BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001G10

Length=341
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AFW90598.1|  E3 ubiquitin ligase                                   96.3    3e-22   Solanum tuberosum [potatoes]
ref|XP_004232585.1|  PREDICTED: RING-H2 finger protein ATL8-like      96.7    4e-22   Solanum lycopersicum
ref|XP_006342165.1|  PREDICTED: RING-H2 finger protein ATL80-like     93.6    4e-21   Solanum tuberosum [potatoes]
ref|XP_002274304.2|  PREDICTED: RING-H2 finger protein ATL8           93.6    9e-21   
ref|XP_004238452.1|  PREDICTED: RING-H2 finger protein ATL80-like     92.4    1e-20   Solanum lycopersicum
emb|CAN59779.1|  hypothetical protein VITISV_024654                   94.0    2e-20   Vitis vinifera
ref|XP_004253118.1|  PREDICTED: RING-H2 finger protein ATL8-like      92.0    2e-20   Solanum lycopersicum
ref|XP_002276539.1|  PREDICTED: RING-H2 finger protein ATL80          91.7    2e-20   Vitis vinifera
emb|CDP01769.1|  unnamed protein product                              92.4    2e-20   Coffea canephora [robusta coffee]
ref|XP_006342531.1|  PREDICTED: RING-H2 finger protein ATL80-like     91.3    4e-20   Solanum tuberosum [potatoes]
ref|XP_010270525.1|  PREDICTED: RING-H2 finger protein ATL80          90.9    5e-20   Nelumbo nucifera [Indian lotus]
ref|XP_009766634.1|  PREDICTED: RING-H2 finger protein ATL8-like      90.9    5e-20   Nicotiana sylvestris
ref|XP_009595867.1|  PREDICTED: RING-H2 finger protein ATL80          90.9    6e-20   Nicotiana tomentosiformis
ref|XP_004145558.1|  PREDICTED: RING-H2 finger protein ATL80-like     90.5    6e-20   Cucumis sativus [cucumbers]
ref|XP_009359625.1|  PREDICTED: RING-H2 finger protein ATL80-like...  90.9    7e-20   
ref|XP_009359623.1|  PREDICTED: RING-H2 finger protein ATL80-like...  90.9    1e-19   Pyrus x bretschneideri [bai li]
ref|XP_007156261.1|  hypothetical protein PHAVU_003G271400g           90.1    1e-19   Phaseolus vulgaris [French bean]
gb|KJB14191.1|  hypothetical protein B456_002G113500                  89.4    2e-19   Gossypium raimondii
ref|XP_008242103.1|  PREDICTED: RING-H2 finger protein ATL8           89.7    2e-19   Prunus mume [ume]
ref|XP_008453009.1|  PREDICTED: RING-H2 finger protein ATL80          89.0    2e-19   Cucumis melo [Oriental melon]
ref|XP_002510714.1|  protein with unknown function                    89.0    3e-19   Ricinus communis
ref|XP_008379650.1|  PREDICTED: RING-H2 finger protein ATL80-like     89.0    4e-19   Malus domestica [apple tree]
ref|XP_009604464.1|  PREDICTED: RING-H2 finger protein ATL80-like     88.2    5e-19   Nicotiana tomentosiformis
ref|XP_010266252.1|  PREDICTED: RING-H2 finger protein ATL80          88.2    6e-19   Nelumbo nucifera [Indian lotus]
gb|AFK44145.1|  unknown                                               86.3    7e-19   Medicago truncatula
ref|XP_009776172.1|  PREDICTED: RING-H2 finger protein ATL8-like      87.8    9e-19   Nicotiana sylvestris
ref|XP_002526834.1|  protein with unknown function                    87.8    1e-18   Ricinus communis
ref|XP_003533404.1|  PREDICTED: RING-H2 finger protein ATL80-like     87.4    1e-18   Glycine max [soybeans]
ref|XP_002307200.1|  hypothetical protein POPTR_0005s10190g           87.4    1e-18   Populus trichocarpa [western balsam poplar]
ref|XP_004287710.1|  PREDICTED: RING-H2 finger protein ATL8           87.0    2e-18   Fragaria vesca subsp. vesca
ref|XP_002526830.1|  protein with unknown function                    87.8    2e-18   
ref|XP_006390200.1|  hypothetical protein EUTSA_v10019183mg           85.9    3e-18   Eutrema salsugineum [saltwater cress]
ref|XP_004253245.1|  PREDICTED: RING-H2 finger protein ATL80-like     85.9    4e-18   Solanum lycopersicum
ref|XP_003547882.1|  PREDICTED: RING-H2 finger protein ATL80-like     85.9    4e-18   Glycine max [soybeans]
ref|XP_011022135.1|  PREDICTED: RING-H2 finger protein ATL8-like      85.9    4e-18   Populus euphratica
ref|XP_003612411.1|  Ring finger protein                              85.9    5e-18   Medicago truncatula
ref|XP_008392292.1|  PREDICTED: RING-H2 finger protein ATL80-like     85.9    5e-18   
ref|XP_009338623.1|  PREDICTED: RING-H2 finger protein ATL80-like     85.9    6e-18   
ref|XP_004512286.1|  PREDICTED: RING-H2 finger protein ATL8-like      85.9    6e-18   Cicer arietinum [garbanzo]
ref|XP_006366657.1|  PREDICTED: RING-H2 finger protein ATL80-like     85.1    6e-18   Solanum tuberosum [potatoes]
ref|XP_009775127.1|  PREDICTED: RING-H2 finger protein ATL80-like     85.1    8e-18   Nicotiana sylvestris
ref|XP_004234505.1|  PREDICTED: RING-H2 finger protein ATL8-like      84.7    1e-17   Solanum lycopersicum
ref|XP_006343322.1|  PREDICTED: RING-H2 finger protein ATL8-like      84.3    1e-17   Solanum tuberosum [potatoes]
ref|XP_010064613.1|  PREDICTED: RING-H2 finger protein ATL80          84.7    1e-17   Eucalyptus grandis [rose gum]
ref|XP_006302871.1|  hypothetical protein CARUB_v10021002mg           84.3    1e-17   Capsella rubella
ref|XP_010498523.1|  PREDICTED: RING-H2 finger protein ATL80-like     84.7    1e-17   Camelina sativa [gold-of-pleasure]
ref|XP_009601753.1|  PREDICTED: RING-H2 finger protein ATL80-like     84.3    1e-17   Nicotiana tomentosiformis
ref|XP_009104676.1|  PREDICTED: RING-H2 finger protein ATL8-like      84.3    1e-17   Brassica rapa
ref|XP_009620555.1|  PREDICTED: RING-H2 finger protein ATL80-like     84.3    2e-17   Nicotiana tomentosiformis
ref|XP_009772726.1|  PREDICTED: RING-H2 finger protein ATL80-like     84.3    2e-17   Nicotiana sylvestris
ref|XP_009589982.1|  PREDICTED: RING-H2 finger protein ATL8-like      84.3    2e-17   Nicotiana tomentosiformis
ref|XP_010471794.1|  PREDICTED: RING-H2 finger protein ATL8-like      84.3    2e-17   Camelina sativa [gold-of-pleasure]
emb|CDX68098.1|  BnaA07g21380D                                        84.0    2e-17   
gb|ADI71977.1|  E3 ubiquitin ligase                                   84.3    2e-17   Capsicum annuum
ref|XP_009795598.1|  PREDICTED: RING-H2 finger protein ATL80-like     84.0    2e-17   Nicotiana sylvestris
ref|XP_006303328.1|  hypothetical protein CARUB_v10010177mg           84.7    2e-17   
ref|XP_010416561.1|  PREDICTED: RING-H2 finger protein ATL8           84.0    2e-17   Camelina sativa [gold-of-pleasure]
gb|KFK42061.1|  hypothetical protein AALP_AA2G206300                  83.6    2e-17   Arabis alpina [alpine rockcress]
ref|XP_004509462.1|  PREDICTED: RING-H2 finger protein ATL80-like     84.0    2e-17   Cicer arietinum [garbanzo]
ref|XP_010462813.1|  PREDICTED: RING-H2 finger protein ATL80-like     84.3    2e-17   
gb|KDP36758.1|  hypothetical protein JCGZ_08049                       84.0    2e-17   Jatropha curcas
ref|XP_010686796.1|  PREDICTED: RING-H2 finger protein ATL80          83.6    2e-17   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003517122.1|  PREDICTED: RING-H2 finger protein ATL8-like      84.0    3e-17   Glycine max [soybeans]
ref|XP_010477335.1|  PREDICTED: RING-H2 finger protein ATL80          83.6    3e-17   Camelina sativa [gold-of-pleasure]
emb|CDY45988.1|  BnaA02g18080D                                        83.2    3e-17   Brassica napus [oilseed rape]
ref|XP_007158027.1|  hypothetical protein PHAVU_002G118000g           83.6    4e-17   Phaseolus vulgaris [French bean]
ref|XP_003537694.1|  PREDICTED: RING-H2 finger protein ATL8-like      83.6    4e-17   Glycine max [soybeans]
ref|XP_010534292.1|  PREDICTED: RING-H2 finger protein ATL80-like     83.2    5e-17   Tarenaya hassleriana [spider flower]
ref|XP_007202550.1|  hypothetical protein PRUPE_ppa011201mg           83.6    5e-17   Prunus persica
ref|XP_010428701.1|  PREDICTED: RING-H2 finger protein ATL8-like      82.8    5e-17   Camelina sativa [gold-of-pleasure]
ref|XP_011074071.1|  PREDICTED: RING-H2 finger protein ATL80-like     82.8    6e-17   
ref|XP_010432277.1|  PREDICTED: RING-H2 finger protein ATL45-like     82.8    7e-17   Camelina sativa [gold-of-pleasure]
emb|CDX85948.1|  BnaC06g21860D                                        82.4    8e-17   
ref|XP_010437466.1|  PREDICTED: RING-H2 finger protein ATL45-like     82.0    1e-16   Camelina sativa [gold-of-pleasure]
ref|NP_177767.1|  RING-H2 finger protein ATL8                         81.6    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006416360.1|  hypothetical protein EUTSA_v10009964mg           82.0    1e-16   Eutrema salsugineum [saltwater cress]
gb|AAM63811.1|  putative RING zinc finger protein                     81.6    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011100182.1|  PREDICTED: RING-H2 finger protein ATL80-like     81.6    1e-16   Sesamum indicum [beniseed]
ref|XP_009109289.1|  PREDICTED: RING-H2 finger protein ATL45-like     81.3    2e-16   Brassica rapa
gb|KDO85202.1|  hypothetical protein CISIN_1g043163mg                 80.9    2e-16   Citrus sinensis [apfelsine]
ref|XP_006435418.1|  hypothetical protein CICLE_v10004041mg           81.3    2e-16   Citrus clementina [clementine]
ref|XP_002887637.1|  hypothetical protein ARALYDRAFT_316562           80.9    2e-16   Arabidopsis lyrata subsp. lyrata
gb|EYU23603.1|  hypothetical protein MIMGU_mgv1a014346mg              80.9    3e-16   Erythranthe guttata [common monkey flower]
ref|NP_173506.1|  RING-H2 finger protein ATL80                        80.9    3e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006412098.1|  hypothetical protein EUTSA_v10027339mg           80.9    3e-16   Eutrema salsugineum [saltwater cress]
ref|XP_010446920.1|  PREDICTED: RING-H2 finger protein ATL45-like     80.5    4e-16   Camelina sativa [gold-of-pleasure]
ref|XP_002532473.1|  protein with unknown function                    80.9    4e-16   
ref|XP_004159747.1|  PREDICTED: RING-H2 finger protein ATL80-like     80.1    4e-16   
ref|XP_007018117.1|  RING/U-box superfamily protein, putative         80.5    4e-16   Theobroma cacao [chocolate]
emb|CDY41651.1|  BnaC03g62330D                                        80.5    4e-16   Brassica napus [oilseed rape]
ref|XP_008449155.1|  PREDICTED: RING-H2 finger protein ATL80          79.7    5e-16   Cucumis melo [Oriental melon]
ref|XP_004146217.1|  PREDICTED: RING-H2 finger protein ATL80-like     80.1    6e-16   Cucumis sativus [cucumbers]
ref|XP_009103326.1|  PREDICTED: RING-H2 finger protein ATL80-like     79.7    7e-16   Brassica rapa
gb|ABK56013.1|  zinc finger protein                                   79.7    7e-16   Brassica rapa
emb|CDY29504.1|  BnaA06g14660D                                        79.7    7e-16   Brassica napus [oilseed rape]
ref|XP_009149561.1|  PREDICTED: RING-H2 finger protein ATL80          79.7    8e-16   Brassica rapa
ref|XP_003629097.1|  Ring finger protein                              79.7    8e-16   Medicago truncatula
ref|XP_006298646.1|  hypothetical protein CARUB_v10014735mg           79.3    9e-16   Capsella rubella
ref|XP_010908037.1|  PREDICTED: RING-H2 finger protein ATL8-like      79.3    9e-16   
ref|NP_001241583.1|  uncharacterized protein LOC100794614             79.3    9e-16   Glycine max [soybeans]
ref|XP_009413072.1|  PREDICTED: RING-H2 finger protein ATL80-like     79.3    1e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009150790.1|  PREDICTED: RING-H2 finger protein ATL44-like     79.0    1e-15   Brassica rapa
emb|CDY01352.1|  BnaA07g11250D                                        79.0    1e-15   
emb|CDY31863.1|  BnaC07g15130D                                        78.6    1e-15   Brassica napus [oilseed rape]
ref|XP_006285317.1|  hypothetical protein CARUB_v10006700mg           79.0    2e-15   Capsella rubella
gb|EPS68943.1|  hypothetical protein M569_05824                       78.6    2e-15   Genlisea aurea
ref|XP_002301903.1|  zinc finger family protein                       78.6    2e-15   Populus trichocarpa [western balsam poplar]
ref|XP_011034822.1|  PREDICTED: RING-H2 finger protein ATL8-like      78.6    2e-15   Populus euphratica
ref|XP_002890411.1|  zinc finger family protein                       78.2    3e-15   
ref|XP_010515011.1|  PREDICTED: RING-H2 finger protein ATL44          78.2    3e-15   Camelina sativa [gold-of-pleasure]
ref|XP_008779008.1|  PREDICTED: RING-H2 finger protein ATL8-like      78.2    3e-15   Phoenix dactylifera
emb|CDX72540.1|  BnaC07g45620D                                        77.8    3e-15   
ref|XP_010489373.1|  PREDICTED: RING-H2 finger protein ATL44-like     77.8    3e-15   Camelina sativa [gold-of-pleasure]
ref|XP_006409305.1|  hypothetical protein EUTSA_v10023141mg           77.8    4e-15   Eutrema salsugineum [saltwater cress]
ref|XP_009138362.1|  PREDICTED: RING-H2 finger protein ATL45-like     77.8    4e-15   Brassica rapa
ref|NP_179337.1|  RING-H2 finger protein ATL44                        77.8    4e-15   Arabidopsis thaliana [mouse-ear cress]
gb|KDP43788.1|  hypothetical protein JCGZ_22415                       77.8    4e-15   Jatropha curcas
emb|CDY31495.1|  BnaC05g16040D                                        77.8    5e-15   Brassica napus [oilseed rape]
emb|CDY69366.1|  BnaAnng30200D                                        77.4    5e-15   Brassica napus [oilseed rape]
ref|XP_010467517.1|  PREDICTED: RING-H2 finger protein ATL44-like     77.4    5e-15   Camelina sativa [gold-of-pleasure]
ref|XP_002886113.1|  ring-H2 finger A3A                               77.4    5e-15   
gb|KFK44194.1|  hypothetical protein AALP_AA1G226700                  77.8    5e-15   Arabis alpina [alpine rockcress]
emb|CDX75506.1|  BnaA01g01960D                                        77.4    6e-15   
ref|XP_002867072.1|  ring-H2 finger A3B                               76.3    1e-14   Arabidopsis lyrata subsp. lyrata
ref|XP_011041176.1|  PREDICTED: RING-H2 finger protein ATL8           76.3    2e-14   Populus euphratica
ref|XP_009110211.1|  PREDICTED: RING-H2 finger protein ATL80          76.3    2e-14   Brassica rapa
ref|XP_002306993.2|  hypothetical protein POPTR_0005s27660g           75.9    2e-14   Populus trichocarpa [western balsam poplar]
emb|CDX96619.1|  BnaA08g21620D                                        75.9    2e-14   
ref|XP_007135973.1|  hypothetical protein PHAVU_009G007400g           75.9    2e-14   Phaseolus vulgaris [French bean]
ref|XP_010935347.1|  PREDICTED: LOW QUALITY PROTEIN: RING-H2 fing...  75.5    2e-14   
emb|CDX69143.1|  BnaC01g03100D                                        75.5    3e-14   
emb|CDY33648.1|  BnaC08g19480D                                        75.5    3e-14   Brassica napus [oilseed rape]
ref|XP_009101519.1|  PREDICTED: RING-H2 finger protein ATL45          75.9    3e-14   Brassica rapa
ref|NP_195273.1|  putative RING-H2 finger protein RHA3b               75.5    3e-14   Arabidopsis thaliana [mouse-ear cress]
emb|CDY49431.1|  BnaC07g06500D                                        75.1    3e-14   Brassica napus [oilseed rape]
ref|XP_008812592.1|  PREDICTED: RING-H2 finger protein ATL80-like     75.1    4e-14   Phoenix dactylifera
ref|XP_003527275.1|  PREDICTED: RING-H2 finger protein ATL80-like     75.1    4e-14   Glycine max [soybeans]
ref|XP_010537218.1|  PREDICTED: RING-H2 finger protein ATL80-like     74.7    5e-14   Tarenaya hassleriana [spider flower]
emb|CDX88272.1|  BnaC06g37160D                                        74.3    7e-14   
emb|CDX87603.1|  BnaA07g32700D                                        73.9    9e-14   
ref|XP_009384604.1|  PREDICTED: RING-H2 finger protein ATL44-like     73.9    1e-13   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK40135.1|  hypothetical protein AALP_AA3G335200                  73.9    1e-13   Arabis alpina [alpine rockcress]
emb|CDY24337.1|  BnaA07g02620D                                        73.6    1e-13   Brassica napus [oilseed rape]
ref|XP_010094527.1|  RING-H2 finger protein ATL80                     73.2    2e-13   Morus notabilis
ref|XP_010911522.1|  PREDICTED: RING-H2 finger protein ATL44-like     72.8    2e-13   Elaeis guineensis
gb|KHN20089.1|  RING-H2 finger protein ATL80                          72.0    3e-13   Glycine soja [wild soybean]
ref|XP_009121114.1|  PREDICTED: RING-H2 finger protein ATL44          73.2    3e-13   Brassica rapa
ref|XP_003572834.1|  PREDICTED: RING-H2 finger protein ATL80-like     72.4    4e-13   Brachypodium distachyon [annual false brome]
ref|XP_003603861.1|  RING-H2 finger protein ATL1B                     71.2    1e-12   Medicago truncatula
ref|XP_009106302.1|  PREDICTED: RING-H2 finger protein ATL8           70.5    2e-12   Brassica rapa
ref|XP_008786682.1|  PREDICTED: RING-H2 finger protein ATL44          70.5    2e-12   Phoenix dactylifera
ref|XP_010029567.1|  PREDICTED: RING-H2 finger protein ATL8-like      70.5    2e-12   Eucalyptus grandis [rose gum]
ref|XP_009395296.1|  PREDICTED: RING-H2 finger protein ATL8-like      69.7    3e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008804625.1|  PREDICTED: RING-H2 finger protein ATL8           68.6    7e-12   Phoenix dactylifera
ref|XP_006855649.1|  hypothetical protein AMTR_s00044p00112360        67.0    3e-11   Amborella trichopoda
ref|XP_009420835.1|  PREDICTED: RING-H2 finger protein ATL8-like      66.6    3e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002452741.1|  hypothetical protein SORBIDRAFT_04g031560        66.6    4e-11   Sorghum bicolor [broomcorn]
ref|XP_009372616.1|  PREDICTED: RING-H2 finger protein ATL80          66.2    4e-11   Pyrus x bretschneideri [bai li]
ref|XP_010548197.1|  PREDICTED: RING-H2 finger protein ATL44-like     65.9    7e-11   Tarenaya hassleriana [spider flower]
ref|XP_008373388.1|  PREDICTED: RING-H2 finger protein ATL8           65.5    9e-11   
ref|XP_009128176.1|  PREDICTED: LOW QUALITY PROTEIN: RING-H2 fing...  65.9    9e-11   Brassica rapa
ref|XP_009410155.1|  PREDICTED: LOW QUALITY PROTEIN: RING-H2 fing...  65.1    1e-10   
ref|XP_007046460.1|  Basic helix-loop-helix DNA-binding superfami...  65.1    1e-10   
ref|NP_001147382.1|  RING-H2 finger protein ATL1R                     62.8    9e-10   Zea mays [maize]
ref|XP_004500836.1|  PREDICTED: RING-H2 finger protein ATL80-like     62.4    1e-09   Cicer arietinum [garbanzo]
ref|XP_009772742.1|  PREDICTED: RING-H2 finger protein ATL8-like ...  63.2    1e-09   Nicotiana sylvestris
ref|XP_009772735.1|  PREDICTED: RING-H2 finger protein ATL8-like ...  62.8    2e-09   Nicotiana sylvestris
ref|XP_009383554.1|  PREDICTED: RING-H2 finger protein ATL45-like     61.6    2e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007212670.1|  hypothetical protein PRUPE_ppa018356mg           60.1    5e-09   
ref|XP_004953481.1|  PREDICTED: RING-H2 finger protein ATL8-like      60.5    5e-09   Setaria italica
ref|XP_003581570.1|  PREDICTED: RING-H2 finger protein ATL44-like     60.5    6e-09   Brachypodium distachyon [annual false brome]
gb|ADW66128.1|  RING-H2 finger protein RHA3b                          59.7    8e-09   Solanum nigrum
gb|EMT08937.1|  hypothetical protein F775_27826                       58.5    9e-09   
ref|NP_001168249.1|  uncharacterized LOC100382012                     59.7    9e-09   Zea mays [maize]
ref|XP_004985867.1|  PREDICTED: RING-H2 finger protein ATL8-like      59.3    2e-08   Setaria italica
ref|NP_001150083.1|  RING-H2 finger protein ATL1R                     58.9    2e-08   
ref|XP_009400319.1|  PREDICTED: RING-H2 finger protein ATL8-like      58.5    2e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001047768.1|  Os02g0686100                                     58.5    3e-08   
ref|XP_002465936.1|  hypothetical protein SORBIDRAFT_01g048530        57.8    5e-08   Sorghum bicolor [broomcorn]
ref|XP_010530985.1|  PREDICTED: RING-H2 finger protein ATL44-like     56.6    1e-07   Tarenaya hassleriana [spider flower]
ref|XP_002266865.1|  PREDICTED: RING-H2 finger protein ATL80-like     55.8    2e-07   Vitis vinifera
ref|XP_006660955.1|  PREDICTED: RING-H2 finger protein ATL80-like     55.5    3e-07   Oryza brachyantha
ref|NP_001053674.1|  Os04g0585000                                     54.3    4e-07   
gb|KFK30185.1|  hypothetical protein AALP_AA7G229000                  55.1    4e-07   Arabis alpina [alpine rockcress]
ref|XP_002529811.1|  hypothetical protein RCOM_0605860                56.6    4e-07   
emb|CAE03757.1|  OSJNBa0013K16.6                                      54.7    6e-07   Oryza sativa Japonica Group [Japonica rice]
gb|EEE61565.1|  hypothetical protein OsJ_15927                        53.5    6e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009401006.1|  PREDICTED: RING-H2 finger protein ATL45          53.1    1e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003562145.1|  PREDICTED: RING-H2 finger protein ATL45          53.1    2e-06   
ref|XP_011014772.1|  PREDICTED: RING-H2 finger protein ATL80-like     53.1    2e-06   Populus euphratica
gb|ABK22591.1|  unknown                                               52.0    6e-06   Picea sitchensis
ref|XP_010479360.1|  PREDICTED: RING-H2 finger protein ATL75-like     52.4    7e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010500468.1|  PREDICTED: RING-H2 finger protein ATL75-like     52.0    7e-06   Camelina sativa [gold-of-pleasure]
dbj|BAD23012.1|  RING zinc finger protein-like                        51.6    8e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010461763.1|  PREDICTED: RING-H2 finger protein ATL75          52.0    8e-06   Camelina sativa [gold-of-pleasure]
ref|XP_002437640.1|  hypothetical protein SORBIDRAFT_10g030990        51.2    1e-05   Sorghum bicolor [broomcorn]
gb|EMT16971.1|  RING-H2 finger protein ATL1B                          50.1    2e-05   
ref|NP_001173220.1|  Os02g0832150                                     50.8    2e-05   
gb|ABK25761.1|  unknown                                               50.8    2e-05   Picea sitchensis
gb|EMS51300.1|  RING-H2 finger protein ATL80                          50.8    3e-05   Triticum urartu
ref|XP_002891483.1|  zinc finger family protein                       50.4    3e-05   Arabidopsis lyrata subsp. lyrata
ref|XP_008679106.1|  PREDICTED: RING-H2 finger protein ATL80-like     50.1    3e-05   Zea mays [maize]
ref|XP_006393289.1|  hypothetical protein EUTSA_v10012018mg           50.4    3e-05   Eutrema salsugineum [saltwater cress]
ref|XP_009382752.1|  PREDICTED: RING-H2 finger protein ATL8-like      49.7    4e-05   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAY88139.1|  hypothetical protein OsI_09574                        49.3    4e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_010260922.1|  PREDICTED: RING-H2 finger protein ATL78          50.1    4e-05   Nelumbo nucifera [Indian lotus]
ref|XP_004976609.1|  PREDICTED: RING-H2 finger protein ATL8-like      49.7    4e-05   Setaria italica
ref|XP_002891481.1|  zinc finger family protein                       50.1    4e-05   Arabidopsis lyrata subsp. lyrata
gb|KJB73014.1|  hypothetical protein B456_011G209400                  49.7    5e-05   Gossypium raimondii
ref|XP_008456776.1|  PREDICTED: RING-H2 finger protein ATL74          49.3    5e-05   
ref|XP_008648859.1|  PREDICTED: RING-H2 finger protein ATL44-like     49.3    6e-05   Zea mays [maize]
ref|NP_175348.1|  RING-H2 finger protein ATL10                        50.1    6e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007209706.1|  hypothetical protein PRUPE_ppa012461mg           48.9    6e-05   Prunus persica
ref|XP_006306107.1|  hypothetical protein CARUB_v10011539mg           49.7    6e-05   Capsella rubella
ref|NP_001063886.1|  Os09g0554200                                     49.3    6e-05   
ref|XP_008237931.1|  PREDICTED: RING-H2 finger protein ATL80-like     48.5    6e-05   Prunus mume [ume]
gb|AAF69723.1|AC016041_28  F27J15.2                                   50.4    6e-05   Arabidopsis thaliana [mouse-ear cress]
gb|EEE70193.1|  hypothetical protein OsJ_30278                        48.9    7e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003573175.1|  PREDICTED: RING-H2 finger protein ATL44-like     49.3    8e-05   Brachypodium distachyon [annual false brome]
gb|KGN45834.1|  hypothetical protein Csa_6G014550                     48.9    8e-05   Cucumis sativus [cucumbers]
ref|XP_002271473.1|  PREDICTED: RING-H2 finger protein ATL74          48.5    1e-04   Vitis vinifera
ref|XP_006393288.1|  hypothetical protein EUTSA_v10011758mg           48.9    1e-04   Eutrema salsugineum [saltwater cress]
ref|XP_011076816.1|  PREDICTED: RING-H2 finger protein ATL74-like     47.8    1e-04   Sesamum indicum [beniseed]
ref|XP_010241725.1|  PREDICTED: RING-H2 finger protein ATL78-like     48.9    1e-04   Nelumbo nucifera [Indian lotus]
ref|NP_001150572.1|  RING-H2 finger protein ATL1R                     48.1    1e-04   
gb|EAZ25203.1|  hypothetical protein OsJ_09003                        47.8    1e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010479359.1|  PREDICTED: E3 ubiquitin-protein ligase ATL76...  48.9    1e-04   Camelina sativa [gold-of-pleasure]
ref|XP_002452232.1|  hypothetical protein SORBIDRAFT_04g022150        48.9    1e-04   
ref|XP_010500467.1|  PREDICTED: E3 ubiquitin-protein ligase ATL76...  48.5    2e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010461762.1|  PREDICTED: E3 ubiquitin-protein ligase ATL76     48.5    2e-04   Camelina sativa [gold-of-pleasure]
ref|XP_006306489.1|  hypothetical protein CARUB_v10012468mg           48.5    2e-04   Capsella rubella
ref|XP_010922739.1|  PREDICTED: RING-H2 finger protein ATL74-like     47.8    2e-04   Elaeis guineensis
ref|XP_010931361.1|  PREDICTED: RING-H2 finger protein ATL74-like     47.8    2e-04   Elaeis guineensis
gb|AFB33711.1|  hypothetical protein 2_89_01                          47.0    2e-04   Larix decidua
gb|KHG05103.1|  RING-H2 finger ATL74 -like protein                    47.8    2e-04   Gossypium arboreum [tree cotton]
ref|XP_010252063.1|  PREDICTED: RING-H2 finger protein ATL74          47.8    2e-04   Nelumbo nucifera [Indian lotus]
ref|XP_009135597.1|  PREDICTED: RING-H2 finger protein ATL77-like     47.8    2e-04   Brassica rapa
emb|CDX82327.1|  BnaA03g34940D                                        47.8    3e-04   
ref|XP_002310694.2|  hypothetical protein POPTR_0007s08550g           47.0    3e-04   
ref|XP_008792228.1|  PREDICTED: RING-H2 finger protein ATL74-like     47.4    3e-04   Phoenix dactylifera
ref|XP_002891482.1|  zinc finger family protein                       47.8    3e-04   Arabidopsis lyrata subsp. lyrata
ref|XP_008809453.1|  PREDICTED: RING-H2 finger protein ATL74-like...  47.4    3e-04   Phoenix dactylifera
ref|XP_010036001.1|  PREDICTED: RING-H2 finger protein ATL74          47.0    3e-04   Eucalyptus grandis [rose gum]
ref|XP_011099792.1|  PREDICTED: RING-H2 finger protein ATL78-like     47.8    3e-04   Sesamum indicum [beniseed]
ref|XP_006842471.1|  hypothetical protein AMTR_s00077p00074350        47.0    3e-04   
ref|NP_175346.1|  RING-H2 finger protein ATL75                        47.8    3e-04   Arabidopsis thaliana [mouse-ear cress]
gb|KJB71523.1|  hypothetical protein B456_011G127700                  47.4    3e-04   Gossypium raimondii
ref|NP_850610.1|  RING-H2 finger protein ATL77                        47.4    3e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003623617.1|  RING-H2 finger protein ATL5H                     46.6    4e-04   Medicago truncatula
ref|XP_003630235.1|  RING-H2 finger protein ATL5F                     47.0    4e-04   
ref|XP_003630211.1|  RING-H2 finger protein ATL1L                     47.4    4e-04   Medicago truncatula
gb|EYU20094.1|  hypothetical protein MIMGU_mgv1a014454mg              46.6    4e-04   Erythranthe guttata [common monkey flower]
ref|XP_009122137.1|  PREDICTED: RING-H2 finger protein ATL73          46.6    5e-04   Brassica rapa
emb|CDX70162.1|  BnaA10g25110D                                        46.6    5e-04   
gb|KCW54274.1|  hypothetical protein EUGRSUZ_I00237                   47.0    5e-04   Eucalyptus grandis [rose gum]
ref|XP_009622929.1|  PREDICTED: RING-H2 finger protein ATL74-like     46.6    5e-04   
gb|EMS62914.1|  RING-H2 finger protein ATL44                          46.6    5e-04   Triticum urartu
ref|XP_011084821.1|  PREDICTED: RING-H2 finger protein ATL73-like     46.2    5e-04   Sesamum indicum [beniseed]
gb|AFB33710.1|  hypothetical protein 2_89_01                          45.4    6e-04   Larix decidua
tpg|DAA46102.1|  TPA: putative RING zinc finger domain superfamil...  47.4    6e-04   
ref|XP_008809452.1|  PREDICTED: RING-H2 finger protein ATL74-like...  47.0    6e-04   Phoenix dactylifera
ref|XP_010027694.1|  PREDICTED: RING-H2 finger protein ATL78-like     47.0    6e-04   Eucalyptus grandis [rose gum]
ref|XP_010322127.1|  PREDICTED: RING-H2 finger protein ATL74-like...  46.6    7e-04   Solanum lycopersicum
ref|XP_006358749.1|  PREDICTED: RING-H2 finger protein ATL72-like     46.6    7e-04   Solanum tuberosum [potatoes]
ref|XP_004240864.1|  PREDICTED: RING-H2 finger protein ATL74-like...  46.6    7e-04   Solanum lycopersicum
ref|XP_009397078.1|  PREDICTED: RING-H2 finger protein ATL74-like     45.8    8e-04   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB18812.1|  hypothetical protein B456_003G070100                  46.6    8e-04   Gossypium raimondii
emb|CDY61981.1|  BnaC03g73800D                                        46.6    8e-04   Brassica napus [oilseed rape]
ref|XP_006464565.1|  PREDICTED: RING-H2 finger protein ATL78-like     46.6    8e-04   
gb|ACN27203.1|  unknown                                               45.8    8e-04   Zea mays [maize]
ref|XP_002531843.1|  ring finger protein, putative                    46.2    9e-04   Ricinus communis
ref|XP_006427854.1|  hypothetical protein CICLE_v10027222mg           46.2    0.001   



>gb|AFW90598.1| E3 ubiquitin ligase [Solanum tuberosum]
Length=170

 Score = 96.3 bits (238),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 55/68 (81%), Gaps = 1/68 (1%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            DF+VILAALLCA+ICVVGL+ VARCAWLRR       G S QPS+NKGLKKKVL+SLPKF
Sbjct  7    DFVVILAALLCALICVVGLIAVARCAWLRRGIGAGGIGGS-QPSANKGLKKKVLQSLPKF  65

Query  317  TYGPSFAA  340
            TY PS  A
Sbjct  66   TYDPSSTA  73



>ref|XP_004232585.1| PREDICTED: RING-H2 finger protein ATL8-like [Solanum lycopersicum]
Length=193

 Score = 96.7 bits (239),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 55/68 (81%), Gaps = 1/68 (1%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            DF+VILAALLCA+ICVVGL+ VARCAWLRR       G S QPS+NKGLKKKVL+SLPKF
Sbjct  30   DFVVILAALLCALICVVGLIAVARCAWLRRGIGAGGNGGS-QPSANKGLKKKVLQSLPKF  88

Query  317  TYGPSFAA  340
            TY PS  A
Sbjct  89   TYDPSSTA  96



>ref|XP_006342165.1| PREDICTED: RING-H2 finger protein ATL80-like [Solanum tuberosum]
Length=180

 Score = 93.6 bits (231),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 56/69 (81%), Gaps = 1/69 (1%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGAS-GQPSSNKGLKKKVLRSLPK  313
            DF+VILAALLCA+ICV+GLV VARCAW+RRI A A G ++   P +NKGLKKKVL+SLPK
Sbjct  23   DFVVILAALLCALICVLGLVAVARCAWIRRISARATGNSAFSSPPANKGLKKKVLKSLPK  82

Query  314  FTYGPSFAA  340
            F+Y    AA
Sbjct  83   FSYSAEHAA  91



>ref|XP_002274304.2| PREDICTED: RING-H2 finger protein ATL8 [Vitis vinifera]
Length=228

 Score = 93.6 bits (231),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 55/69 (80%), Gaps = 2/69 (3%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGAN--GGASGQPSSNKGLKKKVLRSLP  310
            DF+VILAALLCA+ICV+GLV VARCAWLRRI   AN  GG++ Q  +NKGLKKK+LRSLP
Sbjct  27   DFVVILAALLCALICVLGLVAVARCAWLRRISGAANLPGGSAPQTPANKGLKKKILRSLP  86

Query  311  KFTYGPSFA  337
            K TY    A
Sbjct  87   KVTYAAETA  95



>ref|XP_004238452.1| PREDICTED: RING-H2 finger protein ATL80-like [Solanum lycopersicum]
Length=183

 Score = 92.4 bits (228),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGAS-GQPSSNKGLKKKVLRSLPK  313
            DF+VILAALLCA+ICV+GLV VARCAW+RRI A A G +    P +NKGLKKKVL+SLPK
Sbjct  25   DFVVILAALLCALICVLGLVAVARCAWIRRISARATGNSVFSSPPANKGLKKKVLKSLPK  84

Query  314  FTYGPSFAA  340
            F+Y    AA
Sbjct  85   FSYSAEHAA  93



>emb|CAN59779.1| hypothetical protein VITISV_024654 [Vitis vinifera]
Length=312

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 55/69 (80%), Gaps = 2/69 (3%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGAN--GGASGQPSSNKGLKKKVLRSLP  310
            DF+VILAALLCA+ICV+GLV VARCAWLRRI   AN  GG++ Q  +NKGLKKK+LRSLP
Sbjct  27   DFVVILAALLCALICVLGLVAVARCAWLRRISGAANLPGGSAPQTPANKGLKKKILRSLP  86

Query  311  KFTYGPSFA  337
            K TY    A
Sbjct  87   KVTYAAETA  95



>ref|XP_004253118.1| PREDICTED: RING-H2 finger protein ATL8-like [Solanum lycopersicum]
Length=186

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 52/65 (80%), Gaps = 1/65 (2%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            DF+VILAALLC +ICV+GLV VARCAW+RRI  G N   S  P +NKGLKKKVL+SLPKF
Sbjct  29   DFVVILAALLCGLICVIGLVAVARCAWIRRI-TGGNSDDSPFPPANKGLKKKVLKSLPKF  87

Query  317  TYGPS  331
            +Y P 
Sbjct  88   SYTPE  92



>ref|XP_002276539.1| PREDICTED: RING-H2 finger protein ATL80 [Vitis vinifera]
 emb|CBI21575.3| unnamed protein product [Vitis vinifera]
Length=182

 Score = 91.7 bits (226),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            DF+VILAALLCA+ICVVGL+ VARCAWLRR  AG    ++ QP++NKGLKKK+L+SLPK 
Sbjct  27   DFVVILAALLCALICVVGLIAVARCAWLRRGSAGGARASATQPAANKGLKKKILQSLPKL  86

Query  317  TY  322
            T+
Sbjct  87   TH  88



>emb|CDP01769.1| unnamed protein product [Coffea canephora]
Length=221

 Score = 92.4 bits (228),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 55/68 (81%), Gaps = 1/68 (1%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            DF+VILAALLCA+ICVVGL+ VARCAWLRR   G NG   GQ S NKGLKKK+++SLPK+
Sbjct  44   DFVVILAALLCALICVVGLIAVARCAWLRRGTPG-NGRVPGQRSPNKGLKKKIVQSLPKY  102

Query  317  TYGPSFAA  340
            TY  S +A
Sbjct  103  TYDSSSSA  110



>ref|XP_006342531.1| PREDICTED: RING-H2 finger protein ATL80-like [Solanum tuberosum]
Length=192

 Score = 91.3 bits (225),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 51/65 (78%), Gaps = 1/65 (2%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            DF+VILAALLC +ICV+GL  VARCAW+RRI AG N      P +NKGLKKKVL+SLPKF
Sbjct  35   DFVVILAALLCGLICVIGLAAVARCAWIRRI-AGGNSDDDPLPPANKGLKKKVLKSLPKF  93

Query  317  TYGPS  331
            +Y P 
Sbjct  94   SYTPE  98



>ref|XP_010270525.1| PREDICTED: RING-H2 finger protein ATL80 [Nelumbo nucifera]
Length=189

 Score = 90.9 bits (224),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 52/64 (81%), Gaps = 2/64 (3%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPS--SNKGLKKKVLRSLP  310
            DF+VILAALLCA+ICVVGLV VARCAWLRR+  GA G    QP   +NKGLKKK+LRSLP
Sbjct  27   DFVVILAALLCALICVVGLVAVARCAWLRRVSGGAAGSGRTQPQAPANKGLKKKILRSLP  86

Query  311  KFTY  322
            K T+
Sbjct  87   KQTF  90



>ref|XP_009766634.1| PREDICTED: RING-H2 finger protein ATL8-like [Nicotiana sylvestris]
Length=191

 Score = 90.9 bits (224),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGAS-GQPSSNKGLKKKVLRSLPK  313
            DF+VILAALLCA+ICV+GLV VARCAW+RRI A A G ++   P +NKGLKKKVL+SLPK
Sbjct  34   DFVVILAALLCALICVLGLVAVARCAWIRRISARATGNSAFSSPPANKGLKKKVLKSLPK  93

Query  314  FTYGPSFAA  340
             +Y    AA
Sbjct  94   LSYTTEHAA  102



>ref|XP_009595867.1| PREDICTED: RING-H2 finger protein ATL80 [Nicotiana tomentosiformis]
Length=191

 Score = 90.9 bits (224),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGAS-GQPSSNKGLKKKVLRSLPK  313
            DF+VILAALLCA+ICV+GLV VARCAW+RRI A A G ++   P +NKGLKKKVL+SLPK
Sbjct  34   DFVVILAALLCALICVLGLVAVARCAWIRRISARATGNSAFSSPPANKGLKKKVLKSLPK  93

Query  314  FTYGPSFAA  340
             +Y    AA
Sbjct  94   LSYTTEHAA  102



>ref|XP_004145558.1| PREDICTED: RING-H2 finger protein ATL80-like [Cucumis sativus]
 ref|XP_004172116.1| PREDICTED: RING-H2 finger protein ATL80-like [Cucumis sativus]
 gb|KGN55526.1| hypothetical protein Csa_4G664340 [Cucumis sativus]
Length=185

 Score = 90.5 bits (223),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 57/73 (78%), Gaps = 6/73 (8%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQ-----PSSNKGLKKKVLR  301
            DF++ILAALLCA+ICV+GLV VARCAWLR + AG  GGA        P+SNKGLKKK+LR
Sbjct  26   DFVIILAALLCALICVLGLVAVARCAWLRHL-AGDGGGAGSTRPPPPPASNKGLKKKILR  84

Query  302  SLPKFTYGPSFAA  340
            SLPK+T+   F+A
Sbjct  85   SLPKYTFTAEFSA  97



>ref|XP_009359625.1| PREDICTED: RING-H2 finger protein ATL80-like isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009359626.1| PREDICTED: RING-H2 finger protein ATL80-like isoform X3 [Pyrus 
x bretschneideri]
Length=215

 Score = 90.9 bits (224),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            DF+VILAALLCAVICVVGL+ VARCAWLRR+  G     S   S+NKGLKKKVL+SLPKF
Sbjct  34   DFVVILAALLCAVICVVGLLAVARCAWLRRVSGGRAAIGSASSSANKGLKKKVLQSLPKF  93

Query  317  TYG  325
            TYG
Sbjct  94   TYG  96



>ref|XP_009359623.1| PREDICTED: RING-H2 finger protein ATL80-like isoform X1 [Pyrus 
x bretschneideri]
Length=227

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            DF+VILAALLCAVICVVGL+ VARCAWLRR+  G     S   S+NKGLKKKVL+SLPKF
Sbjct  34   DFVVILAALLCAVICVVGLLAVARCAWLRRVSGGRAAIGSASSSANKGLKKKVLQSLPKF  93

Query  317  TYG  325
            TYG
Sbjct  94   TYG  96



>ref|XP_007156261.1| hypothetical protein PHAVU_003G271400g [Phaseolus vulgaris]
 gb|ESW28255.1| hypothetical protein PHAVU_003G271400g [Phaseolus vulgaris]
Length=199

 Score = 90.1 bits (222),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            DF+VILAALLCA+ICVVGLV +ARCAWLRR  A   GG S    +NKGLKK+V+ SLPKF
Sbjct  25   DFVVILAALLCALICVVGLVAIARCAWLRRPPASVGGGGSPPAPANKGLKKRVVNSLPKF  84

Query  317  TY  322
            TY
Sbjct  85   TY  86



>gb|KJB14191.1| hypothetical protein B456_002G113500 [Gossypium raimondii]
Length=189

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 57/72 (79%), Gaps = 4/72 (6%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRA--GANGGASGQPS--SNKGLKKKVLRS  304
            DF+VILAALLCA+ICV+GL+ VARCAWLRR+      N  AS +P+  +NKGLKKK+L+S
Sbjct  30   DFVVILAALLCALICVLGLIAVARCAWLRRLSGAFAPNPSASSRPTPPANKGLKKKILKS  89

Query  305  LPKFTYGPSFAA  340
            LPK T+ P F+A
Sbjct  90   LPKATFSPDFSA  101



>ref|XP_008242103.1| PREDICTED: RING-H2 finger protein ATL8 [Prunus mume]
Length=215

 Score = 89.7 bits (221),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 55/65 (85%), Gaps = 3/65 (5%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGG--ASGQPSSNKGLKKKVLRSLP  310
            DF+VILAALLCAVICV+GL+ VARCAWLRR  +GA G   +S Q  +NKG+KKKVL+SLP
Sbjct  33   DFVVILAALLCAVICVIGLLAVARCAWLRR-GSGAGGASLSSAQAPANKGVKKKVLQSLP  91

Query  311  KFTYG  325
            KFTYG
Sbjct  92   KFTYG  96



>ref|XP_008453009.1| PREDICTED: RING-H2 finger protein ATL80 [Cucumis melo]
Length=185

 Score = 89.0 bits (219),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 55/72 (76%), Gaps = 4/72 (6%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQ----PSSNKGLKKKVLRS  304
            DF++ILAALLCA+ICV+GLV VARCAWLR +     G  S +    P+SNKGLKKK+LRS
Sbjct  26   DFVIILAALLCALICVLGLVAVARCAWLRHLAGDGAGAGSTRPPPPPASNKGLKKKILRS  85

Query  305  LPKFTYGPSFAA  340
            LPK+T+   F+A
Sbjct  86   LPKYTFTAEFSA  97



>ref|XP_002510714.1| protein with unknown function [Ricinus communis]
 gb|EEF52901.1| protein with unknown function [Ricinus communis]
Length=194

 Score = 89.0 bits (219),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 56/68 (82%), Gaps = 6/68 (9%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGAN--GGASGQP----SSNKGLKKKVL  298
            DF+VILAALLCA+ICV+GL+ VARCAWLRR+ + AN  GGA  QP    ++NKGLKKK+L
Sbjct  36   DFVVILAALLCALICVLGLIAVARCAWLRRLSSMANSRGGAPAQPPVPSAANKGLKKKIL  95

Query  299  RSLPKFTY  322
            RSLPK T+
Sbjct  96   RSLPKQTF  103



>ref|XP_008379650.1| PREDICTED: RING-H2 finger protein ATL80-like [Malus domestica]
Length=216

 Score = 89.0 bits (219),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            DF+VILAALLCAVICVVGL+ VARCAWLRR   G     S   S+NKGLKKKVL+SLPKF
Sbjct  34   DFVVILAALLCAVICVVGLLAVARCAWLRRGSEGRAAIGSASSSANKGLKKKVLQSLPKF  93

Query  317  TYG  325
            TYG
Sbjct  94   TYG  96



>ref|XP_009604464.1| PREDICTED: RING-H2 finger protein ATL80-like [Nicotiana tomentosiformis]
Length=184

 Score = 88.2 bits (217),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 53/62 (85%), Gaps = 2/62 (3%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            DF++I AALLCA+ICV+GL+ VARCAWLRR+  GA GG S   ++N+GLKKKVL+SLPKF
Sbjct  37   DFVIITAALLCALICVIGLISVARCAWLRRV-GGATGGQSSS-AANRGLKKKVLQSLPKF  94

Query  317  TY  322
            TY
Sbjct  95   TY  96



>ref|XP_010266252.1| PREDICTED: RING-H2 finger protein ATL80 [Nelumbo nucifera]
Length=189

 Score = 88.2 bits (217),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 51/64 (80%), Gaps = 2/64 (3%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGA--NGGASGQPSSNKGLKKKVLRSLP  310
            DF+VILAALLCA+ICVVGLV VARCAWLRR   GA   G    QP +NKGLKKK+L+SLP
Sbjct  27   DFVVILAALLCALICVVGLVAVARCAWLRRASGGAARTGRTQPQPPANKGLKKKILKSLP  86

Query  311  KFTY  322
            K T+
Sbjct  87   KQTF  90



>gb|AFK44145.1| unknown [Medicago truncatula]
Length=116

 Score = 86.3 bits (212),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 53/62 (85%), Gaps = 2/62 (3%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            DF+VILAALLCA+ICVVGL+ VARCAWLRR  +GA G +  Q  +NKGLKKKVL+SLPKF
Sbjct  32   DFVVILAALLCALICVVGLIAVARCAWLRR-DSGA-GNSPQQALANKGLKKKVLQSLPKF  89

Query  317  TY  322
            +Y
Sbjct  90   SY  91



>ref|XP_009776172.1| PREDICTED: RING-H2 finger protein ATL8-like [Nicotiana sylvestris]
Length=201

 Score = 87.8 bits (216),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 49/65 (75%), Gaps = 6/65 (9%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            DF+VILAALLCAVICV GL++VARC WLRR      G     P +NKGLKKKVL+SLPK+
Sbjct  42   DFVVILAALLCAVICVSGLIVVARCTWLRR------GTPENMPPANKGLKKKVLKSLPKY  95

Query  317  TYGPS  331
             Y PS
Sbjct  96   KYDPS  100



>ref|XP_002526834.1| protein with unknown function [Ricinus communis]
 gb|EEF35569.1| protein with unknown function [Ricinus communis]
Length=207

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 52/63 (83%), Gaps = 2/63 (3%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            D +VILAALLCA+ICVVGL+ VARCAWLRR  + +N     Q ++NKGLKKK+L+SLPKF
Sbjct  28   DLVVILAALLCALICVVGLIAVARCAWLRRTGSASN--YPSQAAANKGLKKKILQSLPKF  85

Query  317  TYG  325
            TYG
Sbjct  86   TYG  88



>ref|XP_003533404.1| PREDICTED: RING-H2 finger protein ATL80-like [Glycine max]
Length=203

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 53/64 (83%), Gaps = 2/64 (3%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGAN--GGASGQPSSNKGLKKKVLRSLP  310
            DF+VILAALLCA+ICVVGLV +ARCAWLRR  AG++  G  S   ++NKGLKKKV+ SLP
Sbjct  26   DFVVILAALLCALICVVGLVAIARCAWLRRGTAGSSAAGAVSSPATANKGLKKKVVNSLP  85

Query  311  KFTY  322
            KFTY
Sbjct  86   KFTY  89



>ref|XP_002307200.1| hypothetical protein POPTR_0005s10190g [Populus trichocarpa]
 gb|ABK93092.1| unknown [Populus trichocarpa]
 gb|EEE94196.1| hypothetical protein POPTR_0005s10190g [Populus trichocarpa]
Length=200

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            DF+VILAALLCA+ICVVGL+  ARCAWLRR+  GA+ G   Q  +NKG+KKK L+ LP+F
Sbjct  24   DFVVILAALLCALICVVGLIAAARCAWLRRVTGGASSGPPPQAKANKGVKKKNLQLLPRF  83

Query  317  TY  322
            TY
Sbjct  84   TY  85



>ref|XP_004287710.1| PREDICTED: RING-H2 finger protein ATL8 [Fragaria vesca subsp. 
vesca]
Length=208

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 52/64 (81%), Gaps = 3/64 (5%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPS-SNKGLKKKVLRSLPK  313
            DF+VILAALLCAVICVVGL+ VARCAWLR  RA   GG S   S +NKGLKKKVL+ LPK
Sbjct  31   DFVVILAALLCAVICVVGLLAVARCAWLR--RAPVPGGQSQASSAANKGLKKKVLQQLPK  88

Query  314  FTYG  325
            FTYG
Sbjct  89   FTYG  92



>ref|XP_002526830.1| protein with unknown function [Ricinus communis]
 gb|EEF35565.1| protein with unknown function [Ricinus communis]
Length=258

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 52/66 (79%), Gaps = 8/66 (12%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPS---SNKGLKKKVLRSL  307
            D +VILAALLCA+ICVVGL+ VARCAWLRR      G AS  PS   +NKGLKKK+L+SL
Sbjct  79   DLVVILAALLCALICVVGLIAVARCAWLRR-----TGSASSYPSQAAANKGLKKKILQSL  133

Query  308  PKFTYG  325
            PKFTYG
Sbjct  134  PKFTYG  139



>ref|XP_006390200.1| hypothetical protein EUTSA_v10019183mg [Eutrema salsugineum]
 gb|ESQ27486.1| hypothetical protein EUTSA_v10019183mg [Eutrema salsugineum]
Length=190

 Score = 85.9 bits (211),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 53/72 (74%), Gaps = 7/72 (10%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRI----RAGANGGASGQP---SSNKGLKKKV  295
            D +VI+AALLCA+ICV+GLV V+RC WLRR+    RA AN   +  P   ++NKGLKKKV
Sbjct  27   DLVVIIAALLCALICVLGLVAVSRCLWLRRLVSGNRAAANSDQTHPPPVAAANKGLKKKV  86

Query  296  LRSLPKFTYGPS  331
            LRSLPK TY P 
Sbjct  87   LRSLPKLTYSPD  98



>ref|XP_004253245.1| PREDICTED: RING-H2 finger protein ATL80-like [Solanum lycopersicum]
Length=183

 Score = 85.9 bits (211),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 55/68 (81%), Gaps = 2/68 (3%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            D+++I+AALLC VIC++GL+ VARCAWLRR   G+ GG S   ++NKGLKKKVLRSLPKF
Sbjct  38   DYVIIIAALLCGVICIIGLISVARCAWLRRT-GGSTGGQSSA-AANKGLKKKVLRSLPKF  95

Query  317  TYGPSFAA  340
             + P+ ++
Sbjct  96   KFDPASSS  103



>ref|XP_003547882.1| PREDICTED: RING-H2 finger protein ATL80-like [Glycine max]
Length=201

 Score = 85.9 bits (211),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 53/64 (83%), Gaps = 2/64 (3%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRR-IRAGANGGASGQP-SSNKGLKKKVLRSLP  310
            DF+VILAALLCA+ICVVGLV +ARCAWLRR   AG+  GA   P ++NKGLKKKV+ SLP
Sbjct  25   DFVVILAALLCALICVVGLVAIARCAWLRRGPVAGSGSGAGESPATANKGLKKKVVNSLP  84

Query  311  KFTY  322
            KFTY
Sbjct  85   KFTY  88



>ref|XP_011022135.1| PREDICTED: RING-H2 finger protein ATL8-like [Populus euphratica]
Length=200

 Score = 85.9 bits (211),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            DF+VILAALLCA+ICVVGL+  ARCAWLRR+  G + G   Q  +NKG+KKK L+ LP+F
Sbjct  24   DFVVILAALLCALICVVGLIAAARCAWLRRVTGGVSSGPPPQAKANKGVKKKNLQLLPRF  83

Query  317  TY  322
            TY
Sbjct  84   TY  85



>ref|XP_003612411.1| Ring finger protein [Medicago truncatula]
 gb|AES95369.1| anaphase-promoting complex subunit 11 RING-H2 finger protein 
[Medicago truncatula]
 gb|AFK36320.1| unknown [Medicago truncatula]
Length=215

 Score = 85.9 bits (211),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 53/62 (85%), Gaps = 2/62 (3%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            DF+VILAALLCA+ICVVGL+ VARCAWLRR  +GA G +  Q  +NKGLKKKVL+SLPKF
Sbjct  32   DFVVILAALLCALICVVGLIAVARCAWLRR-DSGA-GNSPQQALANKGLKKKVLQSLPKF  89

Query  317  TY  322
            +Y
Sbjct  90   SY  91



>ref|XP_008392292.1| PREDICTED: RING-H2 finger protein ATL80-like [Malus domestica]
Length=215

 Score = 85.9 bits (211),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            D +VILAALLCAVICVVGL+ VARCAWLRR   G     S   S+NKGLKKKVL+SLPKF
Sbjct  34   DLVVILAALLCAVICVVGLLAVARCAWLRRGPXGRAAIGSASSSANKGLKKKVLQSLPKF  93

Query  317  TYG  325
            TYG
Sbjct  94   TYG  96



>ref|XP_009338623.1| PREDICTED: RING-H2 finger protein ATL80-like [Pyrus x bretschneideri]
Length=215

 Score = 85.9 bits (211),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            D +VILAALLCAVICVVGL+ VARCAWLRR   G    +S   S+NKGLKKKVL+SLPKF
Sbjct  34   DLVVILAALLCAVICVVGLLAVARCAWLRRGPGGRAAMSSASSSANKGLKKKVLQSLPKF  93

Query  317  TYG  325
            TYG
Sbjct  94   TYG  96



>ref|XP_004512286.1| PREDICTED: RING-H2 finger protein ATL8-like [Cicer arietinum]
Length=217

 Score = 85.9 bits (211),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 52/62 (84%), Gaps = 2/62 (3%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            DF+VILAALLCA+ICVVGLV VARCAWLRR  +GA G +  Q  +NKGLKKKVL+SLPKF
Sbjct  32   DFVVILAALLCALICVVGLVAVARCAWLRR-DSGA-GNSPQQALANKGLKKKVLQSLPKF  89

Query  317  TY  322
             Y
Sbjct  90   AY  91



>ref|XP_006366657.1| PREDICTED: RING-H2 finger protein ATL80-like [Solanum tuberosum]
Length=183

 Score = 85.1 bits (209),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 55/68 (81%), Gaps = 2/68 (3%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            D+++I+AALLCA+IC++GL+ VARCAWLRR   GA GG S   ++NKGLKKKVL SLPKF
Sbjct  38   DYVIIIAALLCALICIIGLISVARCAWLRRT-GGATGGQSAA-AANKGLKKKVLHSLPKF  95

Query  317  TYGPSFAA  340
             + P+ ++
Sbjct  96   KFDPATSS  103



>ref|XP_009775127.1| PREDICTED: RING-H2 finger protein ATL80-like [Nicotiana sylvestris]
Length=184

 Score = 85.1 bits (209),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 50/62 (81%), Gaps = 2/62 (3%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            DF++I AALLCA IC++GL+ V RCAWLRR+R    G +S   ++N+GLKKKVL+SLPKF
Sbjct  37   DFVIITAALLCAFICIIGLISVVRCAWLRRVRERTGGQSSS--AANRGLKKKVLQSLPKF  94

Query  317  TY  322
            TY
Sbjct  95   TY  96



>ref|XP_004234505.1| PREDICTED: RING-H2 finger protein ATL8-like [Solanum lycopersicum]
Length=178

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 48/65 (74%), Gaps = 5/65 (8%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            DFIVILAALLCAVICV GL++VARC WLRR     +   +  P  NKGLKKKVL+ LPKF
Sbjct  34   DFIVILAALLCAVICVSGLIVVARCTWLRR-----DPPENPPPVKNKGLKKKVLKYLPKF  88

Query  317  TYGPS  331
             Y PS
Sbjct  89   KYDPS  93



>ref|XP_006343322.1| PREDICTED: RING-H2 finger protein ATL8-like [Solanum tuberosum]
Length=178

 Score = 84.3 bits (207),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 48/65 (74%), Gaps = 5/65 (8%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            DFIVILAALLCAVICV GL++VARC WLRR     +   +  P  NKGLKKKVL+ LPKF
Sbjct  34   DFIVILAALLCAVICVSGLIVVARCTWLRR-----DPPENPPPVKNKGLKKKVLKYLPKF  88

Query  317  TYGPS  331
             Y PS
Sbjct  89   KYDPS  93



>ref|XP_010064613.1| PREDICTED: RING-H2 finger protein ATL80, partial [Eucalyptus 
grandis]
Length=201

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 54/75 (72%), Gaps = 8/75 (11%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGA--------SGQPSSNKGLKKK  292
            DF+VILAALLCA+ICV+GL+ VARCAWLRR+ + ++GGA             +NKGLKKK
Sbjct  29   DFVVILAALLCALICVLGLIAVARCAWLRRLSSFSSGGAPPPSSPPPPPSSKANKGLKKK  88

Query  293  VLRSLPKFTYGPSFA  337
            VLRSLPK T  P  A
Sbjct  89   VLRSLPKLTVTPDAA  103



>ref|XP_006302871.1| hypothetical protein CARUB_v10021002mg [Capsella rubella]
 gb|EOA35769.1| hypothetical protein CARUB_v10021002mg [Capsella rubella]
Length=186

 Score = 84.3 bits (207),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 50/68 (74%), Gaps = 3/68 (4%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQP---SSNKGLKKKVLRSL  307
            D ++ILA LLCA+ CV+GL+ V+RCAWLRRI +      + QP   ++NKGLKKKVLRSL
Sbjct  27   DLVLILAVLLCALTCVLGLIAVSRCAWLRRIASRNRSDQTDQPPVAAANKGLKKKVLRSL  86

Query  308  PKFTYGPS  331
            PK TY P 
Sbjct  87   PKLTYSPE  94



>ref|XP_010498523.1| PREDICTED: RING-H2 finger protein ATL80-like [Camelina sativa]
Length=198

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 53/74 (72%), Gaps = 9/74 (12%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAG---ANGGASGQPSS------NKGLKK  289
            D IVILAALLCA+ICV+GLV V+RC WLRR+ AG   A+G   GQ  S      NKGLKK
Sbjct  29   DLIVILAALLCALICVLGLVAVSRCVWLRRLAAGNRTASGSHQGQSPSPPVAAANKGLKK  88

Query  290  KVLRSLPKFTYGPS  331
            KVL+SLPK T+ P 
Sbjct  89   KVLQSLPKLTFSPE  102



>ref|XP_009601753.1| PREDICTED: RING-H2 finger protein ATL80-like [Nicotiana tomentosiformis]
Length=197

 Score = 84.3 bits (207),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 54/66 (82%), Gaps = 1/66 (2%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRR-IRAGANGGASGQPSSNKGLKKKVLRSLPK  313
            DF+VILAALLCA+ICVVGL+ VARCAWLRR   AGA G      ++NKGLKKKVL+SLPK
Sbjct  34   DFVVILAALLCALICVVGLIAVARCAWLRRGTGAGAGGAGGQSAAANKGLKKKVLQSLPK  93

Query  314  FTYGPS  331
            FTY PS
Sbjct  94   FTYDPS  99



>ref|XP_009104676.1| PREDICTED: RING-H2 finger protein ATL8-like [Brassica rapa]
Length=185

 Score = 84.3 bits (207),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 51/68 (75%), Gaps = 3/68 (4%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQP---SSNKGLKKKVLRSL  307
            + IVI+AALLCA+ICV+GLV V+RC WLRRI A  +     QP   ++N+GLKKK+LRSL
Sbjct  27   NLIVIIAALLCALICVLGLVAVSRCTWLRRIAAPNSVQTHHQPPVAAANRGLKKKILRSL  86

Query  308  PKFTYGPS  331
            PK TY P 
Sbjct  87   PKLTYSPD  94



>ref|XP_009620555.1| PREDICTED: RING-H2 finger protein ATL80-like [Nicotiana tomentosiformis]
Length=182

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 49/62 (79%), Gaps = 2/62 (3%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            DF VILAAL+C +ICV+GLV VARCAW+RR   G    A+  P +NKGLKKKVL+SLPKF
Sbjct  35   DFFVILAALVCGLICVLGLVSVARCAWIRRFATG--NSAAPSPPANKGLKKKVLKSLPKF  92

Query  317  TY  322
            +Y
Sbjct  93   SY  94



>ref|XP_009772726.1| PREDICTED: RING-H2 finger protein ATL80-like [Nicotiana sylvestris]
Length=198

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 52/67 (78%), Gaps = 2/67 (3%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRR--IRAGANGGASGQPSSNKGLKKKVLRSLP  310
            DF+VILAALLCA+ICVVGL+ VARCAWLRR     G   G     ++NKGLKKKVL+SLP
Sbjct  34   DFVVILAALLCALICVVGLIAVARCAWLRRATGAGGGGAGGQSSAAANKGLKKKVLQSLP  93

Query  311  KFTYGPS  331
            KFTY PS
Sbjct  94   KFTYDPS  100



>ref|XP_009589982.1| PREDICTED: RING-H2 finger protein ATL8-like [Nicotiana tomentosiformis]
Length=201

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 48/65 (74%), Gaps = 6/65 (9%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            DF+VILAALLCAVICV GL++VARC WLRR            P +NKGLKKKVL+SLPK+
Sbjct  42   DFVVILAALLCAVICVSGLIVVARCTWLRR------DTPEIPPPANKGLKKKVLKSLPKY  95

Query  317  TYGPS  331
             Y PS
Sbjct  96   KYDPS  100



>ref|XP_010471794.1| PREDICTED: RING-H2 finger protein ATL8-like [Camelina sativa]
Length=186

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 49/68 (72%), Gaps = 3/68 (4%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQP---SSNKGLKKKVLRSL  307
            D ++ILA LLCA+ CV+GL+ V+RCAWLRRI        + QP   ++NKGLKKKVLRSL
Sbjct  27   DLVLILAVLLCALTCVLGLIAVSRCAWLRRIATRNRSDQTHQPPVAAANKGLKKKVLRSL  86

Query  308  PKFTYGPS  331
            PK TY P 
Sbjct  87   PKLTYSPD  94



>emb|CDX68098.1| BnaA07g21380D [Brassica napus]
Length=185

 Score = 84.0 bits (206),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 51/68 (75%), Gaps = 3/68 (4%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQP---SSNKGLKKKVLRSL  307
            + IVI+AALLCA+ICV+GLV V+RC WLRRI A  +     QP   ++N+GLKKK+LRSL
Sbjct  27   NLIVIIAALLCALICVLGLVAVSRCTWLRRIAAPNSVQTHHQPPVAAANRGLKKKILRSL  86

Query  308  PKFTYGPS  331
            PK TY P 
Sbjct  87   PKLTYSPD  94



>gb|ADI71977.1| E3 ubiquitin ligase [Capsicum annuum]
Length=197

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 51/68 (75%), Gaps = 1/68 (1%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGAS-GQPSSNKGLKKKVLRSLPK  313
            DF+V+LAALLCA+ICV+GLV VARC W+RRI     G ++     +NKGLKKKVL+SLPK
Sbjct  34   DFVVVLAALLCALICVLGLVAVARCNWIRRISGSIAGNSAFASAPANKGLKKKVLKSLPK  93

Query  314  FTYGPSFA  337
            F YG   A
Sbjct  94   FNYGAEHA  101



>ref|XP_009795598.1| PREDICTED: RING-H2 finger protein ATL80-like [Nicotiana sylvestris]
Length=182

 Score = 84.0 bits (206),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 48/62 (77%), Gaps = 2/62 (3%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            DF VILAALLC +ICV+GLV VARC+W+RR   G    A   P +NKGLKKKVL+SLPKF
Sbjct  35   DFFVILAALLCGLICVLGLVSVARCSWIRRFSTG--NSAVPSPPANKGLKKKVLKSLPKF  92

Query  317  TY  322
            +Y
Sbjct  93   SY  94



>ref|XP_006303328.1| hypothetical protein CARUB_v10010177mg [Capsella rubella]
 gb|EOA36226.1| hypothetical protein CARUB_v10010177mg [Capsella rubella]
Length=234

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 53/74 (72%), Gaps = 10/74 (14%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQP---------SSNKGLKK  289
            D +VILAALLCA+ICV+GLV V+RC WLRR  AG N  ASG P         ++NKGLKK
Sbjct  64   DLVVILAALLCALICVLGLVAVSRCVWLRRHAAG-NRTASGSPGQTPQPQVAAANKGLKK  122

Query  290  KVLRSLPKFTYGPS  331
            KVL+SLPK TY P 
Sbjct  123  KVLQSLPKLTYSPE  136



>ref|XP_010416561.1| PREDICTED: RING-H2 finger protein ATL8 [Camelina sativa]
Length=186

 Score = 84.0 bits (206),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 49/68 (72%), Gaps = 3/68 (4%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQP---SSNKGLKKKVLRSL  307
            D ++ILA LLCA+ CV+GL+ V+RCAWLRRI        + QP   ++NKGLKKKVLRSL
Sbjct  27   DLVLILAVLLCALTCVLGLIAVSRCAWLRRIATRNRSDQTHQPPVAAANKGLKKKVLRSL  86

Query  308  PKFTYGPS  331
            PK TY P 
Sbjct  87   PKLTYSPD  94



>gb|KFK42061.1| hypothetical protein AALP_AA2G206300 [Arabis alpina]
Length=175

 Score = 83.6 bits (205),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 52/71 (73%), Gaps = 6/71 (8%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRI--RAGANGGASGQP----SSNKGLKKKVL  298
            + +VI+AALLCA IC +GLV+V+RCAWLRR+  R  AN   +  P    ++NKGLKKKVL
Sbjct  27   ELVVIIAALLCAAICFLGLVVVSRCAWLRRLANRTAANSDQTQPPHVASAANKGLKKKVL  86

Query  299  RSLPKFTYGPS  331
            RSLPK TY P 
Sbjct  87   RSLPKVTYSPE  97



>ref|XP_004509462.1| PREDICTED: RING-H2 finger protein ATL80-like [Cicer arietinum]
Length=205

 Score = 84.0 bits (206),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 48/62 (77%), Gaps = 2/62 (3%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            DF+VILAALLCA+I VVGL  +ARCAWLRR     N  A G  S+NKGLKKKVL SLPKF
Sbjct  28   DFVVILAALLCALISVVGLTAIARCAWLRRGPVAGNSPAPG--SANKGLKKKVLNSLPKF  85

Query  317  TY  322
            TY
Sbjct  86   TY  87



>ref|XP_010462813.1| PREDICTED: RING-H2 finger protein ATL80-like [Camelina sativa]
Length=221

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 53/74 (72%), Gaps = 9/74 (12%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAG---ANGGASGQPSS------NKGLKK  289
            D +VILAALLCA+ICV+GLV V+RC WLRR+ AG   A+G   GQ  S      NKGLKK
Sbjct  29   DLVVILAALLCALICVLGLVAVSRCVWLRRLAAGNRTASGSHQGQSPSPPVAAANKGLKK  88

Query  290  KVLRSLPKFTYGPS  331
            KVL+SLPK T+ P 
Sbjct  89   KVLQSLPKLTFSPE  102



>gb|KDP36758.1| hypothetical protein JCGZ_08049 [Jatropha curcas]
Length=192

 Score = 84.0 bits (206),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 53/72 (74%), Gaps = 4/72 (6%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGA----SGQPSSNKGLKKKVLRS  304
            DF+VILAALLCA+ICV+GL+ VARC WLRR+ + AN       S   S+NKGLKKKVLRS
Sbjct  34   DFVVILAALLCALICVLGLIAVARCGWLRRLSSTANSQTPPPPSLPSSANKGLKKKVLRS  93

Query  305  LPKFTYGPSFAA  340
            LPK T+   F A
Sbjct  94   LPKETFSADFTA  105



>ref|XP_010686796.1| PREDICTED: RING-H2 finger protein ATL80 [Beta vulgaris subsp. 
vulgaris]
Length=186

 Score = 83.6 bits (205),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 50/62 (81%), Gaps = 3/62 (5%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            DF+VILAALLCA+ICV+GLV VARCAWLRR+  GA   +S    +NKGLKKKVL+SLPK 
Sbjct  29   DFVVILAALLCALICVLGLVAVARCAWLRRLAGGATSASS---PANKGLKKKVLKSLPKV  85

Query  317  TY  322
             Y
Sbjct  86   AY  87



>ref|XP_003517122.1| PREDICTED: RING-H2 finger protein ATL8-like [Glycine max]
Length=223

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 52/63 (83%), Gaps = 4/63 (6%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASG-QPSSNKGLKKKVLRSLPK  313
            DF+VILAALLCA+ICVVGLV VARCAW R+   G+ GG+S  Q  +NKGLKKKVL+SLPK
Sbjct  32   DFVVILAALLCALICVVGLVAVARCAWFRQ---GSGGGSSPRQALANKGLKKKVLQSLPK  88

Query  314  FTY  322
            F Y
Sbjct  89   FAY  91



>ref|XP_010477335.1| PREDICTED: RING-H2 finger protein ATL80 [Camelina sativa]
Length=198

 Score = 83.6 bits (205),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 53/74 (72%), Gaps = 9/74 (12%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAG---ANGGASGQPSS------NKGLKK  289
            D +VILAALLCA+ICV+GL+ V+RC WLRR+ AG   A+G   GQ  S      NKGLKK
Sbjct  29   DLVVILAALLCALICVLGLIAVSRCVWLRRLAAGNRTASGSHQGQSPSPPVAAANKGLKK  88

Query  290  KVLRSLPKFTYGPS  331
            KVL+SLPK T+ P 
Sbjct  89   KVLQSLPKLTFSPE  102



>emb|CDY45988.1| BnaA02g18080D [Brassica napus]
Length=186

 Score = 83.2 bits (204),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 52/65 (80%), Gaps = 5/65 (8%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRI--RAGANGGASGQPSSNKGLKKKVLRSLP  310
            D +V++AALLCA+ICV+GL+ V+RC WLRR+  R+ AN   S QP +NKGLKKKVL+SLP
Sbjct  27   DLVVVIAALLCALICVLGLLAVSRCVWLRRLANRSAAN---SDQPPANKGLKKKVLKSLP  83

Query  311  KFTYG  325
            K TY 
Sbjct  84   KLTYS  88



>ref|XP_007158027.1| hypothetical protein PHAVU_002G118000g [Phaseolus vulgaris]
 gb|ESW30021.1| hypothetical protein PHAVU_002G118000g [Phaseolus vulgaris]
Length=220

 Score = 83.6 bits (205),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 49/62 (79%), Gaps = 2/62 (3%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            DF+VILAALLCA+ICVVGLV VARCAWLRR   G N  +  Q   NKGLKKKVL+SLPKF
Sbjct  31   DFVVILAALLCALICVVGLVAVARCAWLRRGPGGGN--SPRQAVVNKGLKKKVLQSLPKF  88

Query  317  TY  322
             Y
Sbjct  89   AY  90



>ref|XP_003537694.1| PREDICTED: RING-H2 finger protein ATL8-like [Glycine max]
Length=226

 Score = 83.6 bits (205),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 49/62 (79%), Gaps = 2/62 (3%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            DF+VILAALLCA+ICVVGLV VARCAWLR  R    G +  Q  +NKGLKKKVL+SLPKF
Sbjct  32   DFVVILAALLCALICVVGLVAVARCAWLR--RGSGAGNSPRQALANKGLKKKVLQSLPKF  89

Query  317  TY  322
             Y
Sbjct  90   AY  91



>ref|XP_010534292.1| PREDICTED: RING-H2 finger protein ATL80-like [Tarenaya hassleriana]
Length=191

 Score = 83.2 bits (204),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 51/69 (74%), Gaps = 4/69 (6%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGA----SGQPSSNKGLKKKVLRS  304
            D +VILAALLCA+ICV+GL+ V+RCAWLRR  A  + G        P++NKGLKKKVLRS
Sbjct  29   DLVVILAALLCALICVLGLIAVSRCAWLRRFTAADSSGQAPSPPPHPAANKGLKKKVLRS  88

Query  305  LPKFTYGPS  331
            LPK TY P 
Sbjct  89   LPKLTYSPE  97



>ref|XP_007202550.1| hypothetical protein PRUPE_ppa011201mg [Prunus persica]
 gb|EMJ03749.1| hypothetical protein PRUPE_ppa011201mg [Prunus persica]
Length=220

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 54/64 (84%), Gaps = 1/64 (2%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIR-AGANGGASGQPSSNKGLKKKVLRSLPK  313
            DF+VILAALLCAVICV+GL+ VARCAWLRR   AG    +S Q S+NKG+KKKVL+SLPK
Sbjct  33   DFVVILAALLCAVICVIGLLAVARCAWLRRGSGAGGASLSSAQASANKGVKKKVLQSLPK  92

Query  314  FTYG  325
            FTYG
Sbjct  93   FTYG  96



>ref|XP_010428701.1| PREDICTED: RING-H2 finger protein ATL8-like [Camelina sativa]
Length=186

 Score = 82.8 bits (203),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 49/68 (72%), Gaps = 3/68 (4%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQP---SSNKGLKKKVLRSL  307
            D ++ILA LLCA+ CV+GL+ V+RCAWLRR+        + QP   ++NKGLKKKVLRSL
Sbjct  27   DLVLILAVLLCALTCVLGLIAVSRCAWLRRMATRNRADQTHQPPVAAANKGLKKKVLRSL  86

Query  308  PKFTYGPS  331
            PK TY P 
Sbjct  87   PKLTYSPD  94



>ref|XP_011074071.1| PREDICTED: RING-H2 finger protein ATL80-like [Sesamum indicum]
Length=188

 Score = 82.8 bits (203),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            DF+VILAALLCA+ICV+GL+ VARCAW+RRI    +  +    ++NKGLKKKVL+SLPK 
Sbjct  34   DFVVILAALLCALICVLGLIAVARCAWIRRIAGRNSDSSPSSAAANKGLKKKVLKSLPKL  93

Query  317  TYG  325
            TYG
Sbjct  94   TYG  96



>ref|XP_010432277.1| PREDICTED: RING-H2 finger protein ATL45-like [Camelina sativa]
Length=212

 Score = 82.8 bits (203),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 49/65 (75%), Gaps = 4/65 (6%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQ---PSSNKGLKKKVLRSL  307
            D +VIL+ALLCA+ICV GL  VARCAWLRR+  G N  A+G+   P  NKGLKKK L++L
Sbjct  26   DMVVILSALLCALICVAGLAAVARCAWLRRL-TGVNSAATGEYPPPPPNKGLKKKALQAL  84

Query  308  PKFTY  322
            PK TY
Sbjct  85   PKSTY  89



>emb|CDX85948.1| BnaC06g21860D [Brassica napus]
Length=185

 Score = 82.4 bits (202),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 50/68 (74%), Gaps = 3/68 (4%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQP---SSNKGLKKKVLRSL  307
            + IVI+AALLCA+ICV+GLV V+RC WLRRI A  +     QP   ++N+GLKKKVLRSL
Sbjct  27   NLIVIIAALLCALICVLGLVAVSRCTWLRRIAAPNSVQTHHQPPVAAANRGLKKKVLRSL  86

Query  308  PKFTYGPS  331
            PK  Y P 
Sbjct  87   PKLAYSPD  94



>ref|XP_010437466.1| PREDICTED: RING-H2 finger protein ATL45-like [Camelina sativa]
Length=202

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 50/68 (74%), Gaps = 4/68 (6%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQ---PSSNKGLKKKVLRSL  307
            D +VIL+ALLCA+ICV GL  VARCAWLRR+  G N  A+G+   P  NKGLKKK L++L
Sbjct  27   DMVVILSALLCALICVAGLAAVARCAWLRRL-TGVNSAATGESPPPPPNKGLKKKALQAL  85

Query  308  PKFTYGPS  331
            PK TY  S
Sbjct  86   PKSTYTAS  93



>ref|NP_177767.1| RING-H2 finger protein ATL8 [Arabidopsis thaliana]
 sp|Q8LC69.2|ATL8_ARATH RecName: Full=RING-H2 finger protein ATL8 [Arabidopsis thaliana]
 gb|AAF16660.1|AC012394_9 putative RING zinc finger protein; 36546-35989 [Arabidopsis thaliana]
 gb|AAG51946.1|AC015450_7 putative RING zinc finger protein; 5217-5774 [Arabidopsis thaliana]
 dbj|BAC43477.1| putative RING finger protein [Arabidopsis thaliana]
 gb|AAO63979.1| putative RING zinc finger protein [Arabidopsis thaliana]
 gb|AEE35838.1| RING-H2 finger protein ATL8 [Arabidopsis thaliana]
Length=185

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 49/68 (72%), Gaps = 3/68 (4%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQP---SSNKGLKKKVLRSL  307
            D ++ILA LLCA+ C++GL+ V+RCAWLRRI +      +  P   ++NKGLKKKVLRSL
Sbjct  27   DLVLILAVLLCALTCIIGLIAVSRCAWLRRIASRNRSDQTHPPPVAAANKGLKKKVLRSL  86

Query  308  PKFTYGPS  331
            PK TY P 
Sbjct  87   PKLTYSPD  94



>ref|XP_006416360.1| hypothetical protein EUTSA_v10009964mg [Eutrema salsugineum]
 gb|ESQ34713.1| hypothetical protein EUTSA_v10009964mg [Eutrema salsugineum]
Length=200

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 55/76 (72%), Gaps = 11/76 (14%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAG-----ANGGASGQP------SSNKGL  283
            D +VILAALLCA+ICV+GL+ V+RC WLRR+ AG     ++ G SGQ       ++NKGL
Sbjct  29   DLVVILAALLCALICVLGLIAVSRCVWLRRLAAGNRTAPSSQGVSGQSPPPTVAAANKGL  88

Query  284  KKKVLRSLPKFTYGPS  331
            KKKVL+SLPK T+ P 
Sbjct  89   KKKVLQSLPKLTFSPE  104



>gb|AAM63811.1| putative RING zinc finger protein [Arabidopsis thaliana]
Length=186

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 49/68 (72%), Gaps = 3/68 (4%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQP---SSNKGLKKKVLRSL  307
            D ++ILA LLCA+ C++GL+ V+RCAWLRRI +      +  P   ++NKGLKKKVLRSL
Sbjct  27   DLVLILAVLLCALTCIIGLIAVSRCAWLRRIASRNRSDQTHPPPVAAANKGLKKKVLRSL  86

Query  308  PKFTYGPS  331
            PK TY P 
Sbjct  87   PKLTYSPD  94



>ref|XP_011100182.1| PREDICTED: RING-H2 finger protein ATL80-like [Sesamum indicum]
Length=185

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 51/67 (76%), Gaps = 4/67 (6%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRI----RAGANGGASGQPSSNKGLKKKVLRS  304
            DF+VILAAL+CA+ICV+GLV VARC+W+RR           GA  + ++NKGLKKKVL+S
Sbjct  26   DFVVILAALICALICVLGLVAVARCSWIRRFTGRNSTPTESGAPPRSAANKGLKKKVLKS  85

Query  305  LPKFTYG  325
            LPK TYG
Sbjct  86   LPKQTYG  92



>ref|XP_009109289.1| PREDICTED: RING-H2 finger protein ATL45-like [Brassica rapa]
 emb|CDY24813.1| BnaA08g14970D [Brassica napus]
Length=193

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 49/63 (78%), Gaps = 2/63 (3%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQ-PSSNKGLKKKVLRSLPK  313
            D IVIL+ALLCA+ICV GL  VARCAW+RR+ AG N  A G+ P  NKGLKKK L+SLPK
Sbjct  26   DMIVILSALLCALICVAGLAAVARCAWIRRL-AGVNSSAVGESPPPNKGLKKKALQSLPK  84

Query  314  FTY  322
             T+
Sbjct  85   STF  87



>gb|KDO85202.1| hypothetical protein CISIN_1g043163mg, partial [Citrus sinensis]
Length=172

 Score = 80.9 bits (198),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 53/70 (76%), Gaps = 10/70 (14%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPS--------SNKGLKKK  292
            D++VILAALLCA+ICV+GL+ VARCAWLRR+  G  G A+  PS        +NKGLKKK
Sbjct  2    DYVVILAALLCALICVLGLIAVARCAWLRRLSGG--GAAATNPSGTSTRNSPANKGLKKK  59

Query  293  VLRSLPKFTY  322
            +LR+LPK T+
Sbjct  60   ILRTLPKQTF  69



>ref|XP_006435418.1| hypothetical protein CICLE_v10004041mg [Citrus clementina]
 ref|XP_006473922.1| PREDICTED: RING-H2 finger protein ATL80-like [Citrus sinensis]
 gb|ESR48658.1| hypothetical protein CICLE_v10004041mg [Citrus clementina]
Length=198

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 53/70 (76%), Gaps = 10/70 (14%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPS--------SNKGLKKK  292
            D++VILAALLCA+ICV+GL+ VARCAWLRR+  G  G A+  PS        +NKGLKKK
Sbjct  28   DYVVILAALLCALICVLGLIAVARCAWLRRLSGG--GAAATNPSGTSTRNSPANKGLKKK  85

Query  293  VLRSLPKFTY  322
            +LR+LPK T+
Sbjct  86   ILRTLPKQTF  95



>ref|XP_002887637.1| hypothetical protein ARALYDRAFT_316562 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63896.1| hypothetical protein ARALYDRAFT_316562 [Arabidopsis lyrata subsp. 
lyrata]
Length=186

 Score = 80.9 bits (198),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 49/68 (72%), Gaps = 3/68 (4%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQP---SSNKGLKKKVLRSL  307
            D ++ILA LLCA+ C++GL+ V+RCAWLRRI +      +  P   ++NKGLKKKVLRSL
Sbjct  27   DLVLILAVLLCALTCIIGLIAVSRCAWLRRIASRNRSDQTHPPPVAAANKGLKKKVLRSL  86

Query  308  PKFTYGPS  331
            PK TY P 
Sbjct  87   PKLTYSPD  94



>gb|EYU23603.1| hypothetical protein MIMGU_mgv1a014346mg [Erythranthe guttata]
Length=192

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 52/68 (76%), Gaps = 5/68 (7%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGAN-----GGASGQPSSNKGLKKKVLR  301
            DF+VILAALLCA+ICV+GLV VARCAW+RR+  G++        +   ++NKGLKKKVL 
Sbjct  30   DFVVILAALLCALICVLGLVTVARCAWIRRLAGGSSAPPAAPPRAAAAAANKGLKKKVLN  89

Query  302  SLPKFTYG  325
            SLPK TYG
Sbjct  90   SLPKLTYG  97



>ref|NP_173506.1| RING-H2 finger protein ATL80 [Arabidopsis thaliana]
 sp|Q9LM69.1|ATL80_ARATH RecName: Full=RING-H2 finger protein ATL80 [Arabidopsis thaliana]
 gb|AAF80624.1|AC069251_17 F2D10.34 [Arabidopsis thaliana]
 gb|AAK76523.1| unknown protein [Arabidopsis thaliana]
 gb|AEE30028.1| RING-H2 finger protein ATL80 [Arabidopsis thaliana]
Length=197

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 53/73 (73%), Gaps = 8/73 (11%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAG-----ANGGASGQP---SSNKGLKKK  292
            D +VILAALLCA+ICV+GL+ V+RC WLRR+ AG      +   S QP   ++NKGLKKK
Sbjct  29   DLVVILAALLCALICVLGLIAVSRCVWLRRLAAGNRTVSGSQTQSPQPPVAAANKGLKKK  88

Query  293  VLRSLPKFTYGPS  331
            VL+SLPK T+ P 
Sbjct  89   VLQSLPKLTFSPE  101



>ref|XP_006412098.1| hypothetical protein EUTSA_v10027339mg [Eutrema salsugineum]
 gb|ESQ53551.1| hypothetical protein EUTSA_v10027339mg [Eutrema salsugineum]
Length=197

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 49/63 (78%), Gaps = 2/63 (3%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQ-PSSNKGLKKKVLRSLPK  313
            D +VIL+ALLCA++CV GL  VARCAW+RR+ AG N  A G+ P  NKGLKKK L+SLPK
Sbjct  26   DMVVILSALLCALVCVAGLAAVARCAWIRRL-AGVNSSAVGESPPPNKGLKKKALQSLPK  84

Query  314  FTY  322
             T+
Sbjct  85   STF  87



>ref|XP_010446920.1| PREDICTED: RING-H2 finger protein ATL45-like [Camelina sativa]
Length=199

 Score = 80.5 bits (197),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 49/64 (77%), Gaps = 3/64 (5%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQ--PSSNKGLKKKVLRSLP  310
            D +VIL+ALLCA+ICV GL  VARCAWLRR+  G +  A+G+  P  NKGLKKK L++LP
Sbjct  27   DMVVILSALLCALICVAGLAAVARCAWLRRL-TGVSSAATGESPPPPNKGLKKKALQALP  85

Query  311  KFTY  322
            K TY
Sbjct  86   KSTY  89



>ref|XP_002532473.1| protein with unknown function [Ricinus communis]
 gb|EEF29897.1| protein with unknown function [Ricinus communis]
Length=204

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 52/63 (83%), Gaps = 2/63 (3%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            DF+VILAALLCA+ICVVGL+ VARCAWLR   + ++  +    ++NKGLKKK+L+SLPKF
Sbjct  28   DFVVILAALLCALICVVGLIAVARCAWLRHSGSASS--SPSHAAANKGLKKKILQSLPKF  85

Query  317  TYG  325
            TYG
Sbjct  86   TYG  88



>ref|XP_004159747.1| PREDICTED: RING-H2 finger protein ATL80-like [Cucumis sativus]
Length=180

 Score = 80.1 bits (196),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 48/62 (77%), Gaps = 9/62 (15%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            DF+VILAALLCA+IC+VGL+ VARCAWLRR           Q S+N+GLKKK+L+SLPKF
Sbjct  26   DFVVILAALLCALICMVGLITVARCAWLRR---------GNQASANRGLKKKILQSLPKF  76

Query  317  TY  322
             Y
Sbjct  77   RY  78



>ref|XP_007018117.1| RING/U-box superfamily protein, putative [Theobroma cacao]
 gb|EOY15342.1| RING/U-box superfamily protein, putative [Theobroma cacao]
Length=193

 Score = 80.5 bits (197),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 52/72 (72%), Gaps = 4/72 (6%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASG----QPSSNKGLKKKVLRS  304
            DF+VILAALLCA+ICV+GL+ VARCAWLRR+   +    +      P +NKGLKKK+L+S
Sbjct  33   DFVVILAALLCALICVLGLIAVARCAWLRRLSGSSASNPADTPRPTPPANKGLKKKILKS  92

Query  305  LPKFTYGPSFAA  340
            LPK T+    +A
Sbjct  93   LPKATFSAESSA  104



>emb|CDY41651.1| BnaC03g62330D [Brassica napus]
Length=193

 Score = 80.5 bits (197),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 49/63 (78%), Gaps = 2/63 (3%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQ-PSSNKGLKKKVLRSLPK  313
            D +VIL+ALLCA+ICV GL  VARCAW+RR+ AG N  A G+ P  NKGLKKK L+SLPK
Sbjct  26   DMVVILSALLCALICVSGLAAVARCAWIRRL-AGVNSSAVGESPPPNKGLKKKALQSLPK  84

Query  314  FTY  322
             T+
Sbjct  85   STF  87



>ref|XP_008449155.1| PREDICTED: RING-H2 finger protein ATL80 [Cucumis melo]
Length=178

 Score = 79.7 bits (195),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 48/62 (77%), Gaps = 9/62 (15%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            DF+VILAALLCA+IC+VGL+ VARCAWLRR           Q S+N+GLKKK+L+SLPKF
Sbjct  26   DFVVILAALLCALICMVGLIAVARCAWLRR---------GNQASANRGLKKKILQSLPKF  76

Query  317  TY  322
             Y
Sbjct  77   RY  78



>ref|XP_004146217.1| PREDICTED: RING-H2 finger protein ATL80-like [Cucumis sativus]
 gb|KGN55591.1| hypothetical protein Csa_3G000150 [Cucumis sativus]
Length=181

 Score = 80.1 bits (196),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 48/62 (77%), Gaps = 9/62 (15%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            DF+VILAALLCA+IC+VGL+ VARCAWLRR           Q S+N+GLKKK+L+SLPKF
Sbjct  26   DFVVILAALLCALICMVGLIAVARCAWLRR---------GNQASANRGLKKKILQSLPKF  76

Query  317  TY  322
             Y
Sbjct  77   RY  78



>ref|XP_009103326.1| PREDICTED: RING-H2 finger protein ATL80-like [Brassica rapa]
Length=196

 Score = 79.7 bits (195),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 53/76 (70%), Gaps = 11/76 (14%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRI------RAGANGGASGQP-----SSNKGL  283
            D +V LAALLCA++CV+GL+ V+RC WLRR+       AG+ GG+   P     ++NKGL
Sbjct  29   DLVVTLAALLCAMVCVLGLIAVSRCVWLRRLAAGNRTHAGSQGGSVQSPPPPVAAANKGL  88

Query  284  KKKVLRSLPKFTYGPS  331
            KKKVL+SLPK T+ P 
Sbjct  89   KKKVLQSLPKLTFSPD  104



>gb|ABK56013.1| zinc finger protein [Brassica rapa]
Length=196

 Score = 79.7 bits (195),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 53/76 (70%), Gaps = 11/76 (14%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRI------RAGANGGASGQP-----SSNKGL  283
            D +V LAALLCA++CV+GL+ V+RC WLRR+       AG+ GG+   P     ++NKGL
Sbjct  29   DLVVTLAALLCAMVCVLGLIAVSRCVWLRRLAAGNRTHAGSQGGSVQSPPPPVAAANKGL  88

Query  284  KKKVLRSLPKFTYGPS  331
            KKKVL+SLPK T+ P 
Sbjct  89   KKKVLQSLPKLTFSPD  104



>emb|CDY29504.1| BnaA06g14660D [Brassica napus]
Length=202

 Score = 79.7 bits (195),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 50/76 (66%), Gaps = 11/76 (14%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSS-----------NKGL  283
            D +VILAAL+CA+ICV+GL+ V+RC WLRR+ AG    +  Q  S           NKGL
Sbjct  29   DLVVILAALICALICVLGLIAVSRCVWLRRLAAGTRTSSGSQDGSGQSPPQQAAAANKGL  88

Query  284  KKKVLRSLPKFTYGPS  331
            KKKVL+SLPK T+ P 
Sbjct  89   KKKVLQSLPKLTFSPE  104



>ref|XP_009149561.1| PREDICTED: RING-H2 finger protein ATL80 [Brassica rapa]
 gb|AGW83699.1| RING zinc finger protein [Brassica rapa subsp. chinensis]
Length=202

 Score = 79.7 bits (195),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 50/76 (66%), Gaps = 11/76 (14%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSS-----------NKGL  283
            D +VILAAL+CA+ICV+GL+ V+RC WLRR+ AG    +  Q  S           NKGL
Sbjct  29   DLVVILAALICALICVLGLIAVSRCVWLRRLAAGTRTSSGSQDGSGQSPPQQAAAANKGL  88

Query  284  KKKVLRSLPKFTYGPS  331
            KKKVL+SLPK T+ P 
Sbjct  89   KKKVLQSLPKLTFSPE  104



>ref|XP_003629097.1| Ring finger protein [Medicago truncatula]
 gb|AET03573.1| anaphase-promoting complex subunit 11 RING-H2 finger protein 
[Medicago truncatula]
Length=203

 Score = 79.7 bits (195),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 50/63 (79%), Gaps = 4/63 (6%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIR-AGANGGASGQPSSNKGLKKKVLRSLPK  313
            DF+VILAALLCA+I VVGL  +ARCAWLRR   AGA+  A+    +NKGLKKKVL SLPK
Sbjct  25   DFVVILAALLCALISVVGLTAIARCAWLRRTPVAGASPSAA---VANKGLKKKVLNSLPK  81

Query  314  FTY  322
            FTY
Sbjct  82   FTY  84



>ref|XP_006298646.1| hypothetical protein CARUB_v10014735mg [Capsella rubella]
 gb|EOA31544.1| hypothetical protein CARUB_v10014735mg [Capsella rubella]
Length=187

 Score = 79.3 bits (194),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 45/62 (73%), Gaps = 3/62 (5%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            D +VIL+ALLCA+ICV GL  V RCAWLRR      GG S  PS NKGLKKK L+SLP+ 
Sbjct  27   DMVVILSALLCALICVAGLAAVVRCAWLRRF---TGGGDSSSPSPNKGLKKKALQSLPRS  83

Query  317  TY  322
            T+
Sbjct  84   TF  85



>ref|XP_010908037.1| PREDICTED: RING-H2 finger protein ATL8-like [Elaeis guineensis]
Length=196

 Score = 79.3 bits (194),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 49/62 (79%), Gaps = 4/62 (6%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            D +VILAALLCA+ICVVGL +VARCAWLRR    ++G  S  P  NKGLKKKVLRSLPK 
Sbjct  50   DVVVILAALLCALICVVGLALVARCAWLRR----SSGDPSPPPPPNKGLKKKVLRSLPKL  105

Query  317  TY  322
            +Y
Sbjct  106  SY  107



>ref|NP_001241583.1| uncharacterized protein LOC100794614 [Glycine max]
 gb|ACU23399.1| unknown [Glycine max]
Length=184

 Score = 79.3 bits (194),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 49/63 (78%), Gaps = 2/63 (3%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSS--NKGLKKKVLRSLP  310
            DF+VILAALLCA+ICV+GLV VARC  LRR+R  ++      P+S  NKG+KKKVLRSLP
Sbjct  23   DFVVILAALLCALICVLGLVAVARCGCLRRLRLSSSATTPQSPTSAANKGVKKKVLRSLP  82

Query  311  KFT  319
            K T
Sbjct  83   KLT  85



>ref|XP_009413072.1| PREDICTED: RING-H2 finger protein ATL80-like [Musa acuminata 
subsp. malaccensis]
Length=191

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 52/68 (76%), Gaps = 5/68 (7%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            D +VILAALLCA+ICVVGL +VARCAWLRR    A+ GA   P S KGLKKK LR+LPK 
Sbjct  29   DVVVILAALLCALICVVGLALVARCAWLRR----ASPGARPAPPS-KGLKKKALRALPKV  83

Query  317  TYGPSFAA  340
            +YG + AA
Sbjct  84   SYGAATAA  91



>ref|XP_009150790.1| PREDICTED: RING-H2 finger protein ATL44-like [Brassica rapa]
 emb|CDY66407.1| BnaA06g39270D [Brassica napus]
Length=187

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 45/62 (73%), Gaps = 5/62 (8%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            D +VIL+ALLCA+ICV GL  V RCAWLRR   G N      PS+NKGLKKK L+SLP+ 
Sbjct  27   DMVVILSALLCALICVAGLAAVVRCAWLRRFTTGENS-----PSANKGLKKKALQSLPRS  81

Query  317  TY  322
            T+
Sbjct  82   TF  83



>emb|CDY01352.1| BnaA07g11250D [Brassica napus]
Length=196

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 52/76 (68%), Gaps = 11/76 (14%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRI------RAGANGGASGQP-----SSNKGL  283
            D +V LAALLCA++C+ GL+ V+RC WLRR+       AG+ GG+   P     ++NKGL
Sbjct  29   DLVVTLAALLCAMVCIFGLIAVSRCVWLRRLAAGNRTHAGSQGGSGQSPPPPVAAANKGL  88

Query  284  KKKVLRSLPKFTYGPS  331
            KKKVL+SLPK T+ P 
Sbjct  89   KKKVLQSLPKLTFSPD  104



>emb|CDY31863.1| BnaC07g15130D [Brassica napus]
Length=167

 Score = 78.6 bits (192),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 52/76 (68%), Gaps = 11/76 (14%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRI------RAGANGGASGQP-----SSNKGL  283
            D +++LAALLCA+IC +GL+ V+RC WLRR+       AG+ GG+   P     ++NKGL
Sbjct  29   DLVIVLAALLCAMICFLGLIAVSRCVWLRRLAAGNRTHAGSQGGSGQSPPPPVAAANKGL  88

Query  284  KKKVLRSLPKFTYGPS  331
            K KVL+SLPK T+ P 
Sbjct  89   KNKVLQSLPKLTFSPE  104



>ref|XP_006285317.1| hypothetical protein CARUB_v10006700mg [Capsella rubella]
 gb|EOA18215.1| hypothetical protein CARUB_v10006700mg [Capsella rubella]
Length=199

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            D +VIL+ALLCA+ICV GL  VARCAWLRR+    +      P  NKGLKKKV+ +LPK 
Sbjct  25   DMVVILSALLCALICVAGLAAVARCAWLRRLTGVNSAAIRESPPPNKGLKKKVIEALPKS  84

Query  317  TY  322
            TY
Sbjct  85   TY  86



>gb|EPS68943.1| hypothetical protein M569_05824 [Genlisea aurea]
Length=198

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            DF+VILAA+LCA+ICV+GL+ VARCAW+RR+  G +  +S   ++NKGLKKKVL SLPK 
Sbjct  37   DFVVILAAMLCALICVLGLIAVARCAWIRRLGGGESAASSLPAAANKGLKKKVLNSLPKT  96

Query  317  TYG  325
            T+ 
Sbjct  97   TFA  99



>ref|XP_002301903.1| zinc finger family protein [Populus trichocarpa]
 gb|EEE81176.1| zinc finger family protein [Populus trichocarpa]
Length=200

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 49/70 (70%), Gaps = 3/70 (4%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRA---GANGGASGQPSSNKGLKKKVLRSL  307
            DF+VILAALLCA+ICV+GL+ VARCAWLRR  +              +NKGLKKKVLRSL
Sbjct  32   DFMVILAALLCALICVLGLIAVARCAWLRRFSSRNPTPPVPPPPPSVANKGLKKKVLRSL  91

Query  308  PKFTYGPSFA  337
            PK T+   F+
Sbjct  92   PKQTFSEDFS  101



>ref|XP_011034822.1| PREDICTED: RING-H2 finger protein ATL8-like [Populus euphratica]
 ref|XP_011034823.1| PREDICTED: RING-H2 finger protein ATL8-like [Populus euphratica]
Length=198

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 49/70 (70%), Gaps = 3/70 (4%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRA---GANGGASGQPSSNKGLKKKVLRSL  307
            DF+VILAALLCA+ICV+GL+ VARCAWLRR  +              +NKGLKKKVLRSL
Sbjct  32   DFMVILAALLCALICVLGLIAVARCAWLRRFSSRNPTPPVPPPPPAVANKGLKKKVLRSL  91

Query  308  PKFTYGPSFA  337
            PK T+   F+
Sbjct  92   PKQTFSEDFS  101



>ref|XP_002890411.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66670.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=197

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 51/73 (70%), Gaps = 8/73 (11%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAG--ANGGASGQP------SSNKGLKKK  292
            D +VILAALLCA+ICV+GL+ V+RC WLRR  AG     G+ GQ       ++NKGLKKK
Sbjct  29   DLVVILAALLCALICVLGLIAVSRCVWLRRFAAGNRTASGSQGQSPPPPVAAANKGLKKK  88

Query  293  VLRSLPKFTYGPS  331
            VL+SLPK  + P 
Sbjct  89   VLQSLPKLAFSPE  101



>ref|XP_010515011.1| PREDICTED: RING-H2 finger protein ATL44 [Camelina sativa]
Length=194

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 44/62 (71%), Gaps = 3/62 (5%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            D +VIL+ALLCA+ICV GL  V RCAWLRR      GG    PS NKGLKKK L+SLP+ 
Sbjct  27   DMVVILSALLCALICVAGLAAVVRCAWLRRF---TGGGGDSSPSPNKGLKKKALQSLPRS  83

Query  317  TY  322
            T+
Sbjct  84   TF  85



>ref|XP_008779008.1| PREDICTED: RING-H2 finger protein ATL8-like [Phoenix dactylifera]
Length=199

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 48/66 (73%), Gaps = 4/66 (6%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANG----GASGQPSSNKGLKKKVLRS  304
            D +V+LAALLCA++CV+GL +VARCAWLRR     +     GA  +P  +KGLKKK LRS
Sbjct  29   DVVVVLAALLCALVCVLGLALVARCAWLRRPSGDPSDLGGSGAPSRPPPDKGLKKKALRS  88

Query  305  LPKFTY  322
            LPK +Y
Sbjct  89   LPKLSY  94



>emb|CDX72540.1| BnaC07g45620D [Brassica napus]
Length=190

 Score = 77.8 bits (190),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 48/65 (74%), Gaps = 3/65 (5%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQ--PSSNKGLKKKVLRSLP  310
            D ++IL+ALLCA+ICV GL  VARCAWLRR+  G N  A G+  P  +KGLKKK L+SLP
Sbjct  26   DMVIILSALLCALICVAGLAAVARCAWLRRL-TGVNSAAVGESPPPPSKGLKKKALQSLP  84

Query  311  KFTYG  325
            K T+ 
Sbjct  85   KSTFA  89



>ref|XP_010489373.1| PREDICTED: RING-H2 finger protein ATL44-like [Camelina sativa]
Length=193

 Score = 77.8 bits (190),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 44/62 (71%), Gaps = 4/62 (6%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            D +VIL+ALLCA+ICV GL  V RCAWLRR      GG    PS NKGLKKK L+SLP+ 
Sbjct  27   DMVVILSALLCALICVAGLAAVVRCAWLRRF----TGGGDSSPSPNKGLKKKALQSLPRS  82

Query  317  TY  322
            T+
Sbjct  83   TF  84



>ref|XP_006409305.1| hypothetical protein EUTSA_v10023141mg [Eutrema salsugineum]
 gb|ESQ50758.1| hypothetical protein EUTSA_v10023141mg [Eutrema salsugineum]
Length=185

 Score = 77.8 bits (190),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 45/62 (73%), Gaps = 5/62 (8%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            D +VIL+ALLCA+ICV GL  V RCAWLRR   G +      PS NKGLKKKVL+SLP+ 
Sbjct  28   DMVVILSALLCALICVAGLAAVLRCAWLRRFTTGGDS-----PSPNKGLKKKVLQSLPRS  82

Query  317  TY  322
            T+
Sbjct  83   TF  84



>ref|XP_009138362.1| PREDICTED: RING-H2 finger protein ATL45-like [Brassica rapa]
 emb|CDY40631.1| BnaA03g53320D [Brassica napus]
Length=190

 Score = 77.8 bits (190),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 48/64 (75%), Gaps = 3/64 (5%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQ--PSSNKGLKKKVLRSLP  310
            D +VIL+ALLCA+ICV GL  VARCAWLRR+  G N  A G+  P  +KGLKKK L+SLP
Sbjct  26   DMVVILSALLCALICVAGLAAVARCAWLRRL-TGVNSAAVGESPPPPSKGLKKKALQSLP  84

Query  311  KFTY  322
            K T+
Sbjct  85   KSTF  88



>ref|NP_179337.1| RING-H2 finger protein ATL44 [Arabidopsis thaliana]
 sp|O22755.1|ATL44_ARATH RecName: Full=RING-H2 finger protein ATL44; AltName: Full=RING-H2 
zinc finger protein RHA3a [Arabidopsis thaliana]
 gb|AAK44054.1|AF370239_1 putative RING zinc finger protein [Arabidopsis thaliana]
 gb|AAC68673.1| RING-H2 finger protein RHA3a [Arabidopsis thaliana]
 gb|AAD32903.1| putative RING zinc finger protein [Arabidopsis thaliana]
 gb|AAL33807.1| putative RING zinc finger protein [Arabidopsis thaliana]
 gb|AEC06631.1| RING-H2 finger protein ATL44 [Arabidopsis thaliana]
Length=185

 Score = 77.8 bits (190),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 45/62 (73%), Gaps = 5/62 (8%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            D +VIL+ALLCA+ICV GL  V RCAWLRR  AG +      PS NKGLKKK L+SLP+ 
Sbjct  27   DMVVILSALLCALICVAGLAAVVRCAWLRRFTAGGDS-----PSPNKGLKKKALQSLPRS  81

Query  317  TY  322
            T+
Sbjct  82   TF  83



>gb|KDP43788.1| hypothetical protein JCGZ_22415 [Jatropha curcas]
Length=209

 Score = 77.8 bits (190),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 56/69 (81%), Gaps = 2/69 (3%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPS--SNKGLKKKVLRSLP  310
            DF+VILAALLCA+ICVVGL+ VARCAWLRR   G+   ++ Q +  +NKGLKKK+++SLP
Sbjct  28   DFVVILAALLCALICVVGLIAVARCAWLRRGSGGSTSRSTSQAAAVANKGLKKKIVQSLP  87

Query  311  KFTYGPSFA  337
            KFTYG + A
Sbjct  88   KFTYGATAA  96



>emb|CDY31495.1| BnaC05g16040D [Brassica napus]
Length=198

 Score = 77.8 bits (190),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 49/76 (64%), Gaps = 11/76 (14%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSS-----------NKGL  283
            D +VILAAL+CA+ICV+GL+ V+RC WLRR+ AG    +  Q  S           NKGL
Sbjct  29   DLVVILAALICALICVLGLIAVSRCVWLRRLAAGTRTSSGSQDGSGQSPPQQAAAANKGL  88

Query  284  KKKVLRSLPKFTYGPS  331
            KKK L+SLPK T+ P 
Sbjct  89   KKKALQSLPKVTFSPE  104



>emb|CDY69366.1| BnaAnng30200D [Brassica napus]
Length=187

 Score = 77.4 bits (189),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 45/62 (73%), Gaps = 5/62 (8%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            D +VIL+ALLCA+ICV GL  V RCAWLR+   G N      PS+NKGLKKK L+SLP+ 
Sbjct  27   DMVVILSALLCALICVAGLAAVVRCAWLRQFTTGENS-----PSANKGLKKKALQSLPRS  81

Query  317  TY  322
            T+
Sbjct  82   TF  83



>ref|XP_010467517.1| PREDICTED: RING-H2 finger protein ATL44-like [Camelina sativa]
Length=190

 Score = 77.4 bits (189),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 45/62 (73%), Gaps = 3/62 (5%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            D +VIL+ALLCA+ICV GL  V RCAWLRR      GG +  PS NKGLKKK L+SLP+ 
Sbjct  27   DMVVILSALLCALICVAGLAAVLRCAWLRRF---TGGGGNSSPSPNKGLKKKALQSLPRS  83

Query  317  TY  322
            T+
Sbjct  84   TF  85



>ref|XP_002886113.1| ring-H2 finger A3A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62372.1| ring-H2 finger A3A [Arabidopsis lyrata subsp. lyrata]
Length=185

 Score = 77.4 bits (189),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 45/62 (73%), Gaps = 5/62 (8%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            D +VIL+ALLCA+ICV GL  V RCAWLRR  AG +      PS NKGLKKK L+SLP+ 
Sbjct  27   DMVVILSALLCALICVAGLAAVVRCAWLRRFTAGGDS-----PSPNKGLKKKALQSLPRS  81

Query  317  TY  322
            T+
Sbjct  82   TF  83



>gb|KFK44194.1| hypothetical protein AALP_AA1G226700 [Arabis alpina]
Length=201

 Score = 77.8 bits (190),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 52/80 (65%), Gaps = 15/80 (19%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRI---------RAGANGGASGQPSS------  271
            D +VILAALLCA+ICV+GL+ V+RC WLRR+          +G+  G+   P S      
Sbjct  29   DLVVILAALLCALICVLGLIAVSRCVWLRRLASGNRTTVYSSGSQTGSGQSPPSPPVAAA  88

Query  272  NKGLKKKVLRSLPKFTYGPS  331
            NKGLKKKVL+SLPK T+ P 
Sbjct  89   NKGLKKKVLQSLPKVTFSPE  108



>emb|CDX75506.1| BnaA01g01960D [Brassica napus]
Length=193

 Score = 77.4 bits (189),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 47/63 (75%), Gaps = 2/63 (3%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQ-PSSNKGLKKKVLRSLPK  313
            D IVILAALLCA+ICV GL  VARCA LRR+  G N  A G+ P  NKGLKKK L+SLPK
Sbjct  26   DMIVILAALLCALICVAGLAAVARCACLRRL-VGVNSSAVGESPPPNKGLKKKALQSLPK  84

Query  314  FTY  322
             T+
Sbjct  85   STF  87



>ref|XP_002867072.1| ring-H2 finger A3B [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43331.1| ring-H2 finger A3B [Arabidopsis lyrata subsp. lyrata]
Length=200

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 46/60 (77%), Gaps = 2/60 (3%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQ-PSSNKGLKKKVLRSLPK  313
            D +VIL+ALLCA+ICV GL  VARCAWLRR+  G N  A G+ P  NKGLKKK L++LPK
Sbjct  25   DMVVILSALLCALICVAGLAAVARCAWLRRL-TGVNSAAVGESPPPNKGLKKKALQALPK  83



>ref|XP_011041176.1| PREDICTED: RING-H2 finger protein ATL8 [Populus euphratica]
Length=194

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 50/70 (71%), Gaps = 3/70 (4%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPS---SNKGLKKKVLRSL  307
            DF+VILAALLCA+ICV+GL+ VARCAWLRR+ +      +  P    +NKGLKKK LRSL
Sbjct  32   DFMVILAALLCALICVLGLIAVARCAWLRRLSSHTPAPPAPLPPPSVANKGLKKKTLRSL  91

Query  308  PKFTYGPSFA  337
            PK T+    A
Sbjct  92   PKQTFSEDSA  101



>ref|XP_009110211.1| PREDICTED: RING-H2 finger protein ATL80 [Brassica rapa]
Length=197

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 51/73 (70%), Gaps = 8/73 (11%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQ--------PSSNKGLKKK  292
            D ++ILAALLCA+ICV+GL+ V+RC WLRR+ AG    + G          ++NKGLKKK
Sbjct  29   DLVIILAALLCALICVLGLIAVSRCVWLRRLAAGNRSSSGGSGQSPPPQVTAANKGLKKK  88

Query  293  VLRSLPKFTYGPS  331
            VL+SLPK T+ P 
Sbjct  89   VLQSLPKMTFSPE  101



>ref|XP_002306993.2| hypothetical protein POPTR_0005s27660g [Populus trichocarpa]
 gb|EEE93989.2| hypothetical protein POPTR_0005s27660g [Populus trichocarpa]
Length=194

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 49/70 (70%), Gaps = 3/70 (4%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPS---SNKGLKKKVLRSL  307
            DF+VILAALLCA+ICV+GL+ VARCAWLRR+ +         P    +NKGLKKK LRSL
Sbjct  32   DFMVILAALLCALICVLGLIAVARCAWLRRLSSHTPAPPVPLPPPSVANKGLKKKTLRSL  91

Query  308  PKFTYGPSFA  337
            PK T+    A
Sbjct  92   PKQTFSEDSA  101



>emb|CDX96619.1| BnaA08g21620D [Brassica napus]
Length=197

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 51/73 (70%), Gaps = 8/73 (11%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQ--------PSSNKGLKKK  292
            D ++ILAALLCA+ICV+GL+ V+RC WLRR+ AG    + G          ++NKGLKKK
Sbjct  29   DLVIILAALLCALICVLGLIAVSRCVWLRRLAAGNRSSSGGSGQSPPPQVTAANKGLKKK  88

Query  293  VLRSLPKFTYGPS  331
            VL+SLPK T+ P 
Sbjct  89   VLQSLPKMTFSPE  101



>ref|XP_007135973.1| hypothetical protein PHAVU_009G007400g [Phaseolus vulgaris]
 gb|ESW07967.1| hypothetical protein PHAVU_009G007400g [Phaseolus vulgaris]
Length=185

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQP-SSNKGLKKKVLRSLPK  313
            DF+VILAALLCA+ICV+GLV VARC  LRR+R  +       P ++NKG+KKKVLRSLPK
Sbjct  24   DFVVILAALLCALICVLGLVAVARCGCLRRLRFSSASTPQPPPAAANKGVKKKVLRSLPK  83

Query  314  FT  319
             T
Sbjct  84   LT  85



>ref|XP_010935347.1| PREDICTED: LOW QUALITY PROTEIN: RING-H2 finger protein ATL8-like 
[Elaeis guineensis]
Length=182

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            D +VILA LLCA+ICVVGL +VARCAW+RR  + A+   +   +  KGLKKK LRSLP F
Sbjct  28   DVVVILATLLCALICVVGLALVARCAWIRRFSSTAHPPPAAAAAPPKGLKKKALRSLPTF  87

Query  317  TY  322
            ++
Sbjct  88   SF  89



>emb|CDX69143.1| BnaC01g03100D [Brassica napus]
Length=194

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 47/63 (75%), Gaps = 2/63 (3%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQ-PSSNKGLKKKVLRSLPK  313
            D +VIL+ALLCA+ICV GL  VARCA LRR+  G N  A G+ P  NKGLKKK L+SLPK
Sbjct  26   DMVVILSALLCALICVAGLAAVARCACLRRL-VGVNSSAVGESPPPNKGLKKKALQSLPK  84

Query  314  FTY  322
             T+
Sbjct  85   STF  87



>emb|CDY33648.1| BnaC08g19480D [Brassica napus]
Length=197

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 51/73 (70%), Gaps = 8/73 (11%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQ--------PSSNKGLKKK  292
            D ++ILAALLCA+ICV+GL+ V+RC WLRR+ AG    + G          ++NKGLKKK
Sbjct  29   DLVIILAALLCALICVLGLIAVSRCVWLRRLAAGNRSSSGGSGQSPPPQVAAANKGLKKK  88

Query  293  VLRSLPKFTYGPS  331
            VL+SLPK T+ P 
Sbjct  89   VLQSLPKLTFSPE  101



>ref|XP_009101519.1| PREDICTED: RING-H2 finger protein ATL45 [Brassica rapa]
Length=237

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 47/63 (75%), Gaps = 2/63 (3%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQ-PSSNKGLKKKVLRSLPK  313
            D IVIL+ALLCA+ICV GL  VARCA LRR+  G N  A G+ P  NKGLKKK L+SLPK
Sbjct  70   DMIVILSALLCALICVAGLAAVARCACLRRL-VGVNSSAVGESPPPNKGLKKKALQSLPK  128

Query  314  FTY  322
             T+
Sbjct  129  STF  131



>ref|NP_195273.1| putative RING-H2 finger protein RHA3b [Arabidopsis thaliana]
 sp|Q9ZT49.1|ATL45_ARATH RecName: Full=RING-H2 finger protein ATL45; AltName: Full=RING-H2 
zinc finger protein RHA3b [Arabidopsis thaliana]
 gb|AAC68674.1| RING-H2 finger protein RHA3b [Arabidopsis thaliana]
 emb|CAB54876.1| RING-H2 finger protein RHA3b [Arabidopsis thaliana]
 emb|CAB80264.1| RING-H2 finger protein RHA3b [Arabidopsis thaliana]
 gb|AAM64643.1| RING-H2 finger protein RHA3b [Arabidopsis thaliana]
 gb|AAY57612.1| RING finger family protein [Arabidopsis thaliana]
 gb|ABR46213.1| At4g35480 [Arabidopsis thaliana]
 gb|AEE86520.1| putative RING-H2 finger protein RHA3b [Arabidopsis thaliana]
Length=200

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 46/60 (77%), Gaps = 2/60 (3%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQ-PSSNKGLKKKVLRSLPK  313
            D +VIL+ALLCA++CV GL  VARCAWLRR+  G N  A G+ P  NKGLKKK L++LPK
Sbjct  25   DMVVILSALLCALVCVAGLAAVARCAWLRRL-TGVNPAAVGEAPPPNKGLKKKALQALPK  83



>emb|CDY49431.1| BnaC07g06500D [Brassica napus]
Length=188

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 44/62 (71%), Gaps = 5/62 (8%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            D +VIL+ALLCA+ICV GL  V RCA LRR  AG N      PS NKGLKKK L+SLP+ 
Sbjct  28   DMVVILSALLCALICVAGLAAVVRCACLRRFTAGGNS-----PSQNKGLKKKALQSLPRS  82

Query  317  TY  322
            T+
Sbjct  83   TF  84



>ref|XP_008812592.1| PREDICTED: RING-H2 finger protein ATL80-like [Phoenix dactylifera]
Length=188

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 48/68 (71%), Gaps = 3/68 (4%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            D +VILAALLCA+ICVVGL +VARCAWLRR  A A   A+      KGLKKK LRSLP  
Sbjct  28   DVVVILAALLCALICVVGLALVARCAWLRRSSASAQPPAA---RPTKGLKKKALRSLPTL  84

Query  317  TYGPSFAA  340
            ++  S A+
Sbjct  85   SFDGSTAS  92



>ref|XP_003527275.1| PREDICTED: RING-H2 finger protein ATL80-like [Glycine max]
Length=184

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 47/63 (75%), Gaps = 2/63 (3%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQP--SSNKGLKKKVLRSLP  310
            DF+VI AALLCA+IC++GLV V RC  LRR+R  ++      P  S+NKG+KKKVLRSLP
Sbjct  23   DFVVIFAALLCALICILGLVAVTRCGCLRRLRLSSSNATPQPPPASANKGVKKKVLRSLP  82

Query  311  KFT  319
            K T
Sbjct  83   KVT  85



>ref|XP_010537218.1| PREDICTED: RING-H2 finger protein ATL80-like [Tarenaya hassleriana]
Length=184

 Score = 74.7 bits (182),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRA---GANGGASGQPSSNKGLKKKVLRSL  307
            D +VILAALLCA++CV+GL+ V+RCAWLRR+ A             +SNKGLKK VLRSL
Sbjct  23   DLVVILAALLCALVCVLGLIAVSRCAWLRRLSASGPSGQSPPPPPAASNKGLKKNVLRSL  82

Query  308  PKFTYG  325
            PK TY 
Sbjct  83   PKLTYS  88



>emb|CDX88272.1| BnaC06g37160D [Brassica napus]
Length=191

 Score = 74.3 bits (181),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 51/72 (71%), Gaps = 7/72 (10%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWL----RRIRAGANGGASGQP---SSNKGLKKKV  295
            D IVI+AALLCA+ICV+GLV V+RC+WL        + AN   + QP   ++NKGLKKKV
Sbjct  27   DLIVIIAALLCALICVLGLVAVSRCSWLRRIAASRSSAANSDQNHQPPVAAANKGLKKKV  86

Query  296  LRSLPKFTYGPS  331
            LRSLPK TY P 
Sbjct  87   LRSLPKLTYSPD  98



>emb|CDX87603.1| BnaA07g32700D [Brassica napus]
Length=192

 Score = 73.9 bits (180),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 51/72 (71%), Gaps = 7/72 (10%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWL----RRIRAGANGGASGQP---SSNKGLKKKV  295
            D IVI+AALLCA+ICV+GLV V+RC+WL        + AN   + QP   ++NKGLKKKV
Sbjct  27   DLIVIIAALLCALICVLGLVAVSRCSWLRRIAASRSSAANSDQNPQPPVAAANKGLKKKV  86

Query  296  LRSLPKFTYGPS  331
            LRSLPK TY P 
Sbjct  87   LRSLPKLTYSPD  98



>ref|XP_009384604.1| PREDICTED: RING-H2 finger protein ATL44-like [Musa acuminata 
subsp. malaccensis]
Length=192

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 47/62 (76%), Gaps = 6/62 (10%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            D +VILAALLCA+ICVVGL +VARCAW+RR     + GA   P S KGLKKK LR+LPK 
Sbjct  29   DMVVILAALLCALICVVGLALVARCAWIRR-----SAGAPPAPKS-KGLKKKALRALPKV  82

Query  317  TY  322
            +Y
Sbjct  83   SY  84



>gb|KFK40135.1| hypothetical protein AALP_AA3G335200 [Arabis alpina]
Length=194

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 43/62 (69%), Gaps = 3/62 (5%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            D +VIL+ALLCA+ICV GL  V RCA LRR      GG    PS NKGLKKK L+SLP+ 
Sbjct  28   DMVVILSALLCALICVAGLAAVVRCACLRRF---TTGGGESSPSPNKGLKKKALQSLPRS  84

Query  317  TY  322
            T+
Sbjct  85   TF  86



>emb|CDY24337.1| BnaA07g02620D [Brassica napus]
Length=188

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 44/62 (71%), Gaps = 5/62 (8%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            D +VIL+ALLCA+ICV GL  + RC+ LRR  AG N      PS NKGLKKK L+SLP+ 
Sbjct  28   DMVVILSALLCALICVAGLAAIVRCSCLRRFTAGGNS-----PSQNKGLKKKALQSLPRS  82

Query  317  TY  322
            T+
Sbjct  83   TF  84



>ref|XP_010094527.1| RING-H2 finger protein ATL80 [Morus notabilis]
 gb|EXB56281.1| RING-H2 finger protein ATL80 [Morus notabilis]
Length=186

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 51/73 (70%), Gaps = 6/73 (8%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRI------RAGANGGASGQPSSNKGLKKKVL  298
            DF+VILAALLCA+ICV+GLV +ARCAWLRR+       A A+      P  NKGLKKK+L
Sbjct  27   DFVVILAALLCALICVLGLVAIARCAWLRRLSGGGSSAASASSSRPPPPPPNKGLKKKIL  86

Query  299  RSLPKFTYGPSFA  337
            RSLPK ++    A
Sbjct  87   RSLPKLSFTADLA  99



>ref|XP_010911522.1| PREDICTED: RING-H2 finger protein ATL44-like [Elaeis guineensis]
Length=183

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 44/64 (69%), Gaps = 7/64 (11%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQP-SSNKGLKKKVLRSLPK  313
            D +VILAALLCA+ICVVGL +VARCAWLRR         S QP    KGLKKK LRSLP 
Sbjct  28   DVVVILAALLCALICVVGLALVARCAWLRR------SSPSAQPLPPTKGLKKKALRSLPT  81

Query  314  FTYG  325
             ++ 
Sbjct  82   LSFD  85



>gb|KHN20089.1| RING-H2 finger protein ATL80, partial [Glycine soja]
Length=133

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 46/63 (73%), Gaps = 2/63 (3%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQP--SSNKGLKKKVLRSLP  310
            DF+VI AALLCA+IC++GLV VARC  LRR    ++      P  S+NKG+KKKVLRSLP
Sbjct  13   DFVVIFAALLCALICILGLVAVARCGCLRRPPLPSSNATPQPPPASANKGVKKKVLRSLP  72

Query  311  KFT  319
            K T
Sbjct  73   KVT  75



>ref|XP_009121114.1| PREDICTED: RING-H2 finger protein ATL44 [Brassica rapa]
Length=226

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 44/62 (71%), Gaps = 5/62 (8%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            D +VIL+ALLCA+ICV GL  + RC+ LRR  AG N      PS NKGLKKK L+SLP+ 
Sbjct  66   DMVVILSALLCALICVAGLAAIVRCSCLRRFTAGGNS-----PSQNKGLKKKALQSLPRS  120

Query  317  TY  322
            T+
Sbjct  121  TF  122



>ref|XP_003572834.1| PREDICTED: RING-H2 finger protein ATL80-like [Brachypodium distachyon]
Length=193

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            D +VILA LLCA++CV+GL +VARCA  RR  A A G +S  P +NKG+KK+VLRSLP  
Sbjct  22   DLVVILAGLLCALVCVLGLGLVARCACTRRW-ARAAGASSSPPGANKGVKKEVLRSLPTV  80

Query  317  TY  322
            TY
Sbjct  81   TY  82



>ref|XP_003603861.1| RING-H2 finger protein ATL1B [Medicago truncatula]
 gb|AES74112.1| anaphase-promoting complex subunit 11 RING-H2 finger protein 
[Medicago truncatula]
Length=193

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 47/65 (72%), Gaps = 4/65 (6%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASG----QPSSNKGLKKKVLRS  304
            DF+VILAALLCA+ICV+GLV V RC  LRR+R  +    +       ++NKG+KKKVLRS
Sbjct  28   DFVVILAALLCALICVLGLVAVTRCGCLRRLRLSSTTNNTSPAAPPAAANKGVKKKVLRS  87

Query  305  LPKFT  319
            LPK T
Sbjct  88   LPKLT  92



>ref|XP_009106302.1| PREDICTED: RING-H2 finger protein ATL8 [Brassica rapa]
Length=192

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 50/72 (69%), Gaps = 7/72 (10%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWL----RRIRAGANGGASGQP---SSNKGLKKKV  295
            D IVI+AALLCA+ICV+GLV V+RC+WL        + AN   + QP   ++NKGLKKKV
Sbjct  27   DLIVIIAALLCALICVLGLVAVSRCSWLRRIAASRSSAANSDQNPQPPVAAANKGLKKKV  86

Query  296  LRSLPKFTYGPS  331
            LRSL K TY P 
Sbjct  87   LRSLSKLTYSPD  98



>ref|XP_008786682.1| PREDICTED: RING-H2 finger protein ATL44 [Phoenix dactylifera]
Length=181

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 44/62 (71%), Gaps = 3/62 (5%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            D +VILAALLCA+ICVVGL +VARCAWLRR     +         NKGLKKK LRSLPK 
Sbjct  29   DVVVILAALLCALICVVGLALVARCAWLRRSSGNPSSPPP---PPNKGLKKKALRSLPKL  85

Query  317  TY  322
            +Y
Sbjct  86   SY  87



>ref|XP_010029567.1| PREDICTED: RING-H2 finger protein ATL8-like [Eucalyptus grandis]
 gb|KCW56484.1| hypothetical protein EUGRSUZ_I02211 [Eucalyptus grandis]
Length=201

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 49/73 (67%), Gaps = 9/73 (12%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRI---------RAGANGGASGQPSSNKGLKK  289
            DF+VILA LLCA+IC VGLV VARCAWLRR           A A   +   P++N+GLKK
Sbjct  25   DFVVILAVLLCALICAVGLVAVARCAWLRRYPPASAASATAAAAAVASRPPPAANRGLKK  84

Query  290  KVLRSLPKFTYGP  328
            K L+SLPK  YGP
Sbjct  85   KALQSLPKIVYGP  97



>ref|XP_009395296.1| PREDICTED: RING-H2 finger protein ATL8-like [Musa acuminata subsp. 
malaccensis]
Length=183

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 47/67 (70%), Gaps = 2/67 (3%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            D IVILAALLCA+ICV+GL +VARCAWLR   A A   +S    + KGLKKK LRSLP  
Sbjct  30   DLIVILAALLCALICVLGLALVARCAWLRPSPAAA--ASSVFRPTGKGLKKKALRSLPTL  87

Query  317  TYGPSFA  337
            ++  S A
Sbjct  88   SFDSSAA  94



>ref|XP_008804625.1| PREDICTED: RING-H2 finger protein ATL8 [Phoenix dactylifera]
Length=177

 Score = 68.6 bits (166),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 42/63 (67%), Gaps = 2/63 (3%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            D +VILA LLCA+ICVVGL +VARCAWLR  RA +       P   KGLKKK LRSLP  
Sbjct  28   DVVVILATLLCALICVVGLALVARCAWLR--RASSTPPPPPPPPPTKGLKKKALRSLPTL  85

Query  317  TYG  325
             + 
Sbjct  86   AFD  88



>ref|XP_006855649.1| hypothetical protein AMTR_s00044p00112360 [Amborella trichopoda]
 gb|ERN17116.1| hypothetical protein AMTR_s00044p00112360 [Amborella trichopoda]
Length=180

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 46/69 (67%), Gaps = 3/69 (4%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRA-GANGGASGQPSSNKGLKKKVLRSLPK  313
            D +V+LAALLC +ICVVGL  +ARCAW  R R+ GA  G     +S KGLKKK L+SLP+
Sbjct  22   DVVVVLAALLCTLICVVGLGFMARCAW--RCRSPGAEAGIRRPENSAKGLKKKALQSLPR  79

Query  314  FTYGPSFAA  340
              YG    A
Sbjct  80   HVYGQDSEA  88



>ref|XP_009420835.1| PREDICTED: RING-H2 finger protein ATL8-like [Musa acuminata subsp. 
malaccensis]
Length=187

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 51/70 (73%), Gaps = 2/70 (3%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRR--IRAGANGGASGQPSSNKGLKKKVLRSLP  310
            D +V+LAALLCA+ICV+GL +VARCAW+RR    + ++  A   P  +KGLKKKVLR+LP
Sbjct  28   DVVVVLAALLCALICVIGLAIVARCAWIRRSSTSSSSSSTAGPPPPPSKGLKKKVLRALP  87

Query  311  KFTYGPSFAA  340
              ++  S AA
Sbjct  88   TLSFDSSAAA  97



>ref|XP_002452741.1| hypothetical protein SORBIDRAFT_04g031560 [Sorghum bicolor]
 gb|EES05717.1| hypothetical protein SORBIDRAFT_04g031560 [Sorghum bicolor]
Length=194

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 46/66 (70%), Gaps = 6/66 (9%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSS----NKGLKKKVLRS  304
            D I+ILA LLCA++CV+GL +VARCA  RR    A+G    QP S    NKG+KK+VLRS
Sbjct  23   DMILILAGLLCALVCVLGLGLVARCACSRRWATAASG--RSQPGSAKAANKGVKKEVLRS  80

Query  305  LPKFTY  322
            LP  TY
Sbjct  81   LPTVTY  86



>ref|XP_009372616.1| PREDICTED: RING-H2 finger protein ATL80 [Pyrus x bretschneideri]
Length=166

 Score = 66.2 bits (160),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 42/65 (65%), Gaps = 3/65 (5%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRR---IRAGANGGASGQPSSNKGLKKKVLRSL  307
            D  ++L AL CA++CV+GLV+VARC WLRR               P  NKGLKKKVLRSL
Sbjct  33   DSALVLLALFCAIVCVLGLVVVARCVWLRRLTAAATTTTPPLPPPPPPNKGLKKKVLRSL  92

Query  308  PKFTY  322
            PK TY
Sbjct  93   PKLTY  97



>ref|XP_010548197.1| PREDICTED: RING-H2 finger protein ATL44-like [Tarenaya hassleriana]
Length=180

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 42/63 (67%), Gaps = 4/63 (6%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            D +VIL+ALLCA+ICVVGLV VARC+W+ R      G +   P   KGLKKK L S+P+ 
Sbjct  25   DMVVILSALLCALICVVGLVAVARCSWIHRF----TGDSPPPPPPRKGLKKKALESIPRL  80

Query  317  TYG  325
             + 
Sbjct  81   AFS  83



>ref|XP_008373388.1| PREDICTED: RING-H2 finger protein ATL8 [Malus domestica]
Length=190

 Score = 65.5 bits (158),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 42/65 (65%), Gaps = 3/65 (5%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRR---IRAGANGGASGQPSSNKGLKKKVLRSL  307
            D  ++L AL CA++CV+GLV++ARC WLRR               P  NKGLKKKVLRSL
Sbjct  57   DSALVLLALFCALVCVLGLVVIARCVWLRRLTAAATTTTPPLPPPPPPNKGLKKKVLRSL  116

Query  308  PKFTY  322
            PK TY
Sbjct  117  PKLTY  121



>ref|XP_009128176.1| PREDICTED: LOW QUALITY PROTEIN: RING-H2 finger protein ATL8-like 
[Brassica rapa]
Length=209

 Score = 65.9 bits (159),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 49/85 (58%), Gaps = 22/85 (26%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRR-------IRAGANGGA--------------  253
            D +V++AALLCA+ICV+GL+ V+RC WLRR       +R+ A                  
Sbjct  27   DLVVVIAALLCALICVLGLLAVSRCVWLRRLANRSRELRSTAGXQRIEEESPKVSAEAHL  86

Query  254  -SGQPSSNKGLKKKVLRSLPKFTYG  325
             +G P +NKGLKKK L+SLPK  Y 
Sbjct  87   LAGLPPANKGLKKKALKSLPKLAYS  111



>ref|XP_009410155.1| PREDICTED: LOW QUALITY PROTEIN: RING-H2 finger protein ATL45-like 
[Musa acuminata subsp. malaccensis]
Length=183

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 42/62 (68%), Gaps = 4/62 (6%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            D +VILAALLCAV+ V GL +VARCA  RR    + GG   Q   +KGLKKK LR+LP+ 
Sbjct  29   DLVVILAALLCAVVSVTGLALVARCASSRR----SPGGGRPQAPPDKGLKKKALRALPRV  84

Query  317  TY  322
             Y
Sbjct  85   AY  86



>ref|XP_007046460.1| Basic helix-loop-helix DNA-binding superfamily protein isoform 
1 [Theobroma cacao]
 ref|XP_007046461.1| Basic helix-loop-helix-containing protein, putative isoform 1 
[Theobroma cacao]
 gb|EOX90617.1| Basic helix-loop-helix DNA-binding superfamily protein isoform 
1 [Theobroma cacao]
 gb|EOX90618.1| Basic helix-loop-helix-containing protein, putative isoform 1 
[Theobroma cacao]
Length=185

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 47/63 (75%), Gaps = 2/63 (3%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            D +VILAALLCA+ICVVGL+ VAR     R R  AN  AS Q S+NKGLKKKVL+SLPK 
Sbjct  24   DLVVILAALLCALICVVGLIAVAR-CACLRRRRTANNNAS-QASANKGLKKKVLQSLPKV  81

Query  317  TYG  325
            TY 
Sbjct  82   TYN  84



>ref|NP_001147382.1| RING-H2 finger protein ATL1R [Zea mays]
 gb|ACF84092.1| unknown [Zea mays]
 gb|ACG27216.1| RING-H2 finger protein ATL1R [Zea mays]
 gb|AFW63433.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=186

 Score = 62.8 bits (151),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 45/67 (67%), Gaps = 2/67 (3%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCA--WLRRIRAGANGGASGQPSSNKGLKKKVLRSLP  310
            D I+ILA LLCA++CV+GL +VARCA  W     + +   A    ++N+G+KK+VLRSLP
Sbjct  22   DMILILAGLLCALVCVLGLGLVARCACSWRWAAASRSQPAADATKAANRGVKKEVLRSLP  81

Query  311  KFTYGPS  331
              TY P 
Sbjct  82   TVTYVPD  88



>ref|XP_004500836.1| PREDICTED: RING-H2 finger protein ATL80-like [Cicer arietinum]
Length=198

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 43/60 (72%), Gaps = 3/60 (5%)
 Frame = +2

Query  149  ILAALLCAVICVVGLVMVARCAWLRRIR---AGANGGASGQPSSNKGLKKKVLRSLPKFT  319
            ILAALLCA+ICV+GLV VARC  LRR+R          +   ++NKG+KKKVLRSLPK T
Sbjct  31   ILAALLCALICVLGLVAVARCGCLRRLRISSTTLTSTTTPPAAANKGVKKKVLRSLPKHT  90



>ref|XP_009772742.1| PREDICTED: RING-H2 finger protein ATL8-like isoform X2 [Nicotiana 
sylvestris]
Length=268

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 53/65 (82%), Gaps = 2/65 (3%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            DF+VILAALLC +ICVVGL+ VARCAWLRR   G  GG S   S+NKGLKKKVL+SLPKF
Sbjct  101  DFVVILAALLCLLICVVGLIAVARCAWLRRATGGGAGGQSS--SANKGLKKKVLQSLPKF  158

Query  317  TYGPS  331
            TY PS
Sbjct  159  TYDPS  163



>ref|XP_009772735.1| PREDICTED: RING-H2 finger protein ATL8-like isoform X1 [Nicotiana 
sylvestris]
Length=270

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 52/65 (80%), Gaps = 2/65 (3%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            DF+VILAALLC +ICVVGL+ VARCAWLRR   G  GG S    +NKGLKKKVL+SLPKF
Sbjct  101  DFVVILAALLCLLICVVGLIAVARCAWLRRATGGGAGGQSSS--ANKGLKKKVLQSLPKF  158

Query  317  TYGPS  331
            TY PS
Sbjct  159  TYDPS  163



>ref|XP_009383554.1| PREDICTED: RING-H2 finger protein ATL45-like [Musa acuminata 
subsp. malaccensis]
Length=174

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 43/65 (66%), Gaps = 9/65 (14%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            D +VILAALLC +I VVGL +VARCAW RR        A+  P  NKGLK+K +++LP  
Sbjct  25   DIVVILAALLCGLISVVGLALVARCAWHRR-------SATAPP--NKGLKRKAVQALPTL  75

Query  317  TYGPS  331
            ++  S
Sbjct  76   SFDSS  80



>ref|XP_007212670.1| hypothetical protein PRUPE_ppa018356mg, partial [Prunus persica]
 gb|EMJ13869.1| hypothetical protein PRUPE_ppa018356mg, partial [Prunus persica]
Length=136

 Score = 60.1 bits (144),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 41/65 (63%), Gaps = 3/65 (5%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRR---IRAGANGGASGQPSSNKGLKKKVLRSL  307
            D  +IL AL CA++C++GL++VARC WLRR               P SN+GLKKK LR L
Sbjct  32   DSALILLALFCALVCILGLLVVARCVWLRRLATAATPPPPPPLPTPPSNRGLKKKNLRLL  91

Query  308  PKFTY  322
            PK TY
Sbjct  92   PKLTY  96



>ref|XP_004953481.1| PREDICTED: RING-H2 finger protein ATL8-like [Setaria italica]
Length=183

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 45/65 (69%), Gaps = 1/65 (2%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            D I+ILA LLCA++CV+GL +VARCA  RR  A A        ++NKG+KK+VLRSLP  
Sbjct  23   DMILILAGLLCALVCVLGLGLVARCACSRRWAAAARAPPGAA-AANKGVKKEVLRSLPTV  81

Query  317  TYGPS  331
            TY P 
Sbjct  82   TYVPD  86



>ref|XP_003581570.1| PREDICTED: RING-H2 finger protein ATL44-like [Brachypodium distachyon]
Length=191

 Score = 60.5 bits (145),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 46/62 (74%), Gaps = 6/62 (10%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            D I+ILA+LLCA+ICV+ + +VARC+  RR+  GA+      P++N+G+KK+VLR++P  
Sbjct  29   DIIIILASLLCALICVLSIGLVARCSCSRRVGLGAS------PAANRGVKKEVLRAIPTV  82

Query  317  TY  322
             Y
Sbjct  83   PY  84



>gb|ADW66128.1| RING-H2 finger protein RHA3b [Solanum nigrum]
Length=142

 Score = 59.7 bits (143),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  185  VGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKFTY  322
            +GLV VARCAW+RRI AG N        +NKGLKKKVLRSLPKF+Y
Sbjct  1    LGLVAVARCAWIRRI-AGINSADPPSLPANKGLKKKVLRSLPKFSY  45



>gb|EMT08937.1| hypothetical protein F775_27826 [Aegilops tauschii]
Length=89

 Score = 58.5 bits (140),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 45/65 (69%), Gaps = 3/65 (5%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            D ++ILA LLCA++CV+GL +VARCA  RR    A+   +  P +N+G+KK+VLR+LP  
Sbjct  23   DLVLILAGLLCALVCVLGLGLVARCACSRRWARPAD---AAPPGANRGVKKEVLRALPTV  79

Query  317  TYGPS  331
              G S
Sbjct  80   RCGYS  84



>ref|NP_001168249.1| uncharacterized LOC100382012 [Zea mays]
 gb|ACN27589.1| unknown [Zea mays]
 gb|AFW72840.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=185

 Score = 59.7 bits (143),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 47/65 (72%), Gaps = 5/65 (8%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCA--WLRRIRAG-ANGGASGQPSSNKGLKKKVLRSL  307
            D I+ILA LLCA++CV+GL +VARCA  W     +G A  GA+   ++N+G+KK+VLRSL
Sbjct  22   DMILILAGLLCALVCVLGLGLVARCACSWRWATESGRAQPGAA--KAANRGVKKEVLRSL  79

Query  308  PKFTY  322
            P  TY
Sbjct  80   PTVTY  84



>ref|XP_004985867.1| PREDICTED: RING-H2 finger protein ATL8-like [Setaria italica]
Length=224

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 44/62 (71%), Gaps = 3/62 (5%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            D +VILAALLCA+ICVVGL  VARCA  RR  A + G  +   ++ KGL+KK LR+LP+ 
Sbjct  35   DVVVILAALLCALICVVGLAAVARCARSRRGAASSAGAPA---AAAKGLRKKALRALPRL  91

Query  317  TY  322
             Y
Sbjct  92   AY  93



>ref|NP_001150083.1| RING-H2 finger protein ATL1R [Zea mays]
 gb|ACG37737.1| RING-H2 finger protein ATL1R [Zea mays]
Length=187

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 44/66 (67%), Gaps = 7/66 (11%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQP----SSNKGLKKKVLRS  304
            D I+ILA LLCA++CV+GL +VARCA   R    A      QP    ++N+G+KK+VLRS
Sbjct  22   DMILILAGLLCALVCVLGLGLVARCACSWRW---ATESGRAQPDAAKAANRGVKKEVLRS  78

Query  305  LPKFTY  322
            LP  TY
Sbjct  79   LPTVTY  84



>ref|XP_009400319.1| PREDICTED: RING-H2 finger protein ATL8-like [Musa acuminata subsp. 
malaccensis]
Length=144

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 41/62 (66%), Gaps = 9/62 (15%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            D +V++AALLCAV+ V GL +VARCA LRR         S    SNKGL+K+ LR+LP  
Sbjct  29   DVVVVIAALLCAVVSVAGLALVARCACLRR---------SPVLPSNKGLEKEALRALPTI  79

Query  317  TY  322
            +Y
Sbjct  80   SY  81



>ref|NP_001047768.1| Os02g0686100 [Oryza sativa Japonica Group]
 dbj|BAD07573.1| putative ring finger protein [Oryza sativa Japonica Group]
 dbj|BAF09682.1| Os02g0686100 [Oryza sativa Japonica Group]
Length=189

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 46/68 (68%), Gaps = 6/68 (9%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRR------IRAGANGGASGQPSSNKGLKKKVL  298
            D +VILA LLCA+ICV+GL +VARCA  RR          A GG  G  ++NKG+KK+VL
Sbjct  21   DLVVILAGLLCALICVLGLGLVARCACTRRWARAAGGGTAAGGGGGGAAAANKGVKKEVL  80

Query  299  RSLPKFTY  322
            RSLP  TY
Sbjct  81   RSLPTVTY  88



>ref|XP_002465936.1| hypothetical protein SORBIDRAFT_01g048530 [Sorghum bicolor]
 gb|EER92934.1| hypothetical protein SORBIDRAFT_01g048530 [Sorghum bicolor]
Length=188

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 45/67 (67%), Gaps = 5/67 (7%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            D +VILAALLCA+ICVVGL  VARCA     R+ A   ++ Q ++ +GLKKK LR+LP  
Sbjct  33   DVVVILAALLCALICVVGLAAVARCA-----RSRAGAPSAAQAAARRGLKKKALRALPSL  87

Query  317  TYGPSFA  337
             Y  + A
Sbjct  88   AYEDAVA  94



>ref|XP_010530985.1| PREDICTED: RING-H2 finger protein ATL44-like [Tarenaya hassleriana]
Length=182

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 43/63 (68%), Gaps = 5/63 (8%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            D +VIL+ALLCA+ICV GLV VARC W+RR       G S  P   KGLKKK L S+P+F
Sbjct  26   DMVVILSALLCALICVAGLVAVARCVWIRRF-----TGNSPPPPPKKGLKKKALESIPRF  80

Query  317  TYG  325
            T+ 
Sbjct  81   TFS  83



>ref|XP_002266865.1| PREDICTED: RING-H2 finger protein ATL80-like [Vitis vinifera]
Length=153

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 34/50 (68%), Gaps = 2/50 (4%)
 Frame = +2

Query  194  VMVARCAWLRRIRAGAN--GGASGQPSSNKGLKKKVLRSLPKFTYGPSFA  337
            V VARCAWL RI   AN   G++ Q  +NKGLKKK+LRSLPK TY    A
Sbjct  46   VAVARCAWLCRISGAANLPDGSAPQTPANKGLKKKILRSLPKVTYAAETA  95



>ref|XP_006660955.1| PREDICTED: RING-H2 finger protein ATL80-like [Oryza brachyantha]
Length=206

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 44/72 (61%), Gaps = 10/72 (14%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWL---------RRIRAGANGGASGQPSSNKGLKK  289
            D ++ILAA+ C ++CVVGL +VARC+ L             AGA G     P+S KGLKK
Sbjct  31   DTLLILAAVFCFLLCVVGLALVARCSRLCNPSSFAVEAEPDAGAEGAMPPAPAS-KGLKK  89

Query  290  KVLRSLPKFTYG  325
            K L+SLP  ++G
Sbjct  90   KALQSLPTVSFG  101



>ref|NP_001053674.1| Os04g0585000 [Oryza sativa Japonica Group]
 dbj|BAF15588.1| Os04g0585000 [Oryza sativa Japonica Group]
Length=104

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 43/63 (68%), Gaps = 5/63 (8%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            D ++ILA+LLCA+ICV+G+ +VARCA  RR   G +  A     +NKG+KK VLR++P  
Sbjct  30   DIVIILASLLCALICVLGIGLVARCACSRRGGGGPDAAA-----ANKGVKKSVLRAIPTV  84

Query  317  TYG  325
             Y 
Sbjct  85   EYA  87



>gb|KFK30185.1| hypothetical protein AALP_AA7G229000 [Arabis alpina]
Length=179

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 34/50 (68%), Gaps = 4/50 (8%)
 Frame = +2

Query  182  VVGLVMVARCAWLRRIRAGANGGASG---QPSSNKGLKKKVLRSLPKFTY  322
            + GL  VARCAWLRR+  G N  A+G    P  NKGLKKK L++LPK TY
Sbjct  8    LAGLAAVARCAWLRRL-TGVNSAAAGVGESPPPNKGLKKKALQALPKSTY  56



>ref|XP_002529811.1| hypothetical protein RCOM_0605860 [Ricinus communis]
 gb|EEF32560.1| hypothetical protein RCOM_0605860 [Ricinus communis]
Length=326

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 39/62 (63%), Gaps = 7/62 (11%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            D +VILAALLCA+IC VGLV              A+     Q ++NKGLKKK+L+S PKF
Sbjct  37   DLVVILAALLCALICEVGLVCSGSMCL-------ASSSYPSQAAANKGLKKKILKSFPKF  89

Query  317  TY  322
            T+
Sbjct  90   TH  91



>emb|CAE03757.1| OSJNBa0013K16.6 [Oryza sativa Japonica Group]
Length=192

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 43/62 (69%), Gaps = 5/62 (8%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            D ++ILA+LLCA+ICV+G+ +VARCA  RR   G +  A     +NKG+KK VLR++P  
Sbjct  27   DIVIILASLLCALICVLGIGLVARCACSRRGGGGPDAAA-----ANKGVKKSVLRAIPTV  81

Query  317  TY  322
             Y
Sbjct  82   EY  83



>gb|EEE61565.1| hypothetical protein OsJ_15927 [Oryza sativa Japonica Group]
Length=101

 Score = 53.5 bits (127),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 42/62 (68%), Gaps = 5/62 (8%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            D ++ILA+LLCA+ICV+G+ +VARCA  RR   G +  A     +NKG+KK VLR +P  
Sbjct  27   DIVIILASLLCALICVLGIGLVARCACSRRGGGGPDAAA-----ANKGVKKSVLRGIPTV  81

Query  317  TY  322
             Y
Sbjct  82   EY  83



>ref|XP_009401006.1| PREDICTED: RING-H2 finger protein ATL45 [Musa acuminata subsp. 
malaccensis]
Length=171

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 40/66 (61%), Gaps = 9/66 (14%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVAR---CAWLRRIRAGANGGASGQPSSNKGLKKKVLRSL  307
            + +VILAALLCA +  VGL +VAR   C W    R+   GG    P  +KGLK+  LR L
Sbjct  20   NVVVILAALLCAAVSAVGLALVARCCACPW----RSLGGGGPRAPP--DKGLKRTALRQL  73

Query  308  PKFTYG  325
            PK +YG
Sbjct  74   PKVSYG  79



>ref|XP_003562145.1| PREDICTED: RING-H2 finger protein ATL45 [Brachypodium distachyon]
Length=200

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 40/63 (63%), Gaps = 1/63 (2%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSN-KGLKKKVLRSLPK  313
            D + +LAALLCA++C +GL  VARC   RR    A   +S +  +  KGL+K+ LR+LPK
Sbjct  33   DVVFVLAALLCALVCFLGLAAVARCTCARRAHNNALSSSSSRADAAVKGLEKEALRALPK  92

Query  314  FTY  322
              Y
Sbjct  93   LAY  95



>ref|XP_011014772.1| PREDICTED: RING-H2 finger protein ATL80-like [Populus euphratica]
Length=198

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 47/62 (76%), Gaps = 4/62 (6%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            D +VILAALLCA++CVVGL++VARCA +RR+     GG+      NKG+KKK L+ LP+F
Sbjct  26   DLMVILAALLCALLCVVGLILVARCACIRRV----TGGSPSSDKDNKGVKKKNLQRLPRF  81

Query  317  TY  322
            +Y
Sbjct  82   SY  83



>gb|ABK22591.1| unknown [Picea sitchensis]
Length=204

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 41/68 (60%), Gaps = 6/68 (9%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSS-----NKGLKKKVLR  301
            + +VILAALLCA+IC +GL  + RCA LR  RA      S Q +      N G+K+K LR
Sbjct  48   NMLVILAALLCALICAMGLNSIVRCA-LRCTRARTVLFVSAQDAEAARVVNTGMKRKALR  106

Query  302  SLPKFTYG  325
            +LP   YG
Sbjct  107  ALPTAVYG  114



>ref|XP_010479360.1| PREDICTED: RING-H2 finger protein ATL75-like [Camelina sativa]
Length=226

 Score = 52.4 bits (124),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 42/70 (60%), Gaps = 4/70 (6%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRR----IRAGANGGASGQPSSNKGLKKKVLRS  304
            + +++L+ L+C +IC +GL  + RCA+ R     I    +G ++ + SS+KG+KKK LR 
Sbjct  58   NVLMLLSVLICGIICCLGLHYIIRCAFRRTSSFMISDPISGFSTSRDSSDKGIKKKALRM  117

Query  305  LPKFTYGPSF  334
             P  +Y P  
Sbjct  118  FPVVSYSPEM  127



>ref|XP_010500468.1| PREDICTED: RING-H2 finger protein ATL75-like [Camelina sativa]
Length=226

 Score = 52.0 bits (123),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 42/70 (60%), Gaps = 4/70 (6%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRR----IRAGANGGASGQPSSNKGLKKKVLRS  304
            + +++L+ L+C +IC +GL  + RCA+ R     I    +G ++ + SS+KG+KKK LR 
Sbjct  58   NVLMLLSVLICGIICCLGLHYIIRCAFRRTSSFMISDPISGFSTSRDSSDKGIKKKALRM  117

Query  305  LPKFTYGPSF  334
             P  +Y P  
Sbjct  118  FPVVSYSPEM  127



>dbj|BAD23012.1| RING zinc finger protein-like [Oryza sativa Japonica Group]
Length=184

 Score = 51.6 bits (122),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 39/67 (58%), Gaps = 4/67 (6%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRR----IRAGANGGASGQPSSNKGLKKKVLRS  304
            D +VILA+LLCA+ICV GL +VARCA  RR             +    + KGLKKK + +
Sbjct  23   DMVVILASLLCALICVAGLALVARCACRRRGAATTTTTTTTTPAATSPAPKGLKKKAIDA  82

Query  305  LPKFTYG  325
            LP  ++ 
Sbjct  83   LPTVSFA  89



>ref|XP_010461763.1| PREDICTED: RING-H2 finger protein ATL75 [Camelina sativa]
Length=226

 Score = 52.0 bits (123),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 42/70 (60%), Gaps = 4/70 (6%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRR----IRAGANGGASGQPSSNKGLKKKVLRS  304
            + +++L+ L+C +IC +GL  + RCA+ R     I    +G ++ + SS+KG+KKK LR 
Sbjct  58   NVLMLLSVLICGIICCLGLHYIIRCAFRRTSSFMISDPISGFSTSRDSSDKGIKKKALRM  117

Query  305  LPKFTYGPSF  334
             P  +Y P  
Sbjct  118  FPVVSYSPEM  127



>ref|XP_002437640.1| hypothetical protein SORBIDRAFT_10g030990 [Sorghum bicolor]
 gb|EER89007.1| hypothetical protein SORBIDRAFT_10g030990 [Sorghum bicolor]
Length=206

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 39/65 (60%), Gaps = 3/65 (5%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWL---RRIRAGANGGASGQPSSNKGLKKKVLRSL  307
            D +VILA+ LCA++CV+GL +V+RCA     R   A ++     Q    KGLKKK + +L
Sbjct  46   DMVVILASFLCALVCVLGLALVSRCACRLCGRGPAAASSSAQQEQAPPPKGLKKKAIDAL  105

Query  308  PKFTY  322
            P   +
Sbjct  106  PTVPF  110



>gb|EMT16971.1| RING-H2 finger protein ATL1B [Aegilops tauschii]
Length=170

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            D ++ILAA+LC ++CV+GL MVARC+ L    A +        +  KG+KKK L++LP  
Sbjct  11   DTLLILAAVLCFLLCVLGLAMVARCSRLCNPSAFSVDAPGPVAAPCKGIKKKALQALPTV  70

Query  317  TYGPS  331
            ++ P 
Sbjct  71   SWRPQ  75



>ref|NP_001173220.1| Os02g0832150 [Oryza sativa Japonica Group]
 dbj|BAH91949.1| Os02g0832150 [Oryza sativa Japonica Group]
Length=217

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 39/66 (59%), Gaps = 4/66 (6%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRR----IRAGANGGASGQPSSNKGLKKKVLRS  304
            D +VILA+LLCA+ICV GL +VARCA  RR             +    + KGLKKK + +
Sbjct  56   DMVVILASLLCALICVAGLALVARCACRRRGAATTTTTTTTTPAATSPAPKGLKKKAIDA  115

Query  305  LPKFTY  322
            LP  ++
Sbjct  116  LPTVSF  121



>gb|ABK25761.1| unknown [Picea sitchensis]
Length=222

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 41/67 (61%), Gaps = 5/67 (7%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSS----NKGLKKKVLRS  304
            + +VILAALLCA+IC +GL  + RCA LR  RA A    S +       N G+K+K LR+
Sbjct  58   NMVVILAALLCALICALGLNSIVRCA-LRCSRARAVLFESAEDVEARLANTGMKRKALRA  116

Query  305  LPKFTYG  325
            LP   YG
Sbjct  117  LPTAVYG  123



>gb|EMS51300.1| RING-H2 finger protein ATL80 [Triticum urartu]
Length=257

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            D ++ILAA+LC ++CVVGL MVARC+ L    A +        +  KG+KKK L++LP  
Sbjct  34   DTLLILAAVLCFLLCVVGLAMVARCSRLCNPSAFSVDAPGAVAAPCKGIKKKALQALPTV  93

Query  317  TYGPS  331
            ++ P 
Sbjct  94   SWRPE  98



>ref|XP_002891483.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67742.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=225

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 38/70 (54%), Gaps = 4/70 (6%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQP----SSNKGLKKKVLRS  304
            + +++L+ L+C +IC +GL  + RCA  R  R   +      P    SSNKG+KKK LR 
Sbjct  57   NVLMLLSILICGIICCLGLHYIIRCASRRSSRFMISEPIPSHPTTRGSSNKGIKKKALRM  116

Query  305  LPKFTYGPSF  334
             P  +Y P  
Sbjct  117  FPVVSYSPEM  126



>ref|XP_008679106.1| PREDICTED: RING-H2 finger protein ATL80-like [Zea mays]
 gb|AFW63874.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=207

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 42/72 (58%), Gaps = 7/72 (10%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLR------RIRAGANGGASGQPSSNKGLKKKVL  298
            D +VIL++LLCA+ICV GL +VARCA  R       + A  +GG S   + + GL+K  +
Sbjct  40   DTVVILSSLLCALICVAGLALVARCACRRGGGASVSVSATTSGGRSSAQAPS-GLEKAAI  98

Query  299  RSLPKFTYGPSF  334
             +LP  +   S 
Sbjct  99   EALPTVSVSSSL  110



>ref|XP_006393289.1| hypothetical protein EUTSA_v10012018mg [Eutrema salsugineum]
 gb|ESQ30575.1| hypothetical protein EUTSA_v10012018mg [Eutrema salsugineum]
Length=222

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 41/70 (59%), Gaps = 4/70 (6%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRR----IRAGANGGASGQPSSNKGLKKKVLRS  304
            + +++L+ L+C VIC +GL  + RCA+ R     I    +  ++ + SSNKG+KKK LR 
Sbjct  57   NVLMLLSVLICGVICCLGLHYIIRCAFRRSSSFMISEPISSLSTPRGSSNKGIKKKALRM  116

Query  305  LPKFTYGPSF  334
             P  +Y P  
Sbjct  117  FPVVSYSPEM  126



>ref|XP_009382752.1| PREDICTED: RING-H2 finger protein ATL8-like [Musa acuminata subsp. 
malaccensis]
Length=181

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 41/67 (61%), Gaps = 4/67 (6%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            D +VILAALLCAVICVVGL ++AR        + +    +     +KGLKKKVLR+L   
Sbjct  29   DVVVILAALLCAVICVVGLALIAR----CSCSSASAAAPAPSSPPSKGLKKKVLRALSTL  84

Query  317  TYGPSFA  337
            ++  S A
Sbjct  85   SFDSSAA  91



>gb|EAY88139.1| hypothetical protein OsI_09574 [Oryza sativa Indica Group]
Length=156

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 39/65 (60%), Gaps = 4/65 (6%)
 Frame = +2

Query  140  FIVILAALLCAVICVVGLVMVARCAWLRR----IRAGANGGASGQPSSNKGLKKKVLRSL  307
             +VILA+LLCA+ICV GLV+VARCA  RR             +    + KGLKKK + +L
Sbjct  1    MVVILASLLCALICVAGLVLVARCACRRRGAATTTTTTTTTPAATSPAPKGLKKKAIDAL  60

Query  308  PKFTY  322
            P  ++
Sbjct  61   PTVSF  65



>ref|XP_010260922.1| PREDICTED: RING-H2 finger protein ATL78 [Nelumbo nucifera]
Length=233

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 39/65 (60%), Gaps = 2/65 (3%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWL--RRIRAGANGGASGQPSSNKGLKKKVLRSLP  310
            + ++IL+ LLCA+IC +GL  + RCA    RR+ +  +   +    +N G+K+K L++ P
Sbjct  65   NVVMILSVLLCALICALGLNSIIRCALRCSRRVNSDPSSNNTANRLANTGIKRKALKTFP  124

Query  311  KFTYG  325
              TY 
Sbjct  125  TLTYS  129



>ref|XP_004976609.1| PREDICTED: RING-H2 finger protein ATL8-like [Setaria italica]
Length=195

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 39/62 (63%), Gaps = 6/62 (10%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            D +++LA+LLCA+I V+G+ +VARCA  R  R  A   A      N+G+KK VLR +P  
Sbjct  24   DVVIVLASLLCAMITVLGIGLVARCACGRGPRHPAAAAA------NRGVKKSVLRKIPTV  77

Query  317  TY  322
             Y
Sbjct  78   PY  79



>ref|XP_002891481.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67740.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=226

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 41/70 (59%), Gaps = 4/70 (6%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRR----IRAGANGGASGQPSSNKGLKKKVLRS  304
            + +++L+ L+C +IC +GL  + RCA+ R     I    +G ++   SSNKG+KKK LR 
Sbjct  58   NVLMLLSILICGIICCLGLHYIIRCAFRRTSSFMISEPISGLSTPCGSSNKGIKKKALRM  117

Query  305  LPKFTYGPSF  334
             P  +Y P  
Sbjct  118  FPVVSYSPEM  127



>gb|KJB73014.1| hypothetical protein B456_011G209400 [Gossypium raimondii]
Length=209

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 39/65 (60%), Gaps = 2/65 (3%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWL--RRIRAGANGGASGQPSSNKGLKKKVLRSLP  310
            + ++ILAALLCA+IC +GL  + RCA+   RR    A    + + ++  GLKK  LR LP
Sbjct  50   NMVIILAALLCALICALGLNSIMRCAFRCGRRFGLDATEETAARLAAATGLKKSALRRLP  109

Query  311  KFTYG  325
               YG
Sbjct  110  VAVYG  114



>ref|XP_008456776.1| PREDICTED: RING-H2 finger protein ATL74 [Cucumis melo]
Length=202

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 39/65 (60%), Gaps = 3/65 (5%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIR--AGANGGASGQPSSNKGLKKKVLRSLP  310
            + ++ILAALLCA+IC +GL  + RCA LR  R  A   GG +    +  GLKK  LR +P
Sbjct  44   NMVIILAALLCALICALGLNSIVRCA-LRCSRRFAFETGGGTASRLTASGLKKSALRQIP  102

Query  311  KFTYG  325
               YG
Sbjct  103  VAVYG  107



>ref|XP_008648859.1| PREDICTED: RING-H2 finger protein ATL44-like [Zea mays]
 gb|AFW75704.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=188

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 40/65 (62%), Gaps = 7/65 (11%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSS---NKGLKKKVLRSL  307
            D ++ILA+ LCA++CV+GL +V+RC      R  ++  A+G P      KGLKKK + +L
Sbjct  51   DTVMILASFLCALVCVLGLALVSRCT----CRPASSSTATGIPQQARPPKGLKKKAIDAL  106

Query  308  PKFTY  322
            P   +
Sbjct  107  PTAPF  111



>ref|NP_175348.1| RING-H2 finger protein ATL10 [Arabidopsis thaliana]
 sp|P0C034.1|ATL10_ARATH RecName: Full=RING-H2 finger protein ATL10 [Arabidopsis thaliana]
 gb|AAY78646.1| zinc finger (C3HC4-type RING finger) family protein [Arabidopsis 
thaliana]
 gb|AEE32406.1| RING-H2 finger protein ATL10 [Arabidopsis thaliana]
Length=251

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 39/70 (56%), Gaps = 4/70 (6%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIR----AGANGGASGQPSSNKGLKKKVLRS  304
            + +++L+ L+C +IC +GL  + RCA  R  R          +S + SSNKG+KKK LR 
Sbjct  57   NVMMLLSILICGIICCLGLHYIIRCALRRSTRFMISEPVPSLSSTRGSSNKGIKKKALRM  116

Query  305  LPKFTYGPSF  334
             P  +Y P  
Sbjct  117  FPVVSYSPEM  126



>ref|XP_007209706.1| hypothetical protein PRUPE_ppa012461mg [Prunus persica]
 gb|EMJ10905.1| hypothetical protein PRUPE_ppa012461mg [Prunus persica]
Length=168

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 42/65 (65%), Gaps = 3/65 (5%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRR---IRAGANGGASGQPSSNKGLKKKVLRSL  307
            D  +IL AL CA++CV+GL++VARC WLRR               P  NKGLKKK+LRSL
Sbjct  32   DSALILLALFCALVCVLGLLVVARCVWLRRLATAATPPPPPPLPTPPPNKGLKKKILRSL  91

Query  308  PKFTY  322
            PK TY
Sbjct  92   PKLTY  96



>ref|XP_006306107.1| hypothetical protein CARUB_v10011539mg [Capsella rubella]
 gb|EOA39005.1| hypothetical protein CARUB_v10011539mg [Capsella rubella]
Length=222

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 38/70 (54%), Gaps = 4/70 (6%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQP----SSNKGLKKKVLRS  304
            + +++L+ L+C +IC +GL  + RC   R  R   +   S  P    SSNKG+KKK LR 
Sbjct  57   NVLMLLSVLICGIICCLGLHYIIRCGSRRSARFMISEPISSLPTTRGSSNKGIKKKALRM  116

Query  305  LPKFTYGPSF  334
             P  +Y P  
Sbjct  117  FPVVSYSPEM  126



>ref|NP_001063886.1| Os09g0554200 [Oryza sativa Japonica Group]
 dbj|BAF25800.1| Os09g0554200 [Oryza sativa Japonica Group]
 gb|EAZ10028.1| hypothetical protein OsI_32332 [Oryza sativa Indica Group]
 dbj|BAG98385.1| unnamed protein product [Oryza sativa Japonica Group]
Length=201

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 39/63 (62%), Gaps = 1/63 (2%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSN-KGLKKKVLRSLPK  313
            D  +ILAA+LC ++CVVGL +VARC+ L    + A       P +  KGLK+K L SLP 
Sbjct  29   DTFLILAAVLCFLLCVVGLALVARCSRLCNPSSFAVEAEEAMPPAPCKGLKRKALLSLPT  88

Query  314  FTY  322
             ++
Sbjct  89   VSF  91



>ref|XP_008237931.1| PREDICTED: RING-H2 finger protein ATL80-like [Prunus mume]
Length=168

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 42/65 (65%), Gaps = 3/65 (5%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRR---IRAGANGGASGQPSSNKGLKKKVLRSL  307
            D  +IL AL CA++CV+GL++VARC WLRR               P  NKGLKKK+LRSL
Sbjct  32   DSALILLALFCALVCVLGLLVVARCVWLRRLTTAATPPPPPPLPTPPPNKGLKKKILRSL  91

Query  308  PKFTY  322
            PK TY
Sbjct  92   PKLTY  96



>gb|AAF69723.1|AC016041_28 F27J15.2 [Arabidopsis thaliana]
Length=426

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 28/69 (41%), Positives = 41/69 (59%), Gaps = 6/69 (9%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRR-----IRAGANGGASGQPSSNKGLKKKVLR  301
            + +++L+ L+C +IC +GL  + RCA LRR     I       +S + SSNKG+KKK LR
Sbjct  57   NVMMLLSILICGIICCLGLHYIIRCA-LRRSTRFMISEPVPSLSSTRGSSNKGIKKKALR  115

Query  302  SLPKFTYGP  328
              P  +Y P
Sbjct  116  MFPVVSYSP  124



>gb|EEE70193.1| hypothetical protein OsJ_30278 [Oryza sativa Japonica Group]
Length=187

 Score = 48.9 bits (115),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 39/63 (62%), Gaps = 1/63 (2%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSN-KGLKKKVLRSLPK  313
            D  +ILAA+LC ++CVVGL +VARC+ L    + A       P +  KGLK+K L SLP 
Sbjct  29   DTFLILAAVLCFLLCVVGLALVARCSRLCNPSSFAVEAEEAMPPAPCKGLKRKALLSLPT  88

Query  314  FTY  322
             ++
Sbjct  89   VSF  91



>ref|XP_003573175.1| PREDICTED: RING-H2 finger protein ATL44-like [Brachypodium distachyon]
Length=213

 Score = 49.3 bits (116),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 41/67 (61%), Gaps = 6/67 (9%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIR----AG--ANGGASGQPSSNKGLKKKVL  298
            + +VILA+LLCA++C+ GL +V RCA  R  R    AG  AN   +  P   +GLKKK +
Sbjct  35   NMVVILASLLCALVCLSGLAIVTRCACRRGRRHPPLAGIIANNSLAPLPPPARGLKKKAI  94

Query  299  RSLPKFT  319
             +LP  T
Sbjct  95   DALPVVT  101



>gb|KGN45834.1| hypothetical protein Csa_6G014550 [Cucumis sativus]
Length=202

 Score = 48.9 bits (115),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 37/64 (58%), Gaps = 1/64 (2%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAW-LRRIRAGANGGASGQPSSNKGLKKKVLRSLPK  313
            + ++ILAALLCA+IC +GL  + RCA    R  A   GG +    +  GLKK  LR +P 
Sbjct  44   NMVIILAALLCALICALGLNSIVRCALRCSRRFAFETGGGTASRLTATGLKKSALRQIPV  103

Query  314  FTYG  325
              YG
Sbjct  104  AVYG  107



>ref|XP_002271473.1| PREDICTED: RING-H2 finger protein ATL74 [Vitis vinifera]
Length=195

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 39/66 (59%), Gaps = 8/66 (12%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWL--RRIRAGANGGASGQPSSNKGLKKKVLRSLP  310
            + ++ILAALLCA+I  +GL  + RCA    RR+   + G A+       GLKK+ LR +P
Sbjct  45   NMVIILAALLCALIGALGLNSIVRCAMRCSRRLSPESQGQAA------TGLKKRALRQIP  98

Query  311  KFTYGP  328
               YGP
Sbjct  99   VAVYGP  104



>ref|XP_006393288.1| hypothetical protein EUTSA_v10011758mg [Eutrema salsugineum]
 gb|ESQ30574.1| hypothetical protein EUTSA_v10011758mg [Eutrema salsugineum]
Length=225

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 40/71 (56%), Gaps = 6/71 (8%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRR-----IRAGANGGASGQPSSNKGLKKKVLR  301
            + +++L+ L+C +IC +GL  + RC  LRR     I       ++ + SSNKG+KKK LR
Sbjct  57   NVLILLSVLVCGIICCIGLHYIIRCT-LRRSSIFLISEPITSLSTPRGSSNKGIKKKALR  115

Query  302  SLPKFTYGPSF  334
              P  +Y P  
Sbjct  116  MFPVVSYSPEM  126



>ref|XP_011076816.1| PREDICTED: RING-H2 finger protein ATL74-like [Sesamum indicum]
Length=160

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 37/64 (58%), Gaps = 1/64 (2%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPS-SNKGLKKKVLRSLPK  313
            + ++ILAALLCA+ICV+G+  + RC      R  +      +P  S KGLKK  LR +P 
Sbjct  22   NLVIILAALLCALICVLGINSIVRCFLRCTARMSSVDTEELRPRFSRKGLKKVALRQIPV  81

Query  314  FTYG  325
              YG
Sbjct  82   VVYG  85



>ref|XP_010241725.1| PREDICTED: RING-H2 finger protein ATL78-like [Nelumbo nucifera]
Length=233

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 38/65 (58%), Gaps = 6/65 (9%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCA--WLRRIRAGANGGASGQPSSNKGLKKKVLRSLP  310
            + I+IL+ LLCA+IC +GL  + RCA  W  R+        + Q  +N G+K+K L++ P
Sbjct  67   NVIMILSVLLCALICALGLNSIIRCALRWSSRV----TSNTTSQKLANTGVKRKALKAFP  122

Query  311  KFTYG  325
              TY 
Sbjct  123  TLTYS  127



>ref|NP_001150572.1| RING-H2 finger protein ATL1R [Zea mays]
 gb|ACG39610.1| RING-H2 finger protein ATL1R [Zea mays]
Length=177

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 42/68 (62%), Gaps = 6/68 (9%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            D +++LA+LLCA+I V+G+ +VARCA  R         A    ++N+G+KK VLR +P  
Sbjct  21   DVVIVLASLLCALITVLGIGLVARCACAR------GPSAQAAAAANRGVKKSVLRRIPTV  74

Query  317  TYGPSFAA  340
             Y  S AA
Sbjct  75   PYAASAAA  82



>gb|EAZ25203.1| hypothetical protein OsJ_09003 [Oryza sativa Japonica Group]
Length=161

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 38/65 (58%), Gaps = 4/65 (6%)
 Frame = +2

Query  140  FIVILAALLCAVICVVGLVMVARCAWLRR----IRAGANGGASGQPSSNKGLKKKVLRSL  307
             +VILA+LLCA+ICV GL +VARCA  RR             +    + KGLKKK + +L
Sbjct  1    MVVILASLLCALICVAGLALVARCACRRRGAATTTTTTTTTPAATSPAPKGLKKKAIDAL  60

Query  308  PKFTY  322
            P  ++
Sbjct  61   PTVSF  65



>ref|XP_010479359.1| PREDICTED: E3 ubiquitin-protein ligase ATL76-like [Camelina sativa]
Length=225

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 41/68 (60%), Gaps = 4/68 (6%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRR----IRAGANGGASGQPSSNKGLKKKVLRS  304
            + +++L+ L+C +IC +GL  + RCA+ R     I    +  ++ + SSNKG+KKK L+ 
Sbjct  57   NVLMLLSVLICGIICCLGLHYIIRCAFTRSSSFMISEPISSLSTPRGSSNKGIKKKALKM  116

Query  305  LPKFTYGP  328
             P  +Y P
Sbjct  117  FPIVSYSP  124



>ref|XP_002452232.1| hypothetical protein SORBIDRAFT_04g022150 [Sorghum bicolor]
 gb|EES05208.1| hypothetical protein SORBIDRAFT_04g022150 [Sorghum bicolor]
Length=240

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 39/79 (49%), Gaps = 13/79 (16%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPS-------------SNK  277
            + ++ILA LLCA+IC +GL  + RCA     R    GGA  QP+             +  
Sbjct  64   NVVMILAVLLCALICALGLNSIVRCALRCTSRTSPGGGAQRQPAAGAGEPGLSVVRLAQA  123

Query  278  GLKKKVLRSLPKFTYGPSF  334
            G ++K LR++P   Y P  
Sbjct  124  GARRKALRAMPTLVYSPGM  142



>ref|XP_010500467.1| PREDICTED: E3 ubiquitin-protein ligase ATL76-like [Camelina sativa]
Length=225

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 41/70 (59%), Gaps = 4/70 (6%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRR----IRAGANGGASGQPSSNKGLKKKVLRS  304
            + +++L+ L+C +IC +GL  + RCA+ R     I    +  ++ + SSNKG+KKK L+ 
Sbjct  57   NVLMLLSVLICGIICCLGLHYIIRCAFRRSSSFMISEPISSLSTPRGSSNKGIKKKALKM  116

Query  305  LPKFTYGPSF  334
             P  +Y P  
Sbjct  117  FPVVSYAPEM  126



>ref|XP_010461762.1| PREDICTED: E3 ubiquitin-protein ligase ATL76 [Camelina sativa]
Length=225

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 41/70 (59%), Gaps = 4/70 (6%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRR----IRAGANGGASGQPSSNKGLKKKVLRS  304
            + +++L+ L+C +IC +GL  + RCA+ R     I    +  ++ + SSNKG+KKK L+ 
Sbjct  57   NVLMLLSVLICGIICCLGLHYIIRCAFRRSSSFMISEPISSLSTPRGSSNKGIKKKALKM  116

Query  305  LPKFTYGPSF  334
             P  +Y P  
Sbjct  117  FPVVSYAPEM  126



>ref|XP_006306489.1| hypothetical protein CARUB_v10012468mg [Capsella rubella]
 gb|EOA39387.1| hypothetical protein CARUB_v10012468mg [Capsella rubella]
Length=225

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 41/70 (59%), Gaps = 4/70 (6%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRR----IRAGANGGASGQPSSNKGLKKKVLRS  304
            + +++L+ L+C +IC +GL  + RCA+ R     I    +  ++ + SSNKG+KKK L+ 
Sbjct  57   NVLMLLSVLICGIICCLGLHYIIRCAFKRSSSFMISEPISSLSTPRGSSNKGIKKKALKM  116

Query  305  LPKFTYGPSF  334
             P  +Y P  
Sbjct  117  FPVVSYSPEM  126



>ref|XP_010922739.1| PREDICTED: RING-H2 finger protein ATL74-like [Elaeis guineensis]
 ref|XP_010922740.1| PREDICTED: RING-H2 finger protein ATL74-like [Elaeis guineensis]
Length=184

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 41/66 (62%), Gaps = 3/66 (5%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWL--RRIRAGANGGASGQPSSNKGLKKKVLRSLP  310
            + ++ILAALLCA+IC +GL  + RCA    RR+       A+ + ++  GLKK+ LR LP
Sbjct  36   NMVIILAALLCALICALGLNSIVRCALRCGRRLAFETPEEAAARLAAT-GLKKRALRRLP  94

Query  311  KFTYGP  328
               YGP
Sbjct  95   VAVYGP  100



>ref|XP_010931361.1| PREDICTED: RING-H2 finger protein ATL74-like [Elaeis guineensis]
Length=182

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWL--RRIRAGANGGASGQPSSNKGLKKKVLRSLP  310
            + ++ILAALLCA+IC +GL  + RCA    RR+       A+ + ++  GLKK+ LR +P
Sbjct  32   NMVIILAALLCALICALGLNSIVRCALRCGRRLDFETPEEAAARLAAT-GLKKRALRRIP  90

Query  311  KFTYGPS  331
               YGP 
Sbjct  91   VAVYGPE  97



>gb|AFB33711.1| hypothetical protein 2_89_01, partial [Larix decidua]
Length=138

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 36/63 (57%), Gaps = 1/63 (2%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANG-GASGQPSSNKGLKKKVLRSLPK  313
            D  VILAA++CA+IC++GL  + RC    R R GA+         +N GLKK  ++ LP 
Sbjct  49   DLAVILAAMVCALICMLGLNSLLRCVLCFRRRMGADSPNEVAIRQANTGLKKAAMKELPI  108

Query  314  FTY  322
              Y
Sbjct  109  VVY  111



>gb|KHG05103.1| RING-H2 finger ATL74 -like protein [Gossypium arboreum]
Length=202

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 39/65 (60%), Gaps = 3/65 (5%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWL--RRIRAGANGGASGQPSSNKGLKKKVLRSLP  310
            + +VILAALLCA+IC VGL  + RCA    RR        A+ + ++  GLKK+ LR +P
Sbjct  46   NLVVILAALLCALICAVGLNSIVRCALRCSRRFSTETPEQAAARLATT-GLKKRDLRQIP  104

Query  311  KFTYG  325
               YG
Sbjct  105  VAVYG  109



>ref|XP_010252063.1| PREDICTED: RING-H2 finger protein ATL74 [Nelumbo nucifera]
 ref|XP_010252064.1| PREDICTED: RING-H2 finger protein ATL74 [Nelumbo nucifera]
 ref|XP_010252065.1| PREDICTED: RING-H2 finger protein ATL74 [Nelumbo nucifera]
Length=198

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 39/65 (60%), Gaps = 3/65 (5%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWL--RRIRAGANGGASGQPSSNKGLKKKVLRSLP  310
            + ++ILAALLCA+IC +GL  + RCA    RR       G + + S+  GLKKK LR +P
Sbjct  43   NMVIILAALLCALICALGLNSIVRCALRCGRRFAFETPEGTAARLSAT-GLKKKALRQIP  101

Query  311  KFTYG  325
               YG
Sbjct  102  VAVYG  106



>ref|XP_009135597.1| PREDICTED: RING-H2 finger protein ATL77-like [Brassica rapa]
Length=217

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 40/72 (56%), Gaps = 6/72 (8%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGAS------GQPSSNKGLKKKVL  298
            + +++L+ L+C +IC +GL  + RCA+ R      +   S      G  ++NKG+KKKVL
Sbjct  52   NILLLLSILVCGIICSLGLHYIIRCAFRRSSSFLISDPISIPSTPRGSAAANKGIKKKVL  111

Query  299  RSLPKFTYGPSF  334
            +  P  TY P  
Sbjct  112  KMFPVLTYSPEM  123



>emb|CDX82327.1| BnaA03g34940D [Brassica napus]
Length=216

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 40/72 (56%), Gaps = 6/72 (8%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGAS------GQPSSNKGLKKKVL  298
            + +++L+ L+C +IC +GL  + RCA+ R      +   S      G  ++NKG+KKKVL
Sbjct  51   NILLLLSILVCGIICSLGLHYIIRCAFRRSSSFLISDPISIPSTPRGSAAANKGIKKKVL  110

Query  299  RSLPKFTYGPSF  334
            +  P  TY P  
Sbjct  111  KMFPVLTYSPEM  122



>ref|XP_002310694.2| hypothetical protein POPTR_0007s08550g [Populus trichocarpa]
 gb|EEE91144.2| hypothetical protein POPTR_0007s08550g [Populus trichocarpa]
Length=165

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 46/60 (77%), Gaps = 4/60 (7%)
 Frame = +2

Query  143  IVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKFTY  322
            +VILAALLCA++CVVGL+++ARCA  RR+     GG+     +NKG+KKK L+ LP+F+Y
Sbjct  1    MVILAALLCALLCVVGLILMARCACTRRV----TGGSPSSDKANKGVKKKNLQLLPRFSY  56



>ref|XP_008792228.1| PREDICTED: RING-H2 finger protein ATL74-like [Phoenix dactylifera]
Length=182

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 41/66 (62%), Gaps = 3/66 (5%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWL--RRIRAGANGGASGQPSSNKGLKKKVLRSLP  310
            + ++ILAALLCA+IC +GL  + RCA    RR+       A+ + ++  GLKK+ LR +P
Sbjct  32   NMVIILAALLCALICALGLNSIVRCALRCGRRLAFETQEEAAARLAAT-GLKKRALRRIP  90

Query  311  KFTYGP  328
               YGP
Sbjct  91   VAVYGP  96



>ref|XP_002891482.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67741.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=225

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 39/67 (58%), Gaps = 4/67 (6%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQP----SSNKGLKKKVLRS  304
            + +++L+ L+C +IC +GL  + RCA+ R  R   +   S  P    SS+KG+KKK LR 
Sbjct  57   NVLMLLSVLICGIICCLGLHYIIRCAFRRSSRFMISEPISSLPTPRGSSDKGIKKKALRM  116

Query  305  LPKFTYG  325
             P  +Y 
Sbjct  117  FPVVSYS  123



>ref|XP_008809453.1| PREDICTED: RING-H2 finger protein ATL74-like isoform X2 [Phoenix 
dactylifera]
Length=181

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 41/66 (62%), Gaps = 3/66 (5%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWL--RRIRAGANGGASGQPSSNKGLKKKVLRSLP  310
            + ++ILAALLCA+IC +GL  + RCA    RR+       A+ + ++  GLKK+ LR +P
Sbjct  36   NMVIILAALLCALICALGLNSIVRCALRCGRRLAFETPEEAAARLAAT-GLKKRALRRIP  94

Query  311  KFTYGP  328
               YGP
Sbjct  95   VAVYGP  100



>ref|XP_010036001.1| PREDICTED: RING-H2 finger protein ATL74 [Eucalyptus grandis]
Length=179

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 39/69 (57%), Gaps = 1/69 (1%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPS-SNKGLKKKVLRSLPK  313
            + ++ILAALLCA+IC +GL  + RCA     R GA          +  GLK++ LR +P 
Sbjct  44   NMVIILAALLCALICALGLNSIVRCALRCSRRFGAETPEQAAARLATTGLKRRDLRQIPV  103

Query  314  FTYGPSFAA  340
              YG + AA
Sbjct  104  AVYGSAAAA  112



>ref|XP_011099792.1| PREDICTED: RING-H2 finger protein ATL78-like [Sesamum indicum]
Length=225

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 39/65 (60%), Gaps = 2/65 (3%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPS--SNKGLKKKVLRSLP  310
            + +++L+ LLCA+IC +GL  + RCA        A+   +GQ +  +N G+KKK L++ P
Sbjct  64   NVVMVLSVLLCALICSLGLNSIIRCALRCSTLVAADSSQTGQSARLANTGIKKKALKTFP  123

Query  311  KFTYG  325
              +Y 
Sbjct  124  VISYA  128



>ref|XP_006842471.1| hypothetical protein AMTR_s00077p00074350 [Amborella trichopoda]
 gb|ERN04146.1| hypothetical protein AMTR_s00077p00074350 [Amborella trichopoda]
Length=182

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 38/63 (60%), Gaps = 1/63 (2%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            + ++ILAALLCA+IC +GL  + RCA LR  R  +    +   +   GLKK+ LR +P  
Sbjct  36   NMVIILAALLCALICALGLNSIVRCA-LRCGRRASIEADTDTATRLSGLKKRALRQIPVS  94

Query  317  TYG  325
             YG
Sbjct  95   IYG  97



>ref|NP_175346.1| RING-H2 finger protein ATL75 [Arabidopsis thaliana]
 sp|Q94BY6.1|ATL75_ARATH RecName: Full=RING-H2 finger protein ATL75 [Arabidopsis thaliana]
 gb|AAK62606.1| At1g49200/F27J15_35 [Arabidopsis thaliana]
 gb|AAM10377.1| At1g49200/F27J15_35 [Arabidopsis thaliana]
 gb|AEE32404.1| RING-H2 finger protein ATL75 [Arabidopsis thaliana]
Length=226

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 39/70 (56%), Gaps = 4/70 (6%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRR----IRAGANGGASGQPSSNKGLKKKVLRS  304
            + +++L+ L+C +IC +GL  + RCA+ R     I     G ++   SSNKG+ KK LR 
Sbjct  58   NVLMLLSVLICGIICCLGLHYIIRCAFRRTSSFMISEPIAGLSTPCGSSNKGINKKALRM  117

Query  305  LPKFTYGPSF  334
             P  +Y P  
Sbjct  118  FPVVSYSPEM  127



>gb|KJB71523.1| hypothetical protein B456_011G127700 [Gossypium raimondii]
 gb|KJB71524.1| hypothetical protein B456_011G127700 [Gossypium raimondii]
Length=196

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 39/65 (60%), Gaps = 3/65 (5%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWL--RRIRAGANGGASGQPSSNKGLKKKVLRSLP  310
            + +VILAALLCA+IC VGL  + RCA    RR        A+ + ++  GLKK+ LR +P
Sbjct  40   NLVVILAALLCALICAVGLNSIVRCALRCSRRFATETPEQAAARLATT-GLKKRDLRQIP  98

Query  311  KFTYG  325
               YG
Sbjct  99   VAVYG  103



>ref|NP_850610.1| RING-H2 finger protein ATL77 [Arabidopsis thaliana]
 sp|Q9LS99.1|ATL77_ARATH RecName: Full=RING-H2 finger protein ATL77 [Arabidopsis thaliana]
 dbj|BAB01804.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM64481.1| contains similarity to RING zinc finger protein [Arabidopsis 
thaliana]
 dbj|BAD95334.1| hypothetical protein [Arabidopsis thaliana]
 gb|ABF19045.1| At3g18773 [Arabidopsis thaliana]
 gb|AEE76145.1| RING-H2 finger protein ATL77 [Arabidopsis thaliana]
Length=220

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 40/71 (56%), Gaps = 7/71 (10%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSS------NKGLKKKVL  298
            + +++L+ LLC +IC +GL  + RCA++R  R+         PS+      NKG+KKK L
Sbjct  51   NVLMLLSILLCGIICSLGLHYIIRCAFIRS-RSFMISDPISIPSTPRDSSVNKGIKKKAL  109

Query  299  RSLPKFTYGPS  331
            + LP   Y P 
Sbjct  110  KMLPVVNYSPE  120



>ref|XP_003623617.1| RING-H2 finger protein ATL5H [Medicago truncatula]
 gb|AES79835.1| RING-H2 finger protein ATL1L [Medicago truncatula]
Length=179

 Score = 46.6 bits (109),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 35/64 (55%), Gaps = 1/64 (2%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNK-GLKKKVLRSLPK  313
            + ++ILAALLCA+IC +GL  +ARCA     R             NK GLKK+ L  +P 
Sbjct  33   NMVIILAALLCALICALGLNTIARCAMRCSRRLSEETPEQATVRLNKTGLKKRELSQIPV  92

Query  314  FTYG  325
              YG
Sbjct  93   TVYG  96



>ref|XP_003630235.1| RING-H2 finger protein ATL5F, partial [Medicago truncatula]
Length=209

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 35/63 (56%), Gaps = 2/63 (3%)
 Frame = +2

Query  137  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANGGASGQPSSNKGLKKKVLRSLPKF  316
            + I+ILA LLCA+IC + L  + RC    R    A        SSNKG+KKK L++ P  
Sbjct  62   NVIMILAVLLCALICSLALNSIIRCGL--RFSNVALHNDPSLSSSNKGIKKKALKTFPTV  119

Query  317  TYG  325
            +Y 
Sbjct  120  SYS  122



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 558646673120