BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001G11

Length=543
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009138940.1|  PREDICTED: 60S ribosomal protein L11-1-like        297   5e-99   Brassica rapa
gb|KDP21119.1|  hypothetical protein JCGZ_21590                         295   2e-98   Jatropha curcas
ref|XP_002522234.1|  60S ribosomal protein L11, putative                294   2e-98   Ricinus communis
ref|NP_001266161.1|  60S ribosomal protein L11-like                     294   2e-98   Cicer arietinum [garbanzo]
gb|EYU29260.1|  hypothetical protein MIMGU_mgv1a014673mg                294   3e-98   Erythranthe guttata [common monkey flower]
ref|XP_002510391.1|  60S ribosomal protein L11, putative                294   3e-98   Ricinus communis
ref|XP_010246451.1|  PREDICTED: 60S ribosomal protein L11-like          294   3e-98   Nelumbo nucifera [Indian lotus]
ref|XP_010274422.1|  PREDICTED: 60S ribosomal protein L11               293   4e-98   Nelumbo nucifera [Indian lotus]
ref|XP_009383242.1|  PREDICTED: 60S ribosomal protein L11               293   4e-98   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX71934.1|  BnaC08g29400D                                          296   5e-98   
ref|XP_009408897.1|  PREDICTED: 60S ribosomal protein L11               293   6e-98   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001237077.1|  uncharacterized protein LOC100499863               293   7e-98   Glycine max [soybeans]
ref|XP_004505457.1|  PREDICTED: 60S ribosomal protein L11-like          293   8e-98   
sp|P46287.1|RL11_MEDSA  RecName: Full=60S ribosomal protein L11; ...    293   8e-98   Medicago sativa [alfalfa]
ref|XP_007132813.1|  hypothetical protein PHAVU_011G126600g             293   8e-98   Phaseolus vulgaris [French bean]
ref|XP_006446820.1|  hypothetical protein CICLE_v10016875mg             293   1e-97   Citrus clementina [clementine]
ref|XP_003540015.1|  PREDICTED: 60S ribosomal protein L11-like          292   1e-97   
ref|XP_007215050.1|  hypothetical protein PRUPE_ppa012119mg             292   1e-97   Prunus persica
ref|XP_006398262.1|  hypothetical protein EUTSA_v10001041mg             292   2e-97   Eutrema salsugineum [saltwater cress]
ref|XP_009132192.1|  PREDICTED: 60S ribosomal protein L11-2 isofo...    292   2e-97   Brassica rapa
ref|XP_006850965.1|  hypothetical protein AMTR_s00025p00203150          292   2e-97   Amborella trichopoda
gb|AFK48866.1|  unknown                                                 292   2e-97   Lotus japonicus
ref|XP_007148755.1|  hypothetical protein PHAVU_005G011400g             292   2e-97   Phaseolus vulgaris [French bean]
ref|XP_004134655.1|  PREDICTED: 60S ribosomal protein L11-1-like        292   2e-97   Cucumis sativus [cucumbers]
ref|XP_009628928.1|  PREDICTED: 60S ribosomal protein L11-1             292   2e-97   Nicotiana tomentosiformis
gb|EYU41113.1|  hypothetical protein MIMGU_mgv1a014638mg                292   2e-97   Erythranthe guttata [common monkey flower]
ref|XP_009629723.1|  PREDICTED: 60S ribosomal protein L11-1-like        291   2e-97   Nicotiana tomentosiformis
ref|XP_008225318.1|  PREDICTED: 60S ribosomal protein L11               291   2e-97   Prunus mume [ume]
ref|XP_010529208.1|  PREDICTED: 60S ribosomal protein L11-1-like        291   2e-97   Tarenaya hassleriana [spider flower]
ref|XP_008381196.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    291   2e-97   Malus domestica [apple tree]
ref|XP_010915478.1|  PREDICTED: 60S ribosomal protein L11-like          291   2e-97   Elaeis guineensis
ref|XP_009403504.1|  PREDICTED: 60S ribosomal protein L11               291   2e-97   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009378940.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    291   2e-97   Pyrus x bretschneideri [bai li]
ref|XP_008786958.1|  PREDICTED: 60S ribosomal protein L11-like          291   2e-97   Phoenix dactylifera
ref|XP_009405599.1|  PREDICTED: 60S ribosomal protein L11-like is...    291   2e-97   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU21905.1|  hypothetical protein MIMGU_mgv1a014651mg                291   2e-97   Erythranthe guttata [common monkey flower]
gb|AFK37822.1|  unknown                                                 291   3e-97   Medicago truncatula
emb|CDY49245.1|  BnaA09g55240D                                          294   3e-97   Brassica napus [oilseed rape]
ref|XP_006843688.1|  hypothetical protein AMTR_s00007p00200160          291   3e-97   Amborella trichopoda
ref|XP_009404521.1|  PREDICTED: 60S ribosomal protein L11               291   3e-97   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN42782.1|  60S ribosomal protein L11                               291   3e-97   Glycine soja [wild soybean]
ref|XP_003628237.1|  60S ribosomal protein L11                          291   3e-97   Medicago truncatula
ref|XP_006449533.1|  hypothetical protein CICLE_v10016873mg             291   3e-97   Citrus clementina [clementine]
ref|XP_010936718.1|  PREDICTED: 60S ribosomal protein L11               291   3e-97   Elaeis guineensis
ref|NP_001238636.1|  uncharacterized protein LOC100305912               291   4e-97   Glycine max [soybeans]
gb|AFP44117.1|  60S ribosomal protein                                   291   4e-97   Lycoris longituba
ref|NP_001132260.1|  hypothetical protein                               291   5e-97   Zea mays [maize]
ref|XP_010525185.1|  PREDICTED: 60S ribosomal protein L11-1             291   5e-97   Tarenaya hassleriana [spider flower]
emb|CDY26360.1|  BnaA02g24100D                                          292   5e-97   Brassica napus [oilseed rape]
ref|XP_004293968.1|  PREDICTED: 60S ribosomal protein L11               290   6e-97   Fragaria vesca subsp. vesca
gb|AFK35020.1|  unknown                                                 290   6e-97   Lotus japonicus
ref|XP_011081868.1|  PREDICTED: 60S ribosomal protein L11-like          290   7e-97   Sesamum indicum [beniseed]
ref|XP_011082984.1|  PREDICTED: 60S ribosomal protein L11               290   7e-97   Sesamum indicum [beniseed]
ref|XP_011088013.1|  PREDICTED: 60S ribosomal protein L11-like          290   7e-97   Sesamum indicum [beniseed]
gb|KHG23956.1|  60S ribosomal L11-2 -like protein                       290   7e-97   Gossypium arboreum [tree cotton]
ref|NP_850376.2|  60S ribosomal protein L16A                            290   8e-97   Arabidopsis thaliana [mouse-ear cress]
ref|NP_191429.1|  60S ribosomal protein L11-2                           290   8e-97   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007025337.1|  Ribosomal protein large subunit 16A                293   9e-97   
ref|XP_009790976.1|  PREDICTED: 60S ribosomal protein L11-1             290   9e-97   Nicotiana sylvestris
ref|XP_009626014.1|  PREDICTED: 60S ribosomal protein L11-1-like        290   9e-97   Nicotiana tomentosiformis
gb|KHN01495.1|  60S ribosomal protein L11                               291   9e-97   Glycine soja [wild soybean]
gb|KJB57391.1|  hypothetical protein B456_009G161300                    290   9e-97   Gossypium raimondii
gb|KHG08920.1|  60S ribosomal L11-1 -like protein                       290   1e-96   Gossypium arboreum [tree cotton]
emb|CDX99436.1|  BnaC01g11160D                                          290   1e-96   
ref|NP_001242757.1|  uncharacterized protein LOC100778713               290   1e-96   Glycine max [soybeans]
ref|XP_010052848.1|  PREDICTED: 60S ribosomal protein L11-1             290   1e-96   Eucalyptus grandis [rose gum]
ref|XP_008228941.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    290   1e-96   Prunus mume [ume]
ref|XP_009132184.1|  PREDICTED: 60S ribosomal protein L11-2 isofo...    290   1e-96   Brassica rapa
ref|XP_008381195.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    290   1e-96   Malus domestica [apple tree]
ref|XP_008345917.1|  PREDICTED: 60S ribosomal protein L11               290   1e-96   Malus domestica [apple tree]
ref|XP_006414065.1|  hypothetical protein EUTSA_v10026344mg             290   1e-96   Eutrema salsugineum [saltwater cress]
ref|XP_009351472.1|  PREDICTED: 60S ribosomal protein L11               290   1e-96   Pyrus x bretschneideri [bai li]
ref|XP_009365286.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    290   1e-96   Pyrus x bretschneideri [bai li]
gb|ABK22492.1|  unknown                                                 290   1e-96   Picea sitchensis
ref|XP_008343092.1|  PREDICTED: 60S ribosomal protein L11-like is...    290   1e-96   
ref|XP_008443441.1|  PREDICTED: 60S ribosomal protein L11-1             290   1e-96   Cucumis melo [Oriental melon]
ref|XP_010052835.1|  PREDICTED: 60S ribosomal protein L11-1-like        290   1e-96   Eucalyptus grandis [rose gum]
emb|CDX87764.1|  BnaC02g31850D                                          291   2e-96   
gb|ACJ86159.1|  unknown                                                 289   2e-96   Medicago truncatula
ref|XP_002281886.1|  PREDICTED: 60S ribosomal protein L11               289   2e-96   Vitis vinifera
ref|NP_001149684.1|  60S ribosomal protein L11-1                        289   2e-96   Zea mays [maize]
ref|XP_010538574.1|  PREDICTED: 60S ribosomal protein L11-1-like ...    289   2e-96   Tarenaya hassleriana [spider flower]
ref|XP_002451841.1|  hypothetical protein SORBIDRAFT_04g008530          289   2e-96   Sorghum bicolor [broomcorn]
emb|CAA57395.1|  ribosomal protein L16                                  289   2e-96   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010538572.1|  PREDICTED: 60S ribosomal protein L11-1-like ...    289   2e-96   Tarenaya hassleriana [spider flower]
ref|XP_009378939.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    289   2e-96   Pyrus x bretschneideri [bai li]
gb|KHN27796.1|  60S ribosomal protein L11                               289   2e-96   Glycine soja [wild soybean]
ref|XP_009405598.1|  PREDICTED: 60S ribosomal protein L11-like is...    289   2e-96   
ref|XP_011039398.1|  PREDICTED: 60S ribosomal protein L11               289   2e-96   Populus euphratica
gb|AAR83867.1|  ribosomal protein L11-like protein                      289   3e-96   Capsicum annuum
gb|AFK38385.1|  unknown                                                 289   3e-96   Lotus japonicus
gb|ADE77225.1|  unknown                                                 289   3e-96   Picea sitchensis
gb|KFK28544.1|  hypothetical protein AALP_AA7G010400                    289   3e-96   Arabis alpina [alpine rockcress]
ref|XP_003598139.1|  60S ribosomal protein L11                          289   3e-96   Medicago truncatula
gb|KDO77896.1|  hypothetical protein CISIN_1g029665mg                   289   3e-96   Citrus sinensis [apfelsine]
ref|XP_010052179.1|  PREDICTED: 60S ribosomal protein L11-1             289   3e-96   Eucalyptus grandis [rose gum]
ref|XP_007048733.1|  Ribosomal L5P family protein isoform 1             289   3e-96   Theobroma cacao [chocolate]
ref|XP_002309361.1|  60S ribosomal protein L11                          288   3e-96   Populus trichocarpa [western balsam poplar]
ref|XP_008366039.1|  PREDICTED: 60S ribosomal protein L11-1             288   4e-96   Malus domestica [apple tree]
ref|NP_001274979.1|  60S ribosomal protein L11-2-like                   288   4e-96   Solanum tuberosum [potatoes]
ref|XP_011033383.1|  PREDICTED: 60S ribosomal protein L11-like          288   4e-96   Populus euphratica
emb|CAA57394.1|  ribosomal protein L16                                  288   4e-96   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002876475.1|  60S ribosomal protein L11                          288   5e-96   
ref|XP_010427776.1|  PREDICTED: 60S ribosomal protein L11-1-like        288   5e-96   Camelina sativa [gold-of-pleasure]
ref|XP_002880003.1|  60S ribosomal protein L11                          288   5e-96   Arabidopsis lyrata subsp. lyrata
ref|XP_003607648.1|  60S ribosomal protein L11-1                        288   5e-96   Medicago truncatula
ref|XP_008782472.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    288   5e-96   Phoenix dactylifera
gb|AFW65990.1|  hypothetical protein ZEAMMB73_747842                    288   6e-96   
ref|XP_004133952.1|  PREDICTED: 60S ribosomal protein L11-2-like ...    288   6e-96   Cucumis sativus [cucumbers]
ref|NP_001046386.1|  Os02g0235600                                       288   6e-96   
ref|XP_006285819.1|  hypothetical protein CARUB_v10007309mg             288   6e-96   Capsella rubella
pir||T04865  ribosomal protein L11, cytosolic - Arabidopsis thaliana    288   6e-96
ref|XP_009116550.1|  PREDICTED: 60S ribosomal protein L11-1             288   6e-96   Brassica rapa
ref|XP_008362518.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    288   8e-96   
ref|XP_004133951.1|  PREDICTED: 60S ribosomal protein L11-2-like ...    288   1e-95   Cucumis sativus [cucumbers]
ref|XP_004976770.1|  PREDICTED: 60S ribosomal protein L11-like          287   1e-95   Setaria italica
ref|XP_009365285.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    287   1e-95   Pyrus x bretschneideri [bai li]
ref|NP_001132427.1|  60S ribosomal protein L11-1                        287   1e-95   Zea mays [maize]
ref|XP_008343091.1|  PREDICTED: 60S ribosomal protein L11-like is...    287   1e-95   
ref|NP_001148395.1|  LOC100282010                                       287   1e-95   Zea mays [maize]
ref|XP_006578416.1|  PREDICTED: 60S ribosomal protein L11-like          287   1e-95   
ref|XP_010689742.1|  PREDICTED: 60S ribosomal protein L11-1 isofo...    287   1e-95   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001131414.1|  uncharacterized protein LOC100192743               287   2e-95   Zea mays [maize]
ref|XP_007214493.1|  hypothetical protein PRUPE_ppa020372mg             290   2e-95   
gb|ABK93207.1|  unknown                                                 286   2e-95   Populus trichocarpa [western balsam poplar]
gb|ACG31637.1|  60S ribosomal protein L11-1                             286   3e-95   Zea mays [maize]
ref|XP_002454974.1|  hypothetical protein SORBIDRAFT_03g002420          286   3e-95   
ref|XP_006654147.1|  PREDICTED: 60S ribosomal protein L11-like          286   3e-95   Oryza brachyantha
gb|KHG13747.1|  60S ribosomal L11-1 -like protein                       286   5e-95   Gossypium arboreum [tree cotton]
ref|XP_010102117.1|  60S ribosomal protein L11-2                        286   5e-95   
ref|XP_008362517.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    285   6e-95   
ref|XP_004968572.1|  PREDICTED: 60S ribosomal protein L11-like          285   7e-95   Setaria italica
ref|XP_006643887.1|  PREDICTED: 60S ribosomal protein L11-like          285   9e-95   Oryza brachyantha
ref|XP_010689741.1|  PREDICTED: 60S ribosomal protein L11-1 isofo...    285   1e-94   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001054899.1|  Os05g0207300                                       285   1e-94   
ref|XP_001759707.1|  predicted protein                                  285   1e-94   
ref|XP_008790022.1|  PREDICTED: 60S ribosomal protein L11-like          285   1e-94   Phoenix dactylifera
gb|ADY38658.1|  putative 60S ribosomal protein L11                      284   2e-94   Wolffia arrhiza
ref|NP_001042339.1|  Os01g0205500                                       284   2e-94   
ref|XP_010940061.1|  PREDICTED: 60S ribosomal protein L11-like          284   2e-94   Elaeis guineensis
gb|AAT08727.1|  60S ribosomal protein L11                               284   3e-94   Hyacinthus orientalis [common hyacinth]
ref|XP_001762314.1|  predicted protein                                  283   5e-94   
ref|XP_008795915.1|  PREDICTED: 60S ribosomal protein L11-like          282   8e-94   Phoenix dactylifera
ref|XP_001760204.1|  predicted protein                                  281   2e-93   
ref|XP_006648487.1|  PREDICTED: 60S ribosomal protein L11-like          281   3e-93   Oryza brachyantha
ref|XP_002270266.1|  PREDICTED: 60S ribosomal protein L11-1-like        280   5e-93   Vitis vinifera
gb|KHG21292.1|  60S ribosomal protein L11-1                             281   2e-92   Gossypium arboreum [tree cotton]
gb|KHG21293.1|  60S ribosomal protein L11-1                             278   5e-92   Gossypium arboreum [tree cotton]
gb|KHN20558.1|  Endoglucanase 9                                         291   3e-91   Glycine soja [wild soybean]
ref|XP_003565263.1|  PREDICTED: 60S ribosomal protein L11               276   4e-91   Brachypodium distachyon [annual false brome]
gb|EMS61347.1|  60S ribosomal protein L11                               275   7e-91   Triticum urartu
gb|KHN11195.1|  60S ribosomal protein L11                               274   1e-90   Glycine soja [wild soybean]
emb|CDY60533.1|  BnaAnng16950D                                          273   3e-90   Brassica napus [oilseed rape]
emb|CDY62552.1|  BnaA03g58370D                                          273   3e-90   Brassica napus [oilseed rape]
dbj|BAJ85332.1|  predicted protein                                      273   4e-90   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACN35575.1|  unknown                                                 273   5e-90   Zea mays [maize]
pdb|3J61|J  Chain J, Localization Of The Large Subunit Ribosomal ...    272   7e-90   Triticum aestivum [Canadian hard winter wheat]
gb|ABR25412.1|  60S ribosomal protein l11                               271   1e-89   Oryza sativa Indica Group [Indian rice]
ref|XP_010516520.1|  PREDICTED: 60S ribosomal protein L11-1-like        271   1e-89   Camelina sativa [gold-of-pleasure]
gb|ACD56663.1|  putative ribosomal protein                              271   1e-89   Gossypium arboreum [tree cotton]
ref|NP_851137.1|  60S ribosomal protein L11-2                           271   2e-89   Arabidopsis thaliana [mouse-ear cress]
gb|AAT64021.1|  putative ribosomal protein                              271   2e-89   Gossypium hirsutum [American cotton]
gb|KJB34908.1|  hypothetical protein B456_006G089700                    271   2e-89   Gossypium raimondii
ref|XP_007048734.1|  Ribosomal L5P family protein isoform 2             271   2e-89   Theobroma cacao [chocolate]
emb|CBI22012.3|  unnamed protein product                                270   3e-89   Vitis vinifera
ref|XP_002981065.1|  hypothetical protein SELMODRAFT_444767             269   1e-88   Selaginella moellendorffii
ref|XP_001751962.1|  predicted protein                                  269   1e-88   
tpg|DAA52967.1|  TPA: hypothetical protein ZEAMMB73_694767              287   2e-88   
ref|XP_006656151.1|  PREDICTED: 60S ribosomal protein L11-like          268   2e-88   
gb|EMS66091.1|  60S ribosomal protein L11                               270   2e-88   Triticum urartu
gb|ADR71243.1|  60S ribosomal protein L11A                              267   5e-88   Hevea brasiliensis [jebe]
emb|CDP15952.1|  unnamed protein product                                267   8e-88   Coffea canephora [robusta coffee]
ref|XP_002438544.1|  hypothetical protein SORBIDRAFT_10g021710          266   3e-87   
gb|AAB82139.1|  ribosomal protein                                       266   3e-87   Oryza sativa Indica Group [Indian rice]
emb|CBI30709.3|  unnamed protein product                                263   3e-86   Vitis vinifera
gb|AAD21733.1|  60S ribosomal protein L11B                              261   2e-85   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD53703.1|  putative 60S ribosomal protein L11-1                   260   7e-85   Oryza sativa Japonica Group [Japonica rice]
gb|AAQ96376.1|  ribosomal protein L11-like protein                      257   4e-84   Solanum palustre
gb|KHN28096.1|  60S ribosomal protein L11                               257   5e-84   Glycine soja [wild soybean]
gb|KDD76069.1|  hypothetical protein H632_c370p1                        253   4e-82   Helicosporidium sp. ATCC 50920
ref|XP_011397124.1|  60S ribosomal protein L11-1                        251   2e-81   Auxenochlorella protothecoides
ref|XP_009617442.1|  PREDICTED: 60S ribosomal protein L11-1-like        249   7e-81   Nicotiana tomentosiformis
emb|CBJ30107.1|  conserved unknown protein                              247   7e-80   Ectocarpus siliculosus
gb|KIY97763.1|  60S ribosomal protein L11                               245   4e-79   Monoraphidium neglectum
ref|XP_005647682.1|  ribosomal protein L5                               244   1e-78   Coccomyxa subellipsoidea C-169
tpe|CAL69062.1|  TPA: putative 60S ribosomal protein L11                241   5e-77   Spadella cephaloptera
gb|KJB57390.1|  hypothetical protein B456_009G161300                    238   8e-77   Gossypium raimondii
gb|AFW65989.1|  hypothetical protein ZEAMMB73_747842                    236   2e-76   
ref|XP_010244733.1|  PREDICTED: 60S ribosomal protein L11-1-like        238   2e-76   Nelumbo nucifera [Indian lotus]
ref|XP_003628238.1|  60S ribosomal protein L11                          235   5e-76   
gb|KHN95345.1|  60S ribosomal protein L11                               236   1e-75   Metarhizium album ARSEF 1941
ref|XP_009261766.1|  hypothetical protein FPSE_10374                    236   1e-75   Fusarium pseudograminearum CS3096
gb|AIU94837.1|  60S ribosomal protein                                   236   2e-75   Phragmatopoma lapidosa
gb|EGU80777.1|  hypothetical protein FOXB_08644                         236   2e-75   Fusarium oxysporum Fo5176
gb|ACN26136.1|  unknown                                                 235   2e-75   Zea mays [maize]
gb|EQL04255.1|  Ribosomal protein L5                                    235   2e-75   Ophiocordyceps sinensis CO18
ref|XP_007811586.1|  60S ribosomal protein L11                          235   2e-75   Metarhizium acridum CQMa 102
gb|KDB13460.1|  60S ribosomal protein L11                               235   2e-75   Ustilaginoidea virens
emb|CCE35354.1|  probable ribosomal protein L11.e.A, cytosolic          235   3e-75   Claviceps purpurea 20.1
emb|CEF97266.1|  Ribosomal protein L5, conserved site                   234   5e-75   Ostreococcus tauri
emb|CCI45988.1|  unnamed protein product                                234   6e-75   Albugo candida
gb|EPX72141.1|  60S ribosomal protein L11                               234   6e-75   Schizosaccharomyces octosporus yFS286
gb|KID77365.1|  Ribosomal protein L5                                    234   7e-75   Metarhizium brunneum ARSEF 3297
gb|KFA66324.1|  hypothetical protein S40285_01884                       234   8e-75   Stachybotrys chlorohalonata IBT 40285
emb|CCE35372.1|  probable ribosomal protein L11.e.A, cytosolic          234   9e-75   Claviceps purpurea 20.1
ref|XP_007874680.1|  hypothetical protein PNEG_02659                    234   1e-74   Pneumocystis murina B123
gb|EPY52057.1|  60S ribosomal protein L11                               233   1e-74   Schizosaccharomyces cryophilus OY26
gb|KFA73465.1|  hypothetical protein S40288_08466                       233   1e-74   Stachybotrys chartarum IBT 40288
gb|EPY49528.1|  60S ribosomal protein L11                               233   1e-74   Schizosaccharomyces cryophilus OY26
ref|XP_006963013.1|  60S ribosomal protein L11, L5 family               233   2e-74   Trichoderma reesei QM6a
gb|KIL95260.1|  hypothetical protein FAVG1_02195                        233   2e-74   Fusarium avenaceum
gb|AFW81632.1|  hypothetical protein ZEAMMB73_719378                    231   2e-74   
ref|XP_006697554.1|  putative ribosomal protein                         233   2e-74   Chaetomium thermophilum var. thermophilum DSM 1495
gb|KEY71076.1|  hypothetical protein S7711_00899                        233   2e-74   Stachybotrys chartarum IBT 7711
emb|CDS05445.1|  Putative 60S ribosomal protein L11                     233   3e-74   Lichtheimia ramosa
ref|XP_003054198.1|  60S ribosomal protein L11                          233   3e-74   [Nectria] haematococca mpVI 77-13-4
emb|CDH52194.1|  60s ribosomal protein l11                              233   3e-74   Lichtheimia corymbifera JMRC:FSU:9682
gb|EHK50062.1|  hypothetical protein TRIATDRAFT_297405                  232   3e-74   Trichoderma atroviride IMI 206040
gb|EHK17585.1|  hypothetical protein TRIVIDRAFT_76021                   232   4e-74   Trichoderma virens Gv29-8
gb|ELW68491.1|  60S ribosomal protein L11                               233   5e-74   Tupaia chinensis
gb|KCW89659.1|  hypothetical protein EUGRSUZ_A01929                     231   5e-74   Eucalyptus grandis [rose gum]
ref|XP_001939101.1|  60S ribosomal protein L11                          232   5e-74   Pyrenophora tritici-repentis Pt-1C-BFP
gb|KFM71516.1|  60S ribosomal protein L11                               233   5e-74   Stegodyphus mimosarum
ref|XP_003302643.1|  60S ribosomal protein L11                          232   5e-74   
ref|XP_003598138.1|  60S ribosomal protein L11-1                        234   5e-74   Medicago truncatula
ref|XP_008782473.1|  PREDICTED: 60S ribosomal protein L11-1 isofo...    230   5e-74   
ref|XP_005988804.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    232   5e-74   Latimeria chalumnae
ref|XP_001794114.1|  hypothetical protein SNOG_03556                    232   5e-74   Parastagonospora nodorum SN15
tpg|DAA52965.1|  TPA: hypothetical protein ZEAMMB73_694767              230   6e-74   
ref|XP_008593474.1|  60S ribosomal protein L11                          232   6e-74   Beauveria bassiana ARSEF 2860
ref|NP_595899.1|  60S ribosomal protein L11                             232   6e-74   Schizosaccharomyces pombe
ref|XP_004678660.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    231   7e-74   
ref|XP_965640.2|  60S ribosomal protein L11                             231   7e-74   Neurospora crassa OR74A
ref|XP_004603489.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    231   7e-74   Sorex araneus [Eurasian shrew]
emb|CCF73368.1|  unnamed protein product                                231   8e-74   Babesia microti strain RI
emb|CDH51840.1|  60s ribosomal protein l11                              231   1e-73   Lichtheimia corymbifera JMRC:FSU:9682
emb|CDX98322.1|  BnaC06g16830D                                          230   1e-73   
ref|XP_006179217.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    231   1e-73   
ref|XP_679576.1|  60S ribosomal protein L11a                            231   1e-73   Plasmodium berghei ANKA
gb|AAX42399.1|  ribosomal protein L11                                   231   1e-73   synthetic construct
emb|CDS03126.1|  Putative 60S ribosomal protein L11                     231   1e-73   Lichtheimia ramosa
ref|XP_001607270.1|  PREDICTED: 60S ribosomal protein L11               231   1e-73   Nasonia vitripennis
ref|XP_007785480.1|  60S ribosomal protein L11                          231   1e-73   Endocarpon pusillum Z07020
gb|AAX29834.1|  ribosomal protein L11                                   231   1e-73   synthetic construct
ref|XP_004220956.1|  60S ribosomal protein L11                          231   1e-73   Plasmodium cynomolgi strain B
ref|NP_001186731.1|  60S ribosomal protein L11 isoform 2                231   1e-73   Homo sapiens [man]
ref|XP_007702064.1|  hypothetical protein COCSADRAFT_28532              231   1e-73   Bipolaris sorokiniana ND90Pr
ref|XP_006862372.1|  PREDICTED: 60S ribosomal protein L11               231   2e-73   Chrysochloris asiatica
ref|XP_003833556.1|  similar to 60s ribosomal protein l11               231   2e-73   Leptosphaeria maculans JN3
gb|AGM32143.1|  60S ribosomal protein L11                               231   2e-73   Coptotermes formosanus
ref|XP_005955884.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    230   2e-73   Pantholops hodgsonii [Tibetan antelope]
ref|XP_007400955.1|  hypothetical protein PHACADRAFT_264100             230   2e-73   Phanerochaete carnosa HHB-10118-sp
ref|XP_007688169.1|  hypothetical protein COCMIDRAFT_5484               230   2e-73   Bipolaris oryzae ATCC 44560
gb|KEZ44553.1|  hypothetical protein SAPIO_CDS3581                      230   2e-73   Scedosporium apiospermum
gb|KIW01718.1|  60S ribosomal protein L11                               230   3e-73   Verruconis gallopava
ref|XP_007406729.1|  hypothetical protein MELLADRAFT_103715             231   3e-73   Melampsora larici-populina 98AG31
ref|NP_001016640.1|  ribosomal protein L11                              230   3e-73   Xenopus tropicalis [western clawed frog]
ref|XP_003652525.1|  60S ribosomal protein L11                          230   3e-73   Thielavia terrestris NRRL 8126
ref|XP_008625536.1|  60S ribosomal protein L11                          230   3e-73   Plasmodium vinckei vinckei
ref|NP_001002139.1|  60S ribosomal protein L11                          230   3e-73   Danio rerio [leopard danio]
gb|EAY96929.1|  hypothetical protein OsI_18847                          228   3e-73   Oryza sativa Indica Group [Indian rice]
emb|CEG66561.1|  Putative 60S ribosomal protein L11                     230   3e-73   Rhizopus microsporus
ref|XP_001612822.1|  60S ribosomal protein L11                          229   4e-73   Plasmodium vivax
emb|CEI93245.1|  Putative 60S ribosomal protein L11                     230   4e-73   Rhizopus microsporus
gb|KIN04023.1|  hypothetical protein OIDMADRAFT_51953                   229   4e-73   Oidiodendron maius Zn
ref|XP_008031258.1|  hypothetical protein SETTUDRAFT_35885              229   4e-73   Exserohilum turcica Et28A
gb|KHJ31708.1|  putative 60s ribosomal protein l11                      229   4e-73   Erysiphe necator
ref|XP_003351085.1|  60S ribosomal protein L11                          229   5e-73   Sordaria macrospora k-hell
ref|NP_001087287.1|  ribosomal protein L11                              229   5e-73   Xenopus laevis [clawed frog]
ref|XP_002364229.1|  ribosomal protein L11, putative                    229   6e-73   Toxoplasma gondii ME49
gb|AAX11430.1|  cell growth-inhibiting protein 34                       229   6e-73   Homo sapiens [man]
ref|XP_007511979.1|  60S ribosomal protein L11                          229   6e-73   Bathycoccus prasinos
ref|XP_008912007.1|  60S ribosomal protein L11                          229   6e-73   Phytophthora parasitica INRA-310
emb|CAL00699.1|  unnamed protein product                                229   7e-73   Aspergillus niger
ref|XP_005941012.1|  PREDICTED: 60S ribosomal protein L11-like is...    229   8e-73   
ref|XP_003227609.1|  PREDICTED: 60S ribosomal protein L11               229   8e-73   Anolis carolinensis [Carolina anole]
gb|EJW85444.1|  60S ribosomal protein L11                               229   8e-73   Wuchereria bancrofti [agent of lymphatic filariasis]
ref|XP_005905227.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    229   8e-73   Bos mutus
ref|XP_001892371.1|  60S ribosomal protein L11                          229   8e-73   Brugia malayi [agent of lymphatic filariasis]
ref|XP_002171744.1|  60S ribosomal protein L11                          229   9e-73   
ref|XP_001401580.2|  60S ribosomal protein L11                          229   9e-73   
ref|XP_002173490.1|  60S ribosomal protein L11                          229   9e-73   
gb|EXX73498.1|  ribosomal 60S subunit protein L11B                      229   9e-73   
ref|XP_003138893.1|  60S ribosomal protein L11                          229   9e-73   
ref|XP_005203175.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    229   9e-73   
ref|XP_007828704.1|  60S ribosomal protein L11                          229   9e-73   
ref|XP_007175169.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    229   1e-72   
ref|XP_002261116.1|  60S ribosomal protein L11a                         228   1e-72   
ref|XP_006671375.1|  60S ribosomal protein L11                          228   1e-72   
ref|XP_006268033.1|  PREDICTED: 60S ribosomal protein L11               229   1e-72   
gb|KFD51459.1|  hypothetical protein M513_07672                         229   1e-72   
ref|XP_002507327.1|  ribosomal protein L11                              228   1e-72   
emb|CEG73597.1|  Putative 60S ribosomal protein L11                     229   1e-72   
ref|XP_005875279.1|  PREDICTED: LOW QUALITY PROTEIN: ribosomal pr...    228   1e-72   
emb|CEI94092.1|  Putative 60S ribosomal protein L11                     229   1e-72   
ref|XP_004678659.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    228   1e-72   
emb|CEJ04024.1|  Putative 60S ribosomal protein L11                     228   1e-72   
ref|XP_007864974.1|  ribosomal protein L5                               228   1e-72   
gb|AAO31779.1|  ribosomal protein L11                                   229   1e-72   
ref|XP_004425775.1|  PREDICTED: 60S ribosomal protein L11 isoform 1     229   1e-72   
ref|XP_003884996.1|  hypothetical protein NCLIV_053950                  228   1e-72   
gb|ABR27976.1|  ribosomal protein L11                                   229   1e-72   
ref|XP_005988803.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    229   1e-72   
ref|XP_003458587.1|  PREDICTED: 60S ribosomal protein L11-like          228   1e-72   
gb|AFM86389.1|  ribosomal protein L11                                   228   1e-72   
ref|XP_002184288.1|  predicted protein                                  228   1e-72   
ref|XP_003293531.1|  ribosomal protein L11                              229   1e-72   
gb|KEQ63433.1|  ribosomal protein L5                                    228   1e-72   
ref|XP_006179216.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    228   1e-72   
gb|EKG14783.1|  Ribosomal protein L5                                    228   2e-72   
ref|XP_007780322.1|  60S ribosomal protein L11                          229   2e-72   
gb|KHJ43623.1|  ribosomal protein L5                                    229   2e-72   
ref|XP_005802897.1|  PREDICTED: 60S ribosomal protein L11-like          228   2e-72   
ref|XP_004603488.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    228   2e-72   
ref|XP_003712966.1|  60S ribosomal protein L11                          228   2e-72   
ref|XP_002741821.1|  PREDICTED: 60S ribosomal protein L11-like          228   2e-72   
ref|XP_010362433.1|  PREDICTED: 60S ribosomal protein L11-like          228   2e-72   
gb|EHL03348.1|  putative 60S ribosomal protein L11                      228   2e-72   
ref|XP_010898594.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    228   2e-72   
ref|XP_006882367.1|  PREDICTED: 60S ribosomal protein L11-like          228   2e-72   
ref|NP_001001638.1|  60S ribosomal protein L11                          228   2e-72   
ref|XP_005353082.1|  PREDICTED: 60S ribosomal protein L11               228   2e-72   
ref|NP_080195.1|  60S ribosomal protein L11                             228   2e-72   
ref|XP_008329249.1|  PREDICTED: 60S ribosomal protein L11               228   2e-72   
ref|XP_003659072.1|  hypothetical protein MYCTH_2075489                 228   2e-72   
gb|AFK10889.1|  ribosomal protein L11                                   228   2e-72   
gb|ADV17698.1|  60S ribosomal protein L11                               228   2e-72   
ref|XP_003968865.1|  PREDICTED: 60S ribosomal protein L11-like          228   2e-72   
gb|ABW06869.1|  ribosomal protein L11                                   228   2e-72   
gb|KFV54375.1|  60S ribosomal protein L11                               228   2e-72   
gb|AGH15796.1|  Rpl11 protein                                           228   2e-72   
ref|XP_003320143.2|  60S ribosomal protein L11                          228   2e-72   
ref|XP_007083757.1|  PREDICTED: 60S ribosomal protein L11               229   2e-72   
gb|KFP68695.1|  60S ribosomal protein L11                               228   2e-72   
ref|XP_006924507.1|  PREDICTED: 60S ribosomal protein L11               228   2e-72   
ref|XP_008291103.1|  PREDICTED: 60S ribosomal protein L11               228   2e-72   
gb|KIW72643.1|  60S ribosomal protein L11                               228   2e-72   
ref|XP_004783520.1|  PREDICTED: 60S ribosomal protein L11               228   2e-72   
gb|KFW09507.1|  60S ribosomal protein L11                               228   2e-72   
ref|XP_010347552.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    228   2e-72   
ref|XP_006078004.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    228   2e-72   
ref|XP_005617268.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    228   2e-72   
ref|XP_007720703.1|  60S ribosomal protein L11                          228   2e-72   
ref|XP_006980890.1|  PREDICTED: 60S ribosomal protein L11               228   2e-72   
gb|AAL99919.1|AF432212_1  CLL-associated antigen KW-12                  228   2e-72   
ref|NP_001125385.1|  60S ribosomal protein L11                          228   2e-72   
gb|EFB27138.1|  hypothetical protein PANDA_001098                       228   2e-72   
gb|ACH85327.1|  ribosomal protein L11                                   228   2e-72   
gb|ACI69075.1|  60S ribosomal protein L11                               228   2e-72   
ref|XP_006539175.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    228   2e-72   
ref|XP_010743989.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    228   3e-72   
gb|EMC79466.1|  60S ribosomal protein L11                               228   3e-72   
gb|KFO60189.1|  60S ribosomal protein L11                               228   3e-72   
gb|EMF09861.1|  60S ribosomal protein L11                               228   3e-72   
ref|XP_008083348.1|  Ribosomal protein L5                               228   3e-72   
ref|XP_006019455.1|  PREDICTED: 60S ribosomal protein L11               228   3e-72   
ref|XP_001553621.1|  60S ribosomal protein L11                          228   3e-72   
ref|NP_001279972.1|  ribosomal protein L11                              228   3e-72   
emb|CEJ90763.1|  Putative 60S ribosomal protein L11                     227   3e-72   
gb|KFU91853.1|  60S ribosomal protein L11                               227   3e-72   
emb|CDS14192.1|  Putative 60S ribosomal protein L11                     228   3e-72   
ref|XP_002485190.1|  60S ribosomal protein L11                          228   3e-72   
ref|XP_005302146.1|  PREDICTED: 60S ribosomal protein L11               228   3e-72   
ref|XP_004893894.1|  PREDICTED: 60S ribosomal protein L11 isoform X3    228   3e-72   
ref|XP_006737644.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    228   3e-72   
ref|XP_008692837.1|  PREDICTED: 60S ribosomal protein L11               228   3e-72   
ref|XP_004893893.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    228   3e-72   
ref|XP_007068087.1|  PREDICTED: 60S ribosomal protein L11               227   3e-72   
ref|XP_003850717.1|  60S ribosomal protein L11                          227   3e-72   
ref|XP_008421109.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    228   3e-72   
ref|XP_008518978.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    228   3e-72   
ref|XP_005955883.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    227   3e-72   
ref|XP_662079.1|  hypothetical protein AN4475.2                         227   4e-72   
ref|XP_011403972.1|  PREDICTED: 60S ribosomal protein L11-like is...    228   4e-72   
gb|KIJ20995.1|  hypothetical protein PAXINDRAFT_165800                  227   4e-72   
ref|XP_003033464.1|  60S ribosomal protein L11                          227   4e-72   
gb|AAN73370.1|  ribosomal protein L11                                   227   4e-72   
gb|KFV16259.1|  60S ribosomal protein L11                               227   4e-72   
ref|XP_003054830.1|  predicted protein                                  227   4e-72   
ref|XP_003382768.1|  PREDICTED: 60S ribosomal protein L11-like is...    228   4e-72   
ref|NP_001292117.1|  60S ribosomal protein L11                          227   4e-72   
ref|XP_004357945.1|  S60 ribosomal protein L11                          228   4e-72   
gb|AAL09706.1|AF420431_1  ribosomal protein L11                         227   4e-72   
gb|KFV77896.1|  60S ribosomal protein L11                               227   4e-72   
gb|KFO76848.1|  60S ribosomal protein L11                               227   4e-72   
ref|XP_009560105.1|  PREDICTED: 60S ribosomal protein L11               227   4e-72   
ref|NP_477054.1|  ribosomal protein L11, isoform A                      227   4e-72   
ref|XP_007290432.1|  60S ribosomal protein L11                          227   4e-72   
gb|KFQ51368.1|  60S ribosomal protein L11                               227   4e-72   
ref|XP_004893892.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    228   4e-72   
gb|EPQ65884.1|  Protein component of the large (60S) ribosomal su...    227   4e-72   
ref|XP_006130554.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    228   5e-72   
ref|XP_005107086.1|  PREDICTED: 60S ribosomal protein L11-like          227   5e-72   
gb|KEQ70785.1|  60S ribosomal protein L11                               228   5e-72   
gb|KFO04838.1|  60S ribosomal protein L11                               227   5e-72   
gb|KFM05522.1|  60S ribosomal protein L11                               227   5e-72   
ref|XP_004074127.1|  PREDICTED: 60S ribosomal protein L11               227   5e-72   
gb|KEQ81180.1|  60S ribosomal protein L11                               227   5e-72   
gb|ESA11406.1|  hypothetical protein GLOINDRAFT_190897                  226   6e-72   
ref|NP_001187040.1|  60S ribosomal protein L11                          227   6e-72   
gb|KFZ56809.1|  60S ribosomal protein L11                               227   6e-72   
gb|KDN52293.1|  putative RPL11B-ribosomal protein L11                   227   6e-72   
ref|XP_001349097.1|  60S ribosomal protein L11a, putative               226   6e-72   
gb|EDL11957.1|  mCG11809                                                227   6e-72   
ref|XP_008722843.1|  60S ribosomal protein L11                          227   6e-72   
ref|XP_007245775.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    227   6e-72   
dbj|GAM29212.1|  hypothetical protein SAMD00019534_123880               228   6e-72   
gb|AFM88490.1|  ribosomal protein L11                                   226   6e-72   
dbj|GAM83435.1|  hypothetical protein ANO11243_014230                   226   7e-72   
ref|XP_007430577.1|  PREDICTED: 60S ribosomal protein L11               227   7e-72   
emb|CDW52299.1|  60S ribosomal protein L11                              227   7e-72   
ref|XP_001512081.1|  PREDICTED: 60S ribosomal protein L11               226   7e-72   
gb|KDR12481.1|  60S ribosomal protein L11                               227   7e-72   
gb|KIK82563.1|  hypothetical protein PAXRUDRAFT_710603                  226   7e-72   
ref|XP_004572770.1|  PREDICTED: 60S ribosomal protein L11-like is...    227   7e-72   
ref|XP_007917396.1|  putative 60s ribosomal protein l11 protein         226   7e-72   
ref|XP_004347799.1|  60S ribosomal protein L11                          227   7e-72   
ref|XP_009152279.1|  60S ribosomal protein L11                          226   8e-72   
ref|XP_002063810.1|  GK15870                                            227   8e-72   
ref|XP_004572769.1|  PREDICTED: 60S ribosomal protein L11-like is...    228   8e-72   
ref|XP_003764935.1|  PREDICTED: 60S ribosomal protein L11               226   8e-72   
gb|ACO57590.1|  60S ribosomal protein L11                               226   8e-72   
ref|XP_002005901.1|  GI18837                                            227   9e-72   
gb|ACI12869.1|  60S ribosomal protein L11                               226   9e-72   
emb|CAH57695.1|  60S ribosomal protein L11                              226   9e-72   
gb|ABV44749.1|  60S ribosomal protein L11-like protein                  228   9e-72   
ref|XP_002049941.1|  GJ21865                                            226   9e-72   
ref|XP_001239964.1|  60S ribosomal protein L11                          226   1e-71   
ref|XP_500914.2|  60S ribosomal protein L11                             226   1e-71   
ref|NP_001158637.1|  60S ribosomal protein L11                          226   1e-71   
gb|ABR23487.1|  60S ribosomal protein L11                               226   1e-71   
gb|KDQ61798.1|  hypothetical protein JAAARDRAFT_150757                  226   1e-71   
ref|XP_001586298.1|  60S ribosomal protein L11                          226   1e-71   
ref|XP_765879.1|  60S ribosomal protein L11a                            226   1e-71   
ref|XP_002148988.1|  60S ribosomal protein L11                          226   1e-71   
emb|CEP61537.1|  LALA0S03e05072g1_1                                     226   1e-71   
gb|AAV90722.1|  60S ribosomal protein L11                               226   1e-71   
ref|XP_001913063.1|  hypothetical protein                               226   1e-71   
ref|XP_007854285.1|  60s ribosomal protein l11                          226   1e-71   
gb|KIX00150.1|  60S ribosomal protein L11                               226   1e-71   
dbj|GAD96427.1|  60S ribosomal protein L11                              226   1e-71   
ref|XP_005905226.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    226   1e-71   
ref|XP_007753389.1|  60S ribosomal protein L11                          226   1e-71   
gb|EYE94898.1|  60S ribosomal protein L11                               226   1e-71   
ref|XP_954382.1|  60S ribosomal protein l11a                            226   1e-71   
dbj|GAA95328.1|  hypothetical protein E5Q_01985                         226   1e-71   
ref|XP_007929171.1|  hypothetical protein MYCFIDRAFT_211970             226   1e-71   
gb|AGH70158.1|  60S ribosomal protein L11                               226   1e-71   
dbj|GAM40478.1|  60S ribosomal protein                                  226   1e-71   
ref|XP_009689157.1|  60S ribosomal protein L11a                         225   2e-71   
gb|ELR49451.1|  60S ribosomal protein L11                               226   2e-71   
ref|XP_008868808.1|  60S ribosomal protein L11                          226   2e-71   
ref|XP_009840198.1|  60S ribosomal protein L11                          226   2e-71   
gb|EAS28381.3|  60S ribosomal protein L11                               228   2e-71   
ref|XP_010955668.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    229   2e-71   
gb|AAS49550.1|  ribosomal protein L11                                   225   2e-71   
ref|XP_011330111.1|  PREDICTED: 60S ribosomal protein L11               226   2e-71   
gb|KFP31127.1|  60S ribosomal protein L11                               226   2e-71   
emb|CCX16540.1|  Similar to 60S ribosomal protein L11; acc. no. Q...    226   2e-71   
ref|NP_508413.1|  Protein RPL-11.2                                      226   2e-71   
ref|XP_007593026.1|  ribosomal L5P family protein                       225   2e-71   
gb|EME39538.1|  hypothetical protein DOTSEDRAFT_75263                   226   2e-71   
ref|XP_004227163.1|  PREDICTED: 60S ribosomal protein L11-like          226   2e-71   
ref|XP_010779161.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    225   2e-71   
dbj|BAO38797.1|  60S ribosomal protein L11                              225   2e-71   
gb|KEQ91782.1|  hypothetical protein AUEXF2481DRAFT_452160              226   2e-71   
gb|EPS30697.1|  hypothetical protein PDE_05649                          225   2e-71   
ref|XP_003645143.1|  hypothetical protein Ecym_2613                     225   2e-71   
emb|CCF38017.1|  60S ribosomal protein L11                              225   2e-71   
ref|XP_006882778.1|  PREDICTED: 60S ribosomal protein L11-like          225   2e-71   
gb|EYB99416.1|  hypothetical protein Y032_0122g1039                     226   2e-71   
emb|CCJ29398.1|  unnamed protein product                                226   2e-71   
ref|XP_010779152.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    225   2e-71   
gb|ADO28174.1|  60S ribosomal protein l11                               225   2e-71   
dbj|BAB29059.1|  unnamed protein product                                225   3e-71   
gb|EYB99481.1|  hypothetical protein Y032_0122g1072                     226   3e-71   
gb|AHA44486.1|  60S ribosomal-like protein                              226   3e-71   
ref|XP_010387110.1|  PREDICTED: 60S ribosomal protein L11-like          225   3e-71   
ref|XP_001540391.1|  60S ribosomal protein L11                          226   3e-71   
ref|XP_002554669.1|  KLTH0F10758p                                       229   3e-71   
gb|ABF18126.1|  60S ribosomal protein L11                               226   3e-71   
gb|KIP07125.1|  hypothetical protein PHLGIDRAFT_89957                   225   3e-71   
ref|XP_004829904.1|  60S ribosomal protein L11, putative                225   3e-71   
gb|AAF13719.1|AF201080_1  ribosomal protein L11                         224   3e-71   
ref|XP_002471021.1|  60S ribosomal protein L11                          225   3e-71   
gb|AFM86678.1|  ribosomal protein L11                                   225   3e-71   
gb|ELU08984.1|  hypothetical protein CAPTEDRAFT_228073                  225   3e-71   
ref|XP_007736757.1|  60S ribosomal protein L11                          225   3e-71   
gb|EEH10656.1|  60S ribosomal protein L11                               224   3e-71   
ref|XP_002289769.1|  RL11A, ribosomal protein 11A 60S large ribos...    225   3e-71   
gb|KIL69083.1|  hypothetical protein M378DRAFT_157314                   225   3e-71   
gb|EPT02960.1|  hypothetical protein FOMPIDRAFT_1159520                 225   3e-71   
gb|ESZ98896.1|  60S ribosomal protein L11                               224   3e-71   
gb|KIH67504.1|  ribosomal protein L5                                    225   4e-71   
gb|EWC43909.1|  60S ribosomal protein L11                               224   4e-71   
gb|ADV03047.1|  ribosomal protein L11                                   224   4e-71   
gb|ADV03013.1|  ribosomal protein L11                                   224   4e-71   
emb|CDH53106.1|  60s ribosomal protein l11                              224   4e-71   
emb|CDI54801.1|  probable RPL11B-ribosomal protein L11                  224   4e-71   
ref|XP_001663129.1|  AAEL012944-PB                                      225   4e-71   



>ref|XP_009138940.1| PREDICTED: 60S ribosomal protein L11-1-like [Brassica rapa]
 emb|CDX88999.1| BnaA04g01870D [Brassica napus]
Length=217

 Score =   297 bits (760),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 163/188 (87%), Positives = 170/188 (90%), Gaps = 8/188 (4%)
 Frame = +1

Query  4    YQFTSRFPSLPAVSPSPR-------QPKA-MASEKKLNNPMREIKVQKLVLNISVGESGD  159
            Y F  RF +L   S   R       QP++ MASEKKL+NPMR+IKVQKLVLNISVGESGD
Sbjct  6    YIFCCRFFALSFASSFNRSSAGVFSQPESQMASEKKLSNPMRDIKVQKLVLNISVGESGD  65

Query  160  RLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLEVKE  339
            RLTRA+KVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGL+VKE
Sbjct  66   RLTRASKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLKVKE  125

Query  340  YELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERPGYrvarrrrckarv  519
            YELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERPGYRVARRRRCKARV
Sbjct  126  YELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERPGYRVARRRRCKARV  185

Query  520  GIQHRVTK  543
            GIQHRVTK
Sbjct  186  GIQHRVTK  193



>gb|KDP21119.1| hypothetical protein JCGZ_21590 [Jatropha curcas]
Length=182

 Score =   295 bits (754),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 153/158 (97%), Positives = 157/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRV RRRRCK++VGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSKVGIQHRVTK  158



>ref|XP_002522234.1| 60S ribosomal protein L11, putative [Ricinus communis]
 gb|EEF40092.1| 60S ribosomal protein L11, putative [Ricinus communis]
Length=182

 Score =   294 bits (753),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 154/158 (97%), Positives = 157/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTK  158



>ref|NP_001266161.1| 60S ribosomal protein L11-like [Cicer arietinum]
 ref|XP_004510433.1| PREDICTED: 60S ribosomal protein L11-like [Cicer arietinum]
 ref|XP_004511177.1| PREDICTED: 60S ribosomal protein L11-like [Cicer arietinum]
 emb|CAD56220.1| ribosomal protein RL5 [Cicer arietinum]
Length=181

 Score =   294 bits (752),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 155/158 (98%), Positives = 157/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRV RRRRCKARVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKARVGIQHRVTK  158



>gb|EYU29260.1| hypothetical protein MIMGU_mgv1a014673mg [Erythranthe guttata]
 gb|EYU41114.1| hypothetical protein MIMGU_mgv1a014638mg [Erythranthe guttata]
Length=182

 Score =   294 bits (752),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 154/158 (97%), Positives = 157/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTK  158



>ref|XP_002510391.1| 60S ribosomal protein L11, putative [Ricinus communis]
 gb|EEF52578.1| 60S ribosomal protein L11, putative [Ricinus communis]
Length=182

 Score =   294 bits (752),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 154/158 (97%), Positives = 157/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTK  158



>ref|XP_010246451.1| PREDICTED: 60S ribosomal protein L11-like [Nelumbo nucifera]
Length=183

 Score =   294 bits (752),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 154/158 (97%), Positives = 158/158 (100%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRVARRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKSRVGIQHRVTK  158



>ref|XP_010274422.1| PREDICTED: 60S ribosomal protein L11 [Nelumbo nucifera]
Length=182

 Score =   293 bits (751),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 154/158 (97%), Positives = 158/158 (100%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRVARRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKSRVGIQHRVTK  158



>ref|XP_009383242.1| PREDICTED: 60S ribosomal protein L11 [Musa acuminata subsp. malaccensis]
Length=182

 Score =   293 bits (751),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 154/158 (97%), Positives = 157/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTK  158



>emb|CDX71934.1| BnaC08g29400D [Brassica napus]
Length=255

 Score =   296 bits (757),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 164/178 (92%), Gaps = 2/178 (1%)
 Frame = +1

Query  10   FTSRFPSLPAVSPSPRQPKAMASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLE  189
            F S FP    V   P     MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLE
Sbjct  56   FDSSFPFPAGVFSQPESQ--MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLE  113

Query  190  QLSGQTPVFSKARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSD  369
            QLSGQTPVFSKARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSD
Sbjct  114  QLSGQTPVFSKARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSD  173

Query  370  TGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            TGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTK
Sbjct  174  TGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTK  231



>ref|XP_009408897.1| PREDICTED: 60S ribosomal protein L11 [Musa acuminata subsp. malaccensis]
Length=182

 Score =   293 bits (750),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 153/158 (97%), Positives = 157/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLER GYRV+RRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERAGYRVSRRRRCKSRVGIQHRVTK  158



>ref|NP_001237077.1| uncharacterized protein LOC100499863 [Glycine max]
 ref|XP_003527577.1| PREDICTED: 60S ribosomal protein L11-like [Glycine max]
 ref|XP_006582268.1| PREDICTED: 60S ribosomal protein L11-like [Glycine max]
 ref|XP_006598073.1| PREDICTED: 60S ribosomal protein L11-like [Glycine max]
 gb|ACU13960.1| unknown [Glycine max]
 gb|ACU24606.1| unknown [Glycine max]
 gb|KHN27795.1| 60S ribosomal protein L11 [Glycine soja]
Length=181

 Score =   293 bits (749),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 153/158 (97%), Positives = 157/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTK  158



>ref|XP_004505457.1| PREDICTED: 60S ribosomal protein L11-like [Cicer arietinum]
Length=181

 Score =   293 bits (749),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 153/158 (97%), Positives = 157/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTK  158



>sp|P46287.1|RL11_MEDSA RecName: Full=60S ribosomal protein L11; AltName: Full=L5 [Medicago 
sativa]
 emb|CAA55090.1| RL5 ribosomal protein [Medicago sativa]
Length=181

 Score =   293 bits (749),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 154/158 (97%), Positives = 157/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDF+VVLERPGYRV RRRRCKARVGIQHRVTK
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKARVGIQHRVTK  158



>ref|XP_007132813.1| hypothetical protein PHAVU_011G126600g [Phaseolus vulgaris]
 gb|ESW04807.1| hypothetical protein PHAVU_011G126600g [Phaseolus vulgaris]
Length=181

 Score =   293 bits (749),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 153/158 (97%), Positives = 157/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTK  158



>ref|XP_006446820.1| hypothetical protein CICLE_v10016875mg [Citrus clementina]
 ref|XP_006468988.1| PREDICTED: 60S ribosomal protein L11-like [Citrus sinensis]
 gb|ESR60060.1| hypothetical protein CICLE_v10016875mg [Citrus clementina]
 gb|KDO63410.1| hypothetical protein CISIN_1g030128mg [Citrus sinensis]
Length=182

 Score =   293 bits (749),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 153/158 (97%), Positives = 157/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTK  158



>ref|XP_003540015.1| PREDICTED: 60S ribosomal protein L11-like [Glycine max]
Length=181

 Score =   292 bits (748),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 153/158 (97%), Positives = 157/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTK  158



>ref|XP_007215050.1| hypothetical protein PRUPE_ppa012119mg [Prunus persica]
 ref|XP_008228942.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Prunus mume]
 gb|EMJ16249.1| hypothetical protein PRUPE_ppa012119mg [Prunus persica]
Length=183

 Score =   292 bits (748),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 153/158 (97%), Positives = 156/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTK  158



>ref|XP_006398262.1| hypothetical protein EUTSA_v10001041mg [Eutrema salsugineum]
 ref|XP_006402758.1| hypothetical protein EUTSA_v10006260mg [Eutrema salsugineum]
 ref|XP_006414066.1| hypothetical protein EUTSA_v10026344mg [Eutrema salsugineum]
 ref|XP_006414067.1| hypothetical protein EUTSA_v10026344mg [Eutrema salsugineum]
 ref|XP_009128823.1| PREDICTED: 60S ribosomal protein L11-1 [Brassica rapa]
 gb|ESQ39715.1| hypothetical protein EUTSA_v10001041mg [Eutrema salsugineum]
 gb|ESQ44211.1| hypothetical protein EUTSA_v10006260mg [Eutrema salsugineum]
 gb|ESQ55519.1| hypothetical protein EUTSA_v10026344mg [Eutrema salsugineum]
 gb|ESQ55520.1| hypothetical protein EUTSA_v10026344mg [Eutrema salsugineum]
Length=182

 Score =   292 bits (747),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 154/158 (97%), Positives = 158/158 (100%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTK  158



>ref|XP_009132192.1| PREDICTED: 60S ribosomal protein L11-2 isoform X2 [Brassica rapa]
 ref|XP_009136955.1| PREDICTED: 60S ribosomal protein L11-2 isoform X2 [Brassica rapa]
 ref|XP_009101572.1| PREDICTED: 60S ribosomal protein L11-2 [Brassica rapa]
Length=182

 Score =   292 bits (747),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 153/158 (97%), Positives = 157/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRVARRRRCK RVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKTRVGIQHRVTK  158



>ref|XP_006850965.1| hypothetical protein AMTR_s00025p00203150 [Amborella trichopoda]
 gb|ERN12546.1| hypothetical protein AMTR_s00025p00203150 [Amborella trichopoda]
Length=183

 Score =   292 bits (747),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 153/158 (97%), Positives = 156/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLTNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTK  158



>gb|AFK48866.1| unknown [Lotus japonicus]
Length=181

 Score =   292 bits (747),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 153/158 (97%), Positives = 156/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLR+NFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRKNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTK  158



>ref|XP_007148755.1| hypothetical protein PHAVU_005G011400g [Phaseolus vulgaris]
 gb|ESW20749.1| hypothetical protein PHAVU_005G011400g [Phaseolus vulgaris]
Length=181

 Score =   292 bits (747),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 152/158 (96%), Positives = 157/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MA+EKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MAAEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTK  158



>ref|XP_004134655.1| PREDICTED: 60S ribosomal protein L11-1-like [Cucumis sativus]
 ref|XP_004163354.1| PREDICTED: 60S ribosomal protein L11-1-like [Cucumis sativus]
 ref|XP_008439725.1| PREDICTED: 60S ribosomal protein L11-1-like [Cucumis melo]
 gb|KGN49316.1| hypothetical protein Csa_6G519680 [Cucumis sativus]
Length=181

 Score =   292 bits (747),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 151/158 (96%), Positives = 156/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRV RRRRCK+ VGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSTVGIQHRVTK  158



>ref|XP_009628928.1| PREDICTED: 60S ribosomal protein L11-1 [Nicotiana tomentosiformis]
 ref|XP_009796075.1| PREDICTED: 60S ribosomal protein L11-1 [Nicotiana sylvestris]
Length=181

 Score =   292 bits (747),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 154/158 (97%), Positives = 158/158 (100%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTK  158



>gb|EYU41113.1| hypothetical protein MIMGU_mgv1a014638mg [Erythranthe guttata]
Length=183

 Score =   292 bits (747),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 153/157 (97%), Positives = 156/157 (99%), Gaps = 0/157 (0%)
 Frame = +1

Query  73   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  252
            ASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  3    ASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  62

Query  253  RRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  432
            RRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  433  TGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            TGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTK
Sbjct  123  TGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTK  159



>ref|XP_009629723.1| PREDICTED: 60S ribosomal protein L11-1-like [Nicotiana tomentosiformis]
 emb|CAC12883.1| ribosomal protein L11-like [Nicotiana tabacum]
Length=181

 Score =   291 bits (746),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 153/158 (97%), Positives = 158/158 (100%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRVARRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKSRVGIQHRVTK  158



>ref|XP_008225318.1| PREDICTED: 60S ribosomal protein L11 [Prunus mume]
Length=182

 Score =   291 bits (746),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 153/158 (97%), Positives = 156/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTK  158



>ref|XP_010529208.1| PREDICTED: 60S ribosomal protein L11-1-like [Tarenaya hassleriana]
 ref|XP_010538573.1| PREDICTED: 60S ribosomal protein L11-1-like isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010518817.1| PREDICTED: 60S ribosomal protein L11-1-like [Tarenaya hassleriana]
Length=182

 Score =   291 bits (746),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 154/158 (97%), Positives = 158/158 (100%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTK  158



>ref|XP_008381196.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Malus domestica]
Length=183

 Score =   291 bits (746),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 153/158 (97%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MA EKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MAEEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTK  158



>ref|XP_010915478.1| PREDICTED: 60S ribosomal protein L11-like [Elaeis guineensis]
 ref|XP_010925608.1| PREDICTED: 60S ribosomal protein L11-like [Elaeis guineensis]
Length=182

 Score =   291 bits (746),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 152/158 (96%), Positives = 157/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKK++NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKMSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTK  158



>ref|XP_009403504.1| PREDICTED: 60S ribosomal protein L11 [Musa acuminata subsp. malaccensis]
Length=182

 Score =   291 bits (746),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 152/158 (96%), Positives = 157/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDF+VVLER GYRV+RRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFFVVLERAGYRVSRRRRCKSRVGIQHRVTK  158



>ref|XP_009378940.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Pyrus x bretschneideri]
Length=182

 Score =   291 bits (746),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 153/158 (97%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MA EKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MAEEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTK  158



>ref|XP_008786958.1| PREDICTED: 60S ribosomal protein L11-like [Phoenix dactylifera]
Length=181

 Score =   291 bits (746),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 151/158 (96%), Positives = 156/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKK++NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKMSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRV RRRRCK+ VGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSGVGIQHRVTK  158



>ref|XP_009405599.1| PREDICTED: 60S ribosomal protein L11-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=182

 Score =   291 bits (746),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 153/158 (97%), Positives = 157/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDF+VVLER GYRVARRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFFVVLERAGYRVARRRRCKSRVGIQHRVTK  158



>gb|EYU21905.1| hypothetical protein MIMGU_mgv1a014651mg [Erythranthe guttata]
Length=182

 Score =   291 bits (746),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 152/158 (96%), Positives = 157/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MA+EKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MAAEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTK  158



>gb|AFK37822.1| unknown [Medicago truncatula]
Length=181

 Score =   291 bits (746),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 153/158 (97%), Positives = 157/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDF+VVLERPGYRV RRRRCKARVGIQHRVTK
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKARVGIQHRVTK  158



>emb|CDY49245.1| BnaA09g55240D [Brassica napus]
Length=259

 Score =   294 bits (753),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 161/181 (89%), Positives = 165/181 (91%), Gaps = 2/181 (1%)
 Frame = +1

Query  1    LYQFTSRFPSLPAVSPSPRQPKAMASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAK  180
            L  F S FP    V   P     MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+K
Sbjct  57   LSLFDSSFPFPAGVLSQPES--QMASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASK  114

Query  181  VLEQLSGQTPVFSKARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRN  360
            VLEQLSGQTPVFSKARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRN
Sbjct  115  VLEQLSGQTPVFSKARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRN  174

Query  361  FSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVT  540
            FSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVT
Sbjct  175  FSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVT  234

Query  541  K  543
            K
Sbjct  235  K  235



>ref|XP_006843688.1| hypothetical protein AMTR_s00007p00200160 [Amborella trichopoda]
 gb|ERN05363.1| hypothetical protein AMTR_s00007p00200160 [Amborella trichopoda]
Length=183

 Score =   291 bits (746),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 153/158 (97%), Positives = 156/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLTNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTK  158



>ref|XP_009404521.1| PREDICTED: 60S ribosomal protein L11 [Musa acuminata subsp. malaccensis]
Length=182

 Score =   291 bits (746),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 153/158 (97%), Positives = 157/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDF+VVLER GYRVARRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFFVVLERAGYRVARRRRCKSRVGIQHRVTK  158



>gb|KHN42782.1| 60S ribosomal protein L11 [Glycine soja]
Length=181

 Score =   291 bits (745),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 152/158 (96%), Positives = 157/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTK  158



>ref|XP_003628237.1| 60S ribosomal protein L11 [Medicago truncatula]
 gb|AET02713.1| 50S ribosomal protein L5P [Medicago truncatula]
 gb|AFK39602.1| unknown [Medicago truncatula]
Length=181

 Score =   291 bits (745),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 153/158 (97%), Positives = 157/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDF+VVLERPGYRV RRRRCKARVGIQHRVTK
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKARVGIQHRVTK  158



>ref|XP_006449533.1| hypothetical protein CICLE_v10016873mg [Citrus clementina]
 ref|XP_006467622.1| PREDICTED: 60S ribosomal protein L11-like [Citrus sinensis]
 gb|ESR62773.1| hypothetical protein CICLE_v10016873mg [Citrus clementina]
 gb|KDO77895.1| hypothetical protein CISIN_1g029665mg [Citrus sinensis]
Length=182

 Score =   291 bits (745),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 152/158 (96%), Positives = 157/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MAS+KKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASDKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTK  158



>ref|XP_010936718.1| PREDICTED: 60S ribosomal protein L11 [Elaeis guineensis]
Length=182

 Score =   291 bits (745),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 152/158 (96%), Positives = 157/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTK  158



>ref|NP_001238636.1| uncharacterized protein LOC100305912 [Glycine max]
 gb|ACU13823.1| unknown [Glycine max]
Length=181

 Score =   291 bits (745),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 152/158 (96%), Positives = 156/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ PVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQAPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTK  158



>gb|AFP44117.1| 60S ribosomal protein [Lycoris longituba]
Length=182

 Score =   291 bits (744),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 152/158 (96%), Positives = 157/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTK  158



>ref|NP_001132260.1| hypothetical protein [Zea mays]
 gb|ACF81036.1| unknown [Zea mays]
 gb|AFW65988.1| hypothetical protein ZEAMMB73_747842 [Zea mays]
Length=182

 Score =   291 bits (744),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 153/158 (97%), Positives = 156/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKK +NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTK  158



>ref|XP_010525185.1| PREDICTED: 60S ribosomal protein L11-1 [Tarenaya hassleriana]
Length=182

 Score =   291 bits (744),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 154/158 (97%), Positives = 157/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL NPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLANPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTK  158



>emb|CDY26360.1| BnaA02g24100D [Brassica napus]
Length=227

 Score =   292 bits (748),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 154/158 (97%), Positives = 158/158 (100%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  46   MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  105

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  106  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  165

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTK
Sbjct  166  STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTK  203



>ref|XP_004293968.1| PREDICTED: 60S ribosomal protein L11 [Fragaria vesca subsp. vesca]
Length=181

 Score =   290 bits (743),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 153/158 (97%), Positives = 156/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLR+NFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRKNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDF+VVLERPGYRV RRRRCKARVGIQHRVTK
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKARVGIQHRVTK  158



>gb|AFK35020.1| unknown [Lotus japonicus]
Length=181

 Score =   290 bits (743),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 152/158 (96%), Positives = 156/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLR+NFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRKNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTK  158



>ref|XP_011081868.1| PREDICTED: 60S ribosomal protein L11-like [Sesamum indicum]
Length=183

 Score =   290 bits (743),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 152/158 (96%), Positives = 157/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTK  158



>ref|XP_011082984.1| PREDICTED: 60S ribosomal protein L11 [Sesamum indicum]
Length=183

 Score =   290 bits (743),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 152/158 (96%), Positives = 157/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTK  158



>ref|XP_011088013.1| PREDICTED: 60S ribosomal protein L11-like [Sesamum indicum]
Length=183

 Score =   290 bits (743),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 152/158 (96%), Positives = 157/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTK  158



>gb|KHG23956.1| 60S ribosomal L11-2 -like protein [Gossypium arboreum]
Length=182

 Score =   290 bits (743),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 151/158 (96%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLER GYRV RRRRCK+ VGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERAGYRVGRRRRCKSSVGIQHRVTK  158



>ref|NP_850376.2| 60S ribosomal protein L16A [Arabidopsis thaliana]
 ref|XP_002863455.1| 60S ribosomal protein L11 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002870025.1| 60S ribosomal protein L11 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006281176.1| hypothetical protein CARUB_v10027211mg [Capsella rubella]
 ref|XP_006291911.1| hypothetical protein CARUB_v10018095mg [Capsella rubella]
 ref|XP_010504827.1| PREDICTED: 60S ribosomal protein L11-1 [Camelina sativa]
 ref|XP_010439816.1| PREDICTED: 60S ribosomal protein L11-1 isoform X2 [Camelina sativa]
 ref|XP_010441671.1| PREDICTED: 60S ribosomal protein L11-1 [Camelina sativa]
 ref|XP_010449473.1| PREDICTED: 60S ribosomal protein L11-1 isoform X2 [Camelina sativa]
 ref|XP_010481534.1| PREDICTED: 60S ribosomal protein L11-1 [Camelina sativa]
 ref|XP_010494724.1| PREDICTED: 60S ribosomal protein L11-1 [Camelina sativa]
 ref|XP_010496881.1| PREDICTED: 60S ribosomal protein L11-1 isoform X2 [Camelina sativa]
 sp|P42795.2|RL111_ARATH RecName: Full=60S ribosomal protein L11-1; AltName: Full=L16A 
[Arabidopsis thaliana]
 dbj|BAF00458.1| 60S ribosomal protein L11B [Arabidopsis thaliana]
 gb|EFH39714.1| 60S ribosomal protein L11 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46284.1| 60S ribosomal protein L11 [Arabidopsis lyrata subsp. lyrata]
 gb|AEC10163.1| 60S ribosomal protein L11-1/L16A [Arabidopsis thaliana]
 gb|EOA14074.1| hypothetical protein CARUB_v10027211mg [Capsella rubella]
 gb|EOA24809.1| hypothetical protein CARUB_v10018095mg [Capsella rubella]
Length=182

 Score =   290 bits (743),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 153/158 (97%), Positives = 158/158 (100%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTK  158



>ref|NP_191429.1| 60S ribosomal protein L11-2 [Arabidopsis thaliana]
 ref|NP_567563.1| 60S ribosomal protein L11-2 [Arabidopsis thaliana]
 ref|NP_568649.2| 60S ribosomal protein L11-2 [Arabidopsis thaliana]
 sp|P42794.2|RL112_ARATH RecName: Full=60S ribosomal protein L11-2; AltName: Full=L16 
[Arabidopsis thaliana]
 gb|AAG41458.1|AF326876_1 putative ribosomal protein L11 [Arabidopsis thaliana]
 gb|AAK00379.1|AF339697_1 putative ribosomal protein L11 [Arabidopsis thaliana]
 gb|AAK60313.1|AF385722_1 AT4g18730/F28A21_140 [Arabidopsis thaliana]
 emb|CAB88287.1| ribosomal protein L11-like [Arabidopsis thaliana]
 dbj|BAB09220.1| ribosomal protein L11-like [Arabidopsis thaliana]
 gb|AAK62625.1| AT4g18730/F28A21_140 [Arabidopsis thaliana]
 gb|AAL77722.1| AT4g18730/F28A21_140 [Arabidopsis thaliana]
 gb|AAM62465.1| ribosomal protein L11, cytosolic [Arabidopsis thaliana]
 gb|AAM64372.1| ribosomal protein L11, cytosolic [Arabidopsis thaliana]
 gb|AAM91073.1| AT4g18730/F28A21_140 [Arabidopsis thaliana]
 gb|AED95297.1| 60S ribosomal protein L11-2 [Arabidopsis thaliana]
 gb|AEE79819.1| 60S ribosomal protein L11-2 [Arabidopsis thaliana]
 gb|AEE84082.1| 60S ribosomal protein L11-2 [Arabidopsis thaliana]
Length=182

 Score =   290 bits (742),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 152/158 (96%), Positives = 157/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRVARRRRCK RVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKTRVGIQHRVTK  158



>ref|XP_007025337.1| Ribosomal protein large subunit 16A [Theobroma cacao]
 gb|EOY27959.1| Ribosomal protein large subunit 16A [Theobroma cacao]
Length=257

 Score =   293 bits (749),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 152/159 (96%), Positives = 157/159 (99%), Gaps = 0/159 (0%)
 Frame = +1

Query  67   AMASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSF  246
            AMASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSF
Sbjct  75   AMASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSF  134

Query  247  GIRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYD  426
            GIRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYD
Sbjct  135  GIRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYD  194

Query  427  PSTGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            PSTGIYGMDFYVVLER GYRV RRRRCK+RVGIQHRVTK
Sbjct  195  PSTGIYGMDFYVVLERAGYRVGRRRRCKSRVGIQHRVTK  233



>ref|XP_009790976.1| PREDICTED: 60S ribosomal protein L11-1 [Nicotiana sylvestris]
Length=181

 Score =   290 bits (742),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 152/158 (96%), Positives = 158/158 (100%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRVARRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKSRVGIQHRVTK  158



>ref|XP_009626014.1| PREDICTED: 60S ribosomal protein L11-1-like [Nicotiana tomentosiformis]
 ref|XP_009593767.1| PREDICTED: 60S ribosomal protein L11-1-like [Nicotiana tomentosiformis]
 ref|XP_009799522.1| PREDICTED: 60S ribosomal protein L11-1-like [Nicotiana sylvestris]
 ref|XP_009766474.1| PREDICTED: 60S ribosomal protein L11-1-like [Nicotiana sylvestris]
Length=181

 Score =   290 bits (742),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 152/158 (96%), Positives = 158/158 (100%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRVARRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKSRVGIQHRVTK  158



>gb|KHN01495.1| 60S ribosomal protein L11 [Glycine soja]
Length=224

 Score =   291 bits (746),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 152/157 (97%), Positives = 156/157 (99%), Gaps = 0/157 (0%)
 Frame = +1

Query  73   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  252
            ASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  45   ASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  104

Query  253  RRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  432
            RRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  105  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  164

Query  433  TGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            TGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK
Sbjct  165  TGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTK  201



>gb|KJB57391.1| hypothetical protein B456_009G161300 [Gossypium raimondii]
 gb|KJB66842.1| hypothetical protein B456_010G160100 [Gossypium raimondii]
 gb|KJB66843.1| hypothetical protein B456_010G160100 [Gossypium raimondii]
 gb|KJB68369.1| hypothetical protein B456_010G241400 [Gossypium raimondii]
 gb|KJB69699.1| hypothetical protein B456_011G038200 [Gossypium raimondii]
Length=182

 Score =   290 bits (742),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 152/158 (96%), Positives = 156/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLER GYRV RRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERAGYRVGRRRRCKSRVGIQHRVTK  158



>gb|KHG08920.1| 60S ribosomal L11-1 -like protein [Gossypium arboreum]
 gb|KJB34907.1| hypothetical protein B456_006G089700 [Gossypium raimondii]
Length=182

 Score =   290 bits (742),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 152/158 (96%), Positives = 156/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLER GYRV RRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERAGYRVGRRRRCKSRVGIQHRVTK  158



>emb|CDX99436.1| BnaC01g11160D [Brassica napus]
Length=184

 Score =   290 bits (742),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 152/157 (97%), Positives = 156/157 (99%), Gaps = 0/157 (0%)
 Frame = +1

Query  73   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  252
            ASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  4    ASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGI  63

Query  253  RRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  432
            RRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  64   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  123

Query  433  TGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            TGIYGMDFYVVLERPGYRVARRRRCK RVGIQHRVTK
Sbjct  124  TGIYGMDFYVVLERPGYRVARRRRCKTRVGIQHRVTK  160



>ref|NP_001242757.1| uncharacterized protein LOC100778713 [Glycine max]
 gb|ACU13845.1| unknown [Glycine max]
Length=181

 Score =   290 bits (742),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 151/158 (96%), Positives = 156/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHR TK
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRATK  158



>ref|XP_010052848.1| PREDICTED: 60S ribosomal protein L11-1 [Eucalyptus grandis]
 gb|KCW89658.1| hypothetical protein EUGRSUZ_A01929 [Eucalyptus grandis]
Length=182

 Score =   290 bits (742),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 151/158 (96%), Positives = 157/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFY+VLERPGYRV RRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFYIVLERPGYRVGRRRRCKSRVGIQHRVTK  158



>ref|XP_008228941.1| PREDICTED: 60S ribosomal protein L11 isoform X1 [Prunus mume]
Length=184

 Score =   290 bits (742),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 152/157 (97%), Positives = 155/157 (99%), Gaps = 0/157 (0%)
 Frame = +1

Query  73   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  252
            ASEKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  3    ASEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  62

Query  253  RRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  432
            RRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  433  TGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            TGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK
Sbjct  123  TGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTK  159



>ref|XP_009132184.1| PREDICTED: 60S ribosomal protein L11-2 isoform X1 [Brassica rapa]
 ref|XP_009136954.1| PREDICTED: 60S ribosomal protein L11-2 isoform X1 [Brassica rapa]
 emb|CDY64920.1| BnaC07g50200D [Brassica napus]
Length=183

 Score =   290 bits (742),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 152/157 (97%), Positives = 156/157 (99%), Gaps = 0/157 (0%)
 Frame = +1

Query  73   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  252
            ASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  3    ASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGI  62

Query  253  RRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  432
            RRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  433  TGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            TGIYGMDFYVVLERPGYRVARRRRCK RVGIQHRVTK
Sbjct  123  TGIYGMDFYVVLERPGYRVARRRRCKTRVGIQHRVTK  159



>ref|XP_008381195.1| PREDICTED: 60S ribosomal protein L11 isoform X1 [Malus domestica]
Length=184

 Score =   290 bits (742),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 152/157 (97%), Positives = 154/157 (98%), Gaps = 0/157 (0%)
 Frame = +1

Query  73   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  252
            A EKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  3    AEEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  62

Query  253  RRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  432
            RRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  433  TGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            TGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTK
Sbjct  123  TGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTK  159



>ref|XP_008345917.1| PREDICTED: 60S ribosomal protein L11 [Malus domestica]
Length=182

 Score =   290 bits (741),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 153/158 (97%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASE KL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASENKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDF+VVLERPGYRV RRRRCKARVGIQHRVTK
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKARVGIQHRVTK  158



>ref|XP_006414065.1| hypothetical protein EUTSA_v10026344mg [Eutrema salsugineum]
 gb|ESQ55518.1| hypothetical protein EUTSA_v10026344mg [Eutrema salsugineum]
Length=183

 Score =   290 bits (741),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 153/157 (97%), Positives = 157/157 (100%), Gaps = 0/157 (0%)
 Frame = +1

Query  73   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  252
            ASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  3    ASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGI  62

Query  253  RRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  432
            RRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  433  TGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            TGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTK
Sbjct  123  TGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTK  159



>ref|XP_009351472.1| PREDICTED: 60S ribosomal protein L11 [Pyrus x bretschneideri]
Length=182

 Score =   290 bits (741),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 152/158 (96%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASE KL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASESKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTK  158



>ref|XP_009365286.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Pyrus x bretschneideri]
Length=183

 Score =   290 bits (741),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 152/158 (96%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MA E KL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MAEENKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTK  158



>gb|ABK22492.1| unknown [Picea sitchensis]
 gb|ABK26358.1| unknown [Picea sitchensis]
Length=180

 Score =   290 bits (741),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 156/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MA+EKKLNNPMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MAAEKKLNNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KA+QLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKALQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDF+VVLERPGYR+ RR+R ++RVGIQHRVTK
Sbjct  121  STGIYGMDFFVVLERPGYRIGRRKRAQSRVGIQHRVTK  158



>ref|XP_008343092.1| PREDICTED: 60S ribosomal protein L11-like isoform X2 [Malus domestica]
Length=182

 Score =   290 bits (741),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 152/158 (96%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MA EKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MAEEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGI+HRVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIRHRVTK  158



>ref|XP_008443441.1| PREDICTED: 60S ribosomal protein L11-1 [Cucumis melo]
 gb|KGN65615.1| hypothetical protein Csa_1G470310 [Cucumis sativus]
Length=182

 Score =   290 bits (741),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 150/158 (95%), Positives = 156/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRV RRRRCK+ VGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSSVGIQHRVTK  158



>ref|XP_010052835.1| PREDICTED: 60S ribosomal protein L11-1-like [Eucalyptus grandis]
Length=182

 Score =   290 bits (741),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 151/158 (96%), Positives = 157/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MA+EKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MAAEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTK  158



>emb|CDX87764.1| BnaC02g31850D [Brassica napus]
Length=228

 Score =   291 bits (745),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 153/158 (97%), Positives = 158/158 (100%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  47   MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  106

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLR+NFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  107  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRKNFSDTGCFGFGIQEHIDLGIKYDP  166

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTK
Sbjct  167  STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTK  204



>gb|ACJ86159.1| unknown [Medicago truncatula]
Length=181

 Score =   289 bits (740),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 152/158 (96%), Positives = 156/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRN SDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNLSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDF+VVLERPGYRV RRRRCKARVGIQHRVTK
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKARVGIQHRVTK  158



>ref|XP_002281886.1| PREDICTED: 60S ribosomal protein L11 [Vitis vinifera]
Length=183

 Score =   289 bits (740),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 151/158 (96%), Positives = 157/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTK  158



>ref|NP_001149684.1| 60S ribosomal protein L11-1 [Zea mays]
 gb|ACF85974.1| unknown [Zea mays]
 gb|ACG36357.1| 60S ribosomal protein L11-1 [Zea mays]
 gb|ACR34870.1| unknown [Zea mays]
 gb|AFW71163.1| 60S ribosomal protein L11-1 [Zea mays]
Length=182

 Score =   289 bits (740),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 152/158 (96%), Positives = 156/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MA EKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MAHEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTK  158



>ref|XP_010538574.1| PREDICTED: 60S ribosomal protein L11-1-like isoform X3 [Tarenaya 
hassleriana]
Length=183

 Score =   289 bits (740),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 152/157 (97%), Positives = 156/157 (99%), Gaps = 0/157 (0%)
 Frame = +1

Query  73   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  252
            ASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  3    ASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  62

Query  253  RRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  432
            RRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  433  TGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            TGIYGMDFYVVLERPGYRVARRRR KARVGIQHRVTK
Sbjct  123  TGIYGMDFYVVLERPGYRVARRRRGKARVGIQHRVTK  159



>ref|XP_002451841.1| hypothetical protein SORBIDRAFT_04g008530 [Sorghum bicolor]
 ref|XP_002451842.1| hypothetical protein SORBIDRAFT_04g008540 [Sorghum bicolor]
 gb|EES04817.1| hypothetical protein SORBIDRAFT_04g008530 [Sorghum bicolor]
 gb|EES04818.1| hypothetical protein SORBIDRAFT_04g008540 [Sorghum bicolor]
Length=182

 Score =   289 bits (740),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 153/158 (97%), Positives = 156/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKK +NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLER GYRVARRRRCKARVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKARVGIQHRVTK  158



>emb|CAA57395.1| ribosomal protein L16 [Arabidopsis thaliana]
Length=182

 Score =   289 bits (740),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 152/158 (96%), Positives = 158/158 (100%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGI+YDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIRYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTK  158



>ref|XP_010538572.1| PREDICTED: 60S ribosomal protein L11-1-like isoform X1 [Tarenaya 
hassleriana]
Length=183

 Score =   289 bits (740),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 153/157 (97%), Positives = 157/157 (100%), Gaps = 0/157 (0%)
 Frame = +1

Query  73   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  252
            ASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  3    ASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  62

Query  253  RRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  432
            RRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  433  TGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            TGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTK
Sbjct  123  TGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTK  159



>ref|XP_009378939.1| PREDICTED: 60S ribosomal protein L11 isoform X1 [Pyrus x bretschneideri]
Length=183

 Score =   289 bits (740),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 152/157 (97%), Positives = 154/157 (98%), Gaps = 0/157 (0%)
 Frame = +1

Query  73   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  252
            A EKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  3    AEEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  62

Query  253  RRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  432
            RRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  433  TGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            TGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTK
Sbjct  123  TGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTK  159



>gb|KHN27796.1| 60S ribosomal protein L11, partial [Glycine soja]
Length=182

 Score =   289 bits (740),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 151/157 (96%), Positives = 156/157 (99%), Gaps = 0/157 (0%)
 Frame = +1

Query  73   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  252
            ASEKKL+NPMRE+KVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  3    ASEKKLSNPMREMKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  62

Query  253  RRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  432
            RRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  433  TGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            TGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK
Sbjct  123  TGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTK  159



>ref|XP_009405598.1| PREDICTED: 60S ribosomal protein L11-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=185

 Score =   289 bits (740),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 152/157 (97%), Positives = 156/157 (99%), Gaps = 0/157 (0%)
 Frame = +1

Query  73   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  252
            ASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  5    ASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  64

Query  253  RRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  432
            RRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  65   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  124

Query  433  TGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            TGIYGMDF+VVLER GYRVARRRRCK+RVGIQHRVTK
Sbjct  125  TGIYGMDFFVVLERAGYRVARRRRCKSRVGIQHRVTK  161



>ref|XP_011039398.1| PREDICTED: 60S ribosomal protein L11 [Populus euphratica]
 ref|XP_011039399.1| PREDICTED: 60S ribosomal protein L11 [Populus euphratica]
 ref|XP_011039400.1| PREDICTED: 60S ribosomal protein L11 [Populus euphratica]
Length=182

 Score =   289 bits (739),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 152/158 (96%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGI  RVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIHQRVTK  158



>gb|AAR83867.1| ribosomal protein L11-like protein [Capsicum annuum]
Length=181

 Score =   289 bits (739),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 151/158 (96%), Positives = 157/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASE KLNNPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASENKLNNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRVARRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKSRVGIQHRVTK  158



>gb|AFK38385.1| unknown [Lotus japonicus]
Length=181

 Score =   289 bits (739),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 151/158 (96%), Positives = 156/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLR+NFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRKNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVT+
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTE  158



>gb|ADE77225.1| unknown [Picea sitchensis]
Length=180

 Score =   289 bits (739),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 156/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MA+EKKLNNPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MAAEKKLNNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KA+QLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKALQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDF+VVLERPGYRV RR+R ++RVGIQHRVTK
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRKRAQSRVGIQHRVTK  158



>gb|KFK28544.1| hypothetical protein AALP_AA7G010400 [Arabis alpina]
 gb|KFK31523.1| hypothetical protein AALP_AA6G123700 [Arabis alpina]
Length=182

 Score =   289 bits (739),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 152/158 (96%), Positives = 158/158 (100%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLR+NFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRKNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTK  158



>ref|XP_003598139.1| 60S ribosomal protein L11 [Medicago truncatula]
 gb|AES68390.1| 50S ribosomal protein L5P [Medicago truncatula]
 gb|AFK34937.1| unknown [Medicago truncatula]
Length=182

 Score =   289 bits (739),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 152/156 (97%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = +1

Query  76   SEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIR  255
            SEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIR
Sbjct  4    SEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIR  63

Query  256  RNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPST  435
            RNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPST
Sbjct  64   RNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPST  123

Query  436  GIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            GIYGMDF+VVLERPGYRV RRRRCKARVGIQHRVTK
Sbjct  124  GIYGMDFFVVLERPGYRVGRRRRCKARVGIQHRVTK  159



>gb|KDO77896.1| hypothetical protein CISIN_1g029665mg [Citrus sinensis]
Length=190

 Score =   289 bits (739),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 151/157 (96%), Positives = 156/157 (99%), Gaps = 0/157 (0%)
 Frame = +1

Query  73   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  252
            AS+KKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  10   ASDKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  69

Query  253  RRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  432
            RRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  70   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  129

Query  433  TGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            TGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK
Sbjct  130  TGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTK  166



>ref|XP_010052179.1| PREDICTED: 60S ribosomal protein L11-1 [Eucalyptus grandis]
 gb|KCW76098.1| hypothetical protein EUGRSUZ_D00478 [Eucalyptus grandis]
Length=182

 Score =   289 bits (739),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 151/158 (96%), Positives = 157/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGI+HRVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIRHRVTK  158



>ref|XP_007048733.1| Ribosomal L5P family protein isoform 1 [Theobroma cacao]
 gb|EOX92890.1| Ribosomal L5P family protein isoform 1 [Theobroma cacao]
Length=182

 Score =   289 bits (739),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 151/158 (96%), Positives = 156/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASE+KL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEQKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLER GYRV RRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERAGYRVGRRRRCKSRVGIQHRVTK  158



>ref|XP_002309361.1| 60S ribosomal protein L11 [Populus trichocarpa]
 ref|XP_002309362.1| 60S ribosomal protein L11-2 [Populus trichocarpa]
 ref|XP_002317400.1| ribosomal protein RL5 [Populus trichocarpa]
 ref|XP_002317401.1| ribosomal protein RL5 [Populus trichocarpa]
 gb|ABK93699.1| unknown [Populus trichocarpa]
 gb|EEE92884.1| 60S ribosomal protein L11 [Populus trichocarpa]
 gb|EEE92885.1| 60S ribosomal protein L11-2 [Populus trichocarpa]
 gb|EEE98012.1| ribosomal protein RL5 [Populus trichocarpa]
 gb|EEE98013.1| ribosomal protein RL5 [Populus trichocarpa]
Length=180

 Score =   288 bits (738),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 152/158 (96%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGI  RVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIHQRVTK  158



>ref|XP_008366039.1| PREDICTED: 60S ribosomal protein L11-1 [Malus domestica]
 ref|XP_009352738.1| PREDICTED: 60S ribosomal protein L11-1 [Pyrus x bretschneideri]
Length=182

 Score =   288 bits (738),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 151/158 (96%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASE K+ NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASESKMANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTK  158



>ref|NP_001274979.1| 60S ribosomal protein L11-2-like [Solanum tuberosum]
 ref|XP_004232337.1| PREDICTED: 60S ribosomal protein L11-1 [Solanum lycopersicum]
 ref|XP_004243273.1| PREDICTED: 60S ribosomal protein L11-1 [Solanum lycopersicum]
 ref|XP_004248195.1| PREDICTED: 60S ribosomal protein L11-1 [Solanum lycopersicum]
 ref|XP_004251809.1| PREDICTED: 60S ribosomal protein L11-1 [Solanum lycopersicum]
 ref|XP_006348888.1| PREDICTED: 60S ribosomal protein L11-2-like [Solanum tuberosum]
 ref|XP_006350023.1| PREDICTED: 60S ribosomal protein L11-2-like [Solanum tuberosum]
 ref|XP_006357834.1| PREDICTED: 60S ribosomal protein L11-2-like [Solanum tuberosum]
 gb|ABB29943.1| ribosomal protein L11-like protein [Solanum tuberosum]
Length=181

 Score =   288 bits (738),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 151/158 (96%), Positives = 158/158 (100%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRVARRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKSRVGIQHRVTK  158



>ref|XP_011033383.1| PREDICTED: 60S ribosomal protein L11-like [Populus euphratica]
 ref|XP_011015073.1| PREDICTED: 60S ribosomal protein L11-like isoform X1 [Populus 
euphratica]
 ref|XP_011015074.1| PREDICTED: 60S ribosomal protein L11-like isoform X2 [Populus 
euphratica]
Length=182

 Score =   288 bits (738),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 152/158 (96%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGI  RVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIHQRVTK  158



>emb|CAA57394.1| ribosomal protein L16 [Arabidopsis thaliana]
Length=182

 Score =   288 bits (738),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 151/158 (96%), Positives = 157/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGM+FYVVLERPGYRVARRRRCK RVGIQHRVTK
Sbjct  121  STGIYGMEFYVVLERPGYRVARRRRCKTRVGIQHRVTK  158



>ref|XP_002876475.1| 60S ribosomal protein L11 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52734.1| 60S ribosomal protein L11 [Arabidopsis lyrata subsp. lyrata]
Length=182

 Score =   288 bits (737),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 152/158 (96%), Positives = 157/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSK RYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKGRYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTK  158



>ref|XP_010427776.1| PREDICTED: 60S ribosomal protein L11-1-like [Camelina sativa]
Length=182

 Score =   288 bits (737),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 152/158 (96%), Positives = 157/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLE GL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLEGGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTK  158



>ref|XP_002880003.1| 60S ribosomal protein L11 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56262.1| 60S ribosomal protein L11 [Arabidopsis lyrata subsp. lyrata]
Length=182

 Score =   288 bits (737),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 152/158 (96%), Positives = 157/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
             RRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   TRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTK  158



>ref|XP_003607648.1| 60S ribosomal protein L11-1 [Medicago truncatula]
 gb|ACJ86168.1| unknown [Medicago truncatula]
 gb|AES89845.1| 50S ribosomal protein L5P [Medicago truncatula]
 gb|AFK48476.1| unknown [Medicago truncatula]
Length=181

 Score =   288 bits (737),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 151/158 (96%), Positives = 156/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MAS+KKL NPMR++KVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASDKKLANPMRDMKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDF+VVLERPGYRV RRRRCKARVGIQHRVTK
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKARVGIQHRVTK  158



>ref|XP_008782472.1| PREDICTED: 60S ribosomal protein L11 isoform X1 [Phoenix dactylifera]
Length=180

 Score =   288 bits (737),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 151/158 (96%), Positives = 156/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMR IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRGIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTK  158



>gb|AFW65990.1| hypothetical protein ZEAMMB73_747842 [Zea mays]
Length=187

 Score =   288 bits (737),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 152/157 (97%), Positives = 155/157 (99%), Gaps = 0/157 (0%)
 Frame = +1

Query  73   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  252
            ASEKK +NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  7    ASEKKQSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  66

Query  253  RRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  432
            RRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  67   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  126

Query  433  TGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            TGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK
Sbjct  127  TGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTK  163



>ref|XP_004133952.1| PREDICTED: 60S ribosomal protein L11-2-like isoform 2 [Cucumis 
sativus]
 ref|XP_004164745.1| PREDICTED: 60S ribosomal protein L11-2-like isoform 2 [Cucumis 
sativus]
 ref|XP_008438244.1| PREDICTED: 60S ribosomal protein L11-1-like isoform X2 [Cucumis 
melo]
 gb|KGN56659.1| hypothetical protein Csa_3G127210 [Cucumis sativus]
Length=182

 Score =   288 bits (737),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 150/158 (95%), Positives = 157/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTK  158



>ref|NP_001046386.1| Os02g0235600 [Oryza sativa Japonica Group]
 dbj|BAF08300.1| Os02g0235600 [Oryza sativa Japonica Group]
 dbj|BAH00003.1| unnamed protein product [Oryza sativa Japonica Group]
Length=182

 Score =   288 bits (737),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 151/158 (96%), Positives = 156/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKK +NPMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTK  158



>ref|XP_006285819.1| hypothetical protein CARUB_v10007309mg [Capsella rubella]
 ref|XP_010439815.1| PREDICTED: 60S ribosomal protein L11-1 isoform X1 [Camelina sativa]
 ref|XP_010449472.1| PREDICTED: 60S ribosomal protein L11-1 isoform X1 [Camelina sativa]
 ref|XP_010496880.1| PREDICTED: 60S ribosomal protein L11-1 isoform X1 [Camelina sativa]
 gb|EOA18717.1| hypothetical protein CARUB_v10007309mg [Capsella rubella]
Length=183

 Score =   288 bits (737),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 152/157 (97%), Positives = 157/157 (100%), Gaps = 0/157 (0%)
 Frame = +1

Query  73   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  252
            ASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  3    ASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGI  62

Query  253  RRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  432
            RRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  433  TGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            TGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTK
Sbjct  123  TGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTK  159



>pir||T04865 ribosomal protein L11, cytosolic - Arabidopsis thaliana
 emb|CAA57396.1| ribosomal protein L16 [Arabidopsis thaliana]
 emb|CAB37458.1| ribosomal protein L11, cytosolic [Arabidopsis thaliana]
 emb|CAB78875.1| ribosomal protein L11, cytosolic [Arabidopsis thaliana]
Length=184

 Score =   288 bits (737),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 151/157 (96%), Positives = 156/157 (99%), Gaps = 0/157 (0%)
 Frame = +1

Query  73   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  252
            ASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  4    ASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGI  63

Query  253  RRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  432
            RRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  64   RRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  123

Query  433  TGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            TGIYGMDFYVVLERPGYRVARRRRCK RVGIQHRVTK
Sbjct  124  TGIYGMDFYVVLERPGYRVARRRRCKTRVGIQHRVTK  160



>ref|XP_009116550.1| PREDICTED: 60S ribosomal protein L11-1 [Brassica rapa]
Length=182

 Score =   288 bits (737),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 153/158 (97%), Positives = 157/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHI LGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIYLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTK  158



>ref|XP_008362518.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Malus domestica]
Length=182

 Score =   288 bits (736),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 151/158 (96%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MA EKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MAEEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFY VLERPGYRV RRRRCK+RVGI+HRVTK
Sbjct  121  STGIYGMDFYXVLERPGYRVGRRRRCKSRVGIRHRVTK  158



>ref|XP_004133951.1| PREDICTED: 60S ribosomal protein L11-2-like isoform 1 [Cucumis 
sativus]
 ref|XP_004164744.1| PREDICTED: 60S ribosomal protein L11-2-like isoform 1 [Cucumis 
sativus]
 ref|XP_008438243.1| PREDICTED: 60S ribosomal protein L11-like isoform X1 [Cucumis 
melo]
Length=184

 Score =   288 bits (736),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 150/159 (94%), Positives = 157/159 (99%), Gaps = 0/159 (0%)
 Frame = +1

Query  67   AMASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSF  246
            A ASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSF
Sbjct  2    AQASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSF  61

Query  247  GIRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYD  426
            GIRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYD
Sbjct  62   GIRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYD  121

Query  427  PSTGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            PSTGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK
Sbjct  122  PSTGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTK  160



>ref|XP_004976770.1| PREDICTED: 60S ribosomal protein L11-like [Setaria italica]
Length=180

 Score =   287 bits (735),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 151/158 (96%), Positives = 156/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKK +NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTK  158



>ref|XP_009365285.1| PREDICTED: 60S ribosomal protein L11 isoform X1 [Pyrus x bretschneideri]
Length=184

 Score =   287 bits (735),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 151/157 (96%), Positives = 153/157 (97%), Gaps = 0/157 (0%)
 Frame = +1

Query  73   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  252
            A E KL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  3    AEENKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  62

Query  253  RRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  432
            RRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  433  TGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            TGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTK
Sbjct  123  TGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTK  159



>ref|NP_001132427.1| 60S ribosomal protein L11-1 [Zea mays]
 gb|ACF81262.1| unknown [Zea mays]
 gb|AFW81631.1| 60S ribosomal protein L11-1 [Zea mays]
Length=181

 Score =   287 bits (735),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 151/158 (96%), Positives = 156/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKK +NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTK  158



>ref|XP_008343091.1| PREDICTED: 60S ribosomal protein L11-like isoform X1 [Malus domestica]
Length=183

 Score =   287 bits (735),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 151/157 (96%), Positives = 154/157 (98%), Gaps = 0/157 (0%)
 Frame = +1

Query  73   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  252
            A EKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  3    AEEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  62

Query  253  RRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  432
            RRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  433  TGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            TGIYGMDFYVVLERPGYRV RRRRCK+RVGI+HRVTK
Sbjct  123  TGIYGMDFYVVLERPGYRVGRRRRCKSRVGIRHRVTK  159



>ref|NP_001148395.1| LOC100282010 [Zea mays]
 gb|ACG31313.1| 60S ribosomal protein L11-1 [Zea mays]
 gb|AFW86972.1| 60S ribosomal protein L11-1 [Zea mays]
Length=182

 Score =   287 bits (734),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 151/158 (96%), Positives = 156/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKK +NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTK  158



>ref|XP_006578416.1| PREDICTED: 60S ribosomal protein L11-like [Glycine max]
Length=181

 Score =   287 bits (734),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 151/158 (96%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIAC+VTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACHVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDF+VVLERPGYRV RR RCKARV IQHRVTK
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRCRCKARVRIQHRVTK  158



>ref|XP_010689742.1| PREDICTED: 60S ribosomal protein L11-1 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=182

 Score =   287 bits (734),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 152/158 (96%), Positives = 157/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MA EKKL+NPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVRSFG
Sbjct  1    MAPEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTK  158



>ref|NP_001131414.1| uncharacterized protein LOC100192743 [Zea mays]
 gb|ACF79812.1| unknown [Zea mays]
 gb|ACG39381.1| 60S ribosomal protein L11-1 [Zea mays]
 tpg|DAA52966.1| TPA: 60S ribosomal protein L11-1 [Zea mays]
Length=182

 Score =   287 bits (734),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 150/158 (95%), Positives = 156/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKK +NPMRE+KVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREMKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTK  158



>ref|XP_007214493.1| hypothetical protein PRUPE_ppa020372mg [Prunus persica]
 gb|EMJ15692.1| hypothetical protein PRUPE_ppa020372mg [Prunus persica]
Length=276

 Score =   290 bits (742),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 152/157 (97%), Positives = 155/157 (99%), Gaps = 0/157 (0%)
 Frame = +1

Query  73   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  252
            ASEKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  96   ASEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  155

Query  253  RRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  432
            RRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  156  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  215

Query  433  TGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            TGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK
Sbjct  216  TGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTK  252



>gb|ABK93207.1| unknown [Populus trichocarpa]
Length=180

 Score =   286 bits (733),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 151/158 (96%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQL ESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLQESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGI  RVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIHQRVTK  158



>gb|ACG31637.1| 60S ribosomal protein L11-1 [Zea mays]
Length=181

 Score =   286 bits (732),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 150/158 (95%), Positives = 156/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKK +NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTV+G+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVKGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTK  158



>ref|XP_002454974.1| hypothetical protein SORBIDRAFT_03g002420 [Sorghum bicolor]
 gb|EES00094.1| hypothetical protein SORBIDRAFT_03g002420 [Sorghum bicolor]
Length=182

 Score =   286 bits (732),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 150/158 (95%), Positives = 156/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKK +NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTK  158



>ref|XP_006654147.1| PREDICTED: 60S ribosomal protein L11-like [Oryza brachyantha]
Length=182

 Score =   286 bits (732),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 150/158 (95%), Positives = 156/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKK +NPMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTK  158



>gb|KHG13747.1| 60S ribosomal L11-1 -like protein [Gossypium arboreum]
Length=188

 Score =   286 bits (731),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 150/157 (96%), Positives = 154/157 (98%), Gaps = 0/157 (0%)
 Frame = +1

Query  73   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  252
            ASEKKL+NPMREIKVQKLVLNI VGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  8    ASEKKLSNPMREIKVQKLVLNICVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  67

Query  253  RRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  432
            RRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  68   RRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  127

Query  433  TGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            TGIYGMDFYVVLER GYRV RRRRCK+RVGIQHRVTK
Sbjct  128  TGIYGMDFYVVLERAGYRVGRRRRCKSRVGIQHRVTK  164



>ref|XP_010102117.1| 60S ribosomal protein L11-2 [Morus notabilis]
 gb|EXB92367.1| 60S ribosomal protein L11-2 [Morus notabilis]
Length=207

 Score =   286 bits (733),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 150/157 (96%), Positives = 154/157 (98%), Gaps = 0/157 (0%)
 Frame = +1

Query  73   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  252
            ASEKKL NPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFGI
Sbjct  27   ASEKKLANPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFGI  86

Query  253  RRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  432
            RRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  87   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  146

Query  433  TGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            TGIYGMDFYVVLER GYRV RRRRCK+RVGIQHRVTK
Sbjct  147  TGIYGMDFYVVLERAGYRVGRRRRCKSRVGIQHRVTK  183



>ref|XP_008362517.1| PREDICTED: 60S ribosomal protein L11 isoform X1 [Malus domestica]
Length=183

 Score =   285 bits (730),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 150/157 (96%), Positives = 153/157 (97%), Gaps = 0/157 (0%)
 Frame = +1

Query  73   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  252
            A EKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  3    AEEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  62

Query  253  RRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  432
            RRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  433  TGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            TGIYGMDFY VLERPGYRV RRRRCK+RVGI+HRVTK
Sbjct  123  TGIYGMDFYXVLERPGYRVGRRRRCKSRVGIRHRVTK  159



>ref|XP_004968572.1| PREDICTED: 60S ribosomal protein L11-like [Setaria italica]
Length=181

 Score =   285 bits (730),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 150/158 (95%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKK  NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTK  158



>ref|XP_006643887.1| PREDICTED: 60S ribosomal protein L11-like [Oryza brachyantha]
Length=182

 Score =   285 bits (729),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 150/158 (95%), Positives = 156/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKK +NPMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLER GYRVARRRRCKARVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKARVGIQHRVTK  158



>ref|XP_010689741.1| PREDICTED: 60S ribosomal protein L11-1 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=183

 Score =   285 bits (729),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 151/157 (96%), Positives = 156/157 (99%), Gaps = 0/157 (0%)
 Frame = +1

Query  73   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  252
            A EKKL+NPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVRSFGI
Sbjct  3    APEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRSFGI  62

Query  253  RRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  432
            RRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  433  TGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            TGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTK
Sbjct  123  TGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTK  159



>ref|NP_001054899.1| Os05g0207300 [Oryza sativa Japonica Group]
 ref|NP_001057834.2| Os06g0550000 [Oryza sativa Japonica Group]
 sp|Q0DK10.1|RL11_ORYSJ RecName: Full=60S ribosomal protein L11 [Oryza sativa Japonica 
Group]
 sp|A2YDY2.2|RL11_ORYSI RecName: Full=60S ribosomal protein L11 [Oryza sativa Indica 
Group]
 gb|AAU90185.1| putative 60S ribosomal protein L11 [Oryza sativa Japonica Group]
 dbj|BAF16813.1| Os05g0207300 [Oryza sativa Japonica Group]
 dbj|BAG92054.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC78695.1| hypothetical protein OsI_18846 [Oryza sativa Indica Group]
 gb|EEC80790.1| hypothetical protein OsI_23322 [Oryza sativa Indica Group]
 gb|EEE62702.1| hypothetical protein OsJ_17505 [Oryza sativa Japonica Group]
 gb|EEE65858.1| hypothetical protein OsJ_21642 [Oryza sativa Japonica Group]
 dbj|BAF19748.2| Os06g0550000 [Oryza sativa Japonica Group]
Length=182

 Score =   285 bits (729),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 149/158 (94%), Positives = 156/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKK +NPMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTK  158



>ref|XP_001759707.1| predicted protein [Physcomitrella patens]
 ref|XP_001778446.1| predicted protein [Physcomitrella patens]
 ref|XP_001779787.1| predicted protein [Physcomitrella patens]
 gb|EDQ55388.1| predicted protein [Physcomitrella patens]
 gb|EDQ56721.1| predicted protein [Physcomitrella patens]
 gb|EDQ75619.1| predicted protein [Physcomitrella patens]
Length=181

 Score =   285 bits (728),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKK+ N MREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKMQNSMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFS++GCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSESGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRV RRRR K+RVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRAKSRVGIQHRVTK  158



>ref|XP_008790022.1| PREDICTED: 60S ribosomal protein L11-like [Phoenix dactylifera]
Length=182

 Score =   285 bits (728),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 150/158 (95%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL NPMR+I VQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLLNPMRDINVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQH VTK
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHGVTK  158



>gb|ADY38658.1| putative 60S ribosomal protein L11 [Wolffia arrhiza]
Length=182

 Score =   284 bits (727),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 150/158 (95%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKK +NPMREIKVQKLVLNI VGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNICVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLER GYRV RRRRCKARVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERAGYRVGRRRRCKARVGIQHRVTK  158



>ref|NP_001042339.1| Os01g0205500 [Oryza sativa Japonica Group]
 dbj|BAA92964.1| putative 60S ribosomal protein L11-1 [Oryza sativa Japonica Group]
 dbj|BAF04253.1| Os01g0205500 [Oryza sativa Japonica Group]
 gb|EAY72954.1| hypothetical protein OsI_00826 [Oryza sativa Indica Group]
 gb|EAZ10965.1| hypothetical protein OsJ_00808 [Oryza sativa Japonica Group]
 dbj|BAG90584.1| unnamed protein product [Oryza sativa Japonica Group]
Length=182

 Score =   284 bits (727),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 149/158 (94%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKK  NPMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQANPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTK  158



>ref|XP_010940061.1| PREDICTED: 60S ribosomal protein L11-like [Elaeis guineensis]
Length=181

 Score =   284 bits (726),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 150/158 (95%), Positives = 156/158 (99%), Gaps = 1/158 (1%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEK+ +NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKQ-SNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  59

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  60   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  119

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRV RRRRCK+RVG+QHRVTK
Sbjct  120  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGLQHRVTK  157



>gb|AAT08727.1| 60S ribosomal protein L11 [Hyacinthus orientalis]
Length=189

 Score =   284 bits (726),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 152/165 (92%), Positives = 155/165 (94%), Gaps = 1/165 (1%)
 Frame = +1

Query  52   PRQPK-AMASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKAR  228
            PR P       KKL NPMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKAR
Sbjct  1    PRIPNPKWLQHKKLANPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKAR  60

Query  229  YTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHID  408
            YTVRSFGIRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHID
Sbjct  61   YTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHID  120

Query  409  LGIKYDPSTGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            LGIKYDPSTGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTK
Sbjct  121  LGIKYDPSTGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTK  165



>ref|XP_001762314.1| predicted protein [Physcomitrella patens]
 gb|EDQ72781.1| predicted protein [Physcomitrella patens]
Length=181

 Score =   283 bits (724),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKK  N MREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQQNSMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFS++GCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSESGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRV RRRR K+RVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRAKSRVGIQHRVTK  158



>ref|XP_008795915.1| PREDICTED: 60S ribosomal protein L11-like [Phoenix dactylifera]
Length=179

 Score =   282 bits (722),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 149/158 (94%), Positives = 156/158 (99%), Gaps = 1/158 (1%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEK+ +NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKQ-SNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  59

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  60   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  119

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDF+VVLERPGYRV RRRRCK+RVG+QHRVTK
Sbjct  120  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGLQHRVTK  157



>ref|XP_001760204.1| predicted protein [Physcomitrella patens]
 gb|EDQ74960.1| predicted protein [Physcomitrella patens]
Length=181

 Score =   281 bits (720),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKK  N MREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQQNLMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFS++GCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSESGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRV RRRR K+RVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRAKSRVGIQHRVTK  158



>ref|XP_006648487.1| PREDICTED: 60S ribosomal protein L11-like [Oryza brachyantha]
Length=189

 Score =   281 bits (720),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 148/157 (94%), Positives = 154/157 (98%), Gaps = 0/157 (0%)
 Frame = +1

Query  73   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  252
            A EKK +NPMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  9    ALEKKQSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGI  68

Query  253  RRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  432
            RRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDPS
Sbjct  69   RRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDPS  128

Query  433  TGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            TGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK
Sbjct  129  TGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTK  165



>ref|XP_002270266.1| PREDICTED: 60S ribosomal protein L11-1-like [Vitis vinifera]
Length=183

 Score =   280 bits (717),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 148/158 (94%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASE+KL NPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSF 
Sbjct  1    MASERKLANPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFA  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRV RRRRCKARVG  HRVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKARVGPHHRVTK  158



>gb|KHG21292.1| 60S ribosomal protein L11-1 [Gossypium arboreum]
Length=228

 Score =   281 bits (718),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 157/176 (89%), Gaps = 17/176 (10%)
 Frame = +1

Query  67   AMASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSF  246
            AMASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSF
Sbjct  29   AMASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSF  88

Query  247  GIRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGI---  417
            GIRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGI   
Sbjct  89   GIRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGINSH  148

Query  418  --------------KYDPSTGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
                          +YDPSTGIYGMDFYVVLER GYRV RRRRCK+RVGIQHRVTK
Sbjct  149  LTRLSNRTRFGIINRYDPSTGIYGMDFYVVLERAGYRVGRRRRCKSRVGIQHRVTK  204



>gb|KHG21293.1| 60S ribosomal protein L11-1 [Gossypium arboreum]
Length=199

 Score =   278 bits (712),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 151/175 (86%), Positives = 156/175 (89%), Gaps = 17/175 (10%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGI----  417
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGI    
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGINSHL  120

Query  418  -------------KYDPSTGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
                         +YDPSTGIYGMDFYVVLER GYRV RRRRCK+RVGIQHRVTK
Sbjct  121  TRLSNRTRFGIINRYDPSTGIYGMDFYVVLERAGYRVGRRRRCKSRVGIQHRVTK  175



>gb|KHN20558.1| Endoglucanase 9 [Glycine soja]
Length=677

 Score =   291 bits (746),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 153/158 (97%), Positives = 157/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  497  MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  556

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  557  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  616

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK
Sbjct  617  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTK  654



>ref|XP_003565263.1| PREDICTED: 60S ribosomal protein L11 [Brachypodium distachyon]
 ref|XP_003568752.1| PREDICTED: 60S ribosomal protein L11 [Brachypodium distachyon]
 ref|XP_003571886.1| PREDICTED: 60S ribosomal protein L11 [Brachypodium distachyon]
Length=180

 Score =   276 bits (705),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 145/158 (92%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            M++EKK  NPMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MSTEKKQLNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLG+KYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGMKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLER GYRV+RRRRCKARVGI  RVTK
Sbjct  121  STGIYGMDFYVVLERAGYRVSRRRRCKARVGIHQRVTK  158



>gb|EMS61347.1| 60S ribosomal protein L11 [Triticum urartu]
Length=180

 Score =   275 bits (703),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            M++EKK  NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MSTEKKQLNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVT+RG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLG+KYDP
Sbjct  61   IRRNEKIACYVTIRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGMKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDF+VVLER GYRV+RRRRCKARVGI  RVTK
Sbjct  121  STGIYGMDFFVVLERAGYRVSRRRRCKARVGIHQRVTK  158



>gb|KHN11195.1| 60S ribosomal protein L11 [Glycine soja]
Length=171

 Score =   274 bits (700),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 144/148 (97%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +1

Query  100  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  279
            MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  60

Query  280  VTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  459
            VTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDF+
Sbjct  61   VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFF  120

Query  460  VVLERPGYrvarrrrckarvGIQHRVTK  543
            VVLERPGYRV RRRRCK+RVGIQHRVTK
Sbjct  121  VVLERPGYRVGRRRRCKSRVGIQHRVTK  148



>emb|CDY60533.1| BnaAnng16950D [Brassica napus]
 emb|CDY23103.1| BnaC09g18570D [Brassica napus]
 emb|CDY00582.1| BnaC04g23430D [Brassica napus]
 emb|CDX77611.1| BnaC07g18650D [Brassica napus]
Length=172

 Score =   273 bits (698),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 145/148 (98%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +1

Query  100  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  279
            MR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  60

Query  280  VTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  459
            VTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  460  VVLERPGYrvarrrrckarvGIQHRVTK  543
            VVLERPGYRVARRRRCKARVGIQHRVTK
Sbjct  121  VVLERPGYRVARRRRCKARVGIQHRVTK  148



>emb|CDY62552.1| BnaA03g58370D [Brassica napus]
 emb|CDY39447.1| BnaAnng05780D [Brassica napus]
 emb|CDX78887.1| BnaA01g09540D [Brassica napus]
Length=172

 Score =   273 bits (698),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 144/148 (97%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +1

Query  100  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  279
            MR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  60

Query  280  VTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  459
            VTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  460  VVLERPGYrvarrrrckarvGIQHRVTK  543
            VVLERPGYRVARRRRCK RVGIQHRVTK
Sbjct  121  VVLERPGYRVARRRRCKTRVGIQHRVTK  148



>dbj|BAJ85332.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95551.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMT17477.1| 60S ribosomal protein L11 [Aegilops tauschii]
Length=180

 Score =   273 bits (698),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            M++EKK  N MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MSTEKKQLNTMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVT+RG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLG+KYDP
Sbjct  61   IRRNEKIACYVTIRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGMKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDF+VVLER GYRV+RRRRCKARVGI  RVTK
Sbjct  121  STGIYGMDFFVVLERAGYRVSRRRRCKARVGIHQRVTK  158



>gb|ACN35575.1| unknown [Zea mays]
 gb|AFW71161.1| hypothetical protein ZEAMMB73_877153 [Zea mays]
 gb|AFW71162.1| hypothetical protein ZEAMMB73_877153 [Zea mays]
Length=172

 Score =   273 bits (697),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 144/148 (97%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +1

Query  100  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  279
            MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  60

Query  280  VTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  459
            VTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  460  VVLERPGYrvarrrrckarvGIQHRVTK  543
            VVLER GYRVARRRRCK+RVGIQHRVTK
Sbjct  121  VVLERAGYRVARRRRCKSRVGIQHRVTK  148



>pdb|3J61|J Chain J, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 gb|AAW50983.1| ribosomal protein L11 [Triticum aestivum]
 gb|EMT22063.1| 60S ribosomal protein L11 [Aegilops tauschii]
Length=180

 Score =   272 bits (696),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            M++EKK  NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MSTEKKQLNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVT+RG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLG+KYDP
Sbjct  61   IRRNEKIACYVTIRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGMKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDF+VVLER GYRV+RRRRCKARVGI  RVTK
Sbjct  121  STGIYGMDFFVVLERAGYRVSRRRRCKARVGIHQRVTK  158



>gb|ABR25412.1| 60S ribosomal protein l11 [Oryza sativa Indica Group]
Length=152

 Score =   271 bits (692),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 130/138 (94%), Positives = 136/138 (99%), Gaps = 0/138 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKK +NPMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGY  483
            STGIYGMDFYVVLER GY
Sbjct  121  STGIYGMDFYVVLERAGY  138



>ref|XP_010516520.1| PREDICTED: 60S ribosomal protein L11-1-like [Camelina sativa]
 gb|AAL69452.1| At2g42740/F7D19.26 [Arabidopsis thaliana]
Length=172

 Score =   271 bits (694),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 144/148 (97%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +1

Query  100  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  279
            MR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  60

Query  280  VTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  459
            VTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  460  VVLERPGYrvarrrrckarvGIQHRVTK  543
            VVLERPGYRVARRRRCKARVGIQHRVTK
Sbjct  121  VVLERPGYRVARRRRCKARVGIQHRVTK  148



>gb|ACD56663.1| putative ribosomal protein [Gossypium arboreum]
Length=172

 Score =   271 bits (694),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 142/148 (96%), Positives = 145/148 (98%), Gaps = 0/148 (0%)
 Frame = +1

Query  100  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  279
            MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  60

Query  280  VTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  459
            VTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  460  VVLERPGYrvarrrrckarvGIQHRVTK  543
            VVLER GYRV RRRRCK+ VGIQHRVTK
Sbjct  121  VVLERAGYRVGRRRRCKSSVGIQHRVTK  148



>ref|NP_851137.1| 60S ribosomal protein L11-2 [Arabidopsis thaliana]
 gb|AAM64289.1| ribosomal protein L11, cytosolic [Arabidopsis thaliana]
 gb|AED95296.1| 60S ribosomal protein L11-2 [Arabidopsis thaliana]
Length=172

 Score =   271 bits (693),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 143/148 (97%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +1

Query  100  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  279
            MR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  60

Query  280  VTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  459
            VTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  460  VVLERPGYrvarrrrckarvGIQHRVTK  543
            VVLERPGYRVARRRRCK RVGIQHRVTK
Sbjct  121  VVLERPGYRVARRRRCKTRVGIQHRVTK  148



>gb|AAT64021.1| putative ribosomal protein [Gossypium hirsutum]
 gb|AAT64031.1| putative ribosomal protein [Gossypium hirsutum]
 gb|ACD56649.1| putative ribosomal protein [Gossypioides kirkii]
 gb|KJB68370.1| hypothetical protein B456_010G241400 [Gossypium raimondii]
 gb|KJB69700.1| hypothetical protein B456_011G038200 [Gossypium raimondii]
Length=172

 Score =   271 bits (693),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 143/148 (97%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +1

Query  100  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  279
            MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  60

Query  280  VTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  459
            VTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  460  VVLERPGYrvarrrrckarvGIQHRVTK  543
            VVLER GYRV RRRRCK+RVGIQHRVTK
Sbjct  121  VVLERAGYRVGRRRRCKSRVGIQHRVTK  148



>gb|KJB34908.1| hypothetical protein B456_006G089700 [Gossypium raimondii]
Length=172

 Score =   271 bits (692),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 143/148 (97%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +1

Query  100  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  279
            MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  60

Query  280  VTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  459
            VTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  460  VVLERPGYrvarrrrckarvGIQHRVTK  543
            VVLER GYRV RRRRCK+RVGIQHRVTK
Sbjct  121  VVLERAGYRVGRRRRCKSRVGIQHRVTK  148



>ref|XP_007048734.1| Ribosomal L5P family protein isoform 2 [Theobroma cacao]
 gb|EOX92891.1| Ribosomal L5P family protein isoform 2 [Theobroma cacao]
Length=172

 Score =   271 bits (692),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 143/148 (97%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +1

Query  100  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  279
            MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  60

Query  280  VTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  459
            VTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  460  VVLERPGYrvarrrrckarvGIQHRVTK  543
            VVLER GYRV RRRRCK+RVGIQHRVTK
Sbjct  121  VVLERAGYRVGRRRRCKSRVGIQHRVTK  148



>emb|CBI22012.3| unnamed protein product [Vitis vinifera]
Length=173

 Score =   270 bits (691),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 142/148 (96%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +1

Query  100  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  279
            MR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  60

Query  280  VTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  459
            VTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDF+
Sbjct  61   VTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFF  120

Query  460  VVLERPGYrvarrrrckarvGIQHRVTK  543
            VVLERPGYRV RRRRCK+RVGIQHRVTK
Sbjct  121  VVLERPGYRVGRRRRCKSRVGIQHRVTK  148



>ref|XP_002981065.1| hypothetical protein SELMODRAFT_444767 [Selaginella moellendorffii]
 ref|XP_002982539.1| hypothetical protein SELMODRAFT_271568 [Selaginella moellendorffii]
 gb|EFJ16292.1| hypothetical protein SELMODRAFT_271568 [Selaginella moellendorffii]
 gb|EFJ17766.1| hypothetical protein SELMODRAFT_444767 [Selaginella moellendorffii]
Length=177

 Score =   269 bits (688),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 141/151 (93%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = +1

Query  91   NNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKI  270
             NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ PVFSKAR+TVRSFGIRRNEKI
Sbjct  5    QNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQQPVFSKARFTVRSFGIRRNEKI  64

Query  271  ACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGM  450
            ACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGM
Sbjct  65   ACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGM  124

Query  451  DFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            DF+VVLERPGYRVARRRRCK++VG + RVTK
Sbjct  125  DFFVVLERPGYRVARRRRCKSKVGHKQRVTK  155



>ref|XP_001751962.1| predicted protein [Physcomitrella patens]
 gb|EDQ83397.1| predicted protein [Physcomitrella patens]
Length=171

 Score =   269 bits (687),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 139/148 (94%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +1

Query  100  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  279
            MREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQ+PVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFGIRRNEKIACY  60

Query  280  VTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  459
            VTVRG+KAMQLLESGL+VKEYELLRRNFS++GCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGEKAMQLLESGLKVKEYELLRRNFSESGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  460  VVLERPGYrvarrrrckarvGIQHRVTK  543
            VVLERPGYRV RRRR K+RVGIQHRVTK
Sbjct  121  VVLERPGYRVGRRRRAKSRVGIQHRVTK  148



>tpg|DAA52967.1| TPA: hypothetical protein ZEAMMB73_694767 [Zea mays]
Length=831

 Score =   287 bits (735),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 150/158 (95%), Positives = 156/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKK +NPMRE+KVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREMKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTK  158



>ref|XP_006656151.1| PREDICTED: 60S ribosomal protein L11-like [Oryza brachyantha]
Length=172

 Score =   268 bits (686),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 141/148 (95%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +1

Query  100  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  279
            MREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQ+PVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFGIRRNEKIACY  60

Query  280  VTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  459
            VTVRG+KAMQLLESGL+VKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  460  VVLERPGYrvarrrrckarvGIQHRVTK  543
            VVLER GYRVARRRRCK+RVGIQHRVTK
Sbjct  121  VVLERAGYRVARRRRCKSRVGIQHRVTK  148



>gb|EMS66091.1| 60S ribosomal protein L11 [Triticum urartu]
Length=225

 Score =   270 bits (691),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 152/157 (97%), Gaps = 0/157 (0%)
 Frame = +1

Query  73   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  252
            ++EKK  NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQ+PVFSKARYTVRSFGI
Sbjct  47   STEKKQLNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFGI  106

Query  253  RRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  432
            RRNEKIACYVT+RG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLG+KYDPS
Sbjct  107  RRNEKIACYVTIRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGMKYDPS  166

Query  433  TGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            TGIYGMDF+VVLER GYRV+RRRRCKARVGI  RVTK
Sbjct  167  TGIYGMDFFVVLERAGYRVSRRRRCKARVGIHQRVTK  203



>gb|ADR71243.1| 60S ribosomal protein L11A [Hevea brasiliensis]
Length=172

 Score =   267 bits (683),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 142/148 (96%), Positives = 144/148 (97%), Gaps = 0/148 (0%)
 Frame = +1

Query  100  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  279
            MREIKVQK VLNISVGESGDRLTRAAKVLEQLSGQ PVFSKARYTVRSFGIR NEKIACY
Sbjct  1    MREIKVQKRVLNISVGESGDRLTRAAKVLEQLSGQAPVFSKARYTVRSFGIRCNEKIACY  60

Query  280  VTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  459
            VTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  460  VVLERPGYrvarrrrckarvGIQHRVTK  543
            VVLERPGYRV RRRRCK+RVGIQHRVTK
Sbjct  121  VVLERPGYRVGRRRRCKSRVGIQHRVTK  148



>emb|CDP15952.1| unnamed protein product [Coffea canephora]
Length=173

 Score =   267 bits (682),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 141/148 (95%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +1

Query  100  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  279
            MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFGIRRNEKIACY  60

Query  280  VTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  459
            VTVRGDKAMQLLESGL+VKEYELL+RNFS+TGCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGDKAMQLLESGLKVKEYELLKRNFSETGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  460  VVLERPGYrvarrrrckarvGIQHRVTK  543
            VVLERPGYRVARRRRCK+RVGI  RVTK
Sbjct  121  VVLERPGYRVARRRRCKSRVGIHQRVTK  148



>ref|XP_002438544.1| hypothetical protein SORBIDRAFT_10g021710 [Sorghum bicolor]
 gb|EER89911.1| hypothetical protein SORBIDRAFT_10g021710 [Sorghum bicolor]
Length=183

 Score =   266 bits (680),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 141/159 (89%), Positives = 149/159 (94%), Gaps = 1/159 (1%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLE-QLSGQTPVFSKARYTVRSF  246
            MASEKK +NPMREIKVQKLVLNISVGESGDRLTRAAK++     GQ+PVFSKARYTVRSF
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRAAKLMHLSWRGQSPVFSKARYTVRSF  60

Query  247  GIRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYD  426
            GIRRNEKI CYVTVRG+KAMQLLESGL+VKEYELLRRNFS+TGCFGFGIQEHIDLGIKYD
Sbjct  61   GIRRNEKIVCYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYD  120

Query  427  PSTGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            PSTGIYGMDFYVVLER GYRVARR RCK+RVGIQH VTK
Sbjct  121  PSTGIYGMDFYVVLERAGYRVARRCRCKSRVGIQHIVTK  159



>gb|AAB82139.1| ribosomal protein [Oryza sativa Indica Group]
Length=182

 Score =   266 bits (679),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 141/158 (89%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKK +NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQL GQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLIGQSPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKE ELLRR+ S+TGCFGFGIQEHIDLGI+ DP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKECELLRRSCSETGCFGFGIQEHIDLGIQCDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STG YGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK
Sbjct  121  STGFYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTK  158



>emb|CBI30709.3| unnamed protein product [Vitis vinifera]
Length=173

 Score =   263 bits (672),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 140/148 (95%), Positives = 144/148 (97%), Gaps = 0/148 (0%)
 Frame = +1

Query  100  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  279
            MR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSF IRRNEKIACY
Sbjct  1    MRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFAIRRNEKIACY  60

Query  280  VTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  459
            VTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  460  VVLERPGYrvarrrrckarvGIQHRVTK  543
            VVLERPGYRV RRRRCKARVG  HRVTK
Sbjct  121  VVLERPGYRVGRRRRCKARVGPHHRVTK  148



>gb|AAD21733.1| 60S ribosomal protein L11B [Arabidopsis thaliana]
Length=182

 Score =   261 bits (668),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 148/158 (94%), Gaps = 10/158 (6%)
 Frame = +1

Query  100  MREIKVQKLVLNISVGESGDRLTRAAKV----------LEQLSGQTPVFSKARYTVRSFG  249
            MR+IKVQKLVLNISVGESGDRLTRA+KV          LEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MRDIKVQKLVLNISVGESGDRLTRASKVPPVFYPFSVVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTK  158



>dbj|BAD53703.1| putative 60S ribosomal protein L11-1 [Oryza sativa Japonica Group]
Length=182

 Score =   260 bits (664),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 141/158 (89%), Positives = 147/158 (93%), Gaps = 10/158 (6%)
 Frame = +1

Query  100  MREIKVQKLVLNISVGESGDRLTRAAKV----------LEQLSGQTPVFSKARYTVRSFG  249
            MREIKVQKLVLNISVGESGDRLTRA+KV          LEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MREIKVQKLVLNISVGESGDRLTRASKVWPIFSMYFQVLEQLSGQSPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTK  158



>gb|AAQ96376.1| ribosomal protein L11-like protein [Solanum palustre]
Length=163

 Score =   257 bits (657),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 136/141 (96%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +1

Query  121  KLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACYVTVRGDK  300
            KLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFGIRRNEKIACYVTVRG+K
Sbjct  1    KLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFGIRRNEKIACYVTVRGEK  60

Query  301  AMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERPG  480
            AMQLLESGL+VKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERPG
Sbjct  61   AMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERPG  120

Query  481  YrvarrrrckarvGIQHRVTK  543
            YRVARRRRCK+RVGIQHRVTK
Sbjct  121  YRVARRRRCKSRVGIQHRVTK  141



>gb|KHN28096.1| 60S ribosomal protein L11 [Glycine soja]
Length=170

 Score =   257 bits (657),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 138/148 (93%), Positives = 142/148 (96%), Gaps = 1/148 (1%)
 Frame = +1

Query  100  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  279
            MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ PVFSK    +RSFGIRRNEKIACY
Sbjct  1    MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQAPVFSKG-TLIRSFGIRRNEKIACY  59

Query  280  VTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  459
            VTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDF+
Sbjct  60   VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFF  119

Query  460  VVLERPGYrvarrrrckarvGIQHRVTK  543
            VVLERPGYRV RRRRCK+RVGIQHRVTK
Sbjct  120  VVLERPGYRVGRRRRCKSRVGIQHRVTK  147



>gb|KDD76069.1| hypothetical protein H632_c370p1 [Helicosporidium sp. ATCC 50920]
Length=179

 Score =   253 bits (645),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKK  NPMR+I+V KLVLN  VGESGDRL +AAKVLEQL+GQ PVF +ARYTVR + 
Sbjct  1    MASEKKKQNPMRDIRVAKLVLNCEVGESGDRLQKAAKVLEQLTGQQPVFGRARYTVRQWS  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRR EKI+C+VTVRGDKA+QLLE+GL+VKEYELLRRNFSDTG FGFGI EHIDLGIKYDP
Sbjct  61   IRRGEKISCFVTVRGDKALQLLEAGLKVKEYELLRRNFSDTGNFGFGISEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRV++R+R  +RVG+QHRVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVSKRKRAPSRVGVQHRVTK  158



>ref|XP_011397124.1| 60S ribosomal protein L11-1 [Auxenochlorella protothecoides]
 gb|KFM24237.1| 60S ribosomal protein L11-1 [Auxenochlorella protothecoides]
Length=180

 Score =   251 bits (641),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            M ++KK +NPMREI+V KLVLN  VGESGDRL +AAKVLEQL+GQ PVF KARYTVR + 
Sbjct  1    MVADKKASNPMREIRVAKLVLNCCVGESGDRLQKAAKVLEQLTGQQPVFGKARYTVRQWS  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            +RRNEKI+C+VTVRG+KA+QLLE+GL+VKEYELLRRNFSD+G FGFGI EHIDLGIKYDP
Sbjct  61   VRRNEKISCHVTVRGEKALQLLEAGLKVKEYELLRRNFSDSGNFGFGITEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLERPGYRVA+RR+  ARVG+QHRVTK
Sbjct  121  STGIYGMDFYVVLERPGYRVAKRRKQLARVGVQHRVTK  158



>ref|XP_009617442.1| PREDICTED: 60S ribosomal protein L11-1-like [Nicotiana tomentosiformis]
Length=171

 Score =   249 bits (636),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 131/148 (89%), Positives = 139/148 (94%), Gaps = 0/148 (0%)
 Frame = +1

Query  100  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  279
            MREIKV KL LNIS+ ESGDRLTRAAKVLEQLSGQ+P+FSKARYTVRSFGIRRNEKI  Y
Sbjct  1    MREIKVHKLFLNISISESGDRLTRAAKVLEQLSGQSPIFSKARYTVRSFGIRRNEKIPYY  60

Query  280  VTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  459
            VTVRGDKAMQL ESGL+VKEYELLRRNFS+T CFGFGIQEHIDLGIKYDPSTGIYG++FY
Sbjct  61   VTVRGDKAMQLFESGLKVKEYELLRRNFSETSCFGFGIQEHIDLGIKYDPSTGIYGINFY  120

Query  460  VVLERPGYrvarrrrckarvGIQHRVTK  543
            VVLE PGYRVAR RRCK+RVGIQHRVTK
Sbjct  121  VVLEHPGYRVARHRRCKSRVGIQHRVTK  148



>emb|CBJ30107.1| conserved unknown protein [Ectocarpus siliculosus]
Length=173

 Score =   247 bits (630),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = +1

Query  91   NNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKI  270
             NPMR++KV KLVLN SVGESGDRLTRAAKVLEQL+GQ+PV+SKARYTVRSFGIRRNEKI
Sbjct  6    TNPMRDLKVDKLVLNCSVGESGDRLTRAAKVLEQLTGQSPVYSKARYTVRSFGIRRNEKI  65

Query  271  ACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGM  450
            AC+VTVRGDKA+++LE GL+VKEYEL R+NFS+TG FGFGIQEHIDLG+KYDPSTGIYGM
Sbjct  66   ACHVTVRGDKALEILERGLKVKEYELKRKNFSNTGSFGFGIQEHIDLGLKYDPSTGIYGM  125

Query  451  DFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            DF+VVL RPGYRVA+R+   A++G QH+VTK
Sbjct  126  DFFVVLNRPGYRVAKRKAKCAKIGYQHKVTK  156



>gb|KIY97763.1| 60S ribosomal protein L11, partial [Monoraphidium neglectum]
 gb|KIZ07647.1| 60S ribosomal protein L11 [Monoraphidium neglectum]
Length=180

 Score =   245 bits (625),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            M ++ K  NPMREI+V KLVLNI VGESGDRL +AAKVLEQL+GQ PV+ KARYTVRSF 
Sbjct  1    MVNDAKAGNPMREIRVSKLVLNICVGESGDRLQKAAKVLEQLTGQQPVYGKARYTVRSFS  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKI+C VTVRG+KAMQLL++GL+VKEYEL+R+NFS++G FGFGI EHIDLGIKYDP
Sbjct  61   IRRNEKISCSVTVRGEKAMQLLDAGLKVKEYELIRKNFSESGNFGFGISEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYV LERPGYRVARRRR  +RVG+QHRVTK
Sbjct  121  STGIYGMDFYVCLERPGYRVARRRRVHSRVGVQHRVTK  158



>ref|XP_005647682.1| ribosomal protein L5 [Coccomyxa subellipsoidea C-169]
 gb|EIE23138.1| ribosomal protein L5 [Coccomyxa subellipsoidea C-169]
Length=180

 Score =   244 bits (622),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            M ++KK  NPMREI+V KLVLNI VGESGDRL +AAKVLEQL+GQ PVF KARYTVR+F 
Sbjct  1    MVNDKKTTNPMREIRVAKLVLNICVGESGDRLQKAAKVLEQLTGQQPVFGKARYTVRTFA  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKI+  VTVRG+KA+QL+E+GL+VKEYELLRRNFS+TG FGFGI EHIDLGIKYDP
Sbjct  61   IRRNEKISTSVTVRGEKALQLIEAGLKVKEYELLRRNFSETGNFGFGINEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDFYVVLER GYRVARRR+  A+VG+QHRV K
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRQRLAKVGVQHRVGK  158



>tpe|CAL69062.1| TPA: putative 60S ribosomal protein L11 [Spadella cephaloptera]
Length=207

 Score =   241 bits (614),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 138/168 (82%), Gaps = 0/168 (0%)
 Frame = +1

Query  40   VSPSPRQPKAMASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFS  219
            ++ + +  K  A  KK NNPMR+IK+ KL LNI VGESGDRLTRAAKVLEQLSGQ PVFS
Sbjct  1    MAATTQAAKTKAVTKKANNPMRDIKIMKLCLNICVGESGDRLTRAAKVLEQLSGQQPVFS  60

Query  220  KARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQE  399
            KARYTVRSFGIRRNEKIAC+ TVRG KA ++LE GL+V EYEL R  FSDTG FGFG+QE
Sbjct  61   KARYTVRSFGIRRNEKIACHCTVRGPKAEEILEKGLKVVEYELRRDCFSDTGSFGFGLQE  120

Query  400  HIDLGIKYDPSTGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            HIDLGIKYDPS GIYG+DFYVVL R GY V +RR  K+ +G+QHRVTK
Sbjct  121  HIDLGIKYDPSIGIYGLDFYVVLGRAGYNVNQRRARKSTIGVQHRVTK  168



>gb|KJB57390.1| hypothetical protein B456_009G161300 [Gossypium raimondii]
Length=154

 Score =   238 bits (608),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 116/124 (94%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIK   
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKCKS  120

Query  430  STGI  441
              GI
Sbjct  121  RVGI  124



>gb|AFW65989.1| hypothetical protein ZEAMMB73_747842 [Zea mays]
Length=127

 Score =   236 bits (603),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/118 (97%), Positives = 117/118 (99%), Gaps = 0/118 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKK +NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKY  423
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKY
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKY  118



>ref|XP_010244733.1| PREDICTED: 60S ribosomal protein L11-1-like [Nelumbo nucifera]
Length=173

 Score =   238 bits (607),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 141/160 (88%), Gaps = 2/160 (1%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMREIKVQKLVLNISVG+SGD LTR AKVLEQLSGQTP+F KAR  V SFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGKSGDCLTRVAKVLEQLSGQTPIFLKARSIVWSFG  60

Query  250  I--RRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKY  423
            I  R NEKI CY T+RG+KA QLLESGL+VKEYELLRRNFSDTGCF F IQEHIDLGI Y
Sbjct  61   ISIRCNEKITCYATLRGEKAKQLLESGLKVKEYELLRRNFSDTGCFSFSIQEHIDLGINY  120

Query  424  DPSTGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            DPS GIYGMDFYV+ ERP YRVARRRRCK+ +GIQHRVTK
Sbjct  121  DPSIGIYGMDFYVIHERPRYRVARRRRCKSHIGIQHRVTK  160



>ref|XP_003628238.1| 60S ribosomal protein L11 [Medicago truncatula]
Length=117

 Score =   235 bits (599),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 114/117 (97%), Positives = 117/117 (100%), Gaps = 0/117 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIK  420
            IRRNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIK
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIK  117



>gb|KHN95345.1| 60S ribosomal protein L11 [Metarhizium album ARSEF 1941]
Length=173

 Score =   236 bits (602),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 139/158 (88%), Gaps = 1/158 (1%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            M+SEK LNNPMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MSSEK-LNNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIA +VTVRG KA ++LE GL+VKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            S GIYGMDFY  + RPG RV RRRR K+ +G  HR+ +
Sbjct  120  SIGIYGMDFYCCMTRPGERVTRRRRMKSTIGASHRIKR  157



>ref|XP_009261766.1| hypothetical protein FPSE_10374 [Fusarium pseudograminearum CS3096]
 ref|XP_011316841.1| 60S ribosomal protein L11 [Fusarium graminearum PH-1]
 gb|EKJ69441.1| hypothetical protein FPSE_10374 [Fusarium pseudograminearum CS3096]
 gb|ESU06356.1| 60S ribosomal protein L11 [Fusarium graminearum PH-1]
 gb|EYB33769.1| hypothetical protein FG05_01081 [Fusarium graminearum]
 emb|CEF73150.1| unnamed protein product [Fusarium graminearum]
Length=173

 Score =   236 bits (601),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 139/158 (88%), Gaps = 1/158 (1%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEK  NNPMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MASEK-ANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIA +VTVRG KA ++LE GL+VKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            S GIYGMDFY  + RPG RV RRRR K+++G  HR+ +
Sbjct  120  SIGIYGMDFYCCMTRPGERVTRRRRTKSKIGASHRIKR  157



>gb|AIU94837.1| 60S ribosomal protein [Phragmatopoma lapidosa]
Length=179

 Score =   236 bits (601),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 136/158 (86%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MA +KK NN MRE+++ KL LNI VGESGDRLTRAAKVLEQL+GQ PVFSKARYTVRSFG
Sbjct  1    MAEDKKKNNAMRELRILKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIA + TVRG KA ++LE GL+V+EYEL R NFS TG FGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIAVHCTVRGAKAEEILEKGLKVREYELRRNNFSGTGNFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            S GIYGMDFYVVL RPG+ V++RR+ K+ +G QHRVTK
Sbjct  121  SIGIYGMDFYVVLGRPGFNVSKRRKRKSVIGFQHRVTK  158



>gb|EGU80777.1| hypothetical protein FOXB_08644 [Fusarium oxysporum Fo5176]
 gb|EMT62178.1| 60S ribosomal protein L11 [Fusarium oxysporum f. sp. cubense 
race 4]
 gb|ENH60794.1| 60S ribosomal protein L11 [Fusarium oxysporum f. sp. cubense 
race 1]
 emb|CCT62200.1| probable ribosomal protein L11.e.A, cytosolic [Fusarium fujikuroi 
IMI 58289]
 gb|EWG37687.1| 60S ribosomal protein L11 [Fusarium verticillioides 7600]
 gb|EWG37688.1| 60S ribosomal protein L11 [Fusarium verticillioides 7600]
 gb|EWY94221.1| 60S ribosomal protein L11 [Fusarium oxysporum FOSC 3-a]
 gb|EWZ50488.1| 60S ribosomal protein L11 [Fusarium oxysporum Fo47]
 gb|EWZ92049.1| 60S ribosomal protein L11 [Fusarium oxysporum f. sp. lycopersici 
MN25]
 gb|EXA53310.1| 60S ribosomal protein L11 [Fusarium oxysporum f. sp. pisi HDV247]
 gb|EXK47721.1| 60S ribosomal protein L11 [Fusarium oxysporum f. sp. melonis 
26406]
 gb|EXK89881.1| 60S ribosomal protein L11 [Fusarium oxysporum f. sp. raphani 
54005]
 gb|EXL49418.1| 60S ribosomal protein L11 [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
 gb|EXL83529.1| 60S ribosomal protein L11 [Fusarium oxysporum f. sp. conglutinans 
race 2 54008]
 gb|EXM10892.1| 60S ribosomal protein L11 [Fusarium oxysporum f. sp. cubense 
tropical race 4 54006]
 gb|EXM28225.1| 60S ribosomal protein L11 [Fusarium oxysporum f. sp. vasinfectum 
25433]
Length=173

 Score =   236 bits (601),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 139/158 (88%), Gaps = 1/158 (1%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEK  NNPMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MASEK-ANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIA +VTVRG KA ++LE GL+VKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            S GIYGMDFY  + RPG RV RRRR K+R+G  HR+ +
Sbjct  120  SIGIYGMDFYCCMTRPGERVTRRRRTKSRIGASHRIKR  157



>gb|ACN26136.1| unknown [Zea mays]
Length=168

 Score =   235 bits (600),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/118 (97%), Positives = 117/118 (99%), Gaps = 0/118 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MA EKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MAHEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKY  423
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIKY
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKY  118



>gb|EQL04255.1| Ribosomal protein L5 [Ophiocordyceps sinensis CO18]
Length=173

 Score =   235 bits (600),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 139/158 (88%), Gaps = 1/158 (1%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEK  NNPMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MASEK-ANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIA +VTVRG KA ++LE GL+VKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            S GIYGMDFY  + RPG RV RRRR K+++G  HR+ +
Sbjct  120  SIGIYGMDFYCCMTRPGERVTRRRRMKSKIGASHRIKR  157



>ref|XP_007811586.1| 60S ribosomal protein L11 [Metarhizium acridum CQMa 102]
 ref|XP_007820170.1| Ribosomal protein L5 [Metarhizium robertsii ARSEF 23]
 gb|EFY88628.1| 60S ribosomal protein L11 [Metarhizium acridum CQMa 102]
 gb|EFZ00204.1| Ribosomal protein L5 [Metarhizium robertsii ARSEF 23]
 gb|EXV02661.1| 60S ribosomal protein L11 [Metarhizium robertsii]
 gb|KFG86990.1| 60S ribosomal protein L11 [Metarhizium anisopliae]
 gb|KID60088.1| Ribosomal protein L5, partial [Metarhizium anisopliae ARSEF 549]
 gb|KID88047.1| Ribosomal protein L5 [Metarhizium guizhouense ARSEF 977]
 gb|KIE01988.1| Ribosomal protein L5, partial [Metarhizium majus ARSEF 297]
Length=173

 Score =   235 bits (600),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 139/158 (88%), Gaps = 1/158 (1%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEK  NNPMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MASEK-ANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIA +VTVRG KA ++LE GL+VKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            S GIYGMDFY  + RPG RV RRRR K+R+G  HR+ +
Sbjct  120  SIGIYGMDFYCCMTRPGERVTRRRRMKSRIGASHRIKR  157



>gb|KDB13460.1| 60S ribosomal protein L11 [Ustilaginoidea virens]
Length=173

 Score =   235 bits (600),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 137/158 (87%), Gaps = 1/158 (1%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEK  NNPMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MASEK-ANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIA +VTVRG KA ++LE GL+VKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            S GIYGMDFY  + RPG RV RRRR K  +G  HR+ +
Sbjct  120  SIGIYGMDFYCCMTRPGERVTRRRRMKTTIGASHRIKR  157



>emb|CCE35354.1| probable ribosomal protein L11.e.A, cytosolic [Claviceps purpurea 
20.1]
Length=173

 Score =   235 bits (600),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 138/158 (87%), Gaps = 1/158 (1%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEK  NNPMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MASEK-ANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIA +VTVRG KA ++LE GL+VKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            S GIYGMDFY  + RPG RV+RRRR K  +G  HR+ +
Sbjct  120  SIGIYGMDFYCCMTRPGERVSRRRRMKNTIGASHRIKR  157



>emb|CEF97266.1| Ribosomal protein L5, conserved site [Ostreococcus tauri]
Length=179

 Score =   234 bits (598),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 140/159 (88%), Gaps = 2/159 (1%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MA +K   NPMR I++ KLVLNI VGESGDRLT+AAKVLEQL+GQ P+FSKARYTVR+FG
Sbjct  1    MAGDKS-ENPMRAIRIHKLVLNICVGESGDRLTKAAKVLEQLTGQQPIFSKARYTVRTFG  59

Query  250  IRRNEKIACYVTVRG-DKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYD  426
            IRRNEKI+ +VT+   DKAMQ+LESGL+VKE+ELL+RNFS TG FGFGI EHIDLGIKYD
Sbjct  60   IRRNEKISAHVTIGNRDKAMQILESGLKVKEFELLKRNFSATGNFGFGISEHIDLGIKYD  119

Query  427  PSTGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            PSTGIYGMDFYVVLERPGYRV RRR+ + ++G QH++TK
Sbjct  120  PSTGIYGMDFYVVLERPGYRVHRRRKQQKKIGKQHKLTK  158



>emb|CCI45988.1| unnamed protein product [Albugo candida]
Length=176

 Score =   234 bits (598),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MA +KK NN MREIKV KLV+N  VGESGD+LTRAA+VLEQL+GQ PV+SKARYTVRSFG
Sbjct  1    MAGDKKSNNAMREIKVDKLVINCCVGESGDKLTRAARVLEQLTGQKPVYSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKI+C+VTVRG+ A ++L+ GL+VKEYEL R+NFSDTG FGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKISCHVTVRGEMASEILDRGLKVKEYELKRKNFSDTGNFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            STGIYGMDF+VVL RPG RV+ R+  ++R+G  HR+ K
Sbjct  121  STGIYGMDFFVVLSRPGARVSHRKIQQSRIGAPHRLRK  158



>gb|EPX72141.1| 60S ribosomal protein L11 [Schizosaccharomyces octosporus yFS286]
 gb|EPX75112.1| 60S ribosomal protein L11 [Schizosaccharomyces octosporus yFS286]
Length=174

 Score =   234 bits (597),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 136/153 (89%), Gaps = 0/153 (0%)
 Frame = +1

Query  82   KKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRN  261
            +K  NPM+E+++ KLVLNIS+GESGDRLTRAAKVLEQLSGQTPVFSKARYT+R FGIRRN
Sbjct  3    EKAQNPMKELRISKLVLNISLGESGDRLTRAAKVLEQLSGQTPVFSKARYTIRRFGIRRN  62

Query  262  EKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGI  441
            EKI+C+VTVRG KA ++LE GL+VKEYEL RRNFS TG FGFGIQEHIDLGIKYDPS GI
Sbjct  63   EKISCHVTVRGPKAEEILERGLKVKEYELKRRNFSATGNFGFGIQEHIDLGIKYDPSIGI  122

Query  442  YGMDFYVVLERPGYrvarrrrckarvGIQHRVT  540
            YGMDFYVV++RPG RV RR+  ++R+G  H++T
Sbjct  123  YGMDFYVVMDRPGMRVTRRKAQRSRIGFTHKIT  155



>gb|KID77365.1| Ribosomal protein L5, partial [Metarhizium brunneum ARSEF 3297]
Length=173

 Score =   234 bits (597),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 139/158 (88%), Gaps = 1/158 (1%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEK  NNPMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MASEK-ANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKI+ +VTVRG KA ++LE GL+VKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKISVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            S GIYGMDFY  + RPG RV RRRR K+R+G  HR+ +
Sbjct  120  SIGIYGMDFYCCMTRPGERVTRRRRMKSRIGASHRIKR  157



>gb|KFA66324.1| hypothetical protein S40285_01884 [Stachybotrys chlorohalonata 
IBT 40285]
Length=173

 Score =   234 bits (596),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 139/158 (88%), Gaps = 1/158 (1%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEK  NNPMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MASEK-ANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKI+ +VTVRG KA ++LE GL+VKEYEL RRNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKISVHVTVRGPKAEEILERGLKVKEYELRRRNFSETGNFGFGISEHIDLGIKYDP  119

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            S GIYGMDFY  + RPG RV RRRR K++VG  H++ +
Sbjct  120  SIGIYGMDFYCCMTRPGERVTRRRRMKSKVGSNHKIKR  157



>emb|CCE35372.1| probable ribosomal protein L11.e.A, cytosolic [Claviceps purpurea 
20.1]
Length=173

 Score =   234 bits (596),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 138/158 (87%), Gaps = 1/158 (1%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            M+SEK  NNPMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MSSEK-ANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIA +VTVRG KA ++LE GL+VKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            S GIYGMDFY  + RPG RV+RRRR K  +G  HR+ +
Sbjct  120  SIGIYGMDFYCCMTRPGERVSRRRRMKNTIGASHRIKR  157



>ref|XP_007874680.1| hypothetical protein PNEG_02659 [Pneumocystis murina B123]
 gb|EMR08874.1| hypothetical protein PNEG_02659 [Pneumocystis murina B123]
Length=175

 Score =   234 bits (596),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +1

Query  82   KKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRN  261
            +K +NPMREIK+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYT+R+FGIRRN
Sbjct  4    EKGSNPMREIKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTIRAFGIRRN  63

Query  262  EKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGI  441
            EKI+ YVTVRG KA ++LE GL+VKEYEL R NFSDTG FGFGI EHIDL IKYDPS GI
Sbjct  64   EKISVYVTVRGAKAEEILERGLKVKEYELKRSNFSDTGNFGFGIHEHIDLNIKYDPSIGI  123

Query  442  YGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            +GM+FYVVL RPG+RV++RRRC++ VG  H+VTK
Sbjct  124  FGMNFYVVLGRPGFRVSKRRRCRSSVGSNHKVTK  157



>gb|EPY52057.1| 60S ribosomal protein L11 [Schizosaccharomyces cryophilus OY26]
Length=174

 Score =   233 bits (595),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 136/153 (89%), Gaps = 0/153 (0%)
 Frame = +1

Query  82   KKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRN  261
            +K  NPM+E+++ KLVLNIS+GESGDRLTRAAKVLEQLSGQTPVFSKARYT+R FGIRRN
Sbjct  3    EKAQNPMKELRISKLVLNISLGESGDRLTRAAKVLEQLSGQTPVFSKARYTIRRFGIRRN  62

Query  262  EKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGI  441
            EKI+C+VTVRG KA ++LE GL+VKEYEL RRNFS TG FGFGIQEHIDLGIKYDPS GI
Sbjct  63   EKISCHVTVRGPKAEEILERGLKVKEYELKRRNFSATGNFGFGIQEHIDLGIKYDPSIGI  122

Query  442  YGMDFYVVLERPGYrvarrrrckarvGIQHRVT  540
            YGMDFYVV++RPG RV RR+  ++R+G  H++T
Sbjct  123  YGMDFYVVMDRPGMRVTRRKAQRSRIGFPHKIT  155



>gb|KFA73465.1| hypothetical protein S40288_08466 [Stachybotrys chartarum IBT 
40288]
Length=173

 Score =   233 bits (595),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 140/158 (89%), Gaps = 1/158 (1%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEK +NNPMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MASEK-VNNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKI+ +VTVRG KA ++LE GL+VKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKISVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            S GIYGMDFY  + RPG RV RRRR K++VG  H++ +
Sbjct  120  SIGIYGMDFYCCMTRPGERVTRRRRMKSKVGSNHKIKR  157



>gb|EPY49528.1| 60S ribosomal protein L11 [Schizosaccharomyces cryophilus OY26]
Length=174

 Score =   233 bits (595),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 136/153 (89%), Gaps = 0/153 (0%)
 Frame = +1

Query  82   KKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRN  261
            +K  NPM+E+++ KLVLNIS+GESGDRLTRAAKVLEQLSGQTPVFSKARYT+R FGIRRN
Sbjct  3    EKAQNPMKELRISKLVLNISLGESGDRLTRAAKVLEQLSGQTPVFSKARYTIRRFGIRRN  62

Query  262  EKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGI  441
            EKI+C+VTVRG KA ++LE GL+VKEYEL RRNFS TG FGFGIQEHIDLGIKYDPS GI
Sbjct  63   EKISCHVTVRGPKAEEILERGLKVKEYELKRRNFSATGNFGFGIQEHIDLGIKYDPSIGI  122

Query  442  YGMDFYVVLERPGYrvarrrrckarvGIQHRVT  540
            YGMDFYVV++RPG RV RR+  ++R+G  H++T
Sbjct  123  YGMDFYVVMDRPGMRVTRRKAQRSRIGFPHKIT  155



>ref|XP_006963013.1| 60S ribosomal protein L11, L5 family [Trichoderma reesei QM6a]
 gb|EGR51550.1| 60S ribosomal protein L11, L5 family [Trichoderma reesei QM6a]
 gb|ETS04354.1| 60S ribosomal protein L11 [Trichoderma reesei RUT C-30]
Length=173

 Score =   233 bits (594),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 139/158 (88%), Gaps = 1/158 (1%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEK  +NPMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MASEK-ASNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIA +VTVRG KA ++LE GL+VKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            S GIYGMDFY  + RPG RV RRRR K+R+G  HR+ +
Sbjct  120  SIGIYGMDFYCCMTRPGERVTRRRRMKSRIGASHRIKR  157



>gb|KIL95260.1| hypothetical protein FAVG1_02195 [Fusarium avenaceum]
Length=173

 Score =   233 bits (594),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 139/158 (88%), Gaps = 1/158 (1%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MA+EK  NNPMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MATEK-ANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKI+ +VTVRG KA ++LE GL+VKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKISVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            S GIYGMDFY  + RPG RV RRRR K+R+G  HR+ +
Sbjct  120  SIGIYGMDFYCCMTRPGERVTRRRRTKSRIGASHRIKR  157



>gb|AFW81632.1| hypothetical protein ZEAMMB73_719378 [Zea mays]
Length=117

 Score =   231 bits (589),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/117 (96%), Positives = 116/117 (99%), Gaps = 0/117 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKK +NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIK  420
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIK
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIK  117



>ref|XP_006697554.1| putative ribosomal protein [Chaetomium thermophilum var. thermophilum 
DSM 1495]
 gb|EGS16972.1| putative ribosomal protein [Chaetomium thermophilum var. thermophilum 
DSM 1495]
Length=173

 Score =   233 bits (593),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 140/158 (89%), Gaps = 1/158 (1%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            M+SEK   NPMRE+++QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR FG
Sbjct  1    MSSEK-AQNPMRELRIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRQFG  59

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIA +VTVRG KA ++LE GL+VKEYEL RRNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRRRNFSETGNFGFGISEHIDLGIKYDP  119

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            S GIYGMDFY  + RPG RVA+RRRCK+R+G  HR+T+
Sbjct  120  SIGIYGMDFYCCMTRPGERVAKRRRCKSRIGASHRITR  157



>gb|KEY71076.1| hypothetical protein S7711_00899 [Stachybotrys chartarum IBT 
7711]
 gb|KFA50220.1| hypothetical protein S40293_03699 [Stachybotrys chartarum IBT 
40293]
Length=173

 Score =   233 bits (593),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 139/158 (88%), Gaps = 1/158 (1%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEK  NNPMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MASEK-ANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKI+ +VTVRG KA ++LE GL+VKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKISVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            S GIYGMDFY  + RPG RV RRRR K++VG  H++ +
Sbjct  120  SIGIYGMDFYCCMTRPGERVTRRRRMKSKVGSNHKIKR  157



>emb|CDS05445.1| Putative 60S ribosomal protein L11 [Absidia idahoensis var. thermophila]
Length=177

 Score =   233 bits (593),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 142/159 (89%), Gaps = 1/159 (1%)
 Frame = +1

Query  70   MASEKKLN-NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSF  246
            M++EK++  NPMR++K++KLVLNISVGESGDRLTRAAKVLEQL+GQTPV+SKARYTVR+F
Sbjct  1    MSAEKQVKKNPMRQLKIEKLVLNISVGESGDRLTRAAKVLEQLTGQTPVYSKARYTVRTF  60

Query  247  GIRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYD  426
            GIRRNEKIA +VTVRG KA ++LE GL+VKEYEL  RNFS+TG FGFGI EHIDLGIKYD
Sbjct  61   GIRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRARNFSETGNFGFGIDEHIDLGIKYD  120

Query  427  PSTGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            PS GIYGMD++VV+ RPGYRVARR++ K+ VG  HR+ K
Sbjct  121  PSIGIYGMDYFVVMGRPGYRVARRKQQKSTVGFNHRIKK  159



>ref|XP_003054198.1| 60S ribosomal protein L11 [Nectria haematococca mpVI 77-13-4]
 gb|EEU48485.1| predicted protein [Nectria haematococca mpVI 77-13-4]
Length=173

 Score =   233 bits (593),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 139/158 (88%), Gaps = 1/158 (1%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEK  +NPMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MASEK-TSNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIA +VTVRG KA ++LE GL+VKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            S GIYGMDFY  + RPG RV RRRR K+R+G  HR+ +
Sbjct  120  SIGIYGMDFYCCMTRPGERVTRRRRTKSRIGAGHRIKR  157



>emb|CDH52194.1| 60s ribosomal protein l11 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=177

 Score =   233 bits (593),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 141/159 (89%), Gaps = 1/159 (1%)
 Frame = +1

Query  70   MASEKKLN-NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSF  246
            M++EK++  NPMR++K++KLVLNISVGESGDRLTRAAKVLEQL+GQTPV+SKARYTVR+F
Sbjct  1    MSAEKQVKKNPMRQLKIEKLVLNISVGESGDRLTRAAKVLEQLTGQTPVYSKARYTVRTF  60

Query  247  GIRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYD  426
            GIRRNEKIA +VTVRG KA ++LE GL+VKEYEL  RNFS+TG FGFGI EHIDLGIKYD
Sbjct  61   GIRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRARNFSETGNFGFGIDEHIDLGIKYD  120

Query  427  PSTGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            PS GIYGMD++VV+ RPGYR+ARR+  K+ VG  HR+ K
Sbjct  121  PSIGIYGMDYFVVMGRPGYRIARRKHQKSTVGFNHRIKK  159



>gb|EHK50062.1| hypothetical protein TRIATDRAFT_297405 [Trichoderma atroviride 
IMI 206040]
Length=173

 Score =   232 bits (592),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 139/158 (88%), Gaps = 1/158 (1%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MA+EK  +NPMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MATEKS-SNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIA +VTVRG KA ++LE GL+VKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            S GIYGMDFY  + RPG RV RRRR K+++G  HR+ +
Sbjct  120  SIGIYGMDFYCCMTRPGERVTRRRRMKSKIGASHRIKR  157



>gb|EHK17585.1| hypothetical protein TRIVIDRAFT_76021 [Trichoderma virens Gv29-8]
Length=173

 Score =   232 bits (592),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 139/158 (88%), Gaps = 1/158 (1%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEK  +NPMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MASEK-TSNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIA +VTVRG KA ++LE GL+VKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            S GIYGMDFY  + RPG RV RRRR K+R+G  HR+ +
Sbjct  120  SIGIYGMDFYCCMTRPGERVTRRRRMKSRIGSSHRIKR  157



>gb|ELW68491.1| 60S ribosomal protein L11 [Tupaia chinensis]
Length=206

 Score =   233 bits (594),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 142/181 (78%), Gaps = 9/181 (5%)
 Frame = +1

Query  28   SLPAVSPSPRQPKAMASEKKL---------NNPMREIKVQKLVLNISVGESGDRLTRAAK  180
            ++P  +P  R P A  ++ +           NPMRE++++KL LNI VGESGDRLTRAAK
Sbjct  7    AVPVATPESRAPPASCADCRFPVQQDQGEKENPMRELRIRKLCLNICVGESGDRLTRAAK  66

Query  181  VLEQLSGQTPVFSKARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRN  360
            VLEQL+GQTPVFSKARYTVRSFGIRRNEKIA + TVRG KA ++LE GL+V+EYEL + N
Sbjct  67   VLEQLTGQTPVFSKARYTVRSFGIRRNEKIAVHCTVRGAKAEEILEKGLKVREYELRKNN  126

Query  361  FSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVT  540
            FSDTG FGFGIQEHIDLGIKYDPS GIYG+DFYVVL RPG+ +A ++R    +G +HR++
Sbjct  127  FSDTGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGRPGFSIADKKRRTGCIGAKHRIS  186

Query  541  K  543
            K
Sbjct  187  K  187



>gb|KCW89659.1| hypothetical protein EUGRSUZ_A01929 [Eucalyptus grandis]
Length=159

 Score =   231 bits (590),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 111/116 (96%), Positives = 116/116 (100%), Gaps = 0/116 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGI  417
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLG+
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGM  116



>ref|XP_001939101.1| 60S ribosomal protein L11 [Pyrenophora tritici-repentis Pt-1C-BFP]
 gb|EDU41820.1| 60S ribosomal protein L11 [Pyrenophora tritici-repentis Pt-1C-BFP]
Length=173

 Score =   232 bits (591),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +1

Query  76   SEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIR  255
            S+ K +NPMRE+++QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FGIR
Sbjct  2    SDSKASNPMRELRIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGIR  61

Query  256  RNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPST  435
            RNEKIA +VTVRG KA ++LE GL+VKEYEL +RNFS++G FGFGI EHIDLGIKYDPS 
Sbjct  62   RNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSESGNFGFGISEHIDLGIKYDPSI  121

Query  436  GIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            GIYGMDFYV + RPG RVA+RRRC++++G  HRV +
Sbjct  122  GIYGMDFYVCMTRPGERVAKRRRCQSKIGASHRVNQ  157



>gb|KFM71516.1| 60S ribosomal protein L11, partial [Stegodyphus mimosarum]
Length=187

 Score =   233 bits (593),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = +1

Query  58   QPKAMASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTV  237
            +PKA A ++K NN MRE++++KL LNI VGESGDRLTRAAKVLEQL+GQ PVFSKARYTV
Sbjct  13   KPKANAGKEKENNRMREVRIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTV  72

Query  238  RSFGIRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGI  417
            RSFGIRRNEKIA + TVRG KA ++LE GL+V+EYEL R NFSDTG FGFGIQEHIDLGI
Sbjct  73   RSFGIRRNEKIAVHCTVRGPKAEEILEKGLKVREYELKRENFSDTGNFGFGIQEHIDLGI  132

Query  418  KYDPSTGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            KYDP+ GIYG+DFYVVL RPG+ VA RRR K  VG +HR++K
Sbjct  133  KYDPTIGIYGLDFYVVLGRPGFNVAYRRRRKGVVGSKHRLSK  174



>ref|XP_003302643.1| 60S ribosomal protein L11 [Pyrenophora teres f. teres 0-1]
 gb|EFQ89243.1| hypothetical protein PTT_14551 [Pyrenophora teres f. teres 0-1]
Length=178

 Score =   232 bits (591),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +1

Query  76   SEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIR  255
            S+ K +NPMRE+++QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FGIR
Sbjct  7    SDSKASNPMRELRIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGIR  66

Query  256  RNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPST  435
            RNEKIA +VTVRG KA ++LE GL+VKEYEL +RNFS++G FGFGI EHIDLGIKYDPS 
Sbjct  67   RNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSESGNFGFGISEHIDLGIKYDPSI  126

Query  436  GIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            GIYGMDFYV + RPG RVA+RRRC++++G  HRV +
Sbjct  127  GIYGMDFYVCMTRPGERVAKRRRCQSKIGASHRVNQ  162



>ref|XP_003598138.1| 60S ribosomal protein L11-1 [Medicago truncatula]
 gb|AES68389.1| 50S ribosomal protein L5P [Medicago truncatula]
Length=241

 Score =   234 bits (597),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 128/163 (79%), Positives = 140/163 (86%), Gaps = 2/163 (1%)
 Frame = +1

Query  61   PKAMASEKKL-NNPMREIKVQKLVLNISVG-ESGDRLTRAAKVLEQLSGQTPVFSKARYT  234
            P   A EKKL NNP+R+IKVQKLVLNISVG ES  RLTRAA VL  LSGQTPV SKA++T
Sbjct  57   PPHQAYEKKLLNNPLRDIKVQKLVLNISVGGESRHRLTRAAMVLHHLSGQTPVLSKAKHT  116

Query  235  VRSFGIRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLG  414
            VRSFG RRNEKI+CYVTVRGDKAMQLLES L+VKEY+LL RNFSDTGCF F IQ+HI+LG
Sbjct  117  VRSFGNRRNEKISCYVTVRGDKAMQLLESSLKVKEYKLLSRNFSDTGCFCFSIQDHIELG  176

Query  415  IKYDPSTGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
             KYDPS GIYGM+F+VVLERPG RV RR R KAR+GIQHRVTK
Sbjct  177  FKYDPSIGIYGMNFFVVLERPGNRVGRRPRGKARLGIQHRVTK  219



>ref|XP_008782473.1| PREDICTED: 60S ribosomal protein L11-1 isoform X2 [Phoenix dactylifera]
Length=134

 Score =   230 bits (587),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 114/120 (95%), Positives = 117/120 (98%), Gaps = 1/120 (1%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKKL+NPMR IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRGIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIK-YD  426
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGI  YD
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGINGYD  120



>ref|XP_005988804.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Latimeria chalumnae]
Length=177

 Score =   232 bits (591),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 136/158 (86%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MA + +  NPMRE++++KL LNI VGESGDRLTRAAKVLEQL+GQTPVFSKARYTVRSFG
Sbjct  1    MAEKSEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIA + TVRG KA ++LE GL+V+EYEL + NFSDTG FGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            S GIYG+DFYVVL RPG+ +A ++R   R+G +HR++K
Sbjct  121  SIGIYGLDFYVVLGRPGFSIADKKRKTGRIGAKHRISK  158



>ref|XP_001794114.1| hypothetical protein SNOG_03556 [Phaeosphaeria nodorum SN15]
 gb|EAT88761.1| hypothetical protein SNOG_03556 [Phaeosphaeria nodorum SN15]
Length=173

 Score =   232 bits (591),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +1

Query  76   SEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIR  255
            S+ K +NPMRE+++QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FGIR
Sbjct  2    SDSKASNPMRELRIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGIR  61

Query  256  RNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPST  435
            RNEKIA +VTVRG KA ++LE GL+VKEYEL +RNFS++G FGFGI EHIDLGIKYDPS 
Sbjct  62   RNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSESGNFGFGISEHIDLGIKYDPSI  121

Query  436  GIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            GIYGMDFYV + RPG RVA+RRRCK+R+G  HRV +
Sbjct  122  GIYGMDFYVCMTRPGERVAKRRRCKSRIGASHRVNQ  157



>tpg|DAA52965.1| TPA: hypothetical protein ZEAMMB73_694767 [Zea mays]
Length=117

 Score =   230 bits (586),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 111/117 (95%), Positives = 116/117 (99%), Gaps = 0/117 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEKK +NPMRE+KVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREMKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIK  420
            IRRNEKIACYVTVRG+KAMQLLESGL+VKEYELLRRNFSDTGCFGFGIQEHIDLGIK
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIK  117



>ref|XP_008593474.1| 60S ribosomal protein L11 [Beauveria bassiana ARSEF 2860]
 gb|EJP70525.1| 60S ribosomal protein L11 [Beauveria bassiana ARSEF 2860]
 gb|KGQ11909.1| 60S ribosomal protein L11 [Beauveria bassiana D1-5]
Length=173

 Score =   232 bits (591),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 137/158 (87%), Gaps = 1/158 (1%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MASEK  NNPMRE+K+QKLVLNI VGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MASEK-ANNPMRELKIQKLVLNICVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKI+ +VTVRG KA ++LE GL+VKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKISVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            S GIYGMDFY  + RPG RV RRRR K+ +G  HR+ +
Sbjct  120  SIGIYGMDFYCCMTRPGERVTRRRRMKSTIGASHRIKR  157



>ref|NP_595899.1| 60S ribosomal protein L11 [Schizosaccharomyces pombe 972h-]
 ref|NP_594150.1| 60S ribosomal protein L11 [Schizosaccharomyces pombe 972h-]
 sp|Q10157.1|RL11_SCHPO RecName: Full=60S ribosomal protein L11 [Schizosaccharomyces 
pombe 972h-]
 emb|CAA93230.1| 60S ribosomal protein L11 (predicted) [Schizosaccharomyces pombe]
 dbj|BAA31552.1| ribosomal protein L11 homolog [Schizosaccharomyces pombe]
 emb|CAB52808.1| 60S ribosomal protein L11 (predicted) [Schizosaccharomyces pombe]
Length=174

 Score =   232 bits (591),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 135/153 (88%), Gaps = 0/153 (0%)
 Frame = +1

Query  82   KKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRN  261
            +K  NPM+E+++ KLVLNIS+GESGDRLTRAAKVLEQLSGQTPVFSKARYT+R FGIRRN
Sbjct  3    EKAQNPMKELRISKLVLNISLGESGDRLTRAAKVLEQLSGQTPVFSKARYTIRRFGIRRN  62

Query  262  EKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGI  441
            EKIAC+VTVRG KA ++LE GL+VKEYEL +RNFS TG FGFGIQEHIDLGIKYDPS GI
Sbjct  63   EKIACHVTVRGPKAEEILERGLKVKEYELKKRNFSATGNFGFGIQEHIDLGIKYDPSIGI  122

Query  442  YGMDFYVVLERPGYrvarrrrckarvGIQHRVT  540
            YGMDFYVV++RPG RVARR+  + RVG  H++ 
Sbjct  123  YGMDFYVVMDRPGMRVARRKAQRGRVGYTHKIN  155



>ref|XP_004678660.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Condylura cristata]
Length=177

 Score =   231 bits (590),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 135/158 (85%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MA + +  NPMRE++++KL LNI VGESGDRLTRAAKVLEQL+GQTPVFSKARYTVRSFG
Sbjct  1    MADQSEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIA + TVRG KA ++LE GL+V+EYEL + NFSDTG FGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            S GIYG+DFYVVL RPG+ +A ++R    +G +HR++K
Sbjct  121  SIGIYGLDFYVVLGRPGFSIADKKRRTGCIGAKHRISK  158



>ref|XP_965640.2| 60S ribosomal protein L11 [Neurospora crassa OR74A]
 ref|XP_009856785.1| 60S ribosomal protein L11 [Neurospora tetrasperma FGSC 2508]
 sp|Q7RVN0.2|RL11_NEUCR RecName: Full=60S ribosomal protein L11 [Neurospora crassa OR74A]
 gb|EAA36404.2| 60S ribosomal protein L11 [Neurospora crassa OR74A]
 gb|EGO53163.1| 60S ribosomal protein L11 [Neurospora tetrasperma FGSC 2508]
 gb|EGZ78005.1| 60S ribosomal protein L11 [Neurospora tetrasperma FGSC 2509]
 gb|KHE89934.1| 60S ribosomal protein L11 [Neurospora crassa]
Length=174

 Score =   231 bits (590),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            M++E+K  NPMRE+++QKLVLNI VGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MSTEQKAQNPMRELRIQKLVLNICVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKI+ +VTVRG KA ++LE GL+VKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  61   IRRNEKISVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
              GIYGMDFY  + RPG RV+RRRR K+RVG  HR+T+
Sbjct  121  GIGIYGMDFYCCMTRPGERVSRRRRAKSRVGATHRITR  158



>ref|XP_004603489.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Sorex araneus]
Length=177

 Score =   231 bits (590),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 135/158 (85%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MA + +  NPMRE++++KL LNI VGESGDRLTRAAKVLEQL+GQTPVFSKARYTVRSFG
Sbjct  1    MADQAEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIA + TVRG KA ++LE GL+V+EYEL + NFSDTG FGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            S GIYG+DFYVVL RPG+ +A ++R    +G +HR++K
Sbjct  121  SIGIYGLDFYVVLGRPGFSIADKKRRTGCIGAKHRISK  158



>emb|CCF73368.1| unnamed protein product [Babesia microti strain RI]
Length=174

 Score =   231 bits (590),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 135/153 (88%), Gaps = 0/153 (0%)
 Frame = +1

Query  85   KLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNE  264
            K  NPMR+I+V+KLVLNI VGESGDRLTRA KVLEQL+ Q PVFSK R T+RSFG+RRNE
Sbjct  4    KEENPMRDIRVKKLVLNIGVGESGDRLTRAGKVLEQLTDQRPVFSKCRLTIRSFGVRRNE  63

Query  265  KIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIY  444
            KIAC+VTVRG KAM +LE GL+VKEYEL R+NFSDTG FGFGIQEHIDLG+KYDPSTGIY
Sbjct  64   KIACHVTVRGKKAMDILERGLKVKEYELKRKNFSDTGNFGFGIQEHIDLGLKYDPSTGIY  123

Query  445  GMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            GMDFYV L RPGYRV +RR+CK+++G  H++TK
Sbjct  124  GMDFYVQLARPGYRVCKRRKCKSKIGASHKITK  156



>emb|CDH51840.1| 60s ribosomal protein l11 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=177

 Score =   231 bits (590),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 141/159 (89%), Gaps = 1/159 (1%)
 Frame = +1

Query  70   MASEKKLN-NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSF  246
            M++E+++  NPMR++K++KLVLNISVGESGDRLTRAAKVLEQL+GQTPV+SKARYTVR+F
Sbjct  1    MSAEQQVKKNPMRQLKIEKLVLNISVGESGDRLTRAAKVLEQLTGQTPVYSKARYTVRTF  60

Query  247  GIRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYD  426
            GIRRNEKIA +VTVRG KA ++LE GL+VKEYEL  RNFS+TG FGFGI EHIDLGIKYD
Sbjct  61   GIRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRARNFSETGNFGFGIDEHIDLGIKYD  120

Query  427  PSTGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            PS GIYGMD++VV+ RPGYR+ARR+  K+ VG  HR+ K
Sbjct  121  PSIGIYGMDYFVVMGRPGYRIARRKHQKSTVGFNHRIKK  159



>emb|CDX98322.1| BnaC06g16830D [Brassica napus]
Length=145

 Score =   230 bits (586),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 122/135 (90%), Gaps = 12/135 (9%)
 Frame = +1

Query  100  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSK--------ARYTVRSFGIR  255
            MR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSK        ARYTVRSFGIR
Sbjct  1    MRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKVLSLLCLSARYTVRSFGIR  60

Query  256  RNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPST  435
            RNEKIACYVTVRGDKAMQLLESGL+VKEYELLRRNFSDTGCFGF IQEHIDLGIKYDPST
Sbjct  61   RNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFVIQEHIDLGIKYDPST  120

Query  436  GIYG---MDFYVVLE  471
            G YG   MDFYVVLE
Sbjct  121  G-YGLEIMDFYVVLE  134



>ref|XP_006179217.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Camelus ferus]
 ref|XP_006196822.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Vicugna pacos]
Length=177

 Score =   231 bits (589),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 135/158 (85%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MA + +  NPMRE++++KL LNI VGESGDRLTRAAKVLEQL+GQTPVFSKARYTVRSFG
Sbjct  1    MADQGEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIA + TVRG KA ++LE GL+V+EYEL + NFSDTG FGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            S GIYG+DFYVVL RPG+ +A ++R    +G +HR++K
Sbjct  121  SIGIYGLDFYVVLGRPGFSIADKKRKTGCIGAKHRISK  158



>ref|XP_679576.1| 60S ribosomal protein L11a [Plasmodium berghei strain ANKA]
 ref|XP_741752.1| 60S ribosomal protein L11a [Plasmodium chabaudi chabaudi]
 ref|XP_730342.1| ribosomal protein L11 [Plasmodium yoelii yoelii 17XNL]
 gb|EAA21907.1| ribosomal protein L11-like [Plasmodium yoelii yoelii]
 emb|CAH98826.1| 60S ribosomal protein L11a, putative [Plasmodium berghei]
 emb|CAH89249.1| 60S ribosomal protein L11a, putative [Plasmodium chabaudi chabaudi]
 emb|CDR11742.1| 60S ribosomal protein L11a, putative [Plasmodium chabaudi chabaudi]
 emb|CDS45545.1| 60S ribosomal protein L11a, putative [Plasmodium berghei ANKA]
 emb|CDU17049.1| 60S ribosomal protein L11a, putative [Plasmodium yoelii]
 emb|CDZ14859.1| 60S ribosomal protein L11a, putative [Plasmodium yoelii]
Length=173

 Score =   231 bits (589),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = +1

Query  79   EKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRR  258
            EKK +N MREIKV KL+LNI VGESGDRLTRAA+VLEQL+ Q P+F K R+T+RSFG+RR
Sbjct  2    EKKEDNVMREIKVNKLILNICVGESGDRLTRAARVLEQLTEQKPIFGKCRFTIRSFGVRR  61

Query  259  NEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTG  438
            NEKI+C+VTVRG KA+++LE GL+VKEYEL R+NFSDTG FGFGIQEHIDLGIKYDPSTG
Sbjct  62   NEKISCFVTVRGKKALEILEKGLKVKEYELRRKNFSDTGNFGFGIQEHIDLGIKYDPSTG  121

Query  439  IYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            IYGMDFYV L RPGYRV RRRR ++ +   H+VTK
Sbjct  122  IYGMDFYVHLSRPGYRVTRRRRKRSTISKTHKVTK  156



>gb|AAX42399.1| ribosomal protein L11 [synthetic construct]
Length=177

 Score =   231 bits (589),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 135/158 (85%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MA + +  NPMRE++++KL LNI VGESGDRLTRAAKVLEQL+GQTPVFSKARYTVRSFG
Sbjct  1    MADQGEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIA + TVRG KA ++LE GL+V+EYEL + NFSDTG FGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            S GIYG+DFYVVL RPG+ +A ++R    +G +HR++K
Sbjct  121  SIGIYGLDFYVVLGRPGFSIANKKRRTGCIGAKHRISK  158



>emb|CDS03126.1| Putative 60S ribosomal protein L11 [Absidia idahoensis var. thermophila]
Length=177

 Score =   231 bits (589),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 141/159 (89%), Gaps = 1/159 (1%)
 Frame = +1

Query  70   MASEKKLN-NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSF  246
            M++E+++  NPMR++K++KLVLNISVGESGDRLTRAAKVLEQL+GQTPV+SKARYTVR+F
Sbjct  1    MSAEQQVKKNPMRQLKIEKLVLNISVGESGDRLTRAAKVLEQLTGQTPVYSKARYTVRTF  60

Query  247  GIRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYD  426
            GIRRNEKIA +VTVRG KA ++LE GL+VKEYEL  RNFS+TG FGFGI EHIDLGIKYD
Sbjct  61   GIRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRARNFSETGNFGFGIDEHIDLGIKYD  120

Query  427  PSTGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            PS GIYGMD++VV+ RPGYR+ARR+  K+ VG  HR+ K
Sbjct  121  PSIGIYGMDYFVVMGRPGYRIARRKHQKSAVGFSHRIKK  159



>ref|XP_001607270.1| PREDICTED: 60S ribosomal protein L11 [Nasonia vitripennis]
Length=195

 Score =   231 bits (590),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/173 (70%), Positives = 140/173 (81%), Gaps = 5/173 (3%)
 Frame = +1

Query  25   PSLPAVSPSPRQPKAMASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ  204
            P+ PAV  + ++PK  +      N MRE++++KL LNI VGESGDRLTRAAKVLEQL+GQ
Sbjct  8    PAKPAVKKTRKEPKDASK-----NVMREVRIRKLCLNICVGESGDRLTRAAKVLEQLTGQ  62

Query  205  TPVFSKARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFG  384
             PVFSKARYTVRSFGIRRNEKIA + TVRG KA ++LE GL+V+EYEL R NFS TG FG
Sbjct  63   QPVFSKARYTVRSFGIRRNEKIAVHCTVRGAKAEEILERGLKVREYELRRENFSCTGNFG  122

Query  385  FGIQEHIDLGIKYDPSTGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            FGIQEHIDLGIKYDPS GIYG+DFYVVL RPG+ VA RRR   +VG QHR+TK
Sbjct  123  FGIQEHIDLGIKYDPSIGIYGLDFYVVLGRPGFNVAHRRRKIGKVGFQHRLTK  175



>ref|XP_007785480.1| 60S ribosomal protein L11 [Endocarpon pusillum Z07020]
 gb|ERF77185.1| 60S ribosomal protein L11 [Endocarpon pusillum Z07020]
Length=175

 Score =   231 bits (589),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 138/153 (90%), Gaps = 0/153 (0%)
 Frame = +1

Query  85   KLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNE  264
            K +NPMRE+++ KLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVRSFGIRRNE
Sbjct  7    KSSNPMRELRIDKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRSFGIRRNE  66

Query  265  KIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIY  444
            KIA +VTVRG KA ++LE GL+VKEYEL ++NFSDTG FGFGI EHIDLGIKYDP+ GIY
Sbjct  67   KIAVHVTVRGPKAEEILERGLKVKEYELRKKNFSDTGNFGFGISEHIDLGIKYDPAIGIY  126

Query  445  GMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            GMDFY  + RPG RVARRRRCK+++G QH+VTK
Sbjct  127  GMDFYCCMSRPGARVARRRRCKSKIGKQHKVTK  159



>gb|AAX29834.1| ribosomal protein L11 [synthetic construct]
Length=178

 Score =   231 bits (589),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 135/158 (85%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MA + +  NPMRE++++KL LNI VGESGDRLTRAAKVLEQL+GQTPVFSKARYTVRSFG
Sbjct  1    MADQGEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIA + TVRG KA ++LE GL+V+EYEL + NFSDTG FGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            S GIYG+DFYVVL RPG+ +A ++R    +G +HR++K
Sbjct  121  SIGIYGLDFYVVLGRPGFSIADKKRRTGCIGAKHRISK  158



>ref|XP_004220956.1| 60S ribosomal protein L11 [Plasmodium cynomolgi strain B]
 dbj|GAB64825.1| 60S ribosomal protein L11 [Plasmodium cynomolgi strain B]
Length=173

 Score =   231 bits (588),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = +1

Query  79   EKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRR  258
            EKK +N MREIKV KLVLNI VGESGDRLTRAA+VLEQL+ Q P+F K R+T+RSFG+RR
Sbjct  2    EKKEDNVMREIKVNKLVLNICVGESGDRLTRAARVLEQLTEQKPIFGKCRFTIRSFGVRR  61

Query  259  NEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTG  438
            NEKI+C+VTVRG KA+++LE GL+VKEYEL R+NFS+TG FGFGIQEHIDLGIKYDPSTG
Sbjct  62   NEKISCFVTVRGKKALEILEKGLKVKEYELRRKNFSETGNFGFGIQEHIDLGIKYDPSTG  121

Query  439  IYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            IYGMDFYV L RPGYRV +RRR ++ +   H+VTK
Sbjct  122  IYGMDFYVHLSRPGYRVTKRRRKRSTISKTHKVTK  156



>ref|NP_001186731.1| 60S ribosomal protein L11 isoform 2 [Homo sapiens]
 ref|NP_001240836.1| 60S ribosomal protein L11 isoform 2 [Canis lupus familiaris]
 ref|XP_004592319.1| PREDICTED: 60S ribosomal protein L11 [Ochotona princeps]
 ref|XP_004637664.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Octodon degus]
 ref|XP_005394827.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Chinchilla lanigera]
 ref|XP_006094109.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Myotis lucifugus]
 ref|XP_006145208.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Tupaia chinensis]
 ref|XP_006777626.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Myotis davidii]
 ref|XP_006737646.1| PREDICTED: 60S ribosomal protein L11 isoform X3 [Leptonychotes 
weddellii]
 ref|XP_006883589.1| PREDICTED: 60S ribosomal protein L11-like isoform X2 [Elephantulus 
edwardii]
 ref|XP_007459240.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Lipotes vexillifer]
 ref|XP_008059999.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Tarsius syrichta]
 ref|XP_008146325.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Eptesicus fuscus]
 ref|XP_008571168.1| PREDICTED: 60S ribosomal protein L11 isoform X3 [Galeopterus 
variegatus]
 gb|AAD20460.3| ribosomal protein L11 [Homo sapiens]
 gb|AAH18970.1| Ribosomal protein L11 [Homo sapiens]
 gb|ABM87711.1| ribosomal protein L11 [synthetic construct]
 gb|ABW03860.1| ribosomal protein L11 [synthetic construct]
 gb|AIC49613.1| RPL11, partial [synthetic construct]
Length=177

 Score =   231 bits (589),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 135/158 (85%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MA + +  NPMRE++++KL LNI VGESGDRLTRAAKVLEQL+GQTPVFSKARYTVRSFG
Sbjct  1    MADQGEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIA + TVRG KA ++LE GL+V+EYEL + NFSDTG FGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            S GIYG+DFYVVL RPG+ +A ++R    +G +HR++K
Sbjct  121  SIGIYGLDFYVVLGRPGFSIADKKRRTGCIGAKHRISK  158



>ref|XP_007702064.1| hypothetical protein COCSADRAFT_28532 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD62134.1| hypothetical protein COCSADRAFT_28532 [Bipolaris sorokiniana 
ND90Pr]
Length=176

 Score =   231 bits (588),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +1

Query  76   SEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIR  255
            S+ K +NPMRE+++QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FGIR
Sbjct  5    SDSKASNPMRELRIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGIR  64

Query  256  RNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPST  435
            RNEKIA +VTVRG KA ++LE GL+VKEYEL +RNFS++G FGFGI EHIDLGIKYDPS 
Sbjct  65   RNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSESGNFGFGISEHIDLGIKYDPSI  124

Query  436  GIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            GIYGMDFYV + RPG RVA+RRRCK+++G  HRV +
Sbjct  125  GIYGMDFYVCMTRPGERVAKRRRCKSKIGPSHRVNQ  160



>ref|XP_006862372.1| PREDICTED: 60S ribosomal protein L11 [Chrysochloris asiatica]
Length=177

 Score =   231 bits (588),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 135/158 (85%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  249
            MA + +  NPMRE++++KL LNI VGESGDRLTRAAKVLEQL+GQTPVFSKARYTVRSFG
Sbjct  1    MADQGEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFG  60

Query  250  IRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  429
            IRRNEKIA + TVRG KA ++LE GL+V+EYEL + NFSDTG FGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIAVHCTVRGAKAEEILERGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDP  120

Query  430  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            S GIYG+DFYVVL RPG+ +A ++R    +G +HR++K
Sbjct  121  SIGIYGLDFYVVLGRPGFSIADKKRRTGCIGAKHRISK  158



>ref|XP_003833556.1| similar to 60s ribosomal protein l11 [Leptosphaeria maculans 
JN3]
 emb|CBX90191.1| similar to 60s ribosomal protein l11 [Leptosphaeria maculans 
JN3]
Length=172

 Score =   231 bits (588),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 138/153 (90%), Gaps = 0/153 (0%)
 Frame = +1

Query  85   KLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNE  264
            K +NPMRE+++QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FGIRRNE
Sbjct  4    KSSNPMRELRIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGIRRNE  63

Query  265  KIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIY  444
            KIA +VTVRG KA ++LE GL+VKEYEL +RNFS++G FGFGI EHIDLGIKYDPS GIY
Sbjct  64   KIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSESGNFGFGISEHIDLGIKYDPSIGIY  123

Query  445  GMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            GMDFYV + RPG RVA+RRRC++++G  HRV K
Sbjct  124  GMDFYVCMTRPGERVAKRRRCQSKIGASHRVNK  156



>gb|AGM32143.1| 60S ribosomal protein L11 [Coptotermes formosanus]
Length=201

 Score =   231 bits (590),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 138/171 (81%), Gaps = 6/171 (4%)
 Frame = +1

Query  34   PAVSPSPR-QPKAMASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTP  210
            PA +  PR +PK      K  NPMRE++++KL LNI VGESGDRLTRAAKVLE L+GQ P
Sbjct  15   PAKAKKPRKEPK-----DKSKNPMREVRIRKLCLNICVGESGDRLTRAAKVLESLTGQQP  69

Query  211  VFSKARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLEVKEYELLRRNFSDTGCFGFG  390
            VFSKARYTVRSFGIRRNEKIA + TVRG KA ++LE GL+V+EYEL + NFSDTG FGFG
Sbjct  70   VFSKARYTVRSFGIRRNEKIAVHCTVRGAKAEEILERGLKVREYELRKDNFSDTGNFGFG  129

Query  391  IQEHIDLGIKYDPSTGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTK  543
            IQEHIDLGIKYDPS GIYG+DFYVVL RPG+ VA RRR    VG QHR+TK
Sbjct  130  IQEHIDLGIKYDPSVGIYGLDFYVVLGRPGFNVAHRRRKTGMVGFQHRLTK  180



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 579015689490