.1|  hypothetical protein PHAVU_001G206400g             135   6e-36   Phaseolus vulgaris [French bean]
ref|NP_001236771.1|  uncharacterized protein LOC100499842               135   7e-36   
ref|XP_009598042.1|  PREDICTED: uncharacterized protein OsI_02794...    135   8e-36   Nicotiana tomentosiformis
ref|XP_009598041.1|  PREDICTED: uncharacterized protein OsI_02794...    135   1e-35   Nicotiana tomentosiformis
ref|XP_010906988.1|  PREDICTED: uncharacterized protein OsI_02794...    135   1e-35   Elaeis guineensis
sp|P0C8Z0.2|Y8359_ORYSI  RecName: Full=Uncharacterized protein Os...    135   1e-35   Oryza sativa Indica Group [Indian rice]
ref|NP_001061631.1|  Os08g0359500                                       135   1e-35   
ref|XP_009598040.1|  PREDICTED: uncharacterized protein OsI_02794...    135   2e-35   Nicotiana tomentosiformis
gb|EEC83453.1|  hypothetical protein OsI_28951                          137   2e-35   Oryza sativa Indica Group [Indian rice]
ref|XP_010038204.1|  PREDICTED: uncharacterized protein Os08g0359500    133   8e-35   Eucalyptus grandis [rose gum]
ref|XP_006359384.1|  PREDICTED: uncharacterized protein Os08g0359...    134   8e-35   
ref|XP_010429707.1|  PREDICTED: uncharacterized protein Os08g0359...    133   3e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010456028.1|  PREDICTED: uncharacterized protein Os08g0359...    133   3e-34   Camelina sativa [gold-of-pleasure]
ref|XP_004494372.1|  PREDICTED: uncharacterized protein Os08g0359...    132   3e-34   Cicer arietinum [garbanzo]
ref|XP_009134430.1|  PREDICTED: uncharacterized protein OsI_02794...    132   3e-34   Brassica rapa
ref|XP_009134431.1|  PREDICTED: uncharacterized protein OsI_02794...    131   5e-34   Brassica rapa
gb|KFK42641.1|  hypothetical protein AALP_AA1G021600                    134   8e-34   Arabis alpina [alpine rockcress]
ref|XP_009769849.1|  PREDICTED: uncharacterized protein OsI_02794...    130   9e-34   Nicotiana sylvestris
gb|AFX67021.1|  putative p23 co-chaperone                               131   9e-34   Solanum tuberosum [potatoes]
emb|CDX90937.1|  BnaA03g26170D                                          131   1e-33   
ref|XP_006288563.1|  hypothetical protein CARUB_v10001852mg             131   1e-33   Capsella rubella
gb|AFK39090.1|  unknown                                                 131   1e-33   Lotus japonicus
emb|CDY15271.1|  BnaC05g01500D                                          132   1e-33   Brassica napus [oilseed rape]
emb|CDY18019.1|  BnaC03g30910D                                          132   2e-33   Brassica napus [oilseed rape]
ref|XP_009769848.1|  PREDICTED: uncharacterized protein OsI_02794...    130   2e-33   Nicotiana sylvestris
ref|XP_006418294.1|  hypothetical protein EUTSA_v10008755mg             129   3e-33   Eutrema salsugineum [saltwater cress]
ref|XP_010474870.1|  PREDICTED: uncharacterized protein OsI_02794...    129   3e-33   Camelina sativa [gold-of-pleasure]
gb|AFX66984.1|  putative p23 co-chaperone                               130   3e-33   Solanum tuberosum [potatoes]
gb|KEH24379.1|  CS domain protein                                       129   3e-33   Medicago truncatula
ref|XP_009144563.1|  PREDICTED: uncharacterized protein Os08g0359...    129   5e-33   Brassica rapa
ref|XP_006840547.1|  hypothetical protein AMTR_s00045p00215950          129   5e-33   Amborella trichopoda
gb|AFK43198.1|  unknown                                                 129   5e-33   Medicago truncatula
gb|KFK30837.1|  hypothetical protein AALP_AA6G032100                    129   6e-33   Arabis alpina [alpine rockcress]
ref|NP_001154201.1|  HSP20-like chaperone                               129   6e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006396454.1|  hypothetical protein EUTSA_v10028946mg             129   6e-33   Eutrema salsugineum [saltwater cress]
ref|NP_192154.2|  HSP20-like chaperone                                  129   6e-33   Arabidopsis thaliana [mouse-ear cress]
gb|KEH24381.1|  CS domain protein                                       129   6e-33   Medicago truncatula
gb|ACJ83262.1|  unknown                                                 129   6e-33   Medicago truncatula
ref|XP_011458723.1|  PREDICTED: uncharacterized protein Os08g0359...    129   6e-33   Fragaria vesca subsp. vesca
emb|CAC16575.1|  p23 co-chaperone                                       129   6e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010481284.1|  PREDICTED: uncharacterized protein OsI_02794...    128   7e-33   Camelina sativa [gold-of-pleasure]
ref|XP_004247428.1|  PREDICTED: uncharacterized protein OsI_027940      129   7e-33   Solanum lycopersicum
ref|XP_004290783.1|  PREDICTED: uncharacterized protein Os08g0359...    129   8e-33   Fragaria vesca subsp. vesca
ref|XP_002872836.1|  predicted protein                                  129   2e-32   
emb|CDX91318.1|  BnaC02g27290D                                          134   2e-32   
emb|CDX89935.1|  BnaA10g01470D                                          128   2e-32   
emb|CDX97265.1|  BnaA02g20560D                                          135   2e-32   
ref|XP_010422586.1|  PREDICTED: uncharacterized protein Os08g0359...    127   3e-32   Camelina sativa [gold-of-pleasure]
ref|XP_008792885.1|  PREDICTED: uncharacterized protein OsI_02794...    126   3e-32   
ref|XP_009119603.1|  PREDICTED: uncharacterized protein Os08g0359...    127   5e-32   Brassica rapa
ref|XP_003628460.1|  Zinc finger CCCH domain-containing protein         129   8e-32   
ref|XP_009414711.1|  PREDICTED: uncharacterized protein OsI_02794...    124   1e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009414713.1|  PREDICTED: uncharacterized protein OsI_02794...    124   1e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003625928.1|  RING finger protein 113A                           129   1e-31   
gb|KEH24380.1|  CS domain protein                                       125   2e-31   Medicago truncatula
gb|AAC19287.1|  T14P8.5                                                 125   6e-31   Arabidopsis thaliana [mouse-ear cress]
gb|ACN34684.1|  unknown                                                 122   8e-31   Zea mays [maize]
gb|ACF88149.1|  unknown                                                 122   9e-31   Zea mays [maize]
emb|CDY50383.1|  BnaCnng19150D                                          129   2e-30   Brassica napus [oilseed rape]
ref|XP_002892131.1|  predicted protein                                  122   3e-30   
ref|XP_002444216.1|  hypothetical protein SORBIDRAFT_07g015140          121   4e-30   Sorghum bicolor [broomcorn]
ref|NP_001241744.1|  co-chaperone protein SBA1                          120   5e-30   
ref|NP_001148972.1|  LOC100282592                                       120   6e-30   
ref|XP_003573778.1|  PREDICTED: uncharacterized protein Os08g0359500    121   7e-30   Brachypodium distachyon [annual false brome]
gb|ACR38464.1|  unknown                                                 120   7e-30   Zea mays [maize]
tpg|DAA49201.1|  TPA: hypothetical protein ZEAMMB73_435161              117   1e-29   
gb|ABK26701.1|  unknown                                                 120   1e-29   Picea sitchensis
gb|ACN35583.1|  unknown                                                 117   1e-29   Zea mays [maize]
ref|XP_009386345.1|  PREDICTED: uncharacterized protein OsI_02794...    118   2e-29   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS68218.1|  hypothetical protein TRIUR3_30845                       118   7e-29   Triticum urartu
ref|XP_004973281.1|  PREDICTED: uncharacterized protein Os08g0359...    118   8e-29   Setaria italica
tpg|DAA49203.1|  TPA: hypothetical protein ZEAMMB73_435161              117   9e-29   
ref|NP_001150702.1|  co-chaperone protein SBA1                          117   9e-29   Zea mays [maize]
dbj|BAJ94677.1|  predicted protein                                      118   1e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ADE76981.1|  unknown                                                 116   4e-28   Picea sitchensis
ref|XP_004973280.1|  PREDICTED: uncharacterized protein Os08g0359...    115   9e-28   Setaria italica
gb|ADE76546.1|  unknown                                                 115   1e-27   Picea sitchensis
ref|XP_010922358.1|  PREDICTED: uncharacterized protein OsI_02794...    113   1e-27   Elaeis guineensis
ref|XP_008811572.1|  PREDICTED: uncharacterized protein Os08g0359...    112   8e-27   Phoenix dactylifera
dbj|BAE92292.1|  putative p23 co-chaperone                              113   9e-27   Cryptomeria japonica
gb|EMT10253.1|  hypothetical protein F775_29406                         114   2e-26   
ref|XP_006434560.1|  hypothetical protein CICLE_v10002611mg             108   2e-25   Citrus clementina [clementine]
ref|XP_010314468.1|  PREDICTED: uncharacterized protein OsI_02794...    108   2e-25   Solanum lycopersicum
ref|XP_006434561.1|  hypothetical protein CICLE_v10002611mg             107   2e-25   
ref|XP_004252558.1|  PREDICTED: uncharacterized protein OsI_02794...    107   3e-25   Solanum lycopersicum
ref|XP_006473157.1|  PREDICTED: uncharacterized protein OsI_02794...    107   3e-25   Citrus sinensis [apfelsine]
ref|XP_010916995.1|  PREDICTED: uncharacterized protein OsI_02794...    107   4e-25   Elaeis guineensis
ref|XP_006360297.1|  PREDICTED: uncharacterized protein Os08g0359...    107   7e-25   Solanum tuberosum [potatoes]
ref|XP_010243328.1|  PREDICTED: uncharacterized protein OsI_02794...    105   2e-24   Nelumbo nucifera [Indian lotus]
ref|XP_008780776.1|  PREDICTED: uncharacterized protein Os08g0359...    104   5e-24   Phoenix dactylifera
emb|CBI29341.3|  unnamed protein product                                105   7e-24   Vitis vinifera
ref|XP_011044819.1|  PREDICTED: uncharacterized protein OsI_02794...    103   1e-23   Populus euphratica
ref|XP_010251769.1|  PREDICTED: uncharacterized protein Os08g0359...    102   2e-23   Nelumbo nucifera [Indian lotus]
ref|XP_010926229.1|  PREDICTED: uncharacterized protein Os08g0359...    102   3e-23   Elaeis guineensis
ref|XP_006359015.1|  PREDICTED: uncharacterized protein OsI_02794...    102   3e-23   Solanum tuberosum [potatoes]
ref|XP_009785922.1|  PREDICTED: uncharacterized protein OsI_02794...    101   6e-23   Nicotiana sylvestris
ref|XP_002265220.1|  PREDICTED: uncharacterized protein OsI_02794...    101   7e-23   Vitis vinifera
gb|AFW60898.1|  hypothetical protein ZEAMMB73_488396                  99.4    1e-22   
ref|XP_006434559.1|  hypothetical protein CICLE_v10002611mg             100   1e-22   
ref|XP_011074127.1|  PREDICTED: uncharacterized protein OsI_02794...    100   1e-22   Sesamum indicum [beniseed]
ref|XP_009380995.1|  PREDICTED: uncharacterized protein At3g03773...    100   1e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007151931.1|  hypothetical protein PHAVU_004G088000g           99.8    4e-22   Phaseolus vulgaris [French bean]
gb|AIL30486.1|  ripening regulated protein DDTFR8                     99.8    4e-22   Nicotiana tabacum [American tobacco]
ref|NP_001234685.1|  ripening regulated protein DDTFR8                99.4    4e-22   
ref|XP_009604976.1|  PREDICTED: uncharacterized protein OsI_02794...  99.4    4e-22   Nicotiana tomentosiformis
ref|XP_009409147.1|  PREDICTED: uncharacterized protein OsI_02794...  99.4    4e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006434558.1|  hypothetical protein CICLE_v10002611mg           99.0    5e-22   
ref|XP_009604975.1|  PREDICTED: uncharacterized protein OsI_02794...  99.4    5e-22   Nicotiana tomentosiformis
gb|KHN32820.1|  Hypothetical protein glysoja_024179                   99.4    5e-22   Glycine soja [wild soybean]
ref|NP_001237326.1|  uncharacterized protein LOC100527783             99.0    6e-22   Glycine max [soybeans]
ref|XP_010694668.1|  PREDICTED: uncharacterized protein At3g03773...  99.4    7e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010694670.1|  PREDICTED: uncharacterized protein OsI_02794...  99.0    7e-22   
ref|XP_010694666.1|  PREDICTED: uncharacterized protein At3g03773...  99.0    9e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010694667.1|  PREDICTED: uncharacterized protein At3g03773...  99.0    9e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011458453.1|  PREDICTED: uncharacterized protein OsI_02794...  98.6    1e-21   Fragaria vesca subsp. vesca
emb|CAN64654.1|  hypothetical protein VITISV_015756                   98.2    1e-21   Vitis vinifera
ref|XP_007020190.1|  HSP20-like chaperones superfamily protein        97.8    2e-21   Theobroma cacao [chocolate]
ref|XP_002276982.1|  PREDICTED: uncharacterized protein OsI_02794...  97.4    2e-21   Vitis vinifera
ref|XP_004159475.1|  PREDICTED: uncharacterized protein OsI_02794...  97.8    2e-21   
ref|XP_004140943.1|  PREDICTED: uncharacterized protein OsI_02794...  97.8    2e-21   Cucumis sativus [cucumbers]
ref|XP_008237431.1|  PREDICTED: uncharacterized protein Os08g0359...  99.0    2e-21   
ref|XP_008237430.1|  PREDICTED: uncharacterized protein Os08g0359...  98.6    2e-21   Prunus mume [ume]
ref|XP_002277004.1|  PREDICTED: uncharacterized protein OsI_02794...  97.1    2e-21   Vitis vinifera
ref|XP_002307531.2|  hypothetical protein POPTR_0005s22140g           97.4    3e-21   
emb|CDY50382.1|  BnaCnng19140D                                          102   5e-21   Brassica napus [oilseed rape]
ref|XP_007201255.1|  hypothetical protein PRUPE_ppa010769mg           97.4    7e-21   Prunus persica
ref|XP_007201254.1|  hypothetical protein PRUPE_ppa010769mg           97.1    7e-21   Prunus persica
gb|AFK43711.1|  unknown                                               95.1    2e-20   Lotus japonicus
ref|XP_002893745.1|  hypothetical protein ARALYDRAFT_336372           94.7    2e-20   Arabidopsis lyrata subsp. lyrata
ref|XP_002525582.1|  HSP90 co-chaperone, putative                     93.6    3e-20   Ricinus communis
ref|XP_009115602.1|  PREDICTED: uncharacterized protein OsI_02794...  94.0    4e-20   Brassica rapa
gb|AAG41763.1|AF153128_1  p23                                         94.0    4e-20   Brassica napus [oilseed rape]
ref|XP_006574773.1|  PREDICTED: uncharacterized protein OsI_02794...  94.4    4e-20   Glycine max [soybeans]
emb|CDY21385.1|  BnaA09g30420D                                        94.0    5e-20   Brassica napus [oilseed rape]
gb|KJB59532.1|  hypothetical protein B456_009G259900                  94.0    5e-20   Gossypium raimondii
gb|ABF96271.1|  expressed protein                                     93.2    6e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008381045.1|  PREDICTED: uncharacterized protein OsI_02794...  94.4    6e-20   Malus domestica [apple tree]
ref|XP_008381044.1|  PREDICTED: uncharacterized protein OsI_02794...  94.4    6e-20   Malus domestica [apple tree]
ref|NP_001050241.1|  Os03g0381300                                     93.2    7e-20   
gb|KHF97613.1|  hypothetical protein F383_14672                       93.2    7e-20   Gossypium arboreum [tree cotton]
gb|EAY90254.1|  hypothetical protein OsI_11826                        93.2    8e-20   Oryza sativa Indica Group [Indian rice]
ref|XP_011026295.1|  PREDICTED: uncharacterized protein OsI_02794...  93.2    1e-19   Populus euphratica
gb|KJB49926.1|  hypothetical protein B456_008G146000                  92.8    1e-19   Gossypium raimondii
ref|XP_008456697.1|  PREDICTED: uncharacterized protein At3g03773...  92.8    1e-19   Cucumis melo [Oriental melon]
gb|ABR17014.1|  unknown                                               91.7    2e-19   Picea sitchensis
emb|CDY04790.1|  BnaC05g17990D                                        92.4    2e-19   
ref|XP_002300889.2|  hypothetical protein POPTR_0002s06240g           92.0    2e-19   Populus trichocarpa [western balsam poplar]
gb|EYU36540.1|  hypothetical protein MIMGU_mgv1a018670mg              90.9    3e-19   Erythranthe guttata [common monkey flower]
ref|XP_003557812.1|  PREDICTED: uncharacterized protein OsI_02794...  91.3    3e-19   Brachypodium distachyon [annual false brome]
ref|NP_001148600.1|  prostaglandin E synthase 3                       91.3    4e-19   Zea mays [maize]
gb|ABA60373.1|  p23                                                   90.9    5e-19   Dactylis glomerata [cocksfoot]
ref|XP_001768873.1|  predicted protein                                87.8    2e-18   
ref|XP_010478707.1|  PREDICTED: uncharacterized protein OsI_02794...  89.0    3e-18   Camelina sativa [gold-of-pleasure]
ref|XP_006651444.1|  PREDICTED: uncharacterized protein OsI_02794...  89.0    3e-18   Oryza brachyantha
ref|XP_006443478.1|  hypothetical protein CICLE_v10022696mg           88.2    3e-18   Citrus clementina [clementine]
ref|XP_008792419.1|  PREDICTED: uncharacterized protein OsI_02794...  88.2    3e-18   
ref|XP_010478705.1|  PREDICTED: uncharacterized protein OsI_02794...  89.0    3e-18   Camelina sativa [gold-of-pleasure]
ref|XP_008456698.1|  PREDICTED: uncharacterized protein At3g03773...  89.0    3e-18   Cucumis melo [Oriental melon]
ref|XP_002992410.1|  hypothetical protein SELMODRAFT_186712           88.6    5e-18   Selaginella moellendorffii
ref|XP_002968013.1|  hypothetical protein SELMODRAFT_145227           88.2    5e-18   Selaginella moellendorffii
ref|XP_007151769.1|  hypothetical protein PHAVU_004G073200g           85.9    1e-17   Phaseolus vulgaris [French bean]
ref|XP_010910290.1|  PREDICTED: uncharacterized protein At3g03773     86.7    1e-17   Elaeis guineensis
gb|AFK42085.1|  unknown                                               86.7    1e-17   Lotus japonicus
gb|AGT16170.1|  hypothetical protein SHCRBa_024_F14_R_20              87.0    2e-17   Saccharum hybrid cultivar R570
ref|XP_003550100.1|  PREDICTED: uncharacterized protein At3g03773...  86.3    2e-17   Glycine max [soybeans]
gb|KDO66094.1|  hypothetical protein CISIN_1g031955mg                 85.9    2e-17   Citrus sinensis [apfelsine]
gb|KHN43783.1|  Hypothetical protein glysoja_035394                   86.7    3e-17   Glycine soja [wild soybean]
emb|CDY22052.1|  BnaA09g00810D                                        89.7    4e-17   Brassica napus [oilseed rape]
ref|XP_010249748.1|  PREDICTED: uncharacterized protein At3g03773     85.5    4e-17   Nelumbo nucifera [Indian lotus]
ref|XP_010461088.1|  PREDICTED: uncharacterized protein OsI_02794...  85.5    5e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010461086.1|  PREDICTED: uncharacterized protein OsI_02794...  85.5    5e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010461085.1|  PREDICTED: uncharacterized protein OsI_02794...  85.5    5e-17   Camelina sativa [gold-of-pleasure]
ref|XP_009406560.1|  PREDICTED: uncharacterized protein At3g03773     84.7    6e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006579379.1|  PREDICTED: uncharacterized protein LOC100527...  84.7    6e-17   Glycine max [soybeans]
ref|XP_002465200.1|  hypothetical protein SORBIDRAFT_01g033940        85.1    7e-17   Sorghum bicolor [broomcorn]
ref|XP_009420684.1|  PREDICTED: uncharacterized protein At3g03773...  84.3    8e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002525703.1|  HSP90 co-chaperone, putative                     84.3    8e-17   
gb|KHG15374.1|  hypothetical protein F383_20155                       84.3    8e-17   Gossypium arboreum [tree cotton]
ref|NP_001236575.1|  uncharacterized protein LOC100527476             84.3    8e-17   Glycine max [soybeans]
ref|XP_010478706.1|  PREDICTED: uncharacterized protein OsI_02794...  85.1    8e-17   Camelina sativa [gold-of-pleasure]
gb|KJB80742.1|  hypothetical protein B456_013G113500                  84.3    8e-17   Gossypium raimondii
gb|KJB80743.1|  hypothetical protein B456_013G113500                  84.3    8e-17   Gossypium raimondii
ref|XP_004984205.1|  PREDICTED: uncharacterized protein OsI_02794...  84.7    1e-16   Setaria italica
ref|XP_010922128.1|  PREDICTED: uncharacterized protein At3g03773...  84.0    1e-16   Elaeis guineensis
ref|XP_008792417.1|  PREDICTED: uncharacterized protein OsI_02794...  85.1    1e-16   
ref|XP_002988870.1|  hypothetical protein SELMODRAFT_128863           83.6    1e-16   
ref|XP_007030017.1|  HSP20-like chaperones superfamily protein is...  84.7    1e-16   
ref|XP_002964192.1|  hypothetical protein SELMODRAFT_81672            83.2    1e-16   
ref|XP_008792416.1|  PREDICTED: uncharacterized protein At3g03773...  84.3    2e-16   
ref|XP_003619026.1|  Ripening regulated protein DDTFR8                84.0    2e-16   Medicago truncatula
gb|EMT32541.1|  hypothetical protein F775_31652                       84.0    3e-16   
ref|XP_008784543.1|  PREDICTED: uncharacterized protein At3g03773     82.8    3e-16   Phoenix dactylifera
emb|CDP01142.1|  unnamed protein product                              84.0    3e-16   Coffea canephora [robusta coffee]
ref|XP_010524994.1|  PREDICTED: uncharacterized protein At3g03773     82.4    4e-16   Tarenaya hassleriana [spider flower]
ref|XP_010499808.1|  PREDICTED: uncharacterized protein OsI_02794...  82.4    6e-16   
ref|XP_010499806.1|  PREDICTED: uncharacterized protein OsI_02794...  82.4    6e-16   Camelina sativa [gold-of-pleasure]
gb|AAT68744.1|  hypothetical protein At3g03773                        80.5    9e-16   Arabidopsis thaliana [mouse-ear cress]
gb|AEO14616.1|  p23-like protein                                      82.0    1e-15   Zea mays [maize]
gb|KDP39664.1|  hypothetical protein JCGZ_02684                       81.3    1e-15   Jatropha curcas
ref|XP_010461087.1|  PREDICTED: uncharacterized protein OsI_02794...  81.6    1e-15   Camelina sativa [gold-of-pleasure]
ref|XP_009102082.1|  PREDICTED: uncharacterized protein At3g03773     80.9    1e-15   Brassica rapa
ref|XP_008386859.1|  PREDICTED: uncharacterized protein At3g03773     80.9    1e-15   Malus domestica [apple tree]
ref|NP_683525.2|  p23 co-chaperone protein                            80.5    2e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009366492.1|  PREDICTED: uncharacterized protein At3g03773...  80.1    2e-15   
ref|XP_007030016.1|  HSP20-like chaperones superfamily protein is...  81.3    3e-15   
emb|CDY21163.1|  BnaA01g33940D                                        80.9    3e-15   Brassica napus [oilseed rape]
emb|CDY29960.1|  BnaC01g40480D                                        79.3    5e-15   Brassica napus [oilseed rape]
ref|XP_002319181.2|  hypothetical protein POPTR_0013s05920g           78.6    7e-15   
ref|XP_002325859.2|  hypothetical protein POPTR_0019s05470g           79.0    7e-15   
gb|KEH25572.1|  HSP20-like chaperone superfamily protein              78.6    8e-15   Medicago truncatula
ref|XP_006375912.1|  hypothetical protein POPTR_0013s05920g           79.0    8e-15   Populus trichocarpa [western balsam poplar]
ref|XP_002882306.1|  predicted protein                                78.6    9e-15   Arabidopsis lyrata subsp. lyrata
pdb|2KMW|A  Chain A, Solution Structure Of At3g03773.1 Protein Fr...  78.2    1e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008244126.1|  PREDICTED: uncharacterized protein At3g03773...  78.2    1e-14   Prunus mume [ume]
ref|NP_001154589.1|  p23 co-chaperone protein                         79.0    1e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010499807.1|  PREDICTED: uncharacterized protein OsI_02794...  78.6    2e-14   Camelina sativa [gold-of-pleasure]
ref|XP_008244127.1|  PREDICTED: uncharacterized protein At3g03773...  77.4    2e-14   Prunus mume [ume]
ref|XP_010514039.1|  PREDICTED: uncharacterized protein At3g03773...  77.8    2e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010036247.1|  PREDICTED: uncharacterized protein At3g03773     77.8    2e-14   Eucalyptus grandis [rose gum]
ref|XP_009614071.1|  PREDICTED: uncharacterized protein At3g03773...  77.4    2e-14   
ref|XP_010111789.1|  hypothetical protein L484_008793                 79.0    2e-14   
ref|XP_007202648.1|  hypothetical protein PRUPE_ppa012211mg           78.2    2e-14   
ref|XP_001763304.1|  predicted protein                                77.4    3e-14   
ref|XP_011001701.1|  PREDICTED: uncharacterized protein At3g03773     77.0    3e-14   Populus euphratica
ref|XP_006298626.1|  hypothetical protein CARUB_v10014713mg           77.8    3e-14   
ref|XP_006826339.1|  hypothetical protein AMTR_s00004p00112630        77.0    3e-14   
gb|KFK37810.1|  hypothetical protein AALP_AA3G032300                  77.0    4e-14   
ref|XP_006387881.1|  hypothetical protein POPTR_0502s00200g           77.8    5e-14   
ref|XP_011467366.1|  PREDICTED: uncharacterized protein At3g03773     76.6    5e-14   
emb|CDP16487.1|  unnamed protein product                              77.0    6e-14   
ref|XP_009759595.1|  PREDICTED: uncharacterized protein At3g03773...  76.3    6e-14   
ref|XP_004489674.1|  PREDICTED: uncharacterized protein At3g03773...  76.3    6e-14   
ref|XP_011034312.1|  PREDICTED: uncharacterized protein At3g03773...  75.9    8e-14   
ref|XP_010677802.1|  PREDICTED: uncharacterized protein At3g03773     75.9    9e-14   
ref|XP_004982271.1|  PREDICTED: uncharacterized protein At3g03773...  75.5    1e-13   
ref|XP_011077748.1|  PREDICTED: uncharacterized protein At3g03773     75.5    1e-13   
ref|XP_009614070.1|  PREDICTED: uncharacterized protein At3g03773...  75.5    1e-13   
ref|XP_006408265.1|  hypothetical protein EUTSA_v10021254mg           77.0    1e-13   
ref|XP_006651649.1|  PREDICTED: uncharacterized protein At3g03773...  75.1    2e-13   
ref|XP_004136663.1|  PREDICTED: uncharacterized protein At3g03773...  74.3    3e-13   
ref|XP_009759594.1|  PREDICTED: uncharacterized protein At3g03773...  73.9    4e-13   
ref|XP_003550101.1|  PREDICTED: uncharacterized protein At3g03773...  73.6    4e-13   
gb|EEC75850.1|  hypothetical protein OsI_12851                        73.2    5e-13   
ref|XP_008443309.1|  PREDICTED: uncharacterized protein At3g03773...  73.2    6e-13   
gb|AAT78841.1|  putative ripening regulated protein                   73.2    7e-13   
ref|XP_008443308.1|  PREDICTED: uncharacterized protein At3g03773...  73.2    7e-13   
gb|EEE59618.1|  hypothetical protein OsJ_11950                        73.2    9e-13   
ref|XP_009759593.1|  PREDICTED: uncharacterized protein At3g03773...  72.0    2e-12   
ref|XP_003561652.1|  PREDICTED: uncharacterized protein At3g03773...  72.0    2e-12   
ref|XP_003561651.1|  PREDICTED: uncharacterized protein At3g03773...  71.6    2e-12   
ref|XP_006339212.1|  PREDICTED: uncharacterized protein At3g03773...  71.6    2e-12   
ref|XP_002505589.1|  predicted protein                                72.0    3e-12   
emb|CDY06232.1|  BnaA09g49710D                                        70.1    3e-12   
gb|EMS50884.1|  hypothetical protein TRIUR3_00736                     70.9    5e-12   
emb|CDX84211.1|  BnaC04g09730D                                        70.1    6e-12   
gb|EJY64547.1|  hypothetical protein OXYTRI_15424                     70.9    8e-12   
emb|CDX96489.1|  BnaA07g31000D                                        70.1    1e-11   
ref|XP_009759592.1|  PREDICTED: uncharacterized protein At3g03773...  70.1    1e-11   
emb|CDY48390.1|  BnaA07g24090D                                        68.9    1e-11   
ref|XP_008676642.1|  PREDICTED: LOC100282649 isoform X1               68.9    3e-11   
gb|EYU38733.1|  hypothetical protein MIMGU_mgv1a015568mg              68.6    3e-11   
ref|NP_001149029.1|  LOC100282649                                     68.6    4e-11   
tpg|DAA50638.1|  TPA: hypothetical protein ZEAMMB73_821193            68.9    4e-11   
ref|XP_004249362.1|  PREDICTED: uncharacterized protein At3g03773...  68.2    4e-11   
ref|XP_002466731.1|  hypothetical protein SORBIDRAFT_01g013010        67.8    4e-11   
gb|EMT28462.1|  hypothetical protein F775_24500                       68.2    1e-10   
ref|XP_010312189.1|  PREDICTED: uncharacterized protein At3g03773...  67.0    1e-10   
emb|CEI91946.1|  hypothetical protein RMCBS344292_06222               66.6    2e-10   
emb|CEG72482.1|  hypothetical protein RMATCC62417_08035               66.6    2e-10   
ref|XP_001751416.1|  predicted protein                                65.5    2e-10   
emb|CDW90495.1|  UNKNOWN                                              66.6    2e-10   
ref|XP_005649882.1|  HSP20-like chaperone                             65.9    3e-10   
ref|XP_001417418.1|  predicted protein                                64.3    6e-10   
gb|EXX75085.1|  Sba1p                                                 63.9    1e-09   
gb|ESA00546.1|  hypothetical protein GLOINDRAFT_338462                64.7    1e-09   
gb|EYU46679.1|  hypothetical protein MIMGU_mgv1a026818mg              61.6    2e-09   
emb|CEP11024.1|  hypothetical protein                                 62.0    6e-09   
dbj|BAH70783.1|  ACYPI001190                                          61.2    8e-09   
gb|ACG46061.1|  hypothetical protein                                  60.1    1e-08   
emb|CDH60308.1|  hypothetical protein RO3G_03344                      60.8    2e-08   
ref|XP_001951884.1|  PREDICTED: uncharacterized protein ZC395.10      61.2    2e-08   
emb|CDS09429.1|  hypothetical protein LRAMOSA10789                    60.1    3e-08   
gb|ELT99588.1|  hypothetical protein CAPTEDRAFT_175529                60.5    4e-08   
ref|XP_011439773.1|  PREDICTED: protein wos2-like isoform X1          59.7    5e-08   
ref|XP_011439774.1|  PREDICTED: prostaglandin E synthase 3-like i...  59.3    5e-08   
gb|AFK73706.1|  prostaglandin E synthase 3                            59.3    6e-08   
gb|KDP27514.1|  hypothetical protein JCGZ_20154                       58.2    8e-08   
emb|CEG81598.1|  hypothetical protein RMATCC62417_15780               57.0    8e-08   
ref|XP_003063702.1|  predicted protein                                59.7    1e-07   
ref|NP_594586.1|  p23 chaperone protein wos2                          58.2    2e-07   
ref|XP_001745103.1|  hypothetical protein                             59.3    3e-07   
dbj|BAN20316.1|  conserved hypothetical protein                       57.4    3e-07   
gb|EPB88551.1|  hypothetical protein HMPREF1544_04664                 56.6    5e-07   
dbj|GAN11316.1|  conserved hypothetical protein                       56.2    8e-07   
ref|XP_011146741.1|  PREDICTED: prostaglandin E synthase 3 isofor...  56.2    9e-07   
gb|ADY38993.1|  nuclear progesterone receptor                         55.8    9e-07   
emb|CDH56868.1|  hypothetical protein RO3G_03344                      55.8    1e-06   
gb|EXX77946.1|  Sba1p                                                 54.3    1e-06   
emb|CDS14405.1|  hypothetical protein LRAMOSA06574                    55.8    1e-06   
ref|XP_011340388.1|  PREDICTED: prostaglandin E synthase 3 isofor...  55.5    1e-06   
gb|EZA53333.1|  Prostaglandin E synthase                              55.5    1e-06   
gb|AET71738.1|  P23                                                   55.5    1e-06   
ref|XP_011155371.1|  PREDICTED: prostaglandin E synthase 3 isofor...  56.2    1e-06   
dbj|GAM26616.1|  hypothetical protein SAMD00019534_097910             57.0    1e-06   
ref|XP_011340387.1|  PREDICTED: prostaglandin E synthase 3 isofor...  55.5    1e-06   
gb|AFJ11394.1|  cytosolic prostaglandin E synthase                    55.1    2e-06   
emb|CCD59100.1|  hsp90 co-chaperone (tebp), putative                  55.1    2e-06   
gb|EIE78640.1|  hypothetical protein RO3G_03344                       54.3    3e-06   
ref|XP_002951829.1|  hypothetical protein VOLCADRAFT_75159            54.7    4e-06   
ref|XP_002680065.1|  co-chaperone p23 domain-containing protein       53.9    5e-06   
ref|XP_006557773.1|  PREDICTED: prostaglandin E synthase 3-like i...  54.7    5e-06   
ref|XP_624846.2|  PREDICTED: prostaglandin E synthase 3-like isof...  54.7    6e-06   
emb|CAX72392.1|  Conserved hypothetical protein                       53.9    8e-06   
emb|CAX79555.1|  Conserved hypothetical protein                       52.4    9e-06   
gb|ACO13013.1|  ZC395.10                                              53.1    9e-06   
ref|XP_011146742.1|  PREDICTED: prostaglandin E synthase 3 isofor...  52.8    1e-05   
ref|XP_003491979.1|  PREDICTED: uncharacterized protein CG16817-like  53.1    1e-05   
gb|EMT33618.1|  hypothetical protein F775_24477                       53.9    1e-05   
gb|ACO12226.1|  ZC395.10                                              52.8    2e-05   
ref|XP_003399635.1|  PREDICTED: uncharacterized protein CG16817-like  52.8    2e-05   
gb|KIY98474.1|  hypothetical protein MNEG_9489                        53.5    2e-05   
ref|XP_001692528.1|  p23 co-chaperone of HSP90 system                 51.6    2e-05   
gb|ACO12539.1|  ZC395.10                                              52.8    2e-05   
gb|AFV74662.1|  progesterone-like protein 2                           52.8    2e-05   
gb|ACO12857.1|  ZC395.10                                              52.4    2e-05   
ref|XP_011155372.1|  PREDICTED: prostaglandin E synthase 3 isofor...  52.8    2e-05   
ref|XP_008482032.1|  PREDICTED: prostaglandin E synthase 3-like       52.4    2e-05   
emb|CAX79533.1|  Conserved hypothetical protein                       52.4    3e-05   
ref|XP_005703152.1|  hypothetical protein Gasu_57530                  52.0    3e-05   
emb|CAX79556.1|  Conserved hypothetical protein                       52.0    3e-05   
gb|AAW26530.1|  SJCHGC02843 protein                                   52.0    3e-05   
emb|CEF97421.1|  HSP20-like chaperone                                 52.4    3e-05   
emb|CAX72397.1|  Conserved hypothetical protein                       52.0    3e-05   
ref|XP_003700535.1|  PREDICTED: uncharacterized protein CG16817-like  51.6    4e-05   
ref|XP_011055805.1|  PREDICTED: prostaglandin E synthase 3-like       51.6    4e-05   
gb|EKC27136.1|  Protein wos2                                          51.6    4e-05   
ref|XP_008482033.1|  PREDICTED: prostaglandin E synthase 3-like       52.0    4e-05   
emb|CAX79528.1|  Conserved hypothetical protein                       52.0    4e-05   
ref|XP_001692527.1|  p23 co-chaperone of HSP90 system                 52.4    4e-05   
gb|AGM32475.1|  p23-like protein                                      51.2    5e-05   
gb|AAQ83891.1|  p23-like protein                                      51.2    5e-05   
gb|ADD37979.1|  protein ZC395.10                                      51.2    6e-05   
gb|EPX70750.1|  p23 Wos2                                              51.6    6e-05   
ref|XP_002111186.1|  expressed hypothetical protein                   52.4    7e-05   
ref|XP_002490155.1|  Co-chaperone that binds to and regulates Hsp...  51.2    8e-05   
ref|XP_011301796.1|  PREDICTED: prostaglandin E synthase 3 isofor...  50.8    8e-05   
ref|XP_011301791.1|  PREDICTED: prostaglandin E synthase 3 isofor...  50.8    8e-05   
gb|EPY51912.1|  hypothetical protein SPOG_00334                       50.8    9e-05   
ref|XP_011259260.1|  PREDICTED: prostaglandin E synthase 3 isofor...  50.1    1e-04   
gb|EPZ32907.1|  HSP20-like chaperone domain-containing protein        51.2    1e-04   
ref|XP_011259259.1|  PREDICTED: prostaglandin E synthase 3 isofor...  50.1    1e-04   
gb|AGJ83338.1|  hypothetical protein                                  49.7    1e-04   
ref|XP_003691156.1|  PREDICTED: something about silencing protein...  51.6    2e-04   
ref|XP_003737019.1|  PREDICTED: prostaglandin E synthase 3-like       50.1    2e-04   
ref|XP_004998230.1|  wos2                                             50.4    2e-04   
gb|EFN66405.1|  Uncharacterized protein CG16817                       50.4    2e-04   
ref|XP_009025602.1|  hypothetical protein HELRODRAFT_163501           49.3    2e-04   
ref|XP_002430923.1|  Prostaglandin E synthase, putative               49.3    2e-04   
ref|XP_002592014.1|  hypothetical protein BRAFLDRAFT_122389           49.7    2e-04   
ref|XP_004366018.1|  CS domain-containing protein                     50.1    3e-04   
ref|XP_002176705.1|  predicted protein                                50.1    3e-04   
ref|XP_006685198.1|  hypothetical protein CANTEDRAFT_113060           49.7    4e-04   
gb|EUB61926.1|  hypothetical protein EGR_03199                        49.3    4e-04   
gb|KIK97887.1|  hypothetical protein PAXRUDRAFT_824469                49.7    4e-04   
gb|ABA28992.1|  p23                                                   48.9    4e-04   
ref|XP_001453905.1|  hypothetical protein                             48.9    4e-04   
ref|XP_010284483.1|  PREDICTED: prostaglandin E synthase 3            48.9    5e-04   
ref|XP_006685197.1|  HSP20-like chaperone                             49.7    5e-04   
ref|XP_002732671.1|  PREDICTED: uncharacterized protein ZC395.10-...  48.5    6e-04   
gb|EFX68359.1|  hypothetical protein DAPPUDRAFT_203299                48.1    7e-04   
gb|ACM08398.1|  Prostaglandin E synthase 3                            47.4    7e-04   
ref|XP_007402477.1|  hypothetical protein PHACADRAFT_107836           48.9    7e-04   
emb|CDQ66888.1|  unnamed protein product                              48.5    8e-04   
ref|XP_004070854.1|  PREDICTED: prostaglandin E synthase 3            47.8    8e-04   
gb|ACM08767.1|  Prostaglandin E synthase 3                            48.1    8e-04   
gb|KDQ30366.1|  hypothetical protein PLEOSDRAFT_1088350               48.9    9e-04   
ref|XP_010891627.1|  PREDICTED: prostaglandin E synthase 3-like       47.8    0.001   
gb|KFM58441.1|  Protein wos2                                          47.4    0.001   
gb|AHG98269.1|  prostaglandin E synthase 3                            47.8    0.001   



>emb|CDP03502.1| unnamed protein product [Coffea canephora]
Length=286

 Score =   161 bits (407),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 106/157 (68%), Positives = 120/157 (76%), Gaps = 2/157 (1%)
 Frame = +3

Query  3    VRVTFYF*GFPFPLPHRQSLPYRRSSKMSRHPEVKWAQREDKIYITVLLADAKNPKVNLE  182
             R   +F    F +    S   +++  MSRHPEVKWAQR DK+Y+TVLL DAKN KVNL+
Sbjct  47   CRAFSFFHLLGFSILSLSSFLQKQNINMSRHPEVKWAQRLDKVYLTVLLPDAKNAKVNLD  106

Query  183  PEGVFTFSATAGAENHLYEFKIELQDKVNVEESKINIGVRNIFCVlekeekk-wwnkllr  359
            P+GVFTFS TAGAENHLYE K+EL DKV+VEESKINIGVRNIFCVLEK EK  W   L  
Sbjct  107  PDGVFTFSGTAGAENHLYELKLELHDKVDVEESKINIGVRNIFCVLEKAEKNWWKKLLRG  166

Query  360  eGKPPHYvkvdwdkwvdededNGPPSDLDLGGMDFSK  470
            +GK PHY+KVDWDKW DED+D G P DLDLGGMDFSK
Sbjct  167  DGKAPHYIKVDWDKWADEDDDTG-PGDLDLGGMDFSK  202



>ref|XP_010269540.1| PREDICTED: uncharacterized protein OsI_027940 [Nelumbo nucifera]
Length=177

 Score =   156 bits (395),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 114/132 (86%), Gaps = 2/132 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWA+R DK+++TVLL DAKNPKVNLEP+G FTFSA AGAENHLYEFKI L DK
Sbjct  1    MSRHPEVKWAERADKVFLTVLLPDAKNPKVNLEPDGAFTFSAIAGAENHLYEFKINLHDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            VNVEESKIN+GVR+IFC++EK E+  W   L  + K PHYVKVDWDKWVDED+D+G P+D
Sbjct  61   VNVEESKINMGVRSIFCIIEKAEQGWWKKLLKGDEKTPHYVKVDWDKWVDEDDDSG-PAD  119

Query  441  LDLGGMDFSKFG  476
            LDLGGMDFSKF 
Sbjct  120  LDLGGMDFSKFA  131



>ref|XP_007050893.1| HSP20-like chaperones superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOX95050.1| HSP20-like chaperones superfamily protein isoform 1 [Theobroma 
cacao]
Length=180

 Score =   154 bits (389),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 112/131 (85%), Gaps = 2/131 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQR DK++ITVLL D+KN KVNLEPEGVFTFSA AGA+N+LYE K+EL DK
Sbjct  1    MSRHPEVKWAQRSDKVFITVLLPDSKNAKVNLEPEGVFTFSANAGADNNLYELKLELHDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            VNVEESKINIGVR+IFC+LEK EK  W   L  +GK PHYVKVDWDKWVDEDE+NG   D
Sbjct  61   VNVEESKINIGVRSIFCILEKAEKVWWNKLLRGDGKTPHYVKVDWDKWVDEDEENG-IGD  119

Query  441  LDLGGMDFSKF  473
            LDLGGMDFS F
Sbjct  120  LDLGGMDFSNF  130



>ref|XP_007050895.1| HSP20-like chaperones superfamily protein isoform 3 [Theobroma 
cacao]
 gb|EOX95052.1| HSP20-like chaperones superfamily protein isoform 3 [Theobroma 
cacao]
Length=183

 Score =   154 bits (388),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 112/131 (85%), Gaps = 2/131 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQR DK++ITVLL D+KN KVNLEPEGVFTFSA AGA+N+LYE K+EL DK
Sbjct  1    MSRHPEVKWAQRSDKVFITVLLPDSKNAKVNLEPEGVFTFSANAGADNNLYELKLELHDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            VNVEESKINIGVR+IFC+LEK EK  W   L  +GK PHYVKVDWDKWVDEDE+NG   D
Sbjct  61   VNVEESKINIGVRSIFCILEKAEKVWWNKLLRGDGKTPHYVKVDWDKWVDEDEENG-IGD  119

Query  441  LDLGGMDFSKF  473
            LDLGGMDFS F
Sbjct  120  LDLGGMDFSNF  130



>ref|XP_007050896.1| HSP20-like chaperones superfamily protein isoform 4 [Theobroma 
cacao]
 gb|EOX95053.1| HSP20-like chaperones superfamily protein isoform 4 [Theobroma 
cacao]
Length=183

 Score =   153 bits (386),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 117/131 (89%), Gaps = 2/131 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQR DK++ITVLL D+KN KVNLEPEGVFTFSA AGA+N+LYE K+EL DK
Sbjct  1    MSRHPEVKWAQRSDKVFITVLLPDSKNAKVNLEPEGVFTFSANAGADNNLYELKLELHDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekkwwnkllr-eGKPPHYvkvdwdkwvdededNGPPSD  440
            VNVEESKINIGVR+IFC+LEK EK WWNKLLR +GK PHYVKVDWDKWVDEDE+NG   D
Sbjct  61   VNVEESKINIGVRSIFCILEKAEKVWWNKLLRGDGKTPHYVKVDWDKWVDEDEENG-IGD  119

Query  441  LDLGGMDFSKF  473
            LDLGGMDFS F
Sbjct  120  LDLGGMDFSNF  130



>ref|XP_006444304.1| hypothetical protein CICLE_v10022431mg [Citrus clementina]
 gb|ESR57544.1| hypothetical protein CICLE_v10022431mg [Citrus clementina]
 gb|KDO87268.1| hypothetical protein CISIN_1g029750mg [Citrus sinensis]
Length=187

 Score =   153 bits (386),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 112/131 (85%), Gaps = 2/131 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSR PEVKWAQR+DK++ITV L DAKN KVNLEPEGVF+FSA+AGAENHLYE K+EL DK
Sbjct  1    MSRVPEVKWAQRQDKVFITVQLPDAKNAKVNLEPEGVFSFSASAGAENHLYELKLELFDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            VNVEESKIN+GVR+IFC++EK EK  W   L  +GK PHYVKVDWDKWVDEDEDNG   D
Sbjct  61   VNVEESKINVGVRSIFCIVEKAEKGWWKKLLRGDGKTPHYVKVDWDKWVDEDEDNG-AGD  119

Query  441  LDLGGMDFSKF  473
            LDLGGMDFS F
Sbjct  120  LDLGGMDFSNF  130



>ref|XP_006444305.1| hypothetical protein CICLE_v10022431mg [Citrus clementina]
 ref|XP_006479938.1| PREDICTED: uncharacterized protein OsI_027940-like [Citrus sinensis]
 gb|ESR57545.1| hypothetical protein CICLE_v10022431mg [Citrus clementina]
 gb|KDO87267.1| hypothetical protein CISIN_1g029750mg [Citrus sinensis]
Length=188

 Score =   153 bits (386),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 112/131 (85%), Gaps = 2/131 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSR PEVKWAQR+DK++ITV L DAKN KVNLEPEGVF+FSA+AGAENHLYE K+EL DK
Sbjct  1    MSRVPEVKWAQRQDKVFITVQLPDAKNAKVNLEPEGVFSFSASAGAENHLYELKLELFDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            VNVEESKIN+GVR+IFC++EK EK  W   L  +GK PHYVKVDWDKWVDEDEDNG   D
Sbjct  61   VNVEESKINVGVRSIFCIVEKAEKGWWKKLLRGDGKTPHYVKVDWDKWVDEDEDNG-AGD  119

Query  441  LDLGGMDFSKF  473
            LDLGGMDFS F
Sbjct  120  LDLGGMDFSNF  130



>emb|CBI36840.3| unnamed protein product [Vitis vinifera]
Length=213

 Score =   153 bits (387),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 118/148 (80%), Gaps = 4/148 (3%)
 Frame = +3

Query  42   LPHRQSLPYRRSSK--MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATA  215
            L  +   P+R  S+  MSRHPEVKWAQR DK++ITVLL DAKN KVNLEP+G FTFSA+A
Sbjct  20   LKAQPGFPFRDLSRENMSRHPEVKWAQRADKVFITVLLPDAKNAKVNLEPDGDFTFSASA  79

Query  216  GAENHLYEFKIELQDKVNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvd  392
            GAENHLYE K++L DKVNVEESKINIGVR+IFCV+EK EK  W   L  + K PHY+KVD
Sbjct  80   GAENHLYELKLDLFDKVNVEESKINIGVRSIFCVVEKAEKGWWKKLLRGDEKAPHYLKVD  139

Query  393  wdkwvdededNGPPSDLDLGGMDFSKFG  476
            WDKWVDEDED G   DLDLGGMDFSKF 
Sbjct  140  WDKWVDEDEDTG-LGDLDLGGMDFSKFA  166



>gb|KJB22493.1| hypothetical protein B456_004G052400 [Gossypium raimondii]
Length=189

 Score =   152 bits (384),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 111/131 (85%), Gaps = 2/131 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWA+R DK+YITVLL D+KN KVNLEPEGVFT SA AGA+N+LYE K++L DK
Sbjct  1    MSRHPEVKWAERADKVYITVLLPDSKNAKVNLEPEGVFTLSANAGADNNLYELKLDLYDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            VNVEESKI+IGVRNI CVLEK EK  W   L  EGK PHY+KVDWDKWVDEDEDNG P D
Sbjct  61   VNVEESKISIGVRNIVCVLEKAEKVWWKKLLRSEGKAPHYIKVDWDKWVDEDEDNG-PGD  119

Query  441  LDLGGMDFSKF  473
            +DLGGMDFS F
Sbjct  120  IDLGGMDFSSF  130



>gb|KJB22494.1| hypothetical protein B456_004G052400 [Gossypium raimondii]
Length=169

 Score =   151 bits (381),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 111/131 (85%), Gaps = 2/131 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWA+R DK+YITVLL D+KN KVNLEPEGVFT SA AGA+N+LYE K++L DK
Sbjct  1    MSRHPEVKWAERADKVYITVLLPDSKNAKVNLEPEGVFTLSANAGADNNLYELKLDLYDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            VNVEESKI+IGVRNI CVLEK EK  W   L  EGK PHY+KVDWDKWVDEDEDNG P D
Sbjct  61   VNVEESKISIGVRNIVCVLEKAEKVWWKKLLRSEGKAPHYIKVDWDKWVDEDEDNG-PGD  119

Query  441  LDLGGMDFSKF  473
            +DLGGMDFS F
Sbjct  120  IDLGGMDFSSF  130



>ref|XP_008235058.1| PREDICTED: uncharacterized protein OsI_027940 [Prunus mume]
Length=183

 Score =   151 bits (381),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 113/132 (86%), Gaps = 2/132 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQR DK++ITVLL DAK+ KV LEP+GVF+FSA+AGAENH YE K++L DK
Sbjct  1    MSRHPEVKWAQRVDKVFITVLLPDAKDAKVKLEPDGVFSFSASAGAENHHYELKLDLFDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGP-PS  437
            VNVEESKIN+GVR+IFC+LEK EK  W   L  +GK PHYVKVDWDKWVDEDED G  PS
Sbjct  61   VNVEESKINVGVRSIFCILEKAEKVWWKKLLRGDGKTPHYVKVDWDKWVDEDEDTGSGPS  120

Query  438  DLDLGGMDFSKF  473
            DLDLGGMDFSKF
Sbjct  121  DLDLGGMDFSKF  132



>ref|XP_007201343.1| hypothetical protein PRUPE_ppa011992mg [Prunus persica]
 gb|EMJ02542.1| hypothetical protein PRUPE_ppa011992mg [Prunus persica]
Length=188

 Score =   151 bits (381),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 113/132 (86%), Gaps = 2/132 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQR DK++ITVLL DAK+ KV LEP+GVF+FSA+AGAENH YE K++L DK
Sbjct  1    MSRHPEVKWAQRVDKVFITVLLPDAKDAKVKLEPDGVFSFSASAGAENHHYELKLDLFDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGP-PS  437
            VNVEESKIN+GVR+IFC+LEK EK  W   L  +GK PHYVKVDWDKWVDEDED G  PS
Sbjct  61   VNVEESKINVGVRSIFCILEKAEKVWWKKLLRGDGKTPHYVKVDWDKWVDEDEDTGSGPS  120

Query  438  DLDLGGMDFSKF  473
            DLDLGGMDFSKF
Sbjct  121  DLDLGGMDFSKF  132



>ref|NP_001241395.1| uncharacterized protein LOC100796372 [Glycine max]
 gb|ACU22871.1| unknown [Glycine max]
Length=200

 Score =   150 bits (380),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 111/131 (85%), Gaps = 1/131 (1%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQR DK+YITV LAD+KN KV+L P+G+FTFS +AGAE+H YE K+EL DK
Sbjct  1    MSRHPEVKWAQRLDKVYITVQLADSKNAKVDLTPDGIFTFSGSAGAEDHQYELKLELFDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            VNVEESKIN+GVR+IFCV++K E   W   L  EGKPPHYVKVDWDKWVDEDED+G   +
Sbjct  61   VNVEESKINVGVRSIFCVVQKAEDGWWKRLLRGEGKPPHYVKVDWDKWVDEDEDDGNNGE  120

Query  441  LDLGGMDFSKF  473
            +DLGGMDFSKF
Sbjct  121  VDLGGMDFSKF  131



>ref|XP_002264898.1| PREDICTED: uncharacterized protein OsI_027940 isoform X1 [Vitis 
vinifera]
Length=178

 Score =   150 bits (379),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 111/132 (84%), Gaps = 2/132 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQR DK++ITVLL DAKN KVNLEP+G FTFSA+AGAENHLYE K++L DK
Sbjct  1    MSRHPEVKWAQRADKVFITVLLPDAKNAKVNLEPDGDFTFSASAGAENHLYELKLDLFDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            VNVEESKINIGVR+IFCV+EK EK  W   L  + K PHY+KVDWDKWVDEDED G   D
Sbjct  61   VNVEESKINIGVRSIFCVVEKAEKGWWKKLLRGDEKAPHYLKVDWDKWVDEDEDTG-LGD  119

Query  441  LDLGGMDFSKFG  476
            LDLGGMDFSKF 
Sbjct  120  LDLGGMDFSKFA  131



>ref|XP_010652179.1| PREDICTED: uncharacterized protein OsI_027940 isoform X2 [Vitis 
vinifera]
Length=177

 Score =   150 bits (378),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 111/132 (84%), Gaps = 2/132 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQR DK++ITVLL DAKN KVNLEP+G FTFSA+AGAENHLYE K++L DK
Sbjct  1    MSRHPEVKWAQRADKVFITVLLPDAKNAKVNLEPDGDFTFSASAGAENHLYELKLDLFDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            VNVEESKINIGVR+IFCV+EK EK  W   L  + K PHY+KVDWDKWVDEDED G   D
Sbjct  61   VNVEESKINIGVRSIFCVVEKAEKGWWKKLLRGDEKAPHYLKVDWDKWVDEDEDTG-LGD  119

Query  441  LDLGGMDFSKFG  476
            LDLGGMDFSKF 
Sbjct  120  LDLGGMDFSKFA  131



>ref|XP_003591549.1| hypothetical protein MTR_1g088700 [Medicago truncatula]
Length=222

 Score =   151 bits (381),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 114/140 (81%), Gaps = 2/140 (1%)
 Frame = +3

Query  57   SLPYRRSSKMSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLY  236
            SL + ++ K SRHPEVKWAQR DK+Y+TV L D+KN KVNL P+GV TFSATAGAE+HLY
Sbjct  31   SLHHHQNPKTSRHPEVKWAQRADKVYVTVQLPDSKNAKVNLTPDGVLTFSATAGAEDHLY  90

Query  237  EFKIELQDKVNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvde  413
            E K+ L DKVNVEESKIN+GVR IFCV++K E + W   L  EGKPPHYVKVDWDKWVDE
Sbjct  91   ELKLPLFDKVNVEESKINVGVRGIFCVVQKAEDEWWKRLLKAEGKPPHYVKVDWDKWVDE  150

Query  414  dedNGPPSDLDLGGMDFSKF  473
            DED G   DLDLGGMDFS+F
Sbjct  151  DEDAG-LGDLDLGGMDFSQF  169



>ref|XP_011082475.1| PREDICTED: uncharacterized protein OsI_027940-like [Sesamum indicum]
Length=196

 Score =   149 bits (376),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 111/133 (83%), Gaps = 3/133 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWA+REDK+Y+TVLL DAKN KVN++PEG FTFSATAG +N+LYE K++L +K
Sbjct  1    MSRHPEVKWAEREDKVYLTVLLPDAKNAKVNVDPEGTFTFSATAGTDNNLYELKLDLLEK  60

Query  264  VNVEESKINIGVRNIFCVlekeekkwwnkllreG-KPPHYvkvdwdk--wvdededNGPP  434
            VNVEE KINIGVRNIFCVLEK EKKWW KLLR   K PHYVKVDWDK    D+D   G P
Sbjct  61   VNVEECKINIGVRNIFCVLEKAEKKWWEKLLRGNEKAPHYVKVDWDKWVDEDDDTGKGAP  120

Query  435  SDLDLGGMDFSKF  473
            +D DLGGMDFSKF
Sbjct  121  ADYDLGGMDFSKF  133



>gb|AES61800.2| CS domain protein [Medicago truncatula]
Length=183

 Score =   149 bits (375),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 109/131 (83%), Gaps = 2/131 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQR DK+Y+TV L D+KN KVNL P+GV TFSATAGAE+HLYE K+ L DK
Sbjct  1    MSRHPEVKWAQRADKVYVTVQLPDSKNAKVNLTPDGVLTFSATAGAEDHLYELKLPLFDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            VNVEESKIN+GVR IFCV++K E + W   L  EGKPPHYVKVDWDKWVDEDED G   D
Sbjct  61   VNVEESKINVGVRGIFCVVQKAEDEWWKRLLKAEGKPPHYVKVDWDKWVDEDEDAG-LGD  119

Query  441  LDLGGMDFSKF  473
            LDLGGMDFS+F
Sbjct  120  LDLGGMDFSQF  130



>ref|XP_008451590.1| PREDICTED: uncharacterized protein OsI_027940 [Cucumis melo]
Length=202

 Score =   148 bits (373),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 112/133 (84%), Gaps = 3/133 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQR DK++ITV L D+K+ KVNLEP+GVFTFS +AG+ENH YE K+EL DK
Sbjct  1    MSRHPEVKWAQRLDKVFITVQLPDSKDSKVNLEPDGVFTFSGSAGSENHHYELKLELFDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGPP--  434
            VNVEESK+NIGVR+IFC+LEK EK  W   L  +GKPPHYVKVDWDKWVDEDED+G    
Sbjct  61   VNVEESKVNIGVRSIFCILEKAEKGWWKKLLRGDGKPPHYVKVDWDKWVDEDEDDGTAGL  120

Query  435  SDLDLGGMDFSKF  473
             DLDLGGMDFSKF
Sbjct  121  GDLDLGGMDFSKF  133



>ref|XP_004136034.1| PREDICTED: uncharacterized protein OsI_027940-like [Cucumis sativus]
 ref|XP_004160550.1| PREDICTED: uncharacterized protein OsI_027940-like [Cucumis sativus]
 gb|KGN44928.1| hypothetical protein Csa_7G396430 [Cucumis sativus]
Length=208

 Score =   148 bits (373),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 112/133 (84%), Gaps = 3/133 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQR DK++ITV L D+K+ KVNLEP+GVFTFS +AG+ENH YE K+EL DK
Sbjct  1    MSRHPEVKWAQRLDKVFITVQLPDSKDSKVNLEPDGVFTFSGSAGSENHHYELKLELFDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGPP--  434
            VNVEESK+NIGVR+IFC+LEK EK  W   L  +GKPPHYVKVDWDKWVDEDED+G    
Sbjct  61   VNVEESKVNIGVRSIFCILEKAEKGWWKKLLRGDGKPPHYVKVDWDKWVDEDEDDGTAGL  120

Query  435  SDLDLGGMDFSKF  473
             DLDLGGMDFSKF
Sbjct  121  GDLDLGGMDFSKF  133



>ref|XP_010556743.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X2 
[Tarenaya hassleriana]
Length=206

 Score =   148 bits (373),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 110/129 (85%), Gaps = 1/129 (1%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWA+  DK+++TV LAD+KN KVNL+PEGVFTFSA AG ENH+YE K+EL DK
Sbjct  1    MSRHPEVKWAELTDKVFLTVQLADSKNTKVNLDPEGVFTFSANAGPENHVYELKLELHDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekkwwnkllreGKPPHYvkvdwdkwvdededNGP-PSD  440
            VNVE SKINIGVRNIFC+LEK E K W KLLR GKPPHYVKVDWDKWVDEDE+ G    D
Sbjct  61   VNVEPSKINIGVRNIFCILEKAEPKRWEKLLRGGKPPHYVKVDWDKWVDEDEEKGAGMGD  120

Query  441  LDLGGMDFS  467
            LD+GGMDFS
Sbjct  121  LDMGGMDFS  129



>ref|XP_010684508.1| PREDICTED: uncharacterized protein OsI_027940 [Beta vulgaris 
subsp. vulgaris]
Length=194

 Score =   147 bits (371),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 103/136 (76%), Gaps = 7/136 (5%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWA+REDK+Y+TV+L DAKNPKVNL PEG FTF+AT GA +H+YE K++L DK
Sbjct  1    MSRHPEVKWAEREDKVYLTVMLPDAKNPKVNLGPEGTFTFTATGGAGDHVYELKLDLFDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvk------vdwdkwvdeded  422
            VNVEESKI+ GVR+IFCVLEK E+K W   L  EGKPPHYVK       D D+       
Sbjct  61   VNVEESKISYGVRSIFCVLEKAEQKWWNRLLRGEGKPPHYVKIDWDKWADEDEDTGAGNG  120

Query  423  NGPPSDLDLGGMDFSK  470
             G P+D DLGGMDFSK
Sbjct  121  TGGPADFDLGGMDFSK  136



>ref|XP_010556742.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X1 
[Tarenaya hassleriana]
Length=224

 Score =   148 bits (373),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 110/129 (85%), Gaps = 1/129 (1%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWA+  DK+++TV LAD+KN KVNL+PEGVFTFSA AG ENH+YE K+EL DK
Sbjct  1    MSRHPEVKWAELTDKVFLTVQLADSKNTKVNLDPEGVFTFSANAGPENHVYELKLELHDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekkwwnkllreGKPPHYvkvdwdkwvdededNGP-PSD  440
            VNVE SKINIGVRNIFC+LEK E K W KLLR GKPPHYVKVDWDKWVDEDE+ G    D
Sbjct  61   VNVEPSKINIGVRNIFCILEKAEPKRWEKLLRGGKPPHYVKVDWDKWVDEDEEKGAGMGD  120

Query  441  LDLGGMDFS  467
            LD+GGMDFS
Sbjct  121  LDMGGMDFS  129



>ref|XP_004495968.1| PREDICTED: uncharacterized protein OsI_027940-like [Cicer arietinum]
Length=186

 Score =   146 bits (368),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 109/132 (83%), Gaps = 2/132 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQR DK+Y+T+ L D+KN KV+L P+G+ TFSA+AGAENHLYE ++ L DK
Sbjct  1    MSRHPEVKWAQRADKVYVTIQLPDSKNAKVDLTPDGILTFSASAGAENHLYELQLPLFDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            VNVEESKIN+GVR IFCV++K E + W   L  EGKPPHYVKVDWDKW+DEDED     D
Sbjct  61   VNVEESKINVGVRGIFCVVQKAEIEWWKRLLKAEGKPPHYVKVDWDKWMDEDEDEA-AGD  119

Query  441  LDLGGMDFSKFG  476
            LDLGGMDFS+FG
Sbjct  120  LDLGGMDFSQFG  131



>ref|XP_007050894.1| HSP20-like chaperones superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOX95051.1| HSP20-like chaperones superfamily protein isoform 2 [Theobroma 
cacao]
Length=188

 Score =   146 bits (368),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 112/139 (81%), Gaps = 10/139 (7%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQR DK++ITVLL D+KN KVNLEPEGVFTFSA AGA+N+LYE K+EL DK
Sbjct  1    MSRHPEVKWAQRSDKVFITVLLPDSKNAKVNLEPEGVFTFSANAGADNNLYELKLELHDK  60

Query  264  VNVE--------ESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvded  416
            VNVE        ESKINIGVR+IFC+LEK EK  W   L  +GK PHYVKVDWDKWVDED
Sbjct  61   VNVEFLFFFGKKESKINIGVRSIFCILEKAEKVWWNKLLRGDGKTPHYVKVDWDKWVDED  120

Query  417  edNGPPSDLDLGGMDFSKF  473
            E+NG   DLDLGGMDFS F
Sbjct  121  EENG-IGDLDLGGMDFSNF  138



>gb|KJB49925.1| hypothetical protein B456_008G146000 [Gossypium raimondii]
Length=209

 Score =   146 bits (368),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 108/131 (82%), Gaps = 1/131 (1%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQR DK++ITVLL D+KN KVNLEPEGVF FSATAG +N+ YE K++L DK
Sbjct  1    MSRHPEVKWAQRTDKVFITVLLPDSKNAKVNLEPEGVFNFSATAGTDNNTYELKLDLFDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            VNVEESKINIGVR+IFC+LEK EK  W   L  +GK PHYVKVDWDKWVDEDED     D
Sbjct  61   VNVEESKINIGVRSIFCILEKAEKVWWKKLLRGDGKAPHYVKVDWDKWVDEDEDKVGLGD  120

Query  441  LDLGGMDFSKF  473
            LDLGGMDFS F
Sbjct  121  LDLGGMDFSNF  131



>gb|KJB49923.1| hypothetical protein B456_008G146000 [Gossypium raimondii]
Length=208

 Score =   145 bits (367),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 109/131 (83%), Gaps = 2/131 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQR DK++ITVLL D+KN KVNLEPEGVF FSATAG +N+ YE K++L DK
Sbjct  1    MSRHPEVKWAQRTDKVFITVLLPDSKNAKVNLEPEGVFNFSATAGTDNNTYELKLDLFDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            VNVEESKINIGVR+IFC+LEK EK  W   L  +GK PHYVKVDWDKWVDEDED G   D
Sbjct  61   VNVEESKINIGVRSIFCILEKAEKVWWKKLLRGDGKAPHYVKVDWDKWVDEDEDKG-LGD  119

Query  441  LDLGGMDFSKF  473
            LDLGGMDFS F
Sbjct  120  LDLGGMDFSNF  130



>gb|KJB49924.1| hypothetical protein B456_008G146000 [Gossypium raimondii]
Length=206

 Score =   145 bits (366),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 109/131 (83%), Gaps = 2/131 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQR DK++ITVLL D+KN KVNLEPEGVF FSATAG +N+ YE K++L DK
Sbjct  1    MSRHPEVKWAQRTDKVFITVLLPDSKNAKVNLEPEGVFNFSATAGTDNNTYELKLDLFDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            VNVEESKINIGVR+IFC+LEK EK  W   L  +GK PHYVKVDWDKWVDEDED G   D
Sbjct  61   VNVEESKINIGVRSIFCILEKAEKVWWKKLLRGDGKAPHYVKVDWDKWVDEDEDKG-LGD  119

Query  441  LDLGGMDFSKF  473
            LDLGGMDFS F
Sbjct  120  LDLGGMDFSNF  130



>gb|KHG16575.1| hypothetical protein F383_01113 [Gossypium arboreum]
Length=193

 Score =   145 bits (365),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 109/131 (83%), Gaps = 2/131 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQR DK++ITVLL D+KN KVNLEPEGVF FSATAG +N+ YE K++L DK
Sbjct  1    MSRHPEVKWAQRTDKVFITVLLPDSKNAKVNLEPEGVFNFSATAGTDNNTYELKLDLFDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            VNVEESKIN+GVR+IFC+LEK EK  W   L  +GK PHYVKVDWDKWVDEDED G   D
Sbjct  61   VNVEESKINVGVRSIFCILEKAEKVWWKKLLRGDGKAPHYVKVDWDKWVDEDEDKG-LGD  119

Query  441  LDLGGMDFSKF  473
            LDLGGMDFS F
Sbjct  120  LDLGGMDFSNF  130



>ref|XP_009342151.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X2 
[Pyrus x bretschneideri]
Length=199

 Score =   145 bits (365),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 106/133 (80%), Gaps = 3/133 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPE+KWAQR DK++ITVLL DAK+ KV LEPEGVF+FSA+AGAENH YE K++L DK
Sbjct  1    MSRHPELKWAQRVDKVFITVLLPDAKDAKVKLEPEGVFSFSASAGAENHQYELKLDLFDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdk--wvdededNGPP  434
            VNVEESKIN+G+R+IFC++EK E   W   L  +GK PHYVKVDWDK    D+D     P
Sbjct  61   VNVEESKINVGMRSIFCIVEKAEPAWWNKLLCGDGKMPHYVKVDWDKWVDEDDDTAGSGP  120

Query  435  SDLDLGGMDFSKF  473
             D+DLGGMDFSKF
Sbjct  121  GDMDLGGMDFSKF  133



>ref|XP_009342150.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X1 
[Pyrus x bretschneideri]
Length=200

 Score =   145 bits (365),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 94/134 (70%), Positives = 110/134 (82%), Gaps = 4/134 (3%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPE+KWAQR DK++ITVLL DAK+ KV LEPEGVF+FSA+AGAENH YE K++L DK
Sbjct  1    MSRHPELKWAQRVDKVFITVLLPDAKDAKVKLEPEGVFSFSASAGAENHQYELKLDLFDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGP---  431
            VNVEESKIN+G+R+IFC++EK E   W   L  +GK PHYVKVDWDKWVDED+D      
Sbjct  61   VNVEESKINVGMRSIFCIVEKAEPAWWNKLLCGDGKMPHYVKVDWDKWVDEDDDTAAGSG  120

Query  432  PSDLDLGGMDFSKF  473
            P D+DLGGMDFSKF
Sbjct  121  PGDMDLGGMDFSKF  134



>ref|XP_009342102.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X1 
[Pyrus x bretschneideri]
Length=193

 Score =   144 bits (363),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 109/133 (82%), Gaps = 4/133 (3%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPE+KWAQR DK++ITVLL DAK+ KV LEPEGVF+FSA+AGAENH YE K++L DK
Sbjct  1    MSRHPELKWAQRVDKVFITVLLPDAKDAKVKLEPEGVFSFSASAGAENHQYELKLDLFDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGP---  431
            VNVEESKIN+GVR+IFC++EK E   W   L  +GK PHYVKVDWDKWVDED+D      
Sbjct  61   VNVEESKINVGVRSIFCIVEKAEPAWWNKLLRGDGKMPHYVKVDWDKWVDEDDDTAAGSG  120

Query  432  PSDLDLGGMDFSK  470
            P D+DLGGMDFSK
Sbjct  121  PGDMDLGGMDFSK  133



>ref|XP_009342103.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X2 
[Pyrus x bretschneideri]
Length=192

 Score =   144 bits (362),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 105/132 (80%), Gaps = 3/132 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPE+KWAQR DK++ITVLL DAK+ KV LEPEGVF+FSA+AGAENH YE K++L DK
Sbjct  1    MSRHPELKWAQRVDKVFITVLLPDAKDAKVKLEPEGVFSFSASAGAENHQYELKLDLFDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdk--wvdededNGPP  434
            VNVEESKIN+GVR+IFC++EK E   W   L  +GK PHYVKVDWDK    D+D     P
Sbjct  61   VNVEESKINVGVRSIFCIVEKAEPAWWNKLLRGDGKMPHYVKVDWDKWVDEDDDTAGSGP  120

Query  435  SDLDLGGMDFSK  470
             D+DLGGMDFSK
Sbjct  121  GDMDLGGMDFSK  132



>gb|KDP28144.1| hypothetical protein JCGZ_13915 [Jatropha curcas]
Length=188

 Score =   144 bits (362),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 87/100 (87%), Gaps = 1/100 (1%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQR DK++ITVLL DAKN KVNLEPEGVFTFSA+AGAENH+YE K+EL DK
Sbjct  1    MSRHPEVKWAQRVDKVFITVLLPDAKNAKVNLEPEGVFTFSASAGAENHVYELKLELFDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHY  380
            VNVEESKINIGVR+IFC++EK EK  W   L  +GKPPHY
Sbjct  61   VNVEESKINIGVRSIFCIVEKAEKVWWKKLLRGDGKPPHY  100



>ref|XP_009799463.1| PREDICTED: uncharacterized protein OsI_027940 [Nicotiana sylvestris]
Length=194

 Score =   142 bits (357),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 108/133 (81%), Gaps = 3/133 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP+VKWAQR D +Y+TV L DAKNPKVNL+PEG+FTFSATAG E++ YE K+EL DK
Sbjct  1    MSRHPQVKWAQRPDVVYLTVQLPDAKNPKVNLDPEGIFTFSATAGPESYAYELKLELFDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededN--GPP  434
            VNVEESKINIGVRNIFCVLEK EKK W   L  + K PHYVKVDWDKWVDED+DN    P
Sbjct  61   VNVEESKINIGVRNIFCVLEKSEKKWWNKLLRGDEKAPHYVKVDWDKWVDEDDDNETAAP  120

Query  435  SDLDLGGMDFSKF  473
             D D+  MDFSKF
Sbjct  121  GDFDMNSMDFSKF  133



>ref|XP_010259596.1| PREDICTED: uncharacterized protein OsI_027940-like [Nelumbo nucifera]
Length=187

 Score =   141 bits (356),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 106/132 (80%), Gaps = 4/132 (3%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWA+R DK+Y+TVLL DAKN KVNLEP+GVFTFSAT G EN LYE KI L DK
Sbjct  1    MSRHPEVKWAERVDKVYLTVLLPDAKNSKVNLEPDGVFTFSATTGPENLLYELKINLHDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            VNVEESKINIGVRNIFCV+EK EK  W   L  + K PHYVKVDWDKWVDED+DN     
Sbjct  61   VNVEESKINIGVRNIFCVIEKAEKGWWKKLLQADEKTPHYVKVDWDKWVDEDDDNADLD-  119

Query  441  LDLGGMDFSKFG  476
              LGGMDFSKFG
Sbjct  120  --LGGMDFSKFG  129



>ref|XP_008386666.1| PREDICTED: uncharacterized protein OsI_027940 isoform X1 [Malus 
domestica]
Length=191

 Score =   141 bits (356),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 109/133 (82%), Gaps = 4/133 (3%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQR DK+++TVLL DAK+ KV LEP+G F+FSA+AGAENH YE K++L DK
Sbjct  1    MSRHPEVKWAQRVDKVFLTVLLPDAKDAKVKLEPDGTFSFSASAGAENHQYELKLDLFDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGP---  431
            VNVEESKIN+GVR+IFC++EK E + W   L  +GK PHYVKVDWDKWVDED+D      
Sbjct  61   VNVEESKINVGVRSIFCIVEKAEPEWWPKLLRGDGKTPHYVKVDWDKWVDEDDDTAAGSG  120

Query  432  PSDLDLGGMDFSK  470
            P D+DLGGMDFSK
Sbjct  121  PGDMDLGGMDFSK  133



>ref|XP_008386667.1| PREDICTED: uncharacterized protein OsI_027940 isoform X2 [Malus 
domestica]
Length=190

 Score =   141 bits (356),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 105/132 (80%), Gaps = 3/132 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQR DK+++TVLL DAK+ KV LEP+G F+FSA+AGAENH YE K++L DK
Sbjct  1    MSRHPEVKWAQRVDKVFLTVLLPDAKDAKVKLEPDGTFSFSASAGAENHQYELKLDLFDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdk--wvdededNGPP  434
            VNVEESKIN+GVR+IFC++EK E + W   L  +GK PHYVKVDWDK    D+D     P
Sbjct  61   VNVEESKINVGVRSIFCIVEKAEPEWWPKLLRGDGKTPHYVKVDWDKWVDEDDDTAGSGP  120

Query  435  SDLDLGGMDFSK  470
             D+DLGGMDFSK
Sbjct  121  GDMDLGGMDFSK  132



>ref|XP_010522788.1| PREDICTED: uncharacterized protein OsI_027940 [Tarenaya hassleriana]
Length=204

 Score =   140 bits (352),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWA+R DKI++TV L D+K+ KVNL+PEGVFTFSA AG ENHLYE K+EL DK
Sbjct  1    MSRHPEVKWAERTDKIFLTVQLPDSKDAKVNLDPEGVFTFSANAGPENHLYELKLELHDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekkwwnkllreGKPPHY  380
            VNVE SKINIGVRNIFC+LEK E K W+KLLR GKPPHY
Sbjct  61   VNVEASKINIGVRNIFCILEKAEPKRWDKLLRGGKPPHY  99



>ref|XP_009385408.1| PREDICTED: uncharacterized protein OsI_027940-like [Musa acuminata 
subsp. malaccensis]
Length=159

 Score =   138 bits (348),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 106/133 (80%), Gaps = 3/133 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVK AQR DKIYITV L DAK+ KVNLEP+G+FTFSATAGA N  YE K++L DK
Sbjct  1    MSRHPEVKLAQRLDKIYITVQLPDAKDAKVNLEPDGIFTFSATAGAGNSTYELKMDLYDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            VN E SKIN+GVR+IFCV+EK EK  W   L  +GK PHYVKVDWDKWVDED D   P D
Sbjct  61   VNKEASKINVGVRSIFCVVEKAEKGWWKKLLRGDGKAPHYVKVDWDKWVDEDADG--PGD  118

Query  441  LDLGGMDFSKFGD  479
            LDLGGMDFS FG+
Sbjct  119  LDLGGMDFSNFGN  131



>ref|XP_009586785.1| PREDICTED: uncharacterized protein OsI_027940-like [Nicotiana 
tomentosiformis]
Length=193

 Score =   139 bits (350),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 107/133 (80%), Gaps = 3/133 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP+VKWAQR D +Y+TV L DAK+ KVNL+PEG+FTFSATAG E+H YE K+EL DK
Sbjct  1    MSRHPQVKWAQRPDVVYLTVQLPDAKSSKVNLDPEGIFTFSATAGPESHAYELKLELFDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededN--GPP  434
            +NVEESKINIGVRNIFCVLEK EKK W   L  + K PHYVKVDWDKWVDED+DN    P
Sbjct  61   INVEESKINIGVRNIFCVLEKSEKKWWNKLLRGDEKAPHYVKVDWDKWVDEDDDNDTAAP  120

Query  435  SDLDLGGMDFSKF  473
             D D+  MDFSKF
Sbjct  121  GDFDMNSMDFSKF  133



>gb|KHN20406.1| Hypothetical protein glysoja_039704 [Glycine soja]
Length=269

 Score =   141 bits (355),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 109/134 (81%), Gaps = 1/134 (1%)
 Frame = +3

Query  75   SSKMSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIEL  254
            S++ SRHPEVKWAQR DK+YITV LAD+KN KV+L P+G+FTFS +AGAE+H YE K+EL
Sbjct  46   STQGSRHPEVKWAQRLDKVYITVQLADSKNAKVDLTPDGIFTFSGSAGAEDHQYELKLEL  105

Query  255  QDKVNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGP  431
             DKVNVEESKIN+G R+IF V++K E   W   L  EGK PHYVKVDWDKWVDEDED G 
Sbjct  106  FDKVNVEESKINVGERSIFIVVQKAEDGWWKRLLRGEGKTPHYVKVDWDKWVDEDEDEGN  165

Query  432  PSDLDLGGMDFSKF  473
              ++DLGGMDFSKF
Sbjct  166  TGEVDLGGMDFSKF  179



>ref|XP_011079678.1| PREDICTED: uncharacterized protein Os08g0359500 [Sesamum indicum]
Length=182

 Score =   138 bits (348),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 109/134 (81%), Gaps = 2/134 (1%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWA+REDK+Y+TVLL+DAKNPKV ++P+G FTFSATAG +N+LYE K++L DK
Sbjct  1    MSRHPEVKWAEREDKVYLTVLLSDAKNPKVKVDPDGTFTFSATAGTDNNLYELKLDLLDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvd-wdkwvdededNGPPS  437
            VNVEESKINIGVRNIFCVLEK E++ W   L    K PHYVKVD      ++D+  G P 
Sbjct  61   VNVEESKINIGVRNIFCVLEKAEQQWWKKLLRGNAKAPHYVKVDWDKWVDEDDDTGGGPG  120

Query  438  DLDLGGMDFSKFGD  479
            DLDLGGMDFSKFGD
Sbjct  121  DLDLGGMDFSKFGD  134



>ref|XP_010922352.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X1 
[Elaeis guineensis]
Length=181

 Score =   138 bits (348),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 96/132 (73%), Gaps = 3/132 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQR DK+YITV L DAK+ KVNLE +G+FTFSATAGAE +LYE K++L DK
Sbjct  1    MSRHPEVKWAQRVDKVYITVQLPDAKDVKVNLESDGIFTFSATAGAEKNLYELKMDLYDK  60

Query  264  VNVEESKINIGVRNIFC-VlekeekkwwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            VNVE SKIN GVR+IFC V + E+  W   L  + K PHY  V  D     DED+  P D
Sbjct  61   VNVEGSKINTGVRSIFCMVEKVEKVWWKKLLRGDEKTPHY--VKVDWDKWVDEDDDGPGD  118

Query  441  LDLGGMDFSKFG  476
             DLGGMDFS FG
Sbjct  119  FDLGGMDFSNFG  130



>ref|XP_011458724.1| PREDICTED: uncharacterized protein Os08g0359500 isoform X6 [Fragaria 
vesca subsp. vesca]
Length=240

 Score =   139 bits (351),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 102/134 (76%), Gaps = 6/134 (4%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQREDK+++TV+L DAK+ KV LEPEGVF FSA+AGAENH YE K++L DK
Sbjct  1    MSRHPEVKWAQREDKVFLTVVLPDAKDAKVKLEPEGVFIFSASAGAENHQYELKLDLFDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGPPS-  437
            VNVEESKI+IGVR+I C++EK EK  W   L  +GK PHY  V  D     DED  PP+ 
Sbjct  61   VNVEESKISIGVRSIVCIVEKAEKVWWSKLLKGDGKTPHY--VKVDWDKWVDEDEDPPAG  118

Query  438  --DLDLGGMDFSKF  473
              D+ +GGMDFSKF
Sbjct  119  ADDMGMGGMDFSKF  132



>ref|XP_004290784.1| PREDICTED: uncharacterized protein Os08g0359500 isoform X5 [Fragaria 
vesca subsp. vesca]
Length=241

 Score =   139 bits (351),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 102/135 (76%), Gaps = 7/135 (5%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQREDK+++TV+L DAK+ KV LEPEGVF FSA+AGAENH YE K++L DK
Sbjct  1    MSRHPEVKWAQREDKVFLTVVLPDAKDAKVKLEPEGVFIFSASAGAENHQYELKLDLFDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGPPS-  437
            VNVEESKI+IGVR+I C++EK EK  W   L  +GK PHY  V  D     DED  PP+ 
Sbjct  61   VNVEESKISIGVRSIVCIVEKAEKVWWSKLLKGDGKTPHY--VKVDWDKWVDEDEDPPAA  118

Query  438  ---DLDLGGMDFSKF  473
               D+ +GGMDFSKF
Sbjct  119  GADDMGMGGMDFSKF  133



>gb|KHN43515.1| Hypothetical protein glysoja_002098 [Glycine soja]
Length=738

 Score =   146 bits (368),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 109/129 (84%), Gaps = 1/129 (1%)
 Frame = +3

Query  90   RHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDKVN  269
            RHPEVKWAQR DK+YITV LAD+KN KV+L P+G+FTFS +AGAE+H YE K+EL DKVN
Sbjct  42   RHPEVKWAQRLDKVYITVQLADSKNAKVDLTPDGIFTFSGSAGAEDHQYELKLELFDKVN  101

Query  270  VEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGPPSDLD  446
            VEESKIN+GVR+IFCV++K E   W   L  EGKPPHYVKVDWDKWVDEDED+G   ++D
Sbjct  102  VEESKINVGVRSIFCVVQKAEDGWWKRLLRGEGKPPHYVKVDWDKWVDEDEDDGNNGEVD  161

Query  447  LGGMDFSKF  473
            LGGMDFSKF
Sbjct  162  LGGMDFSKF  170



>ref|XP_008775907.1| PREDICTED: uncharacterized protein OsI_027940-like [Phoenix dactylifera]
Length=181

 Score =   137 bits (346),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 99/131 (76%), Gaps = 3/131 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQR DK+YIT+ L DAK+ KVNLEP+G+F+FSATAGAE +LYE K++L DK
Sbjct  1    MSRHPEVKWAQRVDKVYITIQLPDAKDAKVNLEPDGIFSFSATAGAEKNLYELKMDLYDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            VNVE SKIN GVR+IFCV+EK EK  W   L  + K PHY  V  D     DED+  P +
Sbjct  61   VNVEGSKINTGVRSIFCVVEKVEKGWWKKLLRGDEKTPHY--VKVDWDKWVDEDDDGPGE  118

Query  441  LDLGGMDFSKF  473
            LDLGGMDFS F
Sbjct  119  LDLGGMDFSNF  129



>gb|EPS74301.1| hypothetical protein M569_00457 [Genlisea aurea]
Length=175

 Score =   137 bits (344),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 113/131 (86%), Gaps = 2/131 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWA+RED +Y+T+LL DAKNPKVN++P+G FTF+ TAG +N+ YE K++L D+
Sbjct  1    MSRHPEVKWAEREDIVYLTLLLPDAKNPKVNVDPDGSFTFTGTAGTDNNHYELKLDLLDR  60

Query  264  VNVEESKINIGVRNIFCVlekeekkwwnkllr-eGKPPHYvkvdwdkwvdededNGP-PS  437
            +NVEESKINIGVR+I C+LEK EKKWW KLLR +GK PHYVKVDWDKWVDED+D G  P 
Sbjct  61   INVEESKINIGVRSIICILEKAEKKWWKKLLRGDGKAPHYVKVDWDKWVDEDDDTGAMPG  120

Query  438  DLDLGGMDFSK  470
            D D+GGMDFSK
Sbjct  121  DFDMGGMDFSK  131



>gb|AGV54501.1| zinc finger CCCH domain-containing protein [Phaseolus vulgaris]
Length=186

 Score =   137 bits (345),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 107/131 (82%), Gaps = 2/131 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQR DK+Y+TV LAD+KN KV+L PEGVFTFS +AG+E+H YE K+EL +K
Sbjct  1    MSRHPEVKWAQRVDKVYVTVQLADSKNAKVDLTPEGVFTFSGSAGSEDHQYELKLELFEK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            VNVEESKIN+GVR+IFCV++K E   W   L  EGK PHYVKVDWDKWVDEDE+ G    
Sbjct  61   VNVEESKINVGVRSIFCVVQKAEIGWWKRFLRAEGKTPHYVKVDWDKWVDEDEEEGSGEP  120

Query  441  LDLGGMDFSKF  473
             DLGGMDFSKF
Sbjct  121  -DLGGMDFSKF  130



>ref|XP_006659323.1| PREDICTED: uncharacterized protein Os08g0359500-like [Oryza brachyantha]
Length=204

 Score =   137 bits (345),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 98/131 (75%), Gaps = 4/131 (3%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQR DK+YITV LADAKN KVNLEPEGVF+FSATAG + +LYE K+EL DK
Sbjct  1    MSRHPEVKWAQRIDKVYITVQLADAKNAKVNLEPEGVFSFSATAGTDGNLYESKLELNDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            VNVEESKI++GVR+IFC++EK E K W   +  + K PH+       W    +++   +D
Sbjct  61   VNVEESKISVGVRSIFCIVEKAEAKWWKKLVRDDQKAPHF---VKVDWDKWVDEDDDGAD  117

Query  441  LDLGGMDFSKF  473
            +++ GMDFS F
Sbjct  118  VNVDGMDFSNF  128



>ref|XP_011458722.1| PREDICTED: uncharacterized protein OsI_027940 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=292

 Score =   139 bits (350),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 102/134 (76%), Gaps = 6/134 (4%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQREDK+++TV+L DAK+ KV LEPEGVF FSA+AGAENH YE K++L DK
Sbjct  1    MSRHPEVKWAQREDKVFLTVVLPDAKDAKVKLEPEGVFIFSASAGAENHQYELKLDLFDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGPPS-  437
            VNVEESKI+IGVR+I C++EK EK  W   L  +GK PHY  V  D     DED  PP+ 
Sbjct  61   VNVEESKISIGVRSIVCIVEKAEKVWWSKLLKGDGKTPHY--VKVDWDKWVDEDEDPPAG  118

Query  438  --DLDLGGMDFSKF  473
              D+ +GGMDFSKF
Sbjct  119  ADDMGMGGMDFSKF  132



>ref|XP_011458721.1| PREDICTED: uncharacterized protein OsI_027940 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=293

 Score =   139 bits (349),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 102/135 (76%), Gaps = 7/135 (5%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQREDK+++TV+L DAK+ KV LEPEGVF FSA+AGAENH YE K++L DK
Sbjct  1    MSRHPEVKWAQREDKVFLTVVLPDAKDAKVKLEPEGVFIFSASAGAENHQYELKLDLFDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGPPS-  437
            VNVEESKI+IGVR+I C++EK EK  W   L  +GK PHY  V  D     DED  PP+ 
Sbjct  61   VNVEESKISIGVRSIVCIVEKAEKVWWSKLLKGDGKTPHY--VKVDWDKWVDEDEDPPAA  118

Query  438  ---DLDLGGMDFSKF  473
               D+ +GGMDFSKF
Sbjct  119  GADDMGMGGMDFSKF  133



>ref|XP_007163102.1| hypothetical protein PHAVU_001G206400g [Phaseolus vulgaris]
 gb|ESW35096.1| hypothetical protein PHAVU_001G206400g [Phaseolus vulgaris]
Length=186

 Score =   135 bits (341),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 107/131 (82%), Gaps = 2/131 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQR DK+++TV LAD+KN KV+L PEGVFTFS +AG+E+H YE K+EL +K
Sbjct  1    MSRHPEVKWAQRVDKVFVTVQLADSKNAKVDLTPEGVFTFSGSAGSEDHQYELKLELFEK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            VNVEESKIN+GVR+IFCV++K E   W   L  EGK PHYVKVDWDKWVDEDE+ G    
Sbjct  61   VNVEESKINVGVRSIFCVVQKAEIGWWKRFLRAEGKTPHYVKVDWDKWVDEDEEEGSGEP  120

Query  441  LDLGGMDFSKF  473
             DLGGMDFSKF
Sbjct  121  -DLGGMDFSKF  130



>ref|NP_001236771.1| uncharacterized protein LOC100499842 [Glycine max]
 gb|ACU13874.1| unknown [Glycine max]
Length=174

 Score =   135 bits (340),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 106/133 (80%), Gaps = 2/133 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQR DK+YITV LAD+KN KV+L P+G+FTFS +AGAE+H YE K+EL DK
Sbjct  1    MSRHPEVKWAQRLDKVYITVQLADSKNAKVDLTPDGIFTFSGSAGAEDHQYELKLELFDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            VNVEESKIN+G R+IF V++K E   W   L  EGK PHYVKVDWDKWVDEDED G    
Sbjct  61   VNVEESKINVGERSIFIVVQKAEDGWWKRLLRGEGKTPHYVKVDWDKWVDEDEDEGNTDA  120

Query  441  L-DLGGMDFSKFG  476
            +  +GGMDFSKFG
Sbjct  121  MGGMGGMDFSKFG  133



>ref|XP_009598042.1| PREDICTED: uncharacterized protein OsI_027940 isoform X3 [Nicotiana 
tomentosiformis]
Length=187

 Score =   135 bits (340),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 101/132 (77%), Gaps = 2/132 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MS HP+VKWAQR D +Y+TVLL DAK+PKVNL+PEG+FTFSATAGA +  YE K+ELQDK
Sbjct  1    MSLHPQVKWAQRPDVVYLTVLLPDAKDPKVNLDPEGIFTFSATAGAGDRHYELKLELQDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvd-wdkwvdededNGPPS  437
            VNVEESKI+IGVR+I CVL+K E K W   L  + K PHYVKVD      ++DE +  P 
Sbjct  61   VNVEESKISIGVRSIVCVLQKAEPKWWNKLLRGDAKAPHYVKVDWDKWVDEDDEADAGPG  120

Query  438  DLDLGGMDFSKF  473
            D+D+  MDFSKF
Sbjct  121  DMDMNSMDFSKF  132



>ref|XP_009598041.1| PREDICTED: uncharacterized protein OsI_027940 isoform X2 [Nicotiana 
tomentosiformis]
Length=198

 Score =   135 bits (340),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 101/132 (77%), Gaps = 2/132 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MS HP+VKWAQR D +Y+TVLL DAK+PKVNL+PEG+FTFSATAGA +  YE K+ELQDK
Sbjct  1    MSLHPQVKWAQRPDVVYLTVLLPDAKDPKVNLDPEGIFTFSATAGAGDRHYELKLELQDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvd-wdkwvdededNGPPS  437
            VNVEESKI+IGVR+I CVL+K E K W   L  + K PHYVKVD      ++DE +  P 
Sbjct  61   VNVEESKISIGVRSIVCVLQKAEPKWWNKLLRGDAKAPHYVKVDWDKWVDEDDEADAGPG  120

Query  438  DLDLGGMDFSKF  473
            D+D+  MDFSKF
Sbjct  121  DMDMNSMDFSKF  132



>ref|XP_010906988.1| PREDICTED: uncharacterized protein OsI_027940-like [Elaeis guineensis]
Length=174

 Score =   135 bits (339),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQR DK+YITV L DAK+ KVNLEP+G+FTFSATAGAEN+LYE K++L DK
Sbjct  1    MSRHPEVKWAQRVDKVYITVQLPDAKDVKVNLEPDGIFTFSATAGAENNLYELKMDLYDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekkwwnkllreGKPPHY  380
            VNVE S+IN GVR+IFCV+EK EK WW KLLR+GK PHY
Sbjct  61   VNVEGSRINTGVRSIFCVVEKVEKGWWKKLLRDGKTPHY  99



>sp|P0C8Z0.2|Y8359_ORYSI RecName: Full=Uncharacterized protein OsI_027940 [Oryza sativa 
Indica Group]
Length=210

 Score =   135 bits (341),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 98/131 (75%), Gaps = 4/131 (3%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQR DK+YITV LADAK+ KVNLEPEGVF+FSATAG + +LYE K+EL DK
Sbjct  1    MSRHPEVKWAQRIDKVYITVQLADAKDAKVNLEPEGVFSFSATAGTDGNLYESKLELNDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            VNVEESKI++GVR+IFC++EK E K W   +  + K PH+       W    +++   +D
Sbjct  61   VNVEESKISVGVRSIFCIVEKAEAKWWKKLVRDDQKAPHF---VKVDWDKWVDEDDDGAD  117

Query  441  LDLGGMDFSKF  473
            +++ GMDFS F
Sbjct  118  VNVDGMDFSNF  128



>ref|NP_001061631.1| Os08g0359500 [Oryza sativa Japonica Group]
 sp|Q6YYB0.1|Y8359_ORYSJ RecName: Full=Uncharacterized protein Os08g0359500 [Oryza sativa 
Japonica Group]
 dbj|BAD03784.1| putative p23 co-chaperone [Oryza sativa Japonica Group]
 dbj|BAD03808.1| putative p23 co-chaperone [Oryza sativa Japonica Group]
 dbj|BAF23545.1| Os08g0359500 [Oryza sativa Japonica Group]
 gb|EAZ42474.1| hypothetical protein OsJ_27041 [Oryza sativa Japonica Group]
 dbj|BAG96959.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99524.1| unnamed protein product [Oryza sativa Japonica Group]
Length=213

 Score =   135 bits (341),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 98/131 (75%), Gaps = 4/131 (3%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQR DK+YITV LADAK+ KVNLEPEGVF+FSATAG + +LYE K+EL DK
Sbjct  1    MSRHPEVKWAQRIDKVYITVQLADAKDAKVNLEPEGVFSFSATAGTDGNLYESKLELNDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            VNVEESKI++GVR+IFC++EK E K W   +  + K PH+       W    +++   +D
Sbjct  61   VNVEESKISVGVRSIFCIVEKAEAKWWKKLVRDDQKAPHF---VKVDWDKWVDEDDDGAD  117

Query  441  LDLGGMDFSKF  473
            +++ GMDFS F
Sbjct  118  VNVDGMDFSNF  128



>ref|XP_009598040.1| PREDICTED: uncharacterized protein OsI_027940 isoform X1 [Nicotiana 
tomentosiformis]
Length=229

 Score =   135 bits (341),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 101/132 (77%), Gaps = 2/132 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MS HP+VKWAQR D +Y+TVLL DAK+PKVNL+PEG+FTFSATAGA +  YE K+ELQDK
Sbjct  1    MSLHPQVKWAQRPDVVYLTVLLPDAKDPKVNLDPEGIFTFSATAGAGDRHYELKLELQDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvd-wdkwvdededNGPPS  437
            VNVEESKI+IGVR+I CVL+K E K W   L  + K PHYVKVD      ++DE +  P 
Sbjct  61   VNVEESKISIGVRSIVCVLQKAEPKWWNKLLRGDAKAPHYVKVDWDKWVDEDDEADAGPG  120

Query  438  DLDLGGMDFSKF  473
            D+D+  MDFSKF
Sbjct  121  DMDMNSMDFSKF  132



>gb|EEC83453.1| hypothetical protein OsI_28951 [Oryza sativa Indica Group]
Length=274

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 98/131 (75%), Gaps = 4/131 (3%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQR DK+YITV LADAK+ KVNLEPEGVF+FSATAG + +LYE K+EL DK
Sbjct  1    MSRHPEVKWAQRIDKVYITVQLADAKDAKVNLEPEGVFSFSATAGTDGNLYESKLELNDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            VNVEESKI++GVR+IFC++EK E K W   +  + K PH+       W    +++   +D
Sbjct  61   VNVEESKISVGVRSIFCIVEKAEAKWWKKLVRDDQKAPHF---VKVDWDKWVDEDDDGAD  117

Query  441  LDLGGMDFSKF  473
            +++ GMDFS F
Sbjct  118  VNVDGMDFSNF  128



>ref|XP_010038204.1| PREDICTED: uncharacterized protein Os08g0359500 [Eucalyptus grandis]
Length=209

 Score =   133 bits (335),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 90/100 (90%), Gaps = 1/100 (1%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            M+RHPE+KWAQR+DK+++TVLL DAK+ KVNLEP+G+FTFSA AGAENH YE K+EL DK
Sbjct  1    MNRHPELKWAQRKDKVFLTVLLPDAKDAKVNLEPDGIFTFSAKAGAENHPYELKLELFDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekkwwnkllr-eGKPPHY  380
            VNVEESKINIGVRNIFC+LEK EK+WW KLLR +GK PHY
Sbjct  61   VNVEESKINIGVRNIFCILEKAEKEWWKKLLRGDGKLPHY  100



>ref|XP_006359384.1| PREDICTED: uncharacterized protein Os08g0359500-like [Solanum 
tuberosum]
Length=230

 Score =   134 bits (337),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 101/132 (77%), Gaps = 2/132 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MS HPEVKWAQR D +Y+TV+L DAK+PKVNL+PEGVF FSA+AGA +  YE K+ELQDK
Sbjct  1    MSLHPEVKWAQRPDVVYLTVMLPDAKDPKVNLDPEGVFNFSASAGAGDRHYELKLELQDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvd-wdkwvdededNGPPS  437
            VNVEESKI+ GVR+IFC+L+K E K W   L  +GK PHYVKVD      ++DE +  P 
Sbjct  61   VNVEESKISTGVRSIFCILQKAEPKWWTKLLRGDGKAPHYVKVDWDKWVDEDDEPDAGPG  120

Query  438  DLDLGGMDFSKF  473
            D+D+  MDFSKF
Sbjct  121  DMDMNSMDFSKF  132



>ref|XP_010429707.1| PREDICTED: uncharacterized protein Os08g0359500-like [Camelina 
sativa]
Length=240

 Score =   133 bits (334),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWA+  DKI++TV+LAD K+ KVNL PEGVF FSA  G ENHLYE K+EL DK
Sbjct  1    MSRHPEVKWAETTDKIFLTVVLADTKDTKVNLAPEGVFDFSAKVGPENHLYELKLELHDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekkwwnkllreGKPPHY  380
            VNVEESKIN+G R+IFC++EK E + WNKLLR GKPPHY
Sbjct  61   VNVEESKINVGERSIFCIIEKAEPERWNKLLRVGKPPHY  99



>ref|XP_010456028.1| PREDICTED: uncharacterized protein Os08g0359500-like [Camelina 
sativa]
Length=234

 Score =   133 bits (334),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWA+  DKI++TV+LAD K+ KVNL PEGVF FSA  G ENHLYE K+EL DK
Sbjct  1    MSRHPEVKWAETTDKIFLTVVLADTKDTKVNLAPEGVFDFSAKVGPENHLYELKLELHDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekkwwnkllreGKPPHY  380
            VNVEESKIN+G R+IFC++EK E + WNKLLR GKPPHY
Sbjct  61   VNVEESKINVGERSIFCIIEKAEPERWNKLLRVGKPPHY  99



>ref|XP_004494372.1| PREDICTED: uncharacterized protein Os08g0359500-like [Cicer arietinum]
Length=215

 Score =   132 bits (332),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 104/131 (79%), Gaps = 4/131 (3%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQR DK+YITV LAD+K+ KV+L P+G FTFS +AGA ++ YE K+EL DK
Sbjct  1    MSRHPEVKWAQRVDKVYITVQLADSKDAKVDLAPDGTFTFSGSAGAGDNQYELKMELFDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            VNVEESKIN+GVR+IFCV++K E   W   L  EGKPPHYVKVDWDKW DEDE+ G    
Sbjct  61   VNVEESKINVGVRSIFCVVQKAENGWWKRLLRGEGKPPHYVKVDWDKWADEDEEEGEVD-  119

Query  441  LDLGGMDFSKF  473
              LGGMDFSKF
Sbjct  120  --LGGMDFSKF  128



>ref|XP_009134430.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X1 
[Brassica rapa]
Length=239

 Score =   132 bits (333),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 94/126 (75%), Gaps = 2/126 (2%)
 Frame = +3

Query  3    VRVTFYF*GFPFPLPHRQSLPYRRSSKMSRHPEVKWAQREDKIYITVLLADAKNPKVNLE  182
             +++F+       LP       RR  K+SRHPEVKWA+  DKI++TV+LAD+K  KVNL+
Sbjct  5    CKLSFFIVSVDSKLPFHWVPGERR--KLSRHPEVKWAETTDKIFLTVVLADSKETKVNLD  62

Query  183  PEGVFTFSATAGAENHLYEFKIELQDKVNVEESKINIGVRNIFCVlekeekkwwnkllre  362
            PEGVF FSA AG ENH+YE K+EL DKVNVEESKINIG R+IFC++EK E + W+KL+R 
Sbjct  63   PEGVFDFSAKAGPENHVYELKLELHDKVNVEESKINIGERSIFCIIEKAEPERWDKLIRG  122

Query  363  GKPPHY  380
            GK PHY
Sbjct  123  GKAPHY  128



>ref|XP_009134431.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X2 
[Brassica rapa]
Length=210

 Score =   131 bits (330),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWA+  DKI++TV+LAD+K  KVNL+PEGVF FSA AG ENH+YE K+EL DK
Sbjct  1    MSRHPEVKWAETTDKIFLTVVLADSKETKVNLDPEGVFDFSAKAGPENHVYELKLELHDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekkwwnkllreGKPPHY  380
            VNVEESKINIG R+IFC++EK E + W+KL+R GK PHY
Sbjct  61   VNVEESKINIGERSIFCIIEKAEPERWDKLIRGGKAPHY  99



>gb|KFK42641.1| hypothetical protein AALP_AA1G021600 [Arabis alpina]
Length=342

 Score =   134 bits (337),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 87/106 (82%), Gaps = 0/106 (0%)
 Frame = +3

Query  63   PYRRSSKMSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEF  242
            P   S+ MS HPEVKWA+REDK+Y+TV L DAK+  V L+PEGVF FSA AG EN LYE 
Sbjct  124  PSTSSTIMSHHPEVKWAEREDKVYLTVSLPDAKDADVKLDPEGVFDFSAKAGPENQLYEL  183

Query  243  KIELQDKVNVEESKINIGVRNIFCVlekeekkwwnkllreGKPPHY  380
            K+EL DKVNVEESKINIG+R+IFC+LEK E KWW+KLLR GKPPHY
Sbjct  184  KLELNDKVNVEESKINIGLRSIFCILEKAEPKWWSKLLRGGKPPHY  229



>ref|XP_009769849.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X2 
[Nicotiana sylvestris]
Length=187

 Score =   130 bits (327),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 99/132 (75%), Gaps = 2/132 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MS HP+VKWAQR D +Y+TVLL DAK+ KVNL+PEGVFTFSATAGA +  YE K+EL DK
Sbjct  1    MSLHPQVKWAQRPDVVYLTVLLPDAKDSKVNLDPEGVFTFSATAGAGDRHYELKLELLDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvd-wdkwvdededNGPPS  437
            VNVEESKI+IGVR+I CVL+K E K W   L  + K PHYVKVD      ++DE +  P 
Sbjct  61   VNVEESKISIGVRSIVCVLQKAEPKWWNKLLRGDAKTPHYVKVDWDKWVDEDDEADAGPG  120

Query  438  DLDLGGMDFSKF  473
            D+D+  MDFSKF
Sbjct  121  DMDMNSMDFSKF  132



>gb|AFX67021.1| putative p23 co-chaperone [Solanum tuberosum]
Length=227

 Score =   131 bits (329),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 100/132 (76%), Gaps = 2/132 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MS HPEVKWAQR D +Y+TV+L DAK+ KVNL+PEGVF FSA+AGA +  YE K+ELQDK
Sbjct  1    MSLHPEVKWAQRPDVVYLTVMLPDAKDAKVNLDPEGVFNFSASAGAGDRHYELKLELQDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvd-wdkwvdededNGPPS  437
            VNVEESKI+ GVR+IFC+L+K E K W   L  +GK PHYVKVD      ++DE +  P 
Sbjct  61   VNVEESKISTGVRSIFCILQKAEPKWWTKLLRGDGKAPHYVKVDWDKWVDEDDEPDAGPG  120

Query  438  DLDLGGMDFSKF  473
            D+D+  MDFSKF
Sbjct  121  DMDMNSMDFSKF  132



>emb|CDX90937.1| BnaA03g26170D [Brassica napus]
Length=240

 Score =   131 bits (330),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 86/105 (82%), Gaps = 0/105 (0%)
 Frame = +3

Query  66   YRRSSKMSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFK  245
            Y+    MSRHPEVKWA+  DKI++TV+LAD+K  KVNL+PEGVF FSA +G ENH+YE K
Sbjct  16   YKLPLNMSRHPEVKWAETTDKIFLTVVLADSKETKVNLDPEGVFDFSAKSGPENHVYELK  75

Query  246  IELQDKVNVEESKINIGVRNIFCVlekeekkwwnkllreGKPPHY  380
            +EL DKVNVEESKINIG R+IFC++EK E + W+KL+R GK PHY
Sbjct  76   LELHDKVNVEESKINIGERSIFCIIEKAEPERWDKLIRGGKAPHY  120



>ref|XP_006288563.1| hypothetical protein CARUB_v10001852mg [Capsella rubella]
 gb|EOA21461.1| hypothetical protein CARUB_v10001852mg [Capsella rubella]
Length=237

 Score =   131 bits (330),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWA+  DKI++TV+LAD K+ KVNL PEGVF FSA  G ENH+YE K+EL DK
Sbjct  1    MSRHPEVKWAETTDKIFLTVVLADTKDTKVNLAPEGVFDFSAKVGPENHVYELKLELHDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekkwwnkllreGKPPHY  380
            VNVEESKIN+G R+IFC++EK E + WNKLLR GKPPHY
Sbjct  61   VNVEESKINVGERSIFCIIEKAEPERWNKLLRVGKPPHY  99



>gb|AFK39090.1| unknown [Lotus japonicus]
Length=228

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 107/130 (82%), Gaps = 2/130 (2%)
 Frame = +3

Query  87   SRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDKV  266
            SRHPEVKWAQREDK+YITV L D+K+ KV+L P+GVFTF+A+AGA +  YE K+EL DKV
Sbjct  4    SRHPEVKWAQREDKVYITVQLPDSKDAKVDLTPDGVFTFTASAGAGDKPYEVKLELFDKV  63

Query  267  NVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGPPSDL  443
            NVEESKINIGVR+IF V++K E   W   L  EGKPPHYVKVDWDKWVDEDE++   ++ 
Sbjct  64   NVEESKINIGVRSIFSVVQKAESGWWKRLLRGEGKPPHYVKVDWDKWVDEDEED-VVAEP  122

Query  444  DLGGMDFSKF  473
            D+GGMDFSKF
Sbjct  123  DMGGMDFSKF  132



>emb|CDY15271.1| BnaC05g01500D [Brassica napus]
Length=282

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MS HPEVKWA+REDK+Y+TVLL DAK+  V L+PEGVF FSA AG EN +YE K+EL DK
Sbjct  56   MSHHPEVKWAEREDKVYLTVLLPDAKDADVKLDPEGVFEFSAKAGPENQVYELKLELNDK  115

Query  264  VNVEESKINIGVRNIFCVlekeekkwwnkllreGKPPHY  380
            VNVEESKINIG+R+IFC++EK E +WW+KLLR GKPPHY
Sbjct  116  VNVEESKINIGLRSIFCIVEKAEPRWWSKLLRGGKPPHY  154



>emb|CDY18019.1| BnaC03g30910D [Brassica napus]
Length=304

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = +3

Query  66   YRRSSKMSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFK  245
            YR    MSRHPEVKWA+  DKI++TV+LAD+K  KVNL PEGVF FSA AG ENH+YE K
Sbjct  77   YRLPLNMSRHPEVKWAETTDKIFLTVVLADSKETKVNLLPEGVFDFSAKAGPENHVYELK  136

Query  246  IELQDKVNVEESKINIGVRNIFCVlekeekkwwnkllreGKPPHY  380
            +EL DKVNVEESKINIG R+IFC++EK E   W+KL+R GK PHY
Sbjct  137  LELHDKVNVEESKINIGERSIFCIIEKAEPARWDKLIRRGKAPHY  181



>ref|XP_009769848.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X1 
[Nicotiana sylvestris]
Length=223

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 99/132 (75%), Gaps = 2/132 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MS HP+VKWAQR D +Y+TVLL DAK+ KVNL+PEGVFTFSATAGA +  YE K+EL DK
Sbjct  1    MSLHPQVKWAQRPDVVYLTVLLPDAKDSKVNLDPEGVFTFSATAGAGDRHYELKLELLDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvd-wdkwvdededNGPPS  437
            VNVEESKI+IGVR+I CVL+K E K W   L  + K PHYVKVD      ++DE +  P 
Sbjct  61   VNVEESKISIGVRSIVCVLQKAEPKWWNKLLRGDAKTPHYVKVDWDKWVDEDDEADAGPG  120

Query  438  DLDLGGMDFSKF  473
            D+D+  MDFSKF
Sbjct  121  DMDMNSMDFSKF  132



>ref|XP_006418294.1| hypothetical protein EUTSA_v10008755mg [Eutrema salsugineum]
 gb|ESQ36647.1| hypothetical protein EUTSA_v10008755mg [Eutrema salsugineum]
Length=215

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MS HPEVKWA+R DK+++TVLL DAK+  V L+PEGVF FSA AG EN LYE K+EL DK
Sbjct  1    MSHHPEVKWAERADKVFLTVLLPDAKDADVKLDPEGVFNFSAKAGPENQLYELKLELNDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekkwwnkllreGKPPHY  380
            VNVEESKINIG+R+IFC+LEK E KWWNKLLR GKPPHY
Sbjct  61   VNVEESKINIGLRSIFCILEKAEPKWWNKLLRGGKPPHY  99



>ref|XP_010474870.1| PREDICTED: uncharacterized protein OsI_027940-like [Camelina 
sativa]
Length=217

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MS HPEVKWA+R DK+Y+TV L DAK+  V L+PEGVF FSA AG++N LYE K+EL DK
Sbjct  1    MSHHPEVKWAERADKVYLTVQLTDAKDADVKLDPEGVFNFSAKAGSDNQLYELKLELNDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekkwwnkllreGKPPHY  380
            VNVEESKINIG+R+IFC+LEK E KWWNKLLR GKPPHY
Sbjct  61   VNVEESKINIGLRSIFCILEKTEPKWWNKLLRGGKPPHY  99



>gb|AFX66984.1| putative p23 co-chaperone [Solanum tuberosum]
Length=256

 Score =   130 bits (328),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 100/132 (76%), Gaps = 2/132 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MS HPEVKWAQR D +Y+TV+L DAK+ KVNL+PEGVF FSA+AGA +  YE K+ELQDK
Sbjct  1    MSLHPEVKWAQRPDVVYLTVMLPDAKDAKVNLDPEGVFNFSASAGAGDRHYELKLELQDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvd-wdkwvdededNGPPS  437
            VNVEESKI+ GVR+IFC+L+K E K W   L  +GK PHYVKVD      ++DE +  P 
Sbjct  61   VNVEESKISTGVRSIFCILQKAEPKWWTKLLRGDGKAPHYVKVDWDKWVDEDDEPDAGPG  120

Query  438  DLDLGGMDFSKF  473
            D+D+  MDFSKF
Sbjct  121  DMDMNSMDFSKF  132



>gb|KEH24379.1| CS domain protein [Medicago truncatula]
Length=209

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 81/100 (81%), Gaps = 1/100 (1%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQREDK+YITV LAD+KN KV+L PEG FTFS +AGA ++ YE K+EL DK
Sbjct  1    MSRHPEVKWAQREDKVYITVQLADSKNSKVDLTPEGDFTFSGSAGAGDNQYELKLELFDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHY  380
            VNVEESKI++GVRNIFCV++K E   W   L  EGK PHY
Sbjct  61   VNVEESKISVGVRNIFCVVQKAESGWWKRLLRGEGKAPHY  100



>ref|XP_009144563.1| PREDICTED: uncharacterized protein Os08g0359500-like [Brassica 
rapa]
Length=218

 Score =   129 bits (324),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWA+  DKI++TV+LAD+K  KVNL PEGVF FSA AG ENH YE K+EL DK
Sbjct  1    MSRHPEVKWAETTDKIFLTVVLADSKETKVNLLPEGVFDFSAKAGPENHAYELKLELHDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekkwwnkllreGKPPHY  380
            VNV+ESKINIGVR+IFC++EK E + WNKL+R GK PHY
Sbjct  61   VNVDESKINIGVRSIFCIIEKAEPERWNKLIRGGKAPHY  99



>ref|XP_006840547.1| hypothetical protein AMTR_s00045p00215950 [Amborella trichopoda]
 gb|ERN02222.1| hypothetical protein AMTR_s00045p00215950 [Amborella trichopoda]
Length=225

 Score =   129 bits (324),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 104/132 (79%), Gaps = 2/132 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQR DK+YITV L DAKN K NL+PEG+FTFSA AG + + YE K++L  K
Sbjct  1    MSRHPEVKWAQRLDKVYITVSLPDAKNVKTNLDPEGIFTFSANAGTDGNPYELKLDLFGK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGPPS-  437
            VN EESKIN+GVRNIFC++EK E+  W   L  + K PHY+KVDWDKWVDEDED+   + 
Sbjct  61   VNAEESKINVGVRNIFCIVEKAEEGWWKKLLRGDEKTPHYLKVDWDKWVDEDEDDTAVAP  120

Query  438  DLDLGGMDFSKF  473
            D+D GGMDFSKF
Sbjct  121  DMDFGGMDFSKF  132



>gb|AFK43198.1| unknown [Medicago truncatula]
 gb|KEH19404.1| CS domain protein [Medicago truncatula]
 gb|AES82146.2| CS domain protein [Medicago truncatula]
Length=234

 Score =   129 bits (325),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 81/100 (81%), Gaps = 1/100 (1%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQREDK+YITV LAD+KN KV+L PEG FTFS +AGA ++ YE K+EL DK
Sbjct  1    MSRHPEVKWAQREDKVYITVQLADSKNSKVDLTPEGDFTFSGSAGAGDNQYELKLELFDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHY  380
            VNVEESKI++GVRNIFCV++K E   W   L  EGK PHY
Sbjct  61   VNVEESKISVGVRNIFCVVQKAESGWWKRLLRGEGKAPHY  100



>gb|KFK30837.1| hypothetical protein AALP_AA6G032100 [Arabis alpina]
Length=234

 Score =   129 bits (324),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWA+  +KI++T++LADAK+ KVNL PEGV  FSA AG ENH++E K+EL DK
Sbjct  1    MSRHPEVKWAETTEKIFLTIVLADAKDAKVNLAPEGVLDFSAKAGPENHVFELKLELHDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekkwwnkllreGKPPHY  380
            VNVEESKINIG R+IFC++EK E   W+KLLR GKPPHY
Sbjct  61   VNVEESKINIGERSIFCIIEKAEPARWDKLLRGGKPPHY  99



>ref|NP_001154201.1| HSP20-like chaperone [Arabidopsis thaliana]
 gb|AEE82174.1| HSP20-like chaperone [Arabidopsis thaliana]
Length=240

 Score =   129 bits (325),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWA+  +KI++TV+LAD K+ KVNL+PEGVF FSA  G ENH+YE K+EL DK
Sbjct  1    MSRHPEVKWAETTEKIFLTVVLADTKDTKVNLDPEGVFDFSAKVGPENHVYELKLELADK  60

Query  264  VNVEESKINIGVRNIFCVlekeekkwwnkllreGKPPHY  380
            VNVEESKINIG R+IFC++EK E + WNKLLR  KPPHY
Sbjct  61   VNVEESKINIGERSIFCIIEKAEPERWNKLLRVKKPPHY  99



>ref|XP_006396454.1| hypothetical protein EUTSA_v10028946mg [Eutrema salsugineum]
 gb|ESQ37907.1| hypothetical protein EUTSA_v10028946mg [Eutrema salsugineum]
Length=225

 Score =   129 bits (324),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWA+  DKI++TV+LAD+K+ KVNL PEGVF FSA AG ENH++E K+EL DK
Sbjct  1    MSRHPEVKWAETTDKIFLTVVLADSKDAKVNLNPEGVFDFSAKAGPENHVFELKLELHDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekkwwnkllreGKPPHY  380
            VNVEESKINIG R+IFC++EK E + WNKL+R GK PHY
Sbjct  61   VNVEESKINIGERSIFCIIEKAEPERWNKLIRGGKAPHY  99



>ref|NP_192154.2| HSP20-like chaperone [Arabidopsis thaliana]
 gb|AAM83226.1| AT4g02450/T14P8_5 [Arabidopsis thaliana]
 gb|AAN18096.1| At4g02450/T14P8_5 [Arabidopsis thaliana]
 gb|AEE82173.1| HSP20-like chaperone [Arabidopsis thaliana]
Length=241

 Score =   129 bits (325),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWA+  +KI++TV+LAD K+ KVNL+PEGVF FSA  G ENH+YE K+EL DK
Sbjct  1    MSRHPEVKWAETTEKIFLTVVLADTKDTKVNLDPEGVFDFSAKVGPENHVYELKLELADK  60

Query  264  VNVEESKINIGVRNIFCVlekeekkwwnkllreGKPPHY  380
            VNVEESKINIG R+IFC++EK E + WNKLLR  KPPHY
Sbjct  61   VNVEESKINIGERSIFCIIEKAEPERWNKLLRVKKPPHY  99



>gb|KEH24381.1| CS domain protein [Medicago truncatula]
Length=213

 Score =   129 bits (323),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 81/100 (81%), Gaps = 1/100 (1%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQREDK+YITV LAD+KN KV+L PEG FTFS +AGA ++ YE K+EL DK
Sbjct  1    MSRHPEVKWAQREDKVYITVQLADSKNSKVDLTPEGDFTFSGSAGAGDNQYELKLELFDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHY  380
            VNVEESKI++GVRNIFCV++K E   W   L  EGK PHY
Sbjct  61   VNVEESKISVGVRNIFCVVQKAESGWWKRLLRGEGKAPHY  100



>gb|ACJ83262.1| unknown [Medicago truncatula]
Length=217

 Score =   129 bits (323),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 81/100 (81%), Gaps = 1/100 (1%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQREDK+YITV LAD+KN KV+L PEG FTFS +AGA ++ YE K+EL DK
Sbjct  1    MSRHPEVKWAQREDKVYITVQLADSKNSKVDLTPEGDFTFSGSAGAGDNQYELKLELFDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHY  380
            VNVEESKI++GVRNIFCV++K E   W   L  EGK PHY
Sbjct  61   VNVEESKISVGVRNIFCVVQKAESGWWKRLLRGEGKAPHY  100



>ref|XP_011458723.1| PREDICTED: uncharacterized protein Os08g0359500 isoform X4 [Fragaria 
vesca subsp. vesca]
Length=248

 Score =   129 bits (325),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 99/134 (74%), Gaps = 6/134 (4%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQREDK+++TVLL DAK+ KV LEPEG F FSA AGA ++ YE K++L DK
Sbjct  1    MSRHPEVKWAQREDKVFLTVLLPDAKDAKVKLEPEGTFIFSACAGAGDNQYELKLDLFDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGPPS-  437
            V+VEESKI+IGVR+I C++EK EK  W   L  +G+ PHY  V  D     DED  PP+ 
Sbjct  61   VDVEESKISIGVRSIVCIVEKAEKVWWSRLLKEQGRTPHY--VKIDWDKWVDEDEDPPAG  118

Query  438  --DLDLGGMDFSKF  473
              D+ +GGMDFSKF
Sbjct  119  ADDMGMGGMDFSKF  132



>emb|CAC16575.1| p23 co-chaperone [Arabidopsis thaliana]
Length=241

 Score =   129 bits (325),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWA+  +KI++TV+LAD K+ KVNL+PEGVF FSA  G ENH+YE K+EL DK
Sbjct  1    MSRHPEVKWAETTEKIFLTVVLADTKDTKVNLDPEGVFDFSAKVGPENHVYELKLELADK  60

Query  264  VNVEESKINIGVRNIFCVlekeekkwwnkllreGKPPHY  380
            VNVEESKINIG R+IFC++EK E + WNKLLR  KPPHY
Sbjct  61   VNVEESKINIGERSIFCIIEKAEPERWNKLLRVKKPPHY  99



>ref|XP_010481284.1| PREDICTED: uncharacterized protein OsI_027940-like [Camelina 
sativa]
 ref|XP_010481293.1| PREDICTED: uncharacterized protein OsI_027940-like [Camelina 
sativa]
Length=202

 Score =   128 bits (322),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MS HPEVKWA+R DK+Y+TV L DAK+  V L+PEGVF FSA AG++N L+E K+EL DK
Sbjct  1    MSHHPEVKWAERADKVYLTVQLTDAKDADVKLDPEGVFNFSAKAGSDNQLFELKLELNDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekkwwnkllreGKPPHY  380
            VNVEESKINIG+R+IFC+LEK E KWWNKLLR GKPPHY
Sbjct  61   VNVEESKINIGLRSIFCILEKAEPKWWNKLLRGGKPPHY  99



>ref|XP_004247428.1| PREDICTED: uncharacterized protein OsI_027940 [Solanum lycopersicum]
Length=225

 Score =   129 bits (323),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 99/132 (75%), Gaps = 2/132 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MS HPEVKWAQR D +Y+TV+L DAK+ KVNL+PEGVF FSA+AG  +  YE K+ELQD+
Sbjct  1    MSLHPEVKWAQRPDVVYLTVMLPDAKDAKVNLDPEGVFNFSASAGTGDRHYELKLELQDQ  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvd-wdkwvdededNGPPS  437
            VNVEESKI+ GVR+IFC+L+K E K W   L  +GK PHYVKVD      ++DE +  P 
Sbjct  61   VNVEESKISTGVRSIFCILQKAEPKWWTKLLRGDGKAPHYVKVDWDKWVDEDDEPDAGPG  120

Query  438  DLDLGGMDFSKF  473
            D+D+  MDFSKF
Sbjct  121  DMDMNSMDFSKF  132



>ref|XP_004290783.1| PREDICTED: uncharacterized protein Os08g0359500 isoform X3 [Fragaria 
vesca subsp. vesca]
Length=249

 Score =   129 bits (324),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 99/135 (73%), Gaps = 7/135 (5%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQREDK+++TVLL DAK+ KV LEPEG F FSA AGA ++ YE K++L DK
Sbjct  1    MSRHPEVKWAQREDKVFLTVLLPDAKDAKVKLEPEGTFIFSACAGAGDNQYELKLDLFDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGPPS-  437
            V+VEESKI+IGVR+I C++EK EK  W   L  +G+ PHY  V  D     DED  PP+ 
Sbjct  61   VDVEESKISIGVRSIVCIVEKAEKVWWSRLLKEQGRTPHY--VKIDWDKWVDEDEDPPAA  118

Query  438  ---DLDLGGMDFSKF  473
               D+ +GGMDFSKF
Sbjct  119  GADDMGMGGMDFSKF  133



>ref|XP_002872836.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49095.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=262

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWA+  +KI++TV+LAD K+ KVNL+PEGVF FSA  G ENH+YE K+EL DK
Sbjct  1    MSRHPEVKWAETTEKIFLTVVLADTKDAKVNLDPEGVFDFSAKVGPENHVYELKLELHDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekkwwnkllreGKPPHY  380
            VNVEESKINIG R+IFC++EK E + WNKLLR  KPPHY
Sbjct  61   VNVEESKINIGERSIFCIIEKAEPERWNKLLRVKKPPHY  99



>emb|CDX91318.1| BnaC02g27290D [Brassica napus]
Length=886

 Score =   134 bits (338),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 71/99 (72%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWA+  DKI++TV+LAD+K  KVNL PEGVF FSA AG ENH+YE K+EL DK
Sbjct  684  MSRHPEVKWAETTDKIFLTVVLADSKETKVNLLPEGVFDFSAKAGPENHVYELKLELHDK  743

Query  264  VNVEESKINIGVRNIFCVlekeekkwwnkllreGKPPHY  380
            VNV+ESKINIGVR+IFC++EK E + WNKL+R GK PHY
Sbjct  744  VNVDESKINIGVRSIFCIIEKAEPERWNKLIRGGKAPHY  782



>emb|CDX89935.1| BnaA10g01470D [Brassica napus]
Length=251

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 80/100 (80%), Gaps = 1/100 (1%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MS HPEVKWA+REDK+Y+TVLL DAK+  V L+PEGVF FSA AG EN +YE K+EL DK
Sbjct  19   MSHHPEVKWAEREDKVYLTVLLPDAKDANVKLDPEGVFEFSAKAGPENQVYELKLELSDK  78

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHY  380
            VNVEESKINIG+R+IFC++EK E K W   L   GKPPHY
Sbjct  79   VNVEESKINIGLRSIFCIVEKAEPKWWSKLLRVGGKPPHY  118



>emb|CDX97265.1| BnaA02g20560D [Brassica napus]
Length=1121

 Score =   135 bits (339),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 71/99 (72%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +3

Query  84    MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
             MSRHPEVKWA+  DKI++TV+LAD+K  KVNL PEGVF FSA AG ENH YE K+EL DK
Sbjct  923   MSRHPEVKWAETTDKIFLTVVLADSKETKVNLLPEGVFDFSAKAGPENHAYELKLELHDK  982

Query  264   VNVEESKINIGVRNIFCVlekeekkwwnkllreGKPPHY  380
             VNV+ESKINIGVR+IFC++EK E + WNKL+R GK PHY
Sbjct  983   VNVDESKINIGVRSIFCIIEKAEPERWNKLIRGGKAPHY  1021



>ref|XP_010422586.1| PREDICTED: uncharacterized protein Os08g0359500-like [Camelina 
sativa]
Length=231

 Score =   127 bits (320),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWA+   KI++TV+LAD K+ KVNL PEGVF FSA  G ENHLYE  +EL DK
Sbjct  1    MSRHPEVKWAETTHKIFLTVVLADTKDTKVNLAPEGVFDFSAKVGPENHLYELNLELHDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekkwwnkllreGKPPHY  380
            VNVEESKIN+G R+IFC++EK E + WNKLLR GKPPHY
Sbjct  61   VNVEESKINVGERSIFCIIEKAEPERWNKLLRVGKPPHY  99



>ref|XP_008792885.1| PREDICTED: uncharacterized protein OsI_027940-like [Phoenix dactylifera]
Length=200

 Score =   126 bits (317),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = +3

Query  90   RHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDKVN  269
            RHPEVKWAQR DK+YITV L DAK+ KVNLEP+G+FTFSATAGAEN+LYE K++L DKVN
Sbjct  17   RHPEVKWAQRVDKVYITVQLPDAKDVKVNLEPDGIFTFSATAGAENNLYELKMDLYDKVN  76

Query  270  VEESKINIGVRNIFCV  317
            VE S+IN GVR+IFCV
Sbjct  77   VEGSRINTGVRSIFCV  92



>ref|XP_009119603.1| PREDICTED: uncharacterized protein Os08g0359500-like [Brassica 
rapa]
Length=230

 Score =   127 bits (318),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 80/100 (80%), Gaps = 1/100 (1%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MS HPEVKWA+REDK+Y+TVLL DAK+  V L+PEGVF FSA AG EN +YE K+EL DK
Sbjct  1    MSHHPEVKWAEREDKVYLTVLLPDAKDADVKLDPEGVFEFSAKAGPENQVYELKLELNDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHY  380
            VNVEESKINIG+R+IFC++EK E K W   L   GKPPHY
Sbjct  61   VNVEESKINIGLRSIFCIVEKAEPKWWGKLLCVGGKPPHY  100



>ref|XP_003628460.1| Zinc finger CCCH domain-containing protein [Medicago truncatula]
Length=358

 Score =   129 bits (323),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 81/100 (81%), Gaps = 1/100 (1%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQREDK+YITV LAD+KN KV+L PEG FTFS +AGA ++ YE K+EL DK
Sbjct  1    MSRHPEVKWAQREDKVYITVQLADSKNSKVDLTPEGDFTFSGSAGAGDNQYELKLELFDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHY  380
            VNVEESKI++GVRNIFCV++K E   W   L  EGK PHY
Sbjct  61   VNVEESKISVGVRNIFCVVQKAESGWWKRLLRGEGKAPHY  100



>ref|XP_009414711.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=181

 Score =   124 bits (311),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 80/100 (80%), Gaps = 1/100 (1%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQR DK+YITV L DA++ KVNLEP+G FTFSATAGA N+ YE +++L DK
Sbjct  1    MSRHPEVKWAQRLDKVYITVQLPDARDVKVNLEPDGSFTFSATAGAGNNTYELQMDLYDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHY  380
            VN E SKINIGVR+IFCV+EK EK  W   L  +GK PHY
Sbjct  61   VNKEASKINIGVRSIFCVVEKAEKGWWKKLLRGDGKAPHY  100



>ref|XP_009414713.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=180

 Score =   124 bits (311),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 80/100 (80%), Gaps = 1/100 (1%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQR DK+YITV L DA++ KVNLEP+G FTFSATAGA N+ YE +++L DK
Sbjct  1    MSRHPEVKWAQRLDKVYITVQLPDARDVKVNLEPDGSFTFSATAGAGNNTYELQMDLYDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHY  380
            VN E SKINIGVR+IFCV+EK EK  W   L  +GK PHY
Sbjct  61   VNKEASKINIGVRSIFCVVEKAEKGWWKKLLRGDGKAPHY  100



>ref|XP_003625928.1| RING finger protein 113A [Medicago truncatula]
Length=394

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 81/100 (81%), Gaps = 1/100 (1%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQREDK+YITV LAD+KN KV+L PEG FTFS +AGA ++ YE K+EL DK
Sbjct  1    MSRHPEVKWAQREDKVYITVQLADSKNSKVDLTPEGDFTFSGSAGAGDNQYELKLELFDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHY  380
            VNVEESKI++GVRNIFCV++K E   W   L  EGK PHY
Sbjct  61   VNVEESKISVGVRNIFCVVQKAESGWWKRLLRGEGKAPHY  100



>gb|KEH24380.1| CS domain protein [Medicago truncatula]
Length=242

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 82/108 (76%), Gaps = 1/108 (1%)
 Frame = +3

Query  60   LPYRRSSKMSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYE  239
            + Y   S   RHPEVKWAQREDK+YITV LAD+KN KV+L PEG FTFS +AGA ++ YE
Sbjct  1    MRYYLQSLHLRHPEVKWAQREDKVYITVQLADSKNSKVDLTPEGDFTFSGSAGAGDNQYE  60

Query  240  FKIELQDKVNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHY  380
             K+EL DKVNVEESKI++GVRNIFCV++K E   W   L  EGK PHY
Sbjct  61   LKLELFDKVNVEESKISVGVRNIFCVVQKAESGWWKRLLRGEGKAPHY  108



>gb|AAC19287.1| T14P8.5 [Arabidopsis thaliana]
 emb|CAB80738.1| putative protein [Arabidopsis thaliana]
Length=262

 Score =   125 bits (313),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +3

Query  90   RHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDKVN  269
            RHPEVKWA+  +KI++TV+LAD K+ KVNL+PEGVF FSA  G ENH+YE K+EL DKVN
Sbjct  7    RHPEVKWAETTEKIFLTVVLADTKDTKVNLDPEGVFDFSAKVGPENHVYELKLELADKVN  66

Query  270  VEESKINIGVRNIFCVlekeekkwwnkllreGKPPHY  380
            VEESKINIG R+IFC++EK E + WNKLLR  KPPHY
Sbjct  67   VEESKINIGERSIFCIIEKAEPERWNKLLRVKKPPHY  103



>gb|ACN34684.1| unknown [Zea mays]
Length=191

 Score =   122 bits (307),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 94/131 (72%), Gaps = 6/131 (5%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQR DK+YITV L DAK+ KVNLEP+GVFTFS +AG   +LYE K++L DK
Sbjct  1    MSRHPEVKWAQRIDKVYITVQLPDAKDAKVNLEPDGVFTFSGSAG--TNLYELKLDLNDK  58

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            VNVE SKI++GVR+IFC++EK E K W   +  + + PH+       W    +++   +D
Sbjct  59   VNVEASKISVGVRSIFCIVEKAEAKWWKKLVRDDQRAPHF---VKVDWDKWVDEDDDGAD  115

Query  441  LDLGGMDFSKF  473
            ++L GMDFS F
Sbjct  116  VNLDGMDFSNF  126



>gb|ACF88149.1| unknown [Zea mays]
 gb|ACG29923.1| hypothetical protein [Zea mays]
 gb|AFW60897.1| co-chaperone protein SBA1 [Zea mays]
Length=192

 Score =   122 bits (307),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 94/131 (72%), Gaps = 6/131 (5%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQR DK+YITV L DAK+ KVNLEP+GVFTFS +AG   +LYE K++L DK
Sbjct  1    MSRHPEVKWAQRIDKVYITVQLPDAKDAKVNLEPDGVFTFSGSAG--TNLYELKLDLNDK  58

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            VNVE SKI++GVR+IFC++EK E K W   +  + + PH+       W    +++   +D
Sbjct  59   VNVEASKISVGVRSIFCIVEKAEAKWWKKLVRDDQRAPHF---VKVDWDKWVDEDDDGAD  115

Query  441  LDLGGMDFSKF  473
            ++L GMDFS F
Sbjct  116  VNLDGMDFSNF  126



>emb|CDY50383.1| BnaCnng19150D [Brassica napus]
Length=843

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = +3

Query  81   KMSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQD  260
            KMSRHPEVKWA+  DKI++TV+LAD+K  KVNL+PEG F FSA AG ENH+YE K+EL  
Sbjct  640  KMSRHPEVKWAETTDKIFLTVVLADSKETKVNLDPEGAFDFSAEAGPENHVYELKLELHG  699

Query  261  KVNVEESKINIGVRNIFCVlekeekkwwnkllreGKPPHY  380
            KVNVEESKINIGVR+IFC++EK E + WNKL+  GK PHY
Sbjct  700  KVNVEESKINIGVRSIFCIIEKAEPERWNKLIGGGKAPHY  739



>ref|XP_002892131.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68390.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=228

 Score =   122 bits (305),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +3

Query  72   RSSKMSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIE  251
             S  +  HPEVKWA+R D +Y+TV LADAK+  V L+PEG+F+FSA AG +N LYE K+E
Sbjct  2    ESLDLGHHPEVKWAERADIVYLTVQLADAKDADVKLDPEGIFSFSAKAGPDNQLYELKLE  61

Query  252  LQDKVNVEESKINIGVRNIFCVlekeekkwwnkllreGKPPHY  380
            L DKVNVEESKINIG+R+I C+LEK E KWWNKLLR GKPPHY
Sbjct  62   LNDKVNVEESKINIGLRSIVCILEKAEPKWWNKLLRGGKPPHY  104



>ref|XP_002444216.1| hypothetical protein SORBIDRAFT_07g015140 [Sorghum bicolor]
 gb|EES13711.1| hypothetical protein SORBIDRAFT_07g015140 [Sorghum bicolor]
Length=214

 Score =   121 bits (304),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 94/131 (72%), Gaps = 6/131 (5%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQR DK+YITV L+DAK+ KVNLEP+GVFTFS + G   ++YE K++L DK
Sbjct  1    MSRHPEVKWAQRIDKVYITVQLSDAKDAKVNLEPDGVFTFSGSVG--TNVYELKLDLNDK  58

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            VNVE SKI++GVR+IFC++EK E K W   +  + + PH+       W    +++   +D
Sbjct  59   VNVEASKISVGVRSIFCIVEKAEAKWWKKLVRDDQRAPHF---VKVDWDKWVDEDDDGTD  115

Query  441  LDLGGMDFSKF  473
            ++L GMDFS F
Sbjct  116  VNLDGMDFSNF  126



>ref|NP_001241744.1| co-chaperone protein SBA1 [Zea mays]
 gb|ACG34656.1| co-chaperone protein SBA1 [Zea mays]
Length=198

 Score =   120 bits (302),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 93/131 (71%), Gaps = 6/131 (5%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQR DK+YITV L DAK+ KVNLEP+GVFTFS + G   +LYE K++L DK
Sbjct  1    MSRHPEVKWAQRIDKVYITVQLPDAKDAKVNLEPDGVFTFSGSVG--TNLYELKLDLNDK  58

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            VNVE SKI++GVR+IFC++EK E K W   +  + + PH+       W    +++   +D
Sbjct  59   VNVEASKISVGVRSIFCIVEKAEAKWWKKLVRDDQRAPHF---VKVDWDKWVDEDDDGAD  115

Query  441  LDLGGMDFSKF  473
            ++L GMDFS F
Sbjct  116  VNLDGMDFSNF  126



>ref|NP_001148972.1| LOC100282592 [Zea mays]
 gb|ACG33684.1| co-chaperone protein SBA1 [Zea mays]
Length=205

 Score =   120 bits (302),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 94/131 (72%), Gaps = 6/131 (5%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQR DK+YITV L DAK+ KVNL+P+GVFTFS +AG   +LYE K++L DK
Sbjct  1    MSRHPEVKWAQRIDKVYITVQLPDAKDAKVNLDPDGVFTFSGSAG--TNLYELKLDLNDK  58

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            VNVE SKI++GVR+IFC++EK E K W   +  + + PH+       W    +++   +D
Sbjct  59   VNVEASKISVGVRSIFCIVEKAEAKWWKKLVRDDQRAPHF---VKVDWDKWVDEDDDGAD  115

Query  441  LDLGGMDFSKF  473
            +++ GMDFS F
Sbjct  116  INMDGMDFSNF  126



>ref|XP_003573778.1| PREDICTED: uncharacterized protein Os08g0359500 [Brachypodium 
distachyon]
Length=234

 Score =   121 bits (303),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQR DK+YITV L DAK+ KVNLEP+GVF+FSATAG++ ++YE K++L DK
Sbjct  1    MSRHPEVKWAQRIDKVYITVQLPDAKDAKVNLEPDGVFSFSATAGSDGNIYESKLDLNDK  60

Query  264  VNVEESKINIGVRNIFCV  317
            VNVEESK ++G R+IFC+
Sbjct  61   VNVEESKTSVGPRSIFCI  78



>gb|ACR38464.1| unknown [Zea mays]
 tpg|DAA49202.1| TPA: co-chaperone protein SBA1 [Zea mays]
Length=205

 Score =   120 bits (301),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 94/131 (72%), Gaps = 6/131 (5%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQR DK+YITV L DAK+ KVNL+P+GVFTFS +AG   +LYE K++L DK
Sbjct  1    MSRHPEVKWAQRIDKVYITVQLPDAKDAKVNLDPDGVFTFSGSAG--TNLYELKLDLNDK  58

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            VNVE SKI++GVR+IFC++EK E K W   +  + + PH+       W    +++   +D
Sbjct  59   VNVEASKISVGVRSIFCIVEKAEAKWWKKLVRDDQRAPHF---VKVDWDKWVDEDDDGAD  115

Query  441  LDLGGMDFSKF  473
            +++ GMDFS F
Sbjct  116  INMDGMDFSNF  126



>tpg|DAA49201.1| TPA: hypothetical protein ZEAMMB73_435161 [Zea mays]
Length=128

 Score =   117 bits (294),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 93/129 (72%), Gaps = 6/129 (5%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQR DK+YITV L DAK+ KVNL+P+GVFTFS +AG   +LYE K++L DK
Sbjct  1    MSRHPEVKWAQRIDKVYITVQLPDAKDAKVNLDPDGVFTFSGSAGT--NLYELKLDLNDK  58

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            VNVE SKI++GVR+IFC++EK E K W   +  + + PH+       W    +++   +D
Sbjct  59   VNVEASKISVGVRSIFCIVEKAEAKWWKKLVRDDQRAPHF---VKVDWDKWVDEDDDGAD  115

Query  441  LDLGGMDFS  467
            +++ GMDFS
Sbjct  116  INMDGMDFS  124



>gb|ABK26701.1| unknown [Picea sitchensis]
Length=246

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 100/130 (77%), Gaps = 2/130 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEV WAQR DKIYIT+LL DAKN  V L+PEG  TFSATAG+++  +E  +EL DK
Sbjct  1    MSRHPEVNWAQRTDKIYITILLPDAKNADVELQPEGKLTFSATAGSQDTPFELNLELYDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGPP-S  437
            VNVE SKIN+G+RNIFCV+EK EK  W   L  EGK P Y+KVDWDKWVDEDE++     
Sbjct  61   VNVEASKINVGLRNIFCVVEKAEKGWWKRLLKGEGKTPLYLKVDWDKWVDEDEEDEKVGG  120

Query  438  DLDLGGMDFS  467
            D+D GGMDFS
Sbjct  121  DVDFGGMDFS  130



>gb|ACN35583.1| unknown [Zea mays]
 gb|AFW60896.1| hypothetical protein ZEAMMB73_488396 [Zea mays]
Length=120

 Score =   117 bits (293),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 67/78 (86%), Gaps = 2/78 (3%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQR DK+YITV L DAK+ KVNLEP+GVFTFS +AG   +LYE K++L DK
Sbjct  1    MSRHPEVKWAQRIDKVYITVQLPDAKDAKVNLEPDGVFTFSGSAG--TNLYELKLDLNDK  58

Query  264  VNVEESKINIGVRNIFCV  317
            VNVE SKI++GVR+IFC+
Sbjct  59   VNVEASKISVGVRSIFCI  76



>ref|XP_009386345.1| PREDICTED: uncharacterized protein OsI_027940-like [Musa acuminata 
subsp. malaccensis]
Length=178

 Score =   118 bits (296),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 79/100 (79%), Gaps = 1/100 (1%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSR+PEVKWAQR DK+YITV L DAK+ KVNLEP+G+FTFSATAG  N+ YE K++L DK
Sbjct  1    MSRYPEVKWAQRLDKVYITVQLPDAKDVKVNLEPDGIFTFSATAGTGNNTYELKMDLYDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHY  380
            V+ + SKINIGVR+IF V+ K EK+ W   L  +GK PHY
Sbjct  61   VDKDASKINIGVRSIFVVVAKAEKQWWKKLLRGDGKAPHY  100



>gb|EMS68218.1| hypothetical protein TRIUR3_30845 [Triticum urartu]
Length=230

 Score =   118 bits (296),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 93/129 (72%), Gaps = 4/129 (3%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEV+WAQR DK+YITV L DAK+ KVNLEP+GVF+F ATAG + + YE K++L DK
Sbjct  1    MSRHPEVRWAQRIDKVYITVQLPDAKDAKVNLEPDGVFSFFATAGTDGNSYESKLDLNDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            VNVE SK+++GVR+IFC+LEK + K W   +  + K PH+       W    +++   +D
Sbjct  61   VNVEASKVSVGVRSIFCILEKADAKWWNKLVRDDQKAPHF---VKVDWDKWVDEDDDGAD  117

Query  441  LDLGGMDFS  467
            +++ GMDFS
Sbjct  118  VNVDGMDFS  126



>ref|XP_004973281.1| PREDICTED: uncharacterized protein Os08g0359500-like isoform 
X2 [Setaria italica]
Length=214

 Score =   118 bits (295),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 67/78 (86%), Gaps = 2/78 (3%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQR DK+YITV L DAK+ KVNLEP+GVFTFS +AG   +LYE K++L DK
Sbjct  1    MSRHPEVKWAQRIDKVYITVQLPDAKDAKVNLEPDGVFTFSGSAG--TNLYELKLDLNDK  58

Query  264  VNVEESKINIGVRNIFCV  317
            VNVE SKI++GVR+IFC+
Sbjct  59   VNVEASKISVGVRSIFCI  76



>tpg|DAA49203.1| TPA: hypothetical protein ZEAMMB73_435161 [Zea mays]
Length=210

 Score =   117 bits (294),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 93/130 (72%), Gaps = 6/130 (5%)
 Frame = +3

Query  87   SRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDKV  266
            SRHPEVKWAQR DK+YITV L DAK+ KVNL+P+GVFTFS +AG   +LYE K++L DKV
Sbjct  8    SRHPEVKWAQRIDKVYITVQLPDAKDAKVNLDPDGVFTFSGSAG--TNLYELKLDLNDKV  65

Query  267  NVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGPPSDL  443
            NVE SKI++GVR+IFC++EK E K W   +  + + PH+       W    +++   +D+
Sbjct  66   NVEASKISVGVRSIFCIVEKAEAKWWKKLVRDDQRAPHF---VKVDWDKWVDEDDDGADI  122

Query  444  DLGGMDFSKF  473
            ++ GMDFS F
Sbjct  123  NMDGMDFSNF  132



>ref|NP_001150702.1| co-chaperone protein SBA1 [Zea mays]
 ref|XP_008676569.1| PREDICTED: LOC100282592 isoform X1 [Zea mays]
 gb|ACG40054.1| co-chaperone protein SBA1 [Zea mays]
 tpg|DAA49204.1| TPA: co-chaperone protein SBA1 [Zea mays]
Length=211

 Score =   117 bits (294),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 93/130 (72%), Gaps = 6/130 (5%)
 Frame = +3

Query  87   SRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDKV  266
            SRHPEVKWAQR DK+YITV L DAK+ KVNL+P+GVFTFS +AG   +LYE K++L DKV
Sbjct  8    SRHPEVKWAQRIDKVYITVQLPDAKDAKVNLDPDGVFTFSGSAG--TNLYELKLDLNDKV  65

Query  267  NVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGPPSDL  443
            NVE SKI++GVR+IFC++EK E K W   +  + + PH+       W    +++   +D+
Sbjct  66   NVEASKISVGVRSIFCIVEKAEAKWWKKLVRDDQRAPHF---VKVDWDKWVDEDDDGADI  122

Query  444  DLGGMDFSKF  473
            ++ GMDFS F
Sbjct  123  NMDGMDFSNF  132



>dbj|BAJ94677.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=224

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEV+WAQR DK+YITV L DAK+ KVNLEP+GVF+F ATAG + + YE K++L DK
Sbjct  1    MSRHPEVRWAQRIDKVYITVQLPDAKDAKVNLEPDGVFSFFATAGTDGNSYESKLDLNDK  60

Query  264  VNVEESKINIGVRNIFCV  317
            VNVE SK+++GVR+IFC+
Sbjct  61   VNVEASKVSVGVRSIFCI  78



>gb|ADE76981.1| unknown [Picea sitchensis]
Length=207

 Score =   116 bits (290),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 86/137 (63%), Gaps = 6/137 (4%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQR DK+YIT+ L DA NPK  LEP+G FTFSAT G E   YE    L D+
Sbjct  1    MSRHPEVKWAQRSDKLYITIELPDANNPKWKLEPDGKFTFSATTGQEKTFYELDFYLYDR  60

Query  264  VNVEESKINIGVRNIFCVlekeekk--wwnkllreGKPPHYvkvdwdkwvdededNG--P  431
            VNVEESKI++ +RNI C+L+KE+KK           + P           +++E +   P
Sbjct  61   VNVEESKISVNLRNIICILKKEDKKWWKQLLKTEAKRLPFLKVDWDKWVDEDEEKDDKLP  120

Query  432  P--SDLDLGGMDFSKFG  476
            P   D+D GGMDFSK G
Sbjct  121  PVGQDMDFGGMDFSKLG  137



>ref|XP_004973280.1| PREDICTED: uncharacterized protein Os08g0359500-like isoform 
X1 [Setaria italica]
Length=220

 Score =   115 bits (288),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 66/77 (86%), Gaps = 2/77 (3%)
 Frame = +3

Query  87   SRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDKV  266
            SRHPEVKWAQR DK+YITV L DAK+ KVNLEP+GVFTFS +AG   +LYE K++L DKV
Sbjct  8    SRHPEVKWAQRIDKVYITVQLPDAKDAKVNLEPDGVFTFSGSAG--TNLYELKLDLNDKV  65

Query  267  NVEESKINIGVRNIFCV  317
            NVE SKI++GVR+IFC+
Sbjct  66   NVEASKISVGVRSIFCI  82



>gb|ADE76546.1| unknown [Picea sitchensis]
Length=204

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 84/134 (63%), Gaps = 3/134 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQR DK+YIT+ L DA NPK  LEP+G FTFSAT G E   YE    L D+
Sbjct  1    MSRHPEVKWAQRSDKLYITIELPDANNPKWKLEPDGKFTFSATTGQEKTFYELDFYLYDR  60

Query  264  VNVEESKINIGVRNIFCVlekeekk--wwnkllreGKPPHYvkvdwdkwvdededNGP-P  434
            VNVEESKI++ +RNI C+L+KE+KK           + P           +++E +    
Sbjct  61   VNVEESKISVNLRNIICILKKEDKKWWKQLLKTEAKRLPFLKVDWDKWVDEDEEKDDKFG  120

Query  435  SDLDLGGMDFSKFG  476
             D+D GGMDFSK G
Sbjct  121  QDMDFGGMDFSKLG  134



>ref|XP_010922358.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X2 
[Elaeis guineensis]
Length=164

 Score =   113 bits (283),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 83/131 (63%), Gaps = 18/131 (14%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQR DK+YITV L DAK+ KVNLE +G+FTFSATAGAE +LYE K++L DK
Sbjct  1    MSRHPEVKWAQRVDKVYITVQLPDAKDVKVNLESDGIFTFSATAGAEKNLYELKMDLYDK  60

Query  264  VNVEESKINIGVRNIFCVlekeekkwwnkllreGKPPHYvkvdwdkwvdededNGPPSDL  443
            VNVE  K+                 W   L  + K PHY  V  D     DED+  P D 
Sbjct  61   VNVEVEKV----------------WWKKLLRGDEKTPHY--VKVDWDKWVDEDDDGPGDF  102

Query  444  DLGGMDFSKFG  476
            DLGGMDFS FG
Sbjct  103  DLGGMDFSNFG  113



>ref|XP_008811572.1| PREDICTED: uncharacterized protein Os08g0359500-like [Phoenix 
dactylifera]
Length=186

 Score =   112 bits (279),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 99/133 (74%), Gaps = 3/133 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP  KWAQR DK+Y+T+ L DAK+ K+NL+P+G F FSAT+GA+N  YE   EL DK
Sbjct  1    MSRHPTTKWAQRSDKVYLTIELPDAKDVKLNLQPDGHFYFSATSGADNTPYEIDFELLDK  60

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvkvdwdkwvdededNGPPS-  437
            V+VEESK  IG+RNI + V + E+K W   L +EGKPP ++KVDWDKW+DED+DN     
Sbjct  61   VSVEESKAAIGLRNICYLVKKAEKKWWSRLLKKEGKPPVFLKVDWDKWIDEDDDNEHSRF  120

Query  438  -DLDLGGMDFSKF  473
             D+D GGMDFSK 
Sbjct  121  GDMDFGGMDFSKL  133



>dbj|BAE92292.1| putative p23 co-chaperone [Cryptomeria japonica]
Length=240

 Score =   113 bits (282),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +3

Query  78   SKMSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQ  257
            +K+SRHPEVKWAQR DK+Y+T+ L D+KN  V LEPEG  +FSAT G EN  +EF  +L 
Sbjct  4    AKISRHPEVKWAQRTDKVYVTIQLPDSKNADVKLEPEGKLSFSATTGPENAPFEFNFDLF  63

Query  258  DKVNVEESKINIGVRNIFCV  317
            DKV+VE SKIN+G+RNIFC 
Sbjct  64   DKVDVEASKINVGLRNIFCC  83



>gb|EMT10253.1| hypothetical protein F775_29406 [Aegilops tauschii]
Length=335

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +3

Query  90   RHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDKVN  269
            RHPEV+WAQR DK+YITV L DAK+ KVNLEP+GVF+F ATAG + + YE K++L DKVN
Sbjct  105  RHPEVRWAQRIDKVYITVQLPDAKDAKVNLEPDGVFSFFATAGTDGNSYESKLDLNDKVN  164

Query  270  VEESKINIGVRNIFCV  317
            VE SK+++GVR+IFC+
Sbjct  165  VEASKVSVGVRSIFCI  180



>ref|XP_006434560.1| hypothetical protein CICLE_v10002611mg [Citrus clementina]
 gb|ESR47800.1| hypothetical protein CICLE_v10002611mg [Citrus clementina]
 gb|KDO83851.1| hypothetical protein CISIN_1g030007mg [Citrus sinensis]
Length=184

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 95/134 (71%), Gaps = 4/134 (3%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP VKWAQR D++YIT+ L DA++ K+ LEPEG F FSAT+G +   YE  I+L DK
Sbjct  1    MSRHPTVKWAQRTDRVYITIDLPDAQDVKLKLEPEGKFFFSATSGPDKIPYEVDIDLYDK  60

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvkvdwdk---wvdededNGP  431
            V+V ESK ++G+RNI + V + E K W   L + GKPP ++KVDWDK     +E +D+ P
Sbjct  61   VDVNESKASVGLRNIHYLVKKAENKWWSRLLKQAGKPPVFLKVDWDKWIDEDEEGKDDKP  120

Query  432  PSDLDLGGMDFSKF  473
            P+D+D G +DFSK 
Sbjct  121  PADMDFGDLDFSKM  134



>ref|XP_010314468.1| PREDICTED: uncharacterized protein OsI_027940 isoform X2 [Solanum 
lycopersicum]
Length=179

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 98/132 (74%), Gaps = 2/132 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP +KWAQR DK++ITV L DAKN K  LEPEG F+FSATAGA+N  YE  ++L DK
Sbjct  1    MSRHPSIKWAQRSDKVFITVELPDAKNVKQKLEPEGKFSFSATAGADNVPYEVVLDLFDK  60

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvkvdwdkwvdededNGPP-S  437
            ++V+ES+ +I  RNI + V + E+  W   + +EGK P ++K DWDKWVDEDE +G P +
Sbjct  61   IDVDESQSSITSRNICYLVKKAEDNWWSRLIKQEGKSPTFLKADWDKWVDEDEQDGEPGA  120

Query  438  DLDLGGMDFSKF  473
            D+D+G +DFS+ 
Sbjct  121  DMDMGDIDFSQL  132



>ref|XP_006434561.1| hypothetical protein CICLE_v10002611mg [Citrus clementina]
 gb|ESR47801.1| hypothetical protein CICLE_v10002611mg [Citrus clementina]
 gb|KDO83852.1| hypothetical protein CISIN_1g030007mg [Citrus sinensis]
Length=139

 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 94/132 (71%), Gaps = 4/132 (3%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP VKWAQR D++YIT+ L DA++ K+ LEPEG F FSAT+G +   YE  I+L DK
Sbjct  1    MSRHPTVKWAQRTDRVYITIDLPDAQDVKLKLEPEGKFFFSATSGPDKIPYEVDIDLYDK  60

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvkvdwdk---wvdededNGP  431
            V+V ESK ++G+RNI + V + E K W   L + GKPP ++KVDWDK     +E +D+ P
Sbjct  61   VDVNESKASVGLRNIHYLVKKAENKWWSRLLKQAGKPPVFLKVDWDKWIDEDEEGKDDKP  120

Query  432  PSDLDLGGMDFS  467
            P+D+D G +DFS
Sbjct  121  PADMDFGDLDFS  132



>ref|XP_004252558.1| PREDICTED: uncharacterized protein OsI_027940 isoform X1 [Solanum 
lycopersicum]
Length=180

 Score =   107 bits (268),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 98/133 (74%), Gaps = 3/133 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP +KWAQR DK++ITV L DAKN K  LEPEG F+FSATAGA+N  YE  ++L DK
Sbjct  1    MSRHPSIKWAQRSDKVFITVELPDAKNVKQKLEPEGKFSFSATAGADNVPYEVVLDLFDK  60

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvkvdwdkwvdededNGPP--  434
            ++V+ES+ +I  RNI + V + E+  W   + +EGK P ++K DWDKWVDEDE +G P  
Sbjct  61   IDVDESQSSITSRNICYLVKKAEDNWWSRLIKQEGKSPTFLKADWDKWVDEDEQDGEPAG  120

Query  435  SDLDLGGMDFSKF  473
            +D+D+G +DFS+ 
Sbjct  121  ADMDMGDIDFSQL  133



>ref|XP_006473157.1| PREDICTED: uncharacterized protein OsI_027940-like [Citrus sinensis]
Length=184

 Score =   107 bits (268),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 94/134 (70%), Gaps = 4/134 (3%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP VKWAQR D++YIT+ L DA++ K+ LEPEG F FSA +G +   YE  I+L DK
Sbjct  1    MSRHPTVKWAQRTDRVYITIDLPDAQDVKLKLEPEGKFFFSAISGPDKIPYEVDIDLYDK  60

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvkvdwdk---wvdededNGP  431
            V+V ESK ++G+RNI + V + E K W   L + GKPP ++KVDWDK     +E +DN P
Sbjct  61   VDVNESKASVGLRNIHYLVKKAENKWWSRLLKQAGKPPVFLKVDWDKWIDEDEEGKDNKP  120

Query  432  PSDLDLGGMDFSKF  473
            P+D+D G +DFSK 
Sbjct  121  PADMDFGDLDFSKM  134



>ref|XP_010916995.1| PREDICTED: uncharacterized protein OsI_027940-like [Elaeis guineensis]
Length=187

 Score =   107 bits (268),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 95/132 (72%), Gaps = 2/132 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP  KWAQR DK+YIT+ L DAK+ K+NL+P+G F F AT+GA+N  YE   EL DK
Sbjct  1    MSRHPTTKWAQRSDKVYITIELPDAKDVKLNLQPDGHFYFYATSGADNIPYEIDFELFDK  60

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvkvdwdkwvdededNGPP-S  437
            VNVEES+  IG+RNI + V + E+K W   L  EG+PP ++K DWDKW+DED++N     
Sbjct  61   VNVEESRAAIGLRNICYLVKKAEKKWWSRLLKNEGRPPVFLKADWDKWIDEDDENENRFG  120

Query  438  DLDLGGMDFSKF  473
            D+D G MDFSK 
Sbjct  121  DMDFGDMDFSKL  132



>ref|XP_006360297.1| PREDICTED: uncharacterized protein Os08g0359500-like [Solanum 
tuberosum]
Length=182

 Score =   107 bits (266),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 97/133 (73%), Gaps = 3/133 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP +KWAQR DK++ITV L DAKN K  LEPEG F+FSATAGA+N  YE  ++L DK
Sbjct  1    MSRHPTIKWAQRSDKVFITVELPDAKNVKQKLEPEGKFSFSATAGADNVPYEVVLDLFDK  60

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvkvdwdkwvdededNGPP--  434
            ++V+ESK +I  RNI + V + E+  W   + +EGK P ++K DWDKW+DEDE +  P  
Sbjct  61   IDVDESKSSITSRNICYLVKKAEDNWWSRLIKQEGKSPTFLKADWDKWIDEDEQDSEPAG  120

Query  435  SDLDLGGMDFSKF  473
            +D+D+G +DFS+ 
Sbjct  121  ADMDMGDIDFSQL  133



>ref|XP_010243328.1| PREDICTED: uncharacterized protein OsI_027940-like [Nelumbo nucifera]
Length=175

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 97/133 (73%), Gaps = 3/133 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            M+RHP VKWAQR DK+YIT+ L DAK+  + LEPEG F FSAT+GA+   YE  I+L DK
Sbjct  1    MNRHPSVKWAQRSDKVYITIELPDAKDVNLKLEPEGKFFFSATSGADKTPYEIDIDLYDK  60

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvkvdwdkwvdededNGPPS-  437
            V+V+ESK ++G+RNI + V + E+K W   L +EGKPP ++KVDWDKWVDEDE+    S 
Sbjct  61   VDVDESKASVGLRNICYLVKKVEKKWWSRFLKQEGKPPVFLKVDWDKWVDEDEEQESKSG  120

Query  438  -DLDLGGMDFSKF  473
             D+D G  DFSK 
Sbjct  121  ADMDFGDFDFSKL  133



>ref|XP_008780776.1| PREDICTED: uncharacterized protein Os08g0359500-like [Phoenix 
dactylifera]
Length=182

 Score =   104 bits (259),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 89/130 (68%), Gaps = 2/130 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP  KWAQR DK+YIT+ L DAK+ K+NL+P+G F FSA +GA+N  YE   EL DK
Sbjct  1    MSRHPTTKWAQRSDKVYITIELPDAKDVKLNLQPDGHFYFSAASGADNVPYEIDFELFDK  60

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvkvd-wdkwvdededNGPPS  437
            VNVEESK ++G+R I + V + E+K W   L +EGKPP ++KVD      ++D+      
Sbjct  61   VNVEESKASVGLRTICYLVKKAEKKWWSRLLKKEGKPPVFLKVDWDKWIDEDDDTENRFG  120

Query  438  DLDLGGMDFS  467
            D+D G MDFS
Sbjct  121  DMDFGDMDFS  130



>emb|CBI29341.3| unnamed protein product [Vitis vinifera]
Length=218

 Score =   105 bits (261),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 75/155 (48%), Positives = 99/155 (64%), Gaps = 9/155 (6%)
 Frame = +3

Query  27   GFPFPLPHRQSLPYRRSSKMSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFS  206
             F F L + ++L     SKMSRHP VKWAQR D IYIT+ L DAK+  + LEPEG F FS
Sbjct  26   AFCFDLLYCKNL----FSKMSRHPTVKWAQRSDTIYITIDLPDAKDVNLKLEPEGKFFFS  81

Query  207  ATAGAENHLYEFKIELQDKVNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYv  383
            AT+GA+   YE  I+L DKV+V ESK +IG+RNI + V + E K W   L +EGKPP ++
Sbjct  82   ATSGADKIPYEIDIDLFDKVDVNESKASIGLRNIRYLVKKAENKWWSRLLKQEGKPPVFL  141

Query  384  kvd----wdkwvdededNGPPSDLDLGGMDFSKFG  476
            KVD     D+  + ++ +   +D+D G  DFSK  
Sbjct  142  KVDWDKWVDEDEEPEDKDKLGADMDFGDFDFSKLN  176



>ref|XP_011044819.1| PREDICTED: uncharacterized protein OsI_027940-like [Populus euphratica]
Length=186

 Score =   103 bits (257),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 70/100 (70%), Gaps = 1/100 (1%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP VKWAQR DK++ITV L DA++ K  LEPEG F FSAT+GA+   YE ++EL DK
Sbjct  1    MSRHPSVKWAQRSDKLFITVQLPDAQDVKFKLEPEGKFFFSATSGADKTPYEIELELLDK  60

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHY  380
            VNVEESK  IG RNI + V + E K W   +   GKPP +
Sbjct  61   VNVEESKAGIGSRNIQYIVKKAENKWWSRLIKPTGKPPVF  100



>ref|XP_010251769.1| PREDICTED: uncharacterized protein Os08g0359500-like [Nelumbo 
nucifera]
Length=172

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 96/131 (73%), Gaps = 4/131 (3%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP +KWAQR DKIY+TV L DAK+ K+ LEPEG F FSAT   +N  YE  I+L DK
Sbjct  1    MSRHPTLKWAQRSDKIYLTVDLPDAKDVKLKLEPEGKFIFSAT--KDNLPYEVDIDLHDK  58

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            VNVEESK++IGVR+I + + + E+K W   L +EGKPP ++KVDWDKWVDE+++N     
Sbjct  59   VNVEESKVSIGVRSIVYVIEKAEKKWWGRLLKQEGKPPVFLKVDWDKWVDEEDENEKAG-  117

Query  441  LDLGGMDFSKF  473
            +D   MDFSK 
Sbjct  118  MDFDDMDFSKL  128



>ref|XP_010926229.1| PREDICTED: uncharacterized protein Os08g0359500-like [Elaeis 
guineensis]
Length=187

 Score =   102 bits (254),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 88/130 (68%), Gaps = 2/130 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP  KWAQR DK+YIT+ L DAK+ K+NL+P G F FSA +GA+N  YE   EL DK
Sbjct  1    MSRHPTTKWAQRSDKVYITIELPDAKDVKLNLQPGGHFYFSAASGADNVPYEIDFELFDK  60

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvkvd-wdkwvdededNGPPS  437
            VNVEESK ++G+R I + V + E+K W   L +EGKPP ++KVD      ++D+      
Sbjct  61   VNVEESKASVGLRTICYLVKKAEKKWWSRLLKKEGKPPVFLKVDWDKWIDEDDDKENKFG  120

Query  438  DLDLGGMDFS  467
            D+D G MDFS
Sbjct  121  DMDFGDMDFS  130



>ref|XP_006359015.1| PREDICTED: uncharacterized protein OsI_027940-like [Solanum tuberosum]
Length=180

 Score =   102 bits (254),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 96/133 (72%), Gaps = 2/133 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP +KWAQR DK++ITV L DAKN K+ LEPEG F FSATAG +N  YE  ++L DK
Sbjct  1    MSRHPTIKWAQRSDKLFITVELPDAKNVKLKLEPEGKFLFSATAGDDNVPYEVDLDLFDK  60

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvkvdwdkwvdededNGPPS-  437
            +NV+ESK +   R+I + V + EEK W   + +EG  P ++KVDWDKWVDEDE++G P  
Sbjct  61   INVDESKSSTTSRSIVYLVKKAEEKWWSRLIKQEGLRPVFLKVDWDKWVDEDEEDGKPEP  120

Query  438  DLDLGGMDFSKFG  476
            D+D G MDFSK  
Sbjct  121  DMDFGDMDFSKLN  133



>ref|XP_009785922.1| PREDICTED: uncharacterized protein OsI_027940-like [Nicotiana 
sylvestris]
Length=184

 Score =   101 bits (252),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 97/132 (73%), Gaps = 2/132 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP VKWAQR DK++ITV L DAKN K+ LEPEG F FSATAGA+N  YE  ++L DK
Sbjct  1    MSRHPAVKWAQRSDKLFITVELPDAKNVKLKLEPEGKFFFSATAGADNVPYEVDLDLFDK  60

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvkvdwdkwvdededNGPP-S  437
            +NV+ESK +   R+I + V + E+K W   + +EG  P ++KVDWDKWVDEDE++  P +
Sbjct  61   INVDESKTSTTSRSIVYLVKKAEDKWWSRLIKQEGVRPVFLKVDWDKWVDEDEEDTKPGT  120

Query  438  DLDLGGMDFSKF  473
            D+D G +DFSK 
Sbjct  121  DMDFGDIDFSKL  132



>ref|XP_002265220.1| PREDICTED: uncharacterized protein OsI_027940-like [Vitis vinifera]
Length=178

 Score =   101 bits (251),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 94/135 (70%), Gaps = 5/135 (4%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP VKWAQR D IYIT+ L DAK+  + LEPEG F FSAT+GA+   YE  I+L DK
Sbjct  1    MSRHPTVKWAQRSDTIYITIDLPDAKDVNLKLEPEGKFFFSATSGADKIPYEIDIDLFDK  60

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvkvdwdkwvdededNGPP--  434
            V+V ESK +IG+RNI + V + E K W   L +EGKPP ++KVDWDKWVDEDE+      
Sbjct  61   VDVNESKASIGLRNIRYLVKKAENKWWSRLLKQEGKPPVFLKVDWDKWVDEDEEPEDKDK  120

Query  435  --SDLDLGGMDFSKF  473
              +D+D G  DFSK 
Sbjct  121  LGADMDFGDFDFSKL  135



>gb|AFW60898.1| hypothetical protein ZEAMMB73_488396, partial [Zea mays]
Length=113

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 58/71 (82%), Gaps = 2/71 (3%)
 Frame = +3

Query  81   KMSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQD  260
            KMSRHPEVKWAQR DK+YITV L DAK+ KVNLEP+GVFTFS +AG   +LYE K++L D
Sbjct  43   KMSRHPEVKWAQRIDKVYITVQLPDAKDAKVNLEPDGVFTFSGSAGT--NLYELKLDLND  100

Query  261  KVNVEESKINI  293
            KVNVE   ++I
Sbjct  101  KVNVEVMHLSI  111



>ref|XP_006434559.1| hypothetical protein CICLE_v10002611mg [Citrus clementina]
 gb|ESR47799.1| hypothetical protein CICLE_v10002611mg [Citrus clementina]
 gb|KDO83850.1| hypothetical protein CISIN_1g030007mg [Citrus sinensis]
Length=182

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 88/132 (67%), Gaps = 2/132 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP VKWAQR D++YIT+ L DA++ K+ LEPEG F FSAT+G +   YE  I+L DK
Sbjct  1    MSRHPTVKWAQRTDRVYITIDLPDAQDVKLKLEPEGKFFFSATSGPDKIPYEVDIDLYDK  60

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvkvd-wdkwvdededNGPPS  437
            V+V ESK ++G+RNI + V + E K W   L + GKPP ++KVD      +++E      
Sbjct  61   VDVNESKASVGLRNIHYLVKKAENKWWSRLLKQAGKPPVFLKVDWDKWIDEDEEGKDDKP  120

Query  438  DLDLGGMDFSKF  473
            D+D G +DFSK 
Sbjct  121  DMDFGDLDFSKM  132



>ref|XP_011074127.1| PREDICTED: uncharacterized protein OsI_027940-like [Sesamum indicum]
Length=180

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 94/132 (71%), Gaps = 2/132 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP VKWAQR DK++ITV L DAKN K+NL+PEG F FSAT+GA+N  YE  I+L DK
Sbjct  1    MSRHPLVKWAQRSDKLFITVELPDAKNVKLNLDPEGKFFFSATSGADNTPYEIDIDLYDK  60

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvkvdwdkwvdededNGPP-S  437
            V+V ESK +   R+I + V + + K W   L +EGKPP ++KVDWDKWVDEDE +     
Sbjct  61   VDVNESKASFTSRSICYLVKKADNKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDEKSGG  120

Query  438  DLDLGGMDFSKF  473
            ++D G  DFSK 
Sbjct  121  NMDFGDFDFSKL  132



>ref|XP_009380995.1| PREDICTED: uncharacterized protein At3g03773-like [Musa acuminata 
subsp. malaccensis]
Length=178

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 68/100 (68%), Gaps = 1/100 (1%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP  KWAQR DK+YI + L DAK+ K  L+P+G F FSAT+GAEN  YE   EL DK
Sbjct  1    MSRHPTTKWAQRSDKVYIIIELPDAKDVKFTLQPDGRFYFSATSGAENIPYELDFELFDK  60

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHY  380
            VNV+ESK  +G+R I + V + E+K W   L   GKPP Y
Sbjct  61   VNVDESKAAVGLRTICYLVKKAEKKWWSRLLKTAGKPPVY  100



>ref|XP_007151931.1| hypothetical protein PHAVU_004G088000g [Phaseolus vulgaris]
 gb|ESW23925.1| hypothetical protein PHAVU_004G088000g [Phaseolus vulgaris]
Length=189

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 87/134 (65%), Gaps = 4/134 (3%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP VKWAQR D +Y+TV L DA++ K+ LEPEG F FSATAG+E   YE  I+L D+
Sbjct  1    MSRHPSVKWAQRSDVLYLTVELPDAQDVKLKLEPEGKFHFSATAGSEKIPYEVDIDLFDE  60

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvk---vdwdkwvdededNGP  431
            ++V  SK ++G RNI + V + E K W   L + GK P ++K     W    +E+ +N P
Sbjct  61   IDVNNSKASVGSRNICYLVKKTENKWWDRLLKKGGKTPVFLKVDWDKWVDEDEEEPENQP  120

Query  432  PSDLDLGGMDFSKF  473
             SD+D G +DFSK 
Sbjct  121  TSDMDFGDIDFSKL  134



>gb|AIL30486.1| ripening regulated protein DDTFR8 [Nicotiana tabacum]
Length=184

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 96/132 (73%), Gaps = 2/132 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP VKWAQR DK++ITV L DAKN K+ LEPEG F FSA AGA+N  YE  ++L DK
Sbjct  1    MSRHPAVKWAQRSDKLFITVELPDAKNVKLKLEPEGKFFFSAIAGADNVPYEVDLDLFDK  60

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvkvdwdkwvdededNGPP-S  437
            +NV+ESK +   R+I + V + E+K W   + +EG  P ++KVDWDKWVDEDE++  P +
Sbjct  61   INVDESKTSTTSRSIVYLVKKAEDKWWSRLIKQEGVRPVFLKVDWDKWVDEDEEDTKPGT  120

Query  438  DLDLGGMDFSKF  473
            D+D G +DFSK 
Sbjct  121  DMDFGDIDFSKL  132



>ref|NP_001234685.1| ripening regulated protein DDTFR8 [Solanum lycopersicum]
 gb|AAG49030.1|AF204783_1 ripening regulated protein DDTFR8 [Solanum lycopersicum]
Length=179

 Score = 99.4 bits (246),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 95/132 (72%), Gaps = 2/132 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP +KWAQ  DK++ITV L DAKN K+ LEPEG F FSATAGA+N  YE  ++L DK
Sbjct  1    MSRHPTIKWAQMSDKLFITVELPDAKNVKLKLEPEGKFLFSATAGADNVPYEVDLDLFDK  60

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvkvdwdkwvdededNGPPS-  437
            +NV+ESK +   R+I + V + E+K W   + +EG  P ++KVDWDKWVDEDE++  P  
Sbjct  61   INVDESKSSTTSRSIVYLVKKAEDKWWSRLVKQEGLRPVFLKVDWDKWVDEDEEDSKPEP  120

Query  438  DLDLGGMDFSKF  473
            D+D G MDFSK 
Sbjct  121  DMDFGDMDFSKL  132



>ref|XP_009604976.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X2 
[Nicotiana tomentosiformis]
Length=184

 Score = 99.4 bits (246),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 96/132 (73%), Gaps = 2/132 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP VKWAQR DK++ITV L DAKN K+ LEPEG F FSA AGA+N  YE  ++L DK
Sbjct  1    MSRHPAVKWAQRSDKLFITVELPDAKNVKLKLEPEGKFFFSAIAGADNVPYEVDLDLFDK  60

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvkvdwdkwvdededNGPP-S  437
            +NV+ESK +   R+I + V + E+K W   + +EG  P ++KVDWDKWVDEDE++  P +
Sbjct  61   INVDESKTSTTSRSIVYLVKKAEDKWWSRLIKQEGVRPVFLKVDWDKWVDEDEEDTKPGT  120

Query  438  DLDLGGMDFSKF  473
            D+D G +DFSK 
Sbjct  121  DMDFGDIDFSKL  132



>ref|XP_009409147.1| PREDICTED: uncharacterized protein OsI_027940-like [Musa acuminata 
subsp. malaccensis]
Length=185

 Score = 99.4 bits (246),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 69/100 (69%), Gaps = 1/100 (1%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP  KWAQR DK+YIT+ L DAK+ K+ LEPEG F FSAT+G  N  YE  +EL D+
Sbjct  1    MSRHPTTKWAQRSDKVYITIELPDAKDVKLTLEPEGRFYFSATSGTANIRYELDLELFDR  60

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHY  380
            V V+ESK  +G+R I + V + E+K W   L + GKPP Y
Sbjct  61   VIVDESKAAVGLRTICYLVKKAEKKWWSRLLKQAGKPPVY  100



>ref|XP_006434558.1| hypothetical protein CICLE_v10002611mg [Citrus clementina]
 gb|ESR47798.1| hypothetical protein CICLE_v10002611mg [Citrus clementina]
Length=180

 Score = 99.0 bits (245),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 92/134 (69%), Gaps = 8/134 (6%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP VKWAQR D++YIT+ L DA++ K+ LEPEG F FSAT+G +   YE  I+L DK
Sbjct  1    MSRHPTVKWAQRTDRVYITIDLPDAQDVKLKLEPEGKFFFSATSGPDKIPYEVDIDLYDK  60

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvkvdwdk---wvdededNGP  431
                ESK ++G+RNI + V + E K W   L + GKPP ++KVDWDK     +E +D+ P
Sbjct  61   ----ESKASVGLRNIHYLVKKAENKWWSRLLKQAGKPPVFLKVDWDKWIDEDEEGKDDKP  116

Query  432  PSDLDLGGMDFSKF  473
            P+D+D G +DFSK 
Sbjct  117  PADMDFGDLDFSKM  130



>ref|XP_009604975.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X1 
[Nicotiana tomentosiformis]
Length=190

 Score = 99.4 bits (246),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 96/132 (73%), Gaps = 2/132 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP VKWAQR DK++ITV L DAKN K+ LEPEG F FSA AGA+N  YE  ++L DK
Sbjct  1    MSRHPAVKWAQRSDKLFITVELPDAKNVKLKLEPEGKFFFSAIAGADNVPYEVDLDLFDK  60

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvkvdwdkwvdededNGPP-S  437
            +NV+ESK +   R+I + V + E+K W   + +EG  P ++KVDWDKWVDEDE++  P +
Sbjct  61   INVDESKTSTTSRSIVYLVKKAEDKWWSRLIKQEGVRPVFLKVDWDKWVDEDEEDTKPGT  120

Query  438  DLDLGGMDFSKF  473
            D+D G +DFSK 
Sbjct  121  DMDFGDIDFSKL  132



>gb|KHN32820.1| Hypothetical protein glysoja_024179 [Glycine soja]
Length=189

 Score = 99.4 bits (246),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 92/135 (68%), Gaps = 4/135 (3%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP VKWAQ  D +Y+TV L DA++ K+ LEPEG F FSATAGAE   YE  I+L DK
Sbjct  1    MSRHPSVKWAQTSDVLYLTVELPDAQDVKLKLEPEGKFYFSATAGAEKIPYEVDIDLFDK  60

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvkvdwdk--wvdededNGP-  431
            ++V  SK ++G RNI + V + E K W   L + GK P ++KVDWDK    DE++DN P 
Sbjct  61   IDVNNSKASVGSRNICYLVKKAENKWWDRLLKQGGKSPVFLKVDWDKWVDEDEEQDNKPA  120

Query  432  PSDLDLGGMDFSKFG  476
             SD+D G +DFSK G
Sbjct  121  ASDMDFGDIDFSKLG  135



>ref|NP_001237326.1| uncharacterized protein LOC100527783 [Glycine max]
 gb|ACU16956.1| unknown [Glycine max]
Length=189

 Score = 99.0 bits (245),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 92/135 (68%), Gaps = 4/135 (3%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP VKWAQ  D +Y+TV L DA++ K+ LEPEG F FSATAGAE   YE  I+L DK
Sbjct  1    MSRHPSVKWAQTSDVLYLTVELPDAQDVKLKLEPEGKFYFSATAGAEKIPYEVDIDLFDK  60

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvkvdwdk--wvdededNGP-  431
            ++V  SK ++G RNI + V + E K W   L + GK P ++KVDWDK    DE++DN P 
Sbjct  61   IDVNNSKASVGSRNICYLVKKAENKWWDRLLKQGGKSPVFLKVDWDKWVDEDEEQDNKPA  120

Query  432  PSDLDLGGMDFSKFG  476
             SD+D G +DFSK G
Sbjct  121  ASDMDFGDIDFSKLG  135



>ref|XP_010694668.1| PREDICTED: uncharacterized protein At3g03773-like isoform X3 
[Beta vulgaris subsp. vulgaris]
Length=197

 Score = 99.4 bits (246),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 92/131 (70%), Gaps = 5/131 (4%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP VKWAQ  DK+Y+T+ L DAK+ K+ LEPEG   FSA   A  H YEF IEL DK
Sbjct  1    MSRHPSVKWAQSSDKVYVTIELPDAKDVKLKLEPEGKMAFSAVKNA--HPYEFDIELLDK  58

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            +NVEESK NIGVR I + + + E++ W   + +EG PP ++KVDWDKWVDE+E+N   S 
Sbjct  59   INVEESKYNIGVRQIVYVIEKAEKRWWSRLIKQEGNPPIFLKVDWDKWVDENEENKNGS-  117

Query  441  LDLGGMDFSKF  473
             DLGG+  S+ 
Sbjct  118  -DLGGLSLSQL  127



>ref|XP_010694670.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X4 
[Beta vulgaris subsp. vulgaris]
Length=187

 Score = 99.0 bits (245),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 56/78 (72%), Gaps = 2/78 (3%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP VKWAQ  DK+Y+T+ L DAK+ K+ LEPEG   FSA   A  H YEF IEL DK
Sbjct  1    MSRHPSVKWAQSSDKVYVTIELPDAKDVKLKLEPEGKMAFSAVKNA--HPYEFDIELLDK  58

Query  264  VNVEESKINIGVRNIFCV  317
            +NVEESK NIGVR I  V
Sbjct  59   INVEESKYNIGVRQIVYV  76



>ref|XP_010694666.1| PREDICTED: uncharacterized protein At3g03773-like isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=201

 Score = 99.0 bits (245),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 56/78 (72%), Gaps = 2/78 (3%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP VKWAQ  DK+Y+T+ L DAK+ K+ LEPEG   FSA   A  H YEF IEL DK
Sbjct  1    MSRHPSVKWAQSSDKVYVTIELPDAKDVKLKLEPEGKMAFSAVKNA--HPYEFDIELLDK  58

Query  264  VNVEESKINIGVRNIFCV  317
            +NVEESK NIGVR I  V
Sbjct  59   INVEESKYNIGVRQIVYV  76



>ref|XP_010694667.1| PREDICTED: uncharacterized protein At3g03773-like isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=200

 Score = 99.0 bits (245),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 56/78 (72%), Gaps = 2/78 (3%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP VKWAQ  DK+Y+T+ L DAK+ K+ LEPEG   FSA   A  H YEF IEL DK
Sbjct  1    MSRHPSVKWAQSSDKVYVTIELPDAKDVKLKLEPEGKMAFSAVKNA--HPYEFDIELLDK  58

Query  264  VNVEESKINIGVRNIFCV  317
            +NVEESK NIGVR I  V
Sbjct  59   INVEESKYNIGVRQIVYV  76



>ref|XP_011458453.1| PREDICTED: uncharacterized protein OsI_027940-like [Fragaria 
vesca subsp. vesca]
Length=183

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 85/135 (63%), Gaps = 4/135 (3%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            M RHP VKWAQR D +YIT+ L DA++ K+ L PEG F FSAT G E   YE  ++L DK
Sbjct  1    MGRHPIVKWAQRPDTLYITIDLPDAQDVKLKLGPEGKFLFSATTGKEKTPYEVDLDLYDK  60

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvk---vdwdkwvdededNGP  431
            ++V ESK +IG+RNI + V + E K W   + +EGK P ++K     W    +E +  GP
Sbjct  61   IDVNESKASIGLRNICYLVKKAESKWWSRLIKQEGKAPVFLKVDWDKWVDEDEESDAQGP  120

Query  432  PSDLDLGGMDFSKFG  476
             +D+D G +DFSK  
Sbjct  121  GNDMDFGDLDFSKLS  135



>emb|CAN64654.1| hypothetical protein VITISV_015756 [Vitis vinifera]
Length=182

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 94/134 (70%), Gaps = 4/134 (3%)
 Frame = +3

Query  78   SKMSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQ  257
             K SRHP VKWAQR DK+Y+TV L DAK+ K+ LEPEG F FSAT   ++  YE  IEL 
Sbjct  9    DKWSRHPTVKWAQRSDKLYLTVELPDAKDVKLKLEPEGRFMFSAT--KDDVPYEVDIELF  66

Query  258  DKVNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvkvdwdkwvdededNGPP  434
            DK+ VE+SK N+GVR+I + + + E+K W   +  EGKPP ++KVDWDKWVDE+++NG  
Sbjct  67   DKIKVEDSKCNVGVRSIVYVIAKAEKKWWARLIKNEGKPPVFLKVDWDKWVDEEDENGRE  126

Query  435  S-DLDLGGMDFSKF  473
               +D   MDFSK 
Sbjct  127  KVGMDFDDMDFSKL  140



>ref|XP_007020190.1| HSP20-like chaperones superfamily protein [Theobroma cacao]
 gb|EOY17415.1| HSP20-like chaperones superfamily protein [Theobroma cacao]
Length=182

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 94/135 (70%), Gaps = 4/135 (3%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP VKWAQR D ++IT+ L DA++ K+ LEPEG F FSAT+G +   YE  I+L+DK
Sbjct  1    MSRHPTVKWAQRSDVVFITIDLPDAQDVKLKLEPEGKFFFSATSGVDKIPYEVDIDLRDK  60

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvkvdwdkwvdededNGPPS-  437
            V+V ESK ++G RNI + V + E K W   L +EGKPP ++KVDWDKWVDEDE++     
Sbjct  61   VDVAESKASVGKRNICYLVKKAENKWWSRLLKQEGKPPVFLKVDWDKWVDEDEEDQDSKL  120

Query  438  --DLDLGGMDFSKFG  476
              D+D G  DFSK  
Sbjct  121  APDMDYGDFDFSKLN  135



>ref|XP_002276982.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X2 
[Vitis vinifera]
Length=170

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 93/131 (71%), Gaps = 4/131 (3%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP VKWAQR DK+Y+TV L DAK+ K+ LEPEG F FSAT   ++  YE  IEL DK
Sbjct  1    MSRHPTVKWAQRSDKLYLTVELPDAKDVKLKLEPEGRFMFSAT--KDDVPYEVDIELFDK  58

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            + VE+SK N+GVR+I + + + E+K W   +  EGKPP ++KVDWDKWVDE+++N     
Sbjct  59   IKVEDSKCNVGVRSIVYVIAKAEKKWWARLIKNEGKPPVFLKVDWDKWVDEEDENEKVG-  117

Query  441  LDLGGMDFSKF  473
            +D   MDFSK 
Sbjct  118  MDFDDMDFSKL  128



>ref|XP_004159475.1| PREDICTED: uncharacterized protein OsI_027940-like [Cucumis sativus]
Length=191

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 96/134 (72%), Gaps = 3/134 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP ++WAQ  D+++IT+ L DA++ K+ L+PEG F FSA +G E   YE  I+L DK
Sbjct  1    MSRHPTLRWAQTSDRLFITIDLPDAQDVKLKLDPEGKFCFSAVSGTEKIPYEVDIDLYDK  60

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvkvdwdkwvdededNGPPS-  437
            V++ ESK +IG+RNI + + + E+K W   L +EGKPP +VK+DWDKW+DEDE+ G  S 
Sbjct  61   VDINESKASIGMRNIRYLIEKAEKKWWSRLLKQEGKPPVFVKIDWDKWIDEDEEKGDNSG  120

Query  438  -DLDLGGMDFSKFG  476
             D+D   +DFSK G
Sbjct  121  NDMDFSSLDFSKLG  134



>ref|XP_004140943.1| PREDICTED: uncharacterized protein OsI_027940-like [Cucumis sativus]
 gb|KGN46095.1| hypothetical protein Csa_6G052700 [Cucumis sativus]
Length=191

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 96/134 (72%), Gaps = 3/134 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP ++WAQ  D+++IT+ L DA++ K+ L+PEG F FSA +G E   YE  I+L DK
Sbjct  1    MSRHPTLRWAQTSDRLFITIDLPDAQDVKLKLDPEGKFCFSAVSGTEKIPYEVDIDLYDK  60

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvkvdwdkwvdededNGPPS-  437
            V++ ESK +IG+RNI + + + E+K W   L +EGKPP +VK+DWDKW+DEDE+ G  S 
Sbjct  61   VDINESKASIGMRNILYLIEKAEKKWWSRLLKQEGKPPVFVKIDWDKWIDEDEEKGDNSG  120

Query  438  -DLDLGGMDFSKFG  476
             D+D   +DFSK G
Sbjct  121  NDMDFSSLDFSKLG  134



>ref|XP_008237431.1| PREDICTED: uncharacterized protein Os08g0359500-like isoform 
X2 [Prunus mume]
Length=236

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP VKWAQR D +YIT+ L DA++ K+NLEPEG F FSAT G E   YE  ++L DK
Sbjct  1    MSRHPNVKWAQRSDTVYITIDLPDAQDVKLNLEPEGKFLFSATTGPEKTPYEIDLDLYDK  60

Query  264  VNVEESKINIGVRNI  308
            ++V ESK ++G+RNI
Sbjct  61   IDVNESKASVGLRNI  75



>ref|XP_008237430.1| PREDICTED: uncharacterized protein Os08g0359500-like isoform 
X1 [Prunus mume]
Length=237

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP VKWAQR D +YIT+ L DA++ K+NLEPEG F FSAT G E   YE  ++L DK
Sbjct  1    MSRHPNVKWAQRSDTVYITIDLPDAQDVKLNLEPEGKFLFSATTGPEKTPYEIDLDLYDK  60

Query  264  VNVEESKINIGVRNI  308
            ++V ESK ++G+RNI
Sbjct  61   IDVNESKASVGLRNI  75



>ref|XP_002277004.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X1 
[Vitis vinifera]
Length=159

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 93/130 (72%), Gaps = 4/130 (3%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP VKWAQR DK+Y+TV L DAK+ K+ LEPEG F FSAT   ++  YE  IEL DK
Sbjct  1    MSRHPTVKWAQRSDKLYLTVELPDAKDVKLKLEPEGRFMFSAT--KDDVPYEVDIELFDK  58

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            + VE+SK N+GVR+I + + + E+K W   +  EGKPP ++KVDWDKWVDE+++N     
Sbjct  59   IKVEDSKCNVGVRSIVYVIAKAEKKWWARLIKNEGKPPVFLKVDWDKWVDEEDENEKVG-  117

Query  441  LDLGGMDFSK  470
            +D   MDFSK
Sbjct  118  MDFDDMDFSK  127



>ref|XP_002307531.2| hypothetical protein POPTR_0005s22140g, partial [Populus trichocarpa]
 gb|EEE94527.2| hypothetical protein POPTR_0005s22140g, partial [Populus trichocarpa]
Length=205

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 72/112 (64%), Gaps = 1/112 (1%)
 Frame = +3

Query  48   HRQSLPYRRSSKMSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAEN  227
             R+  P     +  RHP VKWAQR DK++I V L DA++ K  LEPEG F FSAT+GA+ 
Sbjct  5    RRRKFPCDCFMESIRHPSVKWAQRSDKLFIIVQLPDAQDVKFKLEPEGKFFFSATSGADK  64

Query  228  HLYEFKIELQDKVNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHY  380
              YE +++L DKVNVEESK  IG RNI + V + E K W   + + GKPP +
Sbjct  65   TPYEIELDLLDKVNVEESKAGIGSRNIQYIVKKAENKWWSRLIKQTGKPPVF  116



>emb|CDY50382.1| BnaCnng19140D [Brassica napus]
Length=992

 Score =   102 bits (253),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 59/78 (76%), Gaps = 9/78 (12%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
             SRHPEVKWA         V+LAD+K  KVNL+PEGVF FSA AG ENH+YE K+ L  K
Sbjct  4    CSRHPEVKWA---------VVLADSKETKVNLDPEGVFDFSAKAGPENHVYELKLVLHGK  54

Query  264  VNVEESKINIGVRNIFCV  317
            VNVEESKINIGVR+IFC+
Sbjct  55   VNVEESKINIGVRSIFCI  72



>ref|XP_007201255.1| hypothetical protein PRUPE_ppa010769mg [Prunus persica]
 gb|EMJ02454.1| hypothetical protein PRUPE_ppa010769mg [Prunus persica]
Length=236

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP VKWAQR D +YIT+ L DA + K+NLEPEG F FSAT G E   YE  ++L DK
Sbjct  1    MSRHPNVKWAQRSDTVYITINLPDAHDVKLNLEPEGKFLFSATTGPEKTPYEVDLDLYDK  60

Query  264  VNVEESKINIGVRNI  308
            ++V ESK ++G+RNI
Sbjct  61   IDVNESKASVGLRNI  75



>ref|XP_007201254.1| hypothetical protein PRUPE_ppa010769mg [Prunus persica]
 gb|EMJ02453.1| hypothetical protein PRUPE_ppa010769mg [Prunus persica]
Length=237

 Score = 97.1 bits (240),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP VKWAQR D +YIT+ L DA + K+NLEPEG F FSAT G E   YE  ++L DK
Sbjct  1    MSRHPNVKWAQRSDTVYITINLPDAHDVKLNLEPEGKFLFSATTGPEKTPYEVDLDLYDK  60

Query  264  VNVEESKINIGVRNI  308
            ++V ESK ++G+RNI
Sbjct  61   IDVNESKASVGLRNI  75



>gb|AFK43711.1| unknown [Lotus japonicus]
Length=191

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 86/136 (63%), Gaps = 6/136 (4%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP VKWAQR D++YIT+ L DA++ K+ LEPEG   FSATAG EN  YEF  +L DK
Sbjct  1    MSRHPPVKWAQRSDELYITIELPDAQDVKLILEPEGKLYFSATAGPENIPYEFNFDLFDK  60

Query  264  VNVEESKINIGVRN-IFCVlekeekkwwnkllreGKPPHYvkvd-----wdkwvdededN  425
            V+V  S+ ++  RN I+ + + E K W   L + GKPP ++KVD      +    ED+  
Sbjct  61   VDVNNSESSVSKRNIIYLISKAESKCWDRLLKQGGKPPVFLKVDWDKWVDEDEEQEDDKP  120

Query  426  GPPSDLDLGGMDFSKF  473
            GP +D+D G  DFS  
Sbjct  121  GPGADMDFGDFDFSNL  136



>ref|XP_002893745.1| hypothetical protein ARALYDRAFT_336372 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70004.1| hypothetical protein ARALYDRAFT_336372 [Arabidopsis lyrata subsp. 
lyrata]
Length=180

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 91/131 (69%), Gaps = 1/131 (1%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MS+HP VKWAQR DK+YITV L DA++ K+ LEP+G F FSAT+GA    YE  ++L D 
Sbjct  1    MSKHPTVKWAQRSDKVYITVELPDAEDVKLKLEPQGKFFFSATSGASKTPYEVDLDLFDN  60

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            V+V ESK ++  R I + V + E K W   + +EGKPP ++KVDWDKWVDEDED G  +D
Sbjct  61   VDVNESKASVNSRCICYMVKKAESKWWNRLIKQEGKPPVFLKVDWDKWVDEDEDKGGGAD  120

Query  441  LDLGGMDFSKF  473
            +D G  DF+  
Sbjct  121  MDFGDFDFNSL  131



>ref|XP_002525582.1| HSP90 co-chaperone, putative [Ricinus communis]
 gb|EEF36841.1| HSP90 co-chaperone, putative [Ricinus communis]
Length=149

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 94/131 (72%), Gaps = 4/131 (3%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP VKWAQR DK++ITV L DAK+ K+ LEPEG F FSAT   ++  YE  IEL DK
Sbjct  1    MSRHPIVKWAQRSDKVFITVELPDAKDVKLKLEPEGRFIFSAT--KDDVPYEVDIELFDK  58

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            VNV+ESK NIGVR+I + + + E+K W   + +EGK P ++KVDWDKWVDED++N     
Sbjct  59   VNVKESKYNIGVRSIVYDIKKVEKKWWGRLIKQEGKTPVFLKVDWDKWVDEDDENDKGH-  117

Query  441  LDLGGMDFSKF  473
             D+  MDFSK 
Sbjct  118  FDVDDMDFSKL  128



>ref|XP_009115602.1| PREDICTED: uncharacterized protein OsI_027940-like [Brassica 
rapa]
Length=180

 Score = 94.0 bits (232),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP VKWAQR D +YITV L DA++ K+ LEPEG   FSAT+GA   LYE  ++L D 
Sbjct  1    MSRHPTVKWAQRSDWVYITVELPDAEDVKLKLEPEGKLFFSATSGASKTLYEVDLDLLDS  60

Query  264  VNVEESKINIGVRNIFCV  317
            V+V ESK+N+  R++F +
Sbjct  61   VDVNESKVNVSSRSVFYL  78



>gb|AAG41763.1|AF153128_1 p23 [Brassica napus]
Length=178

 Score = 94.0 bits (232),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 89/130 (68%), Gaps = 2/130 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP VKWAQR D +YITV L DA++ K+ LEPEG F FSAT+GA   LYE  ++L D 
Sbjct  1    MSRHPTVKWAQRSDWVYITVELPDAEDVKLKLEPEGKFFFSATSGASKTLYEVDLDLLDS  60

Query  264  VNVEESKINIGVRNIF-CVlekeekkwwnkllreGKPPHYvkvdwdkwvdededN-GPPS  437
            V+V ESK ++  R++F  V + E K W      EGK P Y+KVDWDKWVDED+++ G   
Sbjct  61   VDVNESKASVSSRSVFYLVKKAESKWWNRLTKPEGKHPLYLKVDWDKWVDEDDEDKGGEG  120

Query  438  DLDLGGMDFS  467
            D+D G  DF+
Sbjct  121  DMDFGDFDFN  130



>ref|XP_006574773.1| PREDICTED: uncharacterized protein OsI_027940-like [Glycine max]
 gb|KHN00714.1| Hypothetical protein glysoja_000382 [Glycine soja]
Length=191

 Score = 94.4 bits (233),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 91/135 (67%), Gaps = 4/135 (3%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP VKWAQ  D +Y+TV L DA++ K+ LEPEG F FSATAGAE   YE  I+L DK
Sbjct  1    MSRHPSVKWAQTSDVLYLTVELPDAQDVKLKLEPEGKFYFSATAGAEKIPYEVDIDLFDK  60

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvkvdwdk--wvdededNGP-  431
            ++V  SK ++G R+I + V + E K W   L + GK P ++KVDWDK    DE++DN P 
Sbjct  61   IDVNNSKASVGSRHICYLVKKAENKWWDRLLKQGGKSPVFLKVDWDKWVDEDEEQDNKPA  120

Query  432  PSDLDLGGMDFSKFG  476
             SD+D G +DFSK  
Sbjct  121  ASDMDFGDIDFSKMS  135



>emb|CDY21385.1| BnaA09g30420D [Brassica napus]
Length=182

 Score = 94.0 bits (232),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 89/129 (69%), Gaps = 2/129 (2%)
 Frame = +3

Query  87   SRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDKV  266
            SRHP VKWAQR D +YITV L DA++ K+ LEPEG   FSAT+GA   LYE  ++L D V
Sbjct  6    SRHPTVKWAQRSDWVYITVELPDAEDVKLKLEPEGKLFFSATSGASKTLYEVDLDLLDSV  65

Query  267  NVEESKINIGVRNIF-CVlekeekkwwnkllreGKPPHYvkvdwdkwvdededN-GPPSD  440
            +V ESK+N+  R++F  V + E K W     +EGK P Y+KVDWDKWVDED+++ G   D
Sbjct  66   DVNESKVNVSSRSVFYLVKKAESKWWNRLTKQEGKHPLYLKVDWDKWVDEDDEDKGGEGD  125

Query  441  LDLGGMDFS  467
            +D G  DF+
Sbjct  126  MDFGDFDFN  134



>gb|KJB59532.1| hypothetical protein B456_009G259900 [Gossypium raimondii]
Length=182

 Score = 94.0 bits (232),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 90/134 (67%), Gaps = 4/134 (3%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP VKWAQR D ++IT+ L DA++ K+ LEPEG F FSA +GA+   YE  ++L DK
Sbjct  1    MSRHPMVKWAQRLDDVFITIELPDAQDVKLKLEPEGKFFFSAKSGADKIPYEVDLDLHDK  60

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvkvdwdk---wvdededNGP  431
            V+V+ SK ++G RNI + V + E K W   L +EG+PP ++KVDWD+     ++D D  P
Sbjct  61   VDVDGSKASVGNRNICYLVKKAESKWWSRLLKQEGRPPVFLKVDWDRWVDEDEDDVDTKP  120

Query  432  PSDLDLGGMDFSKF  473
              D+D G  DFSK 
Sbjct  121  APDMDFGDFDFSKM  134



>gb|ABF96271.1| expressed protein [Oryza sativa Japonica Group]
Length=160

 Score = 93.2 bits (230),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 90/132 (68%), Gaps = 3/132 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP  KWAQR DK+++T+ L DA++ K+NL+PEG F FSA   A++  YE  +EL D 
Sbjct  1    MSRHPSTKWAQRSDKVFLTIELPDARDVKLNLKPEGQFIFSAKGPADDTPYELDLELFDA  60

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            VNVEESK  +  R+I + + + E K W   L +EGKPP ++KVDWDKW DED+++     
Sbjct  61   VNVEESKAAVAARSICYLIKKAESKWWPRLLKKEGKPPVFLKVDWDKWQDEDDEDIGLG-  119

Query  441  LDLGGMDFSKFG  476
             D G MDFSK G
Sbjct  120  -DFGDMDFSKLG  130



>ref|XP_008381045.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X2 
[Malus domestica]
Length=223

 Score = 94.4 bits (233),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP VKWAQR D +YIT+ L DA++ K+ LEPEG F FSAT G E   YE  ++L DK
Sbjct  1    MSRHPNVKWAQRSDMVYITIDLPDAQDVKLKLEPEGKFLFSATTGPEKTPYEVDLDLYDK  60

Query  264  VNVEESKINIGVRNI  308
            +++ E+K ++G+RNI
Sbjct  61   IDINETKTSVGLRNI  75



>ref|XP_008381044.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X1 
[Malus domestica]
Length=224

 Score = 94.4 bits (233),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP VKWAQR D +YIT+ L DA++ K+ LEPEG F FSAT G E   YE  ++L DK
Sbjct  1    MSRHPNVKWAQRSDMVYITIDLPDAQDVKLKLEPEGKFLFSATTGPEKTPYEVDLDLYDK  60

Query  264  VNVEESKINIGVRNI  308
            +++ E+K ++G+RNI
Sbjct  61   IDINETKTSVGLRNI  75



>ref|NP_001050241.1| Os03g0381300 [Oryza sativa Japonica Group]
 gb|AAR96242.1| putative ripening regulated protein [Oryza sativa Japonica Group]
 gb|ABF96270.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF12155.1| Os03g0381300 [Oryza sativa Japonica Group]
Length=173

 Score = 93.2 bits (230),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 90/132 (68%), Gaps = 3/132 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP  KWAQR DK+++T+ L DA++ K+NL+PEG F FSA   A++  YE  +EL D 
Sbjct  1    MSRHPSTKWAQRSDKVFLTIELPDARDVKLNLKPEGQFIFSAKGPADDTPYELDLELFDA  60

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            VNVEESK  +  R+I + + + E K W   L +EGKPP ++KVDWDKW DED+++     
Sbjct  61   VNVEESKAAVAARSICYLIKKAESKWWPRLLKKEGKPPVFLKVDWDKWQDEDDEDIGLG-  119

Query  441  LDLGGMDFSKFG  476
             D G MDFSK G
Sbjct  120  -DFGDMDFSKLG  130



>gb|KHF97613.1| hypothetical protein F383_14672 [Gossypium arboreum]
Length=182

 Score = 93.2 bits (230),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 90/134 (67%), Gaps = 4/134 (3%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP VKWAQR D ++IT+ L DA++ K+ LEPEG F FSA +GA+   YE  ++L DK
Sbjct  1    MSRHPIVKWAQRLDDVFITIELPDAQDVKLKLEPEGKFFFSAKSGADKIPYEVDLDLHDK  60

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvkvdwdk---wvdededNGP  431
            V+V+ SK ++G RNI + V + E K W   L +EG+PP ++KVDWD+     ++D D  P
Sbjct  61   VDVDGSKASVGNRNICYLVKKAESKWWSRLLKQEGRPPVFLKVDWDRWVDEDEDDVDTKP  120

Query  432  PSDLDLGGMDFSKF  473
              D+D G  DFSK 
Sbjct  121  APDMDFGDFDFSKM  134



>gb|EAY90254.1| hypothetical protein OsI_11826 [Oryza sativa Indica Group]
Length=171

 Score = 93.2 bits (230),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 90/132 (68%), Gaps = 3/132 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP  KWAQR DK+++T+ L DA++ K+NL+PEG F FSA   A++  YE  +EL D 
Sbjct  1    MSRHPSTKWAQRSDKVFLTIELPDARDVKLNLKPEGQFIFSAKGPADDTPYELDLELFDA  60

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            VNVEESK  +  R+I + + + E K W   L +EGKPP ++KVDWDKW DED+++     
Sbjct  61   VNVEESKAAVAARSICYLIKKAESKWWPRLLKKEGKPPVFLKVDWDKWQDEDDEDIGLG-  119

Query  441  LDLGGMDFSKFG  476
             D G MDFSK G
Sbjct  120  -DFGDMDFSKLG  130



>ref|XP_011026295.1| PREDICTED: uncharacterized protein OsI_027940-like [Populus euphratica]
Length=184

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 69/100 (69%), Gaps = 1/100 (1%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP VKWAQR D ++ITV L DA++ K+ +EPEG F FSA++G E   YE +++L DK
Sbjct  1    MSRHPSVKWAQRSDNLFITVQLPDAQDVKLKIEPEGKFFFSASSGVEKIPYEVELDLLDK  60

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHY  380
            V VEESK +IG R+I + V + E K W   +   GKPP +
Sbjct  61   VIVEESKASIGSRSIQYIVKKAENKWWSRLIKPTGKPPVF  100



>gb|KJB49926.1| hypothetical protein B456_008G146000 [Gossypium raimondii]
Length=183

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 88/131 (67%), Gaps = 27/131 (21%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEVKWAQR DK++ITVLL D+KN                          K++L DK
Sbjct  1    MSRHPEVKWAQRTDKVFITVLLPDSKNA-------------------------KLDLFDK  35

Query  264  VNVEESKINIGVRNIFCVlekeekk-wwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            VNVEESKINIGVR+IFC+LEK EK  W   L  +GK PHYVKVDWDKWVDEDED G   D
Sbjct  36   VNVEESKINIGVRSIFCILEKAEKVWWKKLLRGDGKAPHYVKVDWDKWVDEDEDKG-LGD  94

Query  441  LDLGGMDFSKF  473
            LDLGGMDFS F
Sbjct  95   LDLGGMDFSNF  105



>ref|XP_008456697.1| PREDICTED: uncharacterized protein At3g03773-like isoform X1 
[Cucumis melo]
Length=190

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 96/134 (72%), Gaps = 3/134 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP ++WAQ  ++++IT+ L DA++ K+ LEPEG F FSA +GAE   +E  I+L DK
Sbjct  1    MSRHPTLRWAQTSNRLFITIDLPDAQDVKLKLEPEGKFCFSAVSGAEKIPHEVDIDLYDK  60

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvkvdwdkwvdededNGPPS-  437
            V++ ESK +IG+RNI + + + E+K W   L +EGK P +VK+DWDKW+DEDE+ G  S 
Sbjct  61   VDINESKASIGMRNIRYLIEKAEKKWWSRLLKQEGKHPVFVKIDWDKWIDEDEEKGDNSG  120

Query  438  -DLDLGGMDFSKFG  476
             D+D   +DFSK G
Sbjct  121  NDMDFSSLDFSKLG  134



>gb|ABR17014.1| unknown [Picea sitchensis]
Length=157

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 57/78 (73%), Gaps = 1/78 (1%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEV WAQR DK+Y+TV L DAKN  V  EP+G F+FSA  G     ++ ++EL  K
Sbjct  1    MSRHPEVLWAQRSDKLYLTVCLPDAKNVLVKPEPDGKFSFSAI-GLHAEPFQLELELFGK  59

Query  264  VNVEESKINIGVRNIFCV  317
            +N E SKINIG+RNIFCV
Sbjct  60   LNSEGSKINIGLRNIFCV  77



>emb|CDY04790.1| BnaC05g17990D [Brassica napus]
Length=196

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 90/138 (65%), Gaps = 2/138 (1%)
 Frame = +3

Query  60   LPYRRSSKMSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYE  239
            +P       SRHP VKWAQR D +YITV L DA++ K+ LEPEG F FSAT+GA   LYE
Sbjct  11   VPNNMFQSCSRHPTVKWAQRSDWVYITVELPDAEDVKLKLEPEGKFFFSATSGASKTLYE  70

Query  240  FKIELQDKVNVEESKINIGVRNIF-CVlekeekkwwnkllreGKPPHYvkvdwdkwvded  416
              ++L D V+V ESK ++  R++F  V + E K W      EGK P Y+KVDWDKWVDED
Sbjct  71   VDLDLLDSVDVNESKASVSSRSVFYLVKKAESKWWNRLTKPEGKHPLYLKVDWDKWVDED  130

Query  417  edN-GPPSDLDLGGMDFS  467
            +++ G   D+D G  DF+
Sbjct  131  DEDKGGEGDMDFGDFDFN  148



>ref|XP_002300889.2| hypothetical protein POPTR_0002s06240g [Populus trichocarpa]
 gb|EEE80162.2| hypothetical protein POPTR_0002s06240g [Populus trichocarpa]
Length=184

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 69/100 (69%), Gaps = 1/100 (1%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP VKWAQR D ++ITV L DA++ K+ +EPEG F FSAT+G +   YE +++L DK
Sbjct  1    MSRHPSVKWAQRSDNLFITVQLPDAQDVKLKIEPEGKFFFSATSGVDKIPYEVELDLLDK  60

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHY  380
            V VEESK + G R+I + V + E K W   + + GKPP +
Sbjct  61   VIVEESKASTGSRSIQYIVKKAENKWWSRLIKQTGKPPVF  100



>gb|EYU36540.1| hypothetical protein MIMGU_mgv1a018670mg, partial [Erythranthe 
guttata]
Length=136

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 69/105 (66%), Gaps = 1/105 (1%)
 Frame = +3

Query  69   RRSSKMSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKI  248
            R  +   RHP VKWAQR DK+++TV L DAKN K+NL+PEG F FSAT G +N  YE  I
Sbjct  2    RYFASTIRHPLVKWAQRSDKLFVTVELPDAKNVKLNLDPEGKFFFSATGGVDNVPYEIDI  61

Query  249  ELQDKVNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHY  380
            +L DKV V+ESK +   R+I + V + E K W   L + GKPP +
Sbjct  62   DLYDKVVVDESKASCTSRHICYLVKKAESKWWSRLLKQGGKPPLF  106



>ref|XP_003557812.1| PREDICTED: uncharacterized protein OsI_027940-like [Brachypodium 
distachyon]
Length=175

 Score = 91.3 bits (225),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 87/131 (66%), Gaps = 3/131 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP  KWAQR DK+Y+T+ L DAK+ K+NL+P+G F FSA A A+   Y F  EL D 
Sbjct  1    MSRHPSTKWAQRSDKVYLTIELPDAKDVKLNLKPDGHFDFSAKAPADETQYVFDFELFDA  60

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            VNVEESK  +  R+I + + + E K W   L  EGKPP ++KVDWDKW DED+++     
Sbjct  61   VNVEESKAAVAQRSICYLIKKAESKWWPRLLKNEGKPPVFLKVDWDKWQDEDDEDAGFG-  119

Query  441  LDLGGMDFSKF  473
             D G MDFSK 
Sbjct  120  -DFGDMDFSKL  129



>ref|NP_001148600.1| prostaglandin E synthase 3 [Zea mays]
 gb|ACF82936.1| unknown [Zea mays]
 gb|ACG32174.1| prostaglandin E synthase 3 [Zea mays]
Length=176

 Score = 91.3 bits (225),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 91/131 (69%), Gaps = 4/131 (3%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP  KWAQR D++++T+ L DA++ K+NL+PEG F FSA  G+++  YEF IEL D 
Sbjct  1    MSRHPITKWAQRSDRVFLTIELPDAQDVKLNLKPEGHFNFSAK-GSDDLRYEFDIELFDA  59

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            VNVEESK  I  R I + + + +   W   L +EGKPP ++KVDWDKW DED+++   + 
Sbjct  60   VNVEESKAAIAPRTICYLIKKAKSGWWPRLLKQEGKPPVFLKVDWDKWQDEDDEDAGFN-  118

Query  441  LDLGGMDFSKF  473
             D GGMDFSK 
Sbjct  119  -DFGGMDFSKL  128



>gb|ABA60373.1| p23 [Dactylis glomerata]
Length=180

 Score = 90.9 bits (224),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 89/132 (67%), Gaps = 3/132 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP  KWAQR DK+Y+T+ L DAK+ K+NL+P+G F FSA  G+++  YE  +EL D 
Sbjct  1    MSRHPSTKWAQRSDKVYLTIELPDAKDVKLNLKPDGHFNFSAK-GSDDMQYELDLELFDA  59

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            VNVEESK  +  R I + V + E   W   L +EGKPP ++KVDWDKW DED+++     
Sbjct  60   VNVEESKAAVAPRTICYLVKKAESTWWPRLLKKEGKPPVFLKVDWDKWQDEDDEDAGFGG  119

Query  441  LDLGGMDFSKFG  476
             D G MDFSK G
Sbjct  120  -DFGDMDFSKLG  130



>ref|XP_001768873.1| predicted protein [Physcomitrella patens]
 gb|EDQ66227.1| predicted protein, partial [Physcomitrella patens]
Length=114

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPE+ WAQR DK+++TV L DAK+P+V LEPEG FTFSAT GA +  +E  ++L   
Sbjct  1    MSRHPEILWAQRSDKVFLTVELLDAKHPEVKLEPEGRFTFSATVGANDLKFETDLQLFGA  60

Query  264  VNVEESKINIGVRNIFCV  317
            ++VE+S +N G R+   V
Sbjct  61   IDVEKSVVNKGQRHTTLV  78



>ref|XP_010478707.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X3 
[Camelina sativa]
Length=182

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 88/131 (67%), Gaps = 1/131 (1%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP VKWAQR DK+YITV L DA++ KV L+P G F FSAT+G     YE +I+L + 
Sbjct  1    MSRHPTVKWAQRSDKVYITVELPDAEDVKVKLDPHGKFFFSATSGPSKTPYEVEIDLFES  60

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            V+V ESK ++  R I + V + E K W   + +EGK P Y+KVDWDKWVDEDED G   D
Sbjct  61   VDVNESKASVSSRCICYMVKKAESKWWNRLIKQEGKTPVYLKVDWDKWVDEDEDKGGADD  120

Query  441  LDLGGMDFSKF  473
            +D G  +F+  
Sbjct  121  MDFGDFNFNSL  131



>ref|XP_006651444.1| PREDICTED: uncharacterized protein OsI_027940-like [Oryza brachyantha]
Length=173

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 89/132 (67%), Gaps = 3/132 (2%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP  KWAQR DK+++T+ L DA++ K+NL+P+G F FSA   A++  YE  +EL D 
Sbjct  1    MSRHPITKWAQRSDKVFLTIELPDARDVKLNLKPDGHFIFSAKGPADDTPYELDLELFDA  60

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            VNVEESK  +  R I + V + E K W   L +EGKPP ++KVDWDKW DED+++     
Sbjct  61   VNVEESKAAVAPRTICYLVKKAESKWWPRLLKKEGKPPVFLKVDWDKWQDEDDEDIGLG-  119

Query  441  LDLGGMDFSKFG  476
             D G MDFSK G
Sbjct  120  -DFGDMDFSKLG  130



>ref|XP_006443478.1| hypothetical protein CICLE_v10022696mg [Citrus clementina]
 ref|XP_006479156.1| PREDICTED: uncharacterized protein At3g03773-like [Citrus sinensis]
 gb|ESR56718.1| hypothetical protein CICLE_v10022696mg [Citrus clementina]
Length=150

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 54/77 (70%), Gaps = 1/77 (1%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEV WAQR DK+Y+T+ L DAK+  V  EP+G+F FSA  G +  LY+F +EL  K
Sbjct  1    MSRHPEVLWAQRSDKVYLTISLPDAKDISVKCEPQGIFGFSAV-GVQGELYDFSLELFGK  59

Query  264  VNVEESKINIGVRNIFC  314
            +  E+ K  +G+RNI C
Sbjct  60   ILPEKCKTKVGLRNIIC  76



>ref|XP_008792419.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X3 
[Phoenix dactylifera]
Length=155

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 69/100 (69%), Gaps = 3/100 (3%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP VKWAQR DKIY+TV L DAK+  + LEPEG F+FSA     +  YE  +EL DK
Sbjct  1    MSRHPTVKWAQRCDKIYLTVELPDAKDVNLKLEPEGKFSFSANKDGVS--YEVDLELFDK  58

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHY  380
            V+ +ESK NIG+R+I + + + E+K W   L  EGKPP +
Sbjct  59   VSTKESKFNIGMRSIVYVIKKAEKKWWSRLLKDEGKPPAF  98



>ref|XP_010478705.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X1 
[Camelina sativa]
Length=183

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 88/131 (67%), Gaps = 1/131 (1%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP VKWAQR DK+YITV L DA++ KV L+P G F FSAT+G     YE +I+L + 
Sbjct  1    MSRHPTVKWAQRSDKVYITVELPDAEDVKVKLDPHGKFFFSATSGPSKTPYEVEIDLFES  60

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            V+V ESK ++  R I + V + E K W   + +EGK P Y+KVDWDKWVDEDED G   D
Sbjct  61   VDVNESKASVSSRCICYMVKKAESKWWNRLIKQEGKTPVYLKVDWDKWVDEDEDKGGADD  120

Query  441  LDLGGMDFSKF  473
            +D G  +F+  
Sbjct  121  MDFGDFNFNSL  131



>ref|XP_008456698.1| PREDICTED: uncharacterized protein At3g03773-like isoform X2 
[Cucumis melo]
Length=189

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 94/132 (71%), Gaps = 3/132 (2%)
 Frame = +3

Query  90   RHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDKVN  269
            RHP ++WAQ  ++++IT+ L DA++ K+ LEPEG F FSA +GAE   +E  I+L DKV+
Sbjct  2    RHPTLRWAQTSNRLFITIDLPDAQDVKLKLEPEGKFCFSAVSGAEKIPHEVDIDLYDKVD  61

Query  270  VEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvkvdwdkwvdededNGPPS--D  440
            + ESK +IG+RNI + + + E+K W   L +EGK P +VK+DWDKW+DEDE+ G  S  D
Sbjct  62   INESKASIGMRNIRYLIEKAEKKWWSRLLKQEGKHPVFVKIDWDKWIDEDEEKGDNSGND  121

Query  441  LDLGGMDFSKFG  476
            +D   +DFSK G
Sbjct  122  MDFSSLDFSKLG  133



>ref|XP_002992410.1| hypothetical protein SELMODRAFT_186712 [Selaginella moellendorffii]
 gb|EFJ06560.1| hypothetical protein SELMODRAFT_186712 [Selaginella moellendorffii]
Length=184

 Score = 88.6 bits (218),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +3

Query  90   RHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDKVN  269
            RHPE+ WAQ  +++++T+ L DAK+P V +EP+G   FSATAGA +  YE ++EL  ++N
Sbjct  2    RHPEIVWAQHSERVFLTIELPDAKSPVVKIEPQGKLKFSATAGASDEKYEVELELFKEIN  61

Query  270  VEESKINIGVRNIFCV  317
            VE SKI+ G R IF V
Sbjct  62   VEASKISTGARQIFVV  77



>ref|XP_002968013.1| hypothetical protein SELMODRAFT_145227 [Selaginella moellendorffii]
 gb|EFJ31360.1| hypothetical protein SELMODRAFT_145227 [Selaginella moellendorffii]
Length=183

 Score = 88.2 bits (217),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +3

Query  90   RHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDKVN  269
            RHPE+ WAQ  +++++T+ L DAK+P V +EP+G   FSATAGA +  YE ++EL  ++N
Sbjct  2    RHPEIVWAQHSERVFLTIELPDAKSPVVKIEPQGKLKFSATAGASDEKYEVELELFKEIN  61

Query  270  VEESKINIGVRNIFCV  317
            VE SKI+ G R IF V
Sbjct  62   VEASKISTGARQIFVV  77



>ref|XP_007151769.1| hypothetical protein PHAVU_004G073200g [Phaseolus vulgaris]
 gb|ESW23763.1| hypothetical protein PHAVU_004G073200g [Phaseolus vulgaris]
Length=119

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 52/77 (68%), Gaps = 1/77 (1%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEV WAQR DK+Y+TV L DAK+  V  EP+G+F+FSA+ G ++  Y F +EL   
Sbjct  1    MSRHPEVLWAQRSDKVYLTVALPDAKDVSVKCEPQGLFSFSAS-GVQDESYSFSLELYGS  59

Query  264  VNVEESKINIGVRNIFC  314
            +  E  K   G+RNI C
Sbjct  60   IEPEGCKTKSGLRNILC  76



>ref|XP_010910290.1| PREDICTED: uncharacterized protein At3g03773 [Elaeis guineensis]
Length=154

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 53/77 (69%), Gaps = 1/77 (1%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            M R PEV WAQR DKIY+TV L DA +  V  EPEG+F+FSA  GA+   + F ++L D 
Sbjct  1    MGRQPEVLWAQRSDKIYLTVSLPDATDVSVKSEPEGLFSFSAV-GAQGESFSFSLKLYDT  59

Query  264  VNVEESKINIGVRNIFC  314
            ++ E SK NIG+RNI C
Sbjct  60   ISPEGSKTNIGLRNIIC  76



>gb|AFK42085.1| unknown [Lotus japonicus]
Length=150

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 52/77 (68%), Gaps = 1/77 (1%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEV WAQR DK+Y+TV L DAK+  V  EP G+F+FSA+ G ++  Y F +EL   
Sbjct  1    MSRHPEVLWAQRSDKVYLTVALPDAKDVSVKCEPHGLFSFSAS-GVQHEPYSFSLELYGS  59

Query  264  VNVEESKINIGVRNIFC  314
            +  E  KI  G+RNI C
Sbjct  60   IEPEGCKIKAGLRNILC  76



>gb|AGT16170.1| hypothetical protein SHCRBa_024_F14_R_20 [Saccharum hybrid cultivar 
R570]
Length=179

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 91/131 (69%), Gaps = 4/131 (3%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP  KWAQR D++++T+ L DAK+ K+NL+PEG F FSA  G+++  YEF +EL D 
Sbjct  1    MSRHPITKWAQRSDRVFLTIELPDAKDVKLNLKPEGHFNFSAK-GSDDLPYEFDLELFDA  59

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            VNVEESK  +  R I + + + E K W   L +EGKPP ++KVDWDKW DED+++   + 
Sbjct  60   VNVEESKAAVAPRTICYLIKKTESKWWPRLLKKEGKPPVFLKVDWDKWQDEDDEDIGFN-  118

Query  441  LDLGGMDFSKF  473
             D G MDFSK 
Sbjct  119  -DFGDMDFSKL  128



>ref|XP_003550100.1| PREDICTED: uncharacterized protein At3g03773-like isoform 1 [Glycine 
max]
Length=151

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSR+PEV WAQR DK+Y+TV L DAKN  V  EP+G+FTFSA+ G +   Y F +EL   
Sbjct  1    MSRYPEVLWAQRSDKVYLTVALPDAKNVSVKCEPQGLFTFSAS-GVQEEAYSFSLELYGC  59

Query  264  VNVEESKINIGVRNIFC  314
            +  E  K   G+RNI C
Sbjct  60   IEPEGCKTKSGLRNILC  76



>gb|KDO66094.1| hypothetical protein CISIN_1g031955mg [Citrus sinensis]
Length=150

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 53/77 (69%), Gaps = 1/77 (1%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEV WAQR DK+Y+T+ L DAK+  V  EP+G+F FSA  G +  L++F +EL  K
Sbjct  1    MSRHPEVLWAQRSDKVYLTISLPDAKDISVKCEPQGIFGFSAV-GVQGELFDFSLELFGK  59

Query  264  VNVEESKINIGVRNIFC  314
               E+ K  +G+RNI C
Sbjct  60   TLPEKCKTKVGLRNIIC  76



>gb|KHN43783.1| Hypothetical protein glysoja_035394 [Glycine soja]
Length=206

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSR+PEV WAQR DK+Y+TV L DAKN  V  EP+G+FTFSA+ G +   Y F +EL   
Sbjct  1    MSRYPEVLWAQRSDKVYLTVALPDAKNVSVKCEPQGLFTFSAS-GVQEEAYSFSLELYGC  59

Query  264  VNVEESKINIGVRNIFC  314
            +  E  K   G+RNI C
Sbjct  60   IEPEGCKTKSGLRNILC  76



>emb|CDY22052.1| BnaA09g00810D [Brassica napus]
Length=633

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 59/90 (66%), Gaps = 8/90 (9%)
 Frame = +3

Query  51   RQSLPYRRSSKM-------SRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSA  209
            R    YRRS+          R   ++W Q   + Y+TV+ AD+K  KVNL+PEGVF FSA
Sbjct  472  RCDACYRRSNGFMYKHGGKERSRNMQWLQNSKEDYLTVV-ADSKETKVNLDPEGVFDFSA  530

Query  210  TAGAENHLYEFKIELQDKVNVEESKINIGV  299
             AG ENH+YE K+EL  KVNVEESKINIGV
Sbjct  531  KAGPENHVYELKLELHSKVNVEESKINIGV  560



>ref|XP_010249748.1| PREDICTED: uncharacterized protein At3g03773 [Nelumbo nucifera]
Length=165

 Score = 85.5 bits (210),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = +3

Query  87   SRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDKV  266
            SR+PEV WAQR DKIY+T+ L DAKN  V  EPEG+F+FSA  GA+   ++  +EL   +
Sbjct  13   SRNPEVLWAQRSDKIYLTIALPDAKNVSVKSEPEGLFSFSAM-GAQGESFDLNLELYGTI  71

Query  267  NVEESKINIGVRNIFC  314
              E SK+N+G+RNI C
Sbjct  72   VPEGSKVNVGLRNILC  87



>ref|XP_010461088.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X4 
[Camelina sativa]
Length=179

 Score = 85.5 bits (210),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 65/100 (65%), Gaps = 1/100 (1%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP VKWAQR DK+YITV L DA++ KV LEP G F FSAT+G     YE  I+L + 
Sbjct  1    MSRHPTVKWAQRSDKVYITVELPDAEDVKVKLEPHGKFFFSATSGPSKTPYEVDIDLFES  60

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHY  380
            V+V ESK ++  R I + V + E K W   + +EGK P Y
Sbjct  61   VDVNESKASVSSRCICYMVKKAESKWWNRLIKQEGKTPVY  100



>ref|XP_010461086.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X2 
[Camelina sativa]
Length=181

 Score = 85.5 bits (210),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 65/100 (65%), Gaps = 1/100 (1%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP VKWAQR DK+YITV L DA++ KV LEP G F FSAT+G     YE  I+L + 
Sbjct  1    MSRHPTVKWAQRSDKVYITVELPDAEDVKVKLEPHGKFFFSATSGPSKTPYEVDIDLFES  60

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHY  380
            V+V ESK ++  R I + V + E K W   + +EGK P Y
Sbjct  61   VDVNESKASVSSRCICYMVKKAESKWWNRLIKQEGKTPVY  100



>ref|XP_010461085.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X1 
[Camelina sativa]
Length=181

 Score = 85.5 bits (210),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 65/100 (65%), Gaps = 1/100 (1%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP VKWAQR DK+YITV L DA++ KV LEP G F FSAT+G     YE  I+L + 
Sbjct  1    MSRHPTVKWAQRSDKVYITVELPDAEDVKVKLEPHGKFFFSATSGPSKTPYEVDIDLFES  60

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHY  380
            V+V ESK ++  R I + V + E K W   + +EGK P Y
Sbjct  61   VDVNESKASVSSRCICYMVKKAESKWWNRLIKQEGKTPVY  100



>ref|XP_009406560.1| PREDICTED: uncharacterized protein At3g03773 [Musa acuminata 
subsp. malaccensis]
Length=155

 Score = 84.7 bits (208),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 52/77 (68%), Gaps = 1/77 (1%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            M R PEV WAQR DK+Y+TV L DA++  V  EP+G F FSA  GA+   ++F +EL D 
Sbjct  1    MGRQPEVLWAQRSDKVYLTVSLPDARDVSVESEPQGAFRFSAV-GAQGEHFDFSLELYDS  59

Query  264  VNVEESKINIGVRNIFC  314
            +  E SK NIG+RNI C
Sbjct  60   IVPEASKTNIGMRNIIC  76



>ref|XP_006579379.1| PREDICTED: uncharacterized protein LOC100527476 isoform X2 [Glycine 
max]
Length=149

 Score = 84.7 bits (208),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEV WAQR DK+Y+TV L DAK+  V  EP+G+F FSA+ G ++  Y F +EL   
Sbjct  1    MSRHPEVLWAQRSDKVYLTVALPDAKDVFVKCEPQGLFAFSAS-GVQDKAYSFSLELYGS  59

Query  264  VNVEESKINIGVRNIFC  314
            +  E  K   G+RNI C
Sbjct  60   IEPEGCKTKSGLRNILC  76



>ref|XP_002465200.1| hypothetical protein SORBIDRAFT_01g033940 [Sorghum bicolor]
 gb|EER92198.1| hypothetical protein SORBIDRAFT_01g033940 [Sorghum bicolor]
Length=178

 Score = 85.1 bits (209),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 55/75 (73%), Gaps = 1/75 (1%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP  KWAQR D++++T+ L DAK+ K+NL+PEG F FSA  G+++  YEF +EL D 
Sbjct  1    MSRHPITKWAQRSDRVFLTIELPDAKDVKLNLKPEGHFNFSAK-GSDDLPYEFDLELFDA  59

Query  264  VNVEESKINIGVRNI  308
            VNVEESK  +  R I
Sbjct  60   VNVEESKAAVAPRTI  74



>ref|XP_009420684.1| PREDICTED: uncharacterized protein At3g03773-like [Musa acuminata 
subsp. malaccensis]
Length=156

 Score = 84.3 bits (207),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 52/77 (68%), Gaps = 1/77 (1%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            M R PEV WAQR DKIY+TV L DA++     EP G F FSA  GA++  ++F +EL D 
Sbjct  1    MGRQPEVLWAQRSDKIYLTVSLPDARDVFAESEPHGAFKFSAV-GAQDEHFDFSLELYDA  59

Query  264  VNVEESKINIGVRNIFC  314
            V  E SKINIG+RNI C
Sbjct  60   VVPEASKINIGMRNIIC  76



>ref|XP_002525703.1| HSP90 co-chaperone, putative [Ricinus communis]
 gb|EEF36686.1| HSP90 co-chaperone, putative [Ricinus communis]
Length=144

 Score = 84.3 bits (207),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 52/77 (68%), Gaps = 1/77 (1%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEV WAQR DK+Y+T+ L DAKN  V  E EG+F+FSA  G +   ++F ++L   
Sbjct  1    MSRHPEVLWAQRSDKVYLTIALPDAKNISVKCEAEGLFSFSAV-GIQGESFDFTLQLYGS  59

Query  264  VNVEESKINIGVRNIFC  314
            V  E  K N+G+RNI C
Sbjct  60   VIPEGCKTNVGLRNIIC  76



>gb|KHG15374.1| hypothetical protein F383_20155 [Gossypium arboreum]
Length=153

 Score = 84.3 bits (207),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 54/77 (70%), Gaps = 1/77 (1%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEV WAQR DK+Y+T+ L DAK+  V  +P+G+F+FSA  G +   ++F +EL  K
Sbjct  1    MSRHPEVLWAQRSDKVYLTISLPDAKDISVKCDPQGLFSFSAM-GVQGESFDFSLELFGK  59

Query  264  VNVEESKINIGVRNIFC  314
            +  E  K N+G+RNI C
Sbjct  60   IVPEGCKTNVGLRNIIC  76



>ref|NP_001236575.1| uncharacterized protein LOC100527476 [Glycine max]
 ref|XP_006579378.1| PREDICTED: uncharacterized protein LOC100527476 isoform X1 [Glycine 
max]
 gb|ACU16570.1| unknown [Glycine max]
Length=151

 Score = 84.3 bits (207),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEV WAQR DK+Y+TV L DAK+  V  EP+G+F FSA+ G ++  Y F +EL   
Sbjct  1    MSRHPEVLWAQRSDKVYLTVALPDAKDVFVKCEPQGLFAFSAS-GVQDKAYSFSLELYGS  59

Query  264  VNVEESKINIGVRNIFC  314
            +  E  K   G+RNI C
Sbjct  60   IEPEGCKTKSGLRNILC  76



>ref|XP_010478706.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X2 
[Camelina sativa]
Length=182

 Score = 85.1 bits (209),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 86/129 (67%), Gaps = 1/129 (1%)
 Frame = +3

Query  90   RHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDKVN  269
            RHP VKWAQR DK+YITV L DA++ KV L+P G F FSAT+G     YE +I+L + V+
Sbjct  2    RHPTVKWAQRSDKVYITVELPDAEDVKVKLDPHGKFFFSATSGPSKTPYEVEIDLFESVD  61

Query  270  VEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvkvdwdkwvdededNGPPSDLD  446
            V ESK ++  R I + V + E K W   + +EGK P Y+KVDWDKWVDEDED G   D+D
Sbjct  62   VNESKASVSSRCICYMVKKAESKWWNRLIKQEGKTPVYLKVDWDKWVDEDEDKGGADDMD  121

Query  447  LGGMDFSKF  473
             G  +F+  
Sbjct  122  FGDFNFNSL  130



>gb|KJB80742.1| hypothetical protein B456_013G113500 [Gossypium raimondii]
Length=153

 Score = 84.3 bits (207),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 54/77 (70%), Gaps = 1/77 (1%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEV WAQR DK+Y+T+ L DAK+  V  +P+G+F+FSA  G +   ++F +EL  K
Sbjct  1    MSRHPEVLWAQRSDKVYLTISLPDAKDISVKCDPQGLFSFSAM-GVQGESFDFSLELFGK  59

Query  264  VNVEESKINIGVRNIFC  314
            +  E  K N+G+RNI C
Sbjct  60   IVPEGCKTNVGLRNIIC  76



>gb|KJB80743.1| hypothetical protein B456_013G113500 [Gossypium raimondii]
Length=151

 Score = 84.3 bits (207),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 54/77 (70%), Gaps = 1/77 (1%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHPEV WAQR DK+Y+T+ L DAK+  V  +P+G+F+FSA  G +   ++F +EL  K
Sbjct  1    MSRHPEVLWAQRSDKVYLTISLPDAKDISVKCDPQGLFSFSAM-GVQGESFDFSLELFGK  59

Query  264  VNVEESKINIGVRNIFC  314
            +  E  K N+G+RNI C
Sbjct  60   IVPEGCKTNVGLRNIIC  76



>ref|XP_004984205.1| PREDICTED: uncharacterized protein OsI_027940-like [Setaria italica]
Length=177

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 89/131 (68%), Gaps = 4/131 (3%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP  KWAQR D++++T+ L DAK+ K+NL+PEG F FSA  G+++  YE  +EL D 
Sbjct  1    MSRHPITKWAQRSDRVFLTIELPDAKDVKLNLKPEGHFNFSAK-GSDDLPYELDLELFDA  59

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvkvdwdkwvdededNGPPSD  440
            VNVEESK  +  R I + + + E K W     +EGKPP ++KVDWDKW DED+++   + 
Sbjct  60   VNVEESKAAVAPRTICYLIKKAESKWWPRLPKKEGKPPVFLKVDWDKWQDEDDEDVGFN-  118

Query  441  LDLGGMDFSKF  473
             D G MDFSK 
Sbjct  119  -DFGDMDFSKL  128



>ref|XP_010922128.1| PREDICTED: uncharacterized protein At3g03773-like [Elaeis guineensis]
Length=155

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 67/100 (67%), Gaps = 3/100 (3%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP VKWAQR DKIY+TV L DAK+  + LEPEG F FSA     +  YE  +EL +K
Sbjct  1    MSRHPIVKWAQRSDKIYLTVELPDAKDVNLKLEPEGKFYFSANKDGVS--YEVDLELFNK  58

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHY  380
            V  +ESK NIG+R+I + + + E+K W   L  EGKPP +
Sbjct  59   VITKESKFNIGMRSIGYVIKKAEKKWWSRLLKEEGKPPAF  98



>ref|XP_008792417.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X2 
[Phoenix dactylifera]
 ref|XP_008792418.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X2 
[Phoenix dactylifera]
Length=213

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 68/99 (69%), Gaps = 3/99 (3%)
 Frame = +3

Query  87   SRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDKV  266
            +RHP VKWAQR DKIY+TV L DAK+  + LEPEG F+FSA     +  YE  +EL DKV
Sbjct  73   NRHPTVKWAQRCDKIYLTVELPDAKDVNLKLEPEGKFSFSANKDGVS--YEVDLELFDKV  130

Query  267  NVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHY  380
            + +ESK NIG+R+I + + + E+K W   L  EGKPP +
Sbjct  131  STKESKFNIGMRSIVYVIKKAEKKWWSRLLKDEGKPPAF  169



>ref|XP_002988870.1| hypothetical protein SELMODRAFT_128863, partial [Selaginella 
moellendorffii]
 gb|EFJ10132.1| hypothetical protein SELMODRAFT_128863, partial [Selaginella 
moellendorffii]
Length=144

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = +3

Query  90   RHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDKVN  269
            RHPE+ WAQR DK+++TV L DA +P V L+P+G F F A A A++  YE  +EL   V+
Sbjct  1    RHPEIVWAQRSDKLFLTVELPDAVDPSVELQPDGRFVFRA-AAADSAPYEASLELYGSVS  59

Query  270  VEESKINIGVRNIFCV  317
            VEESK+N+G R+  C+
Sbjct  60   VEESKVNVGSRHTLCI  75



>ref|XP_007030017.1| HSP20-like chaperones superfamily protein isoform 2, partial 
[Theobroma cacao]
 gb|EOY10519.1| HSP20-like chaperones superfamily protein isoform 2, partial 
[Theobroma cacao]
Length=206

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = +3

Query  78   SKMSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQ  257
            S MSRHPEV WAQR DK+Y+T+ L DAK+  V  +P+G+F+FSA  G +   ++F +EL 
Sbjct  52   SNMSRHPEVLWAQRSDKVYLTISLPDAKDISVICDPQGLFSFSAM-GVQGESFDFSLELF  110

Query  258  DKVNVEESKINIGVRNIFC  314
             K+  E  K N+G+RNI C
Sbjct  111  GKIVPEGCKTNVGLRNIIC  129



>ref|XP_002964192.1| hypothetical protein SELMODRAFT_81672, partial [Selaginella moellendorffii]
 gb|EFJ34525.1| hypothetical protein SELMODRAFT_81672, partial [Selaginella moellendorffii]
Length=135

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = +3

Query  90   RHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDKVN  269
            RHPE+ WAQR DK+++TV L DA +P V L+P+G F F A A A++  YE  +EL   V+
Sbjct  1    RHPEIVWAQRSDKLFLTVELPDAVDPSVELQPDGRFVFRA-AAADSAPYEASLELYGSVS  59

Query  270  VEESKINIGVRNIFCV  317
            VEESK+N+G R+  C+
Sbjct  60   VEESKVNVGSRHTLCI  75



>ref|XP_008792416.1| PREDICTED: uncharacterized protein At3g03773-like isoform X1 
[Phoenix dactylifera]
Length=226

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 68/99 (69%), Gaps = 3/99 (3%)
 Frame = +3

Query  87   SRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDKV  266
            +RHP VKWAQR DKIY+TV L DAK+  + LEPEG F+FSA     +  YE  +EL DKV
Sbjct  73   NRHPTVKWAQRCDKIYLTVELPDAKDVNLKLEPEGKFSFSANKDGVS--YEVDLELFDKV  130

Query  267  NVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHY  380
            + +ESK NIG+R+I + + + E+K W   L  EGKPP +
Sbjct  131  STKESKFNIGMRSIVYVIKKAEKKWWSRLLKDEGKPPAF  169



>ref|XP_003619026.1| Ripening regulated protein DDTFR8 [Medicago truncatula]
 gb|AES75244.1| HSP90 co-chaperone [Medicago truncatula]
Length=190

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 83/135 (61%), Gaps = 5/135 (4%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP VKWAQR +++ ITV L DA++ K+ +EPEG F FSATAGAE   YE  ++L D 
Sbjct  1    MSRHPTVKWAQRSEELSITVELPDAQDVKLKVEPEGKFYFSATAGAEKIPYEVNVDLFDS  60

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvkvd----wdkwvdededNG  428
            ++V +   +   R I + V + E K W   L + GK P ++K+D     D+    +++  
Sbjct  61   IDVNDIITSASSRQICYLVKKAENKWWDRLLKQGGKIPSFLKIDWDKWVDEDEYYEQEAK  120

Query  429  PPSDLDLGGMDFSKF  473
            P SD DLG +DFSK 
Sbjct  121  PASDKDLGDIDFSKL  135



>gb|EMT32541.1| hypothetical protein F775_31652 [Aegilops tauschii]
Length=194

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 86/129 (67%), Gaps = 3/129 (2%)
 Frame = +3

Query  90   RHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDKVN  269
            RHP  KWAQR DK+Y+T+ L DAK+ K+NL P+G F FSA A A++  YE  +EL D V+
Sbjct  16   RHPSTKWAQRLDKVYLTIELPDAKDVKLNLRPDGHFNFSAKAPADDMQYELDLELFDAVS  75

Query  270  VEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHYvkvdwdkwvdededNGPPSDLD  446
            VEES+  +  R I + V + E K W   L +EG+PP ++KVDWDKW DED+++      D
Sbjct  76   VEESQAAVAPRAICYLVKKAEGKWWPRLLKKEGRPPVFLKVDWDKWQDEDDEDAGFG--D  133

Query  447  LGGMDFSKF  473
             G MDFSK 
Sbjct  134  FGDMDFSKL  142



>ref|XP_008784543.1| PREDICTED: uncharacterized protein At3g03773 [Phoenix dactylifera]
Length=156

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 52/76 (68%), Gaps = 1/76 (1%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            M R PEV WAQR DKIY+TV L DAK+  V  EP+G+F+FSA  G +  L+ FK+EL D 
Sbjct  1    MGRQPEVLWAQRSDKIYLTVSLPDAKDVCVKSEPQGLFSFSAV-GPQGELFSFKLELYDT  59

Query  264  VNVEESKINIGVRNIF  311
            +  E  K NIG+RNI 
Sbjct  60   IIPEGGKTNIGLRNII  75



>emb|CDP01142.1| unnamed protein product [Coffea canephora]
Length=209

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 84/126 (67%), Gaps = 2/126 (2%)
 Frame = +3

Query  102  VKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDKVNVEES  281
            VKWAQR D+++ITV L DA N    LEPEG F FSAT G +N  YE + +L DKV+  ES
Sbjct  2    VKWAQRSDRLFITVELPDANNVTHKLEPEGKFLFSATTGVDNTPYEVEFDLFDKVDANES  61

Query  282  KINIGVRNI-FCVlekeekkwwnkllreGKPPHYvkvdwdkwvdededNGPP-SDLDLGG  455
            KI+   RNI + V + E K W   L + GKPP ++KVDWDKWVDEDE +    SD+D G 
Sbjct  62   KISATSRNICYLVQKAENKWWGRLLKQSGKPPIFLKVDWDKWVDEDEQDEKVGSDMDFGD  121

Query  456  MDFSKF  473
            +DFSK 
Sbjct  122  IDFSKL  127



>ref|XP_010524994.1| PREDICTED: uncharacterized protein At3g03773 [Tarenaya hassleriana]
Length=151

 Score = 82.4 bits (202),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MS +PEV WAQR DK+Y+TV L DAK+  V  EP G F+FSA  GA+   +EF +EL  K
Sbjct  1    MSHNPEVLWAQRSDKVYLTVALPDAKDISVKCEPHGAFSFSAV-GAQGKRFEFSVELYGK  59

Query  264  VNVEESKINIGVRNIFC  314
            +     K N+G+RNI C
Sbjct  60   IVPAGCKTNVGLRNIIC  76



>ref|XP_010499808.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X3 
[Camelina sativa]
Length=180

 Score = 82.4 bits (202),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 64/100 (64%), Gaps = 1/100 (1%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP VKWAQR DK+YITV L DA++ KV LEP G F FSAT+      YE  I+L + 
Sbjct  1    MSRHPTVKWAQRSDKVYITVELPDAEDVKVKLEPHGKFFFSATSEPTKTPYEVDIDLFES  60

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHY  380
            V+V ESK ++  R I + V + E K W   + +EGK P Y
Sbjct  61   VDVNESKASVSSRCICYMVKKAESKWWDRLIKQEGKTPVY  100



>ref|XP_010499806.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X1 
[Camelina sativa]
Length=182

 Score = 82.4 bits (202),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 64/100 (64%), Gaps = 1/100 (1%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSRHP VKWAQR DK+YITV L DA++ KV LEP G F FSAT+      YE  I+L + 
Sbjct  1    MSRHPTVKWAQRSDKVYITVELPDAEDVKVKLEPHGKFFFSATSEPTKTPYEVDIDLFES  60

Query  264  VNVEESKINIGVRNI-FCVlekeekkwwnkllreGKPPHY  380
            V+V ESK ++  R I + V + E K W   + +EGK P Y
Sbjct  61   VDVNESKASVSSRCICYMVKKAESKWWDRLIKQEGKTPVY  100



>gb|AAT68744.1| hypothetical protein At3g03773 [Arabidopsis thaliana]
Length=117

 Score = 80.5 bits (197),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 54/76 (71%), Gaps = 2/76 (3%)
 Frame = +3

Query  84   MSRHPEVKWAQREDKIYITVLLADAKNPKVNLEPEGVFTFSATAGAENHLYEFKIELQDK  263
            MSR+PEV WAQR DK+Y+TV L DAK+  V  EP+G+F+FSA  GA+   +EF +EL  K
Sbjct  1    MSRNPEVLWAQRSDKVYLTVALPDAKDISVKCEPQGLFSFSAL-GAQGERFEFSLELYGK  59

Query  264  VNVEESKINIGVRNIF  311
            +  E  K N+G+RNI 
Sbjct  60   IMTEYRK-NVGLRNII  74



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 906702465875