BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001G09

Length=502
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009604184.1|  PREDICTED: uncharacterized protein LOC104099022  92.8    3e-20   Nicotiana tomentosiformis
ref|XP_009787253.1|  PREDICTED: uncharacterized protein LOC104235230  91.3    1e-19   Nicotiana sylvestris
ref|XP_010322440.1|  PREDICTED: uncharacterized protein LOC101253793  83.6    8e-17   
ref|XP_006361081.1|  PREDICTED: uncharacterized protein LOC102600541  82.4    3e-16   Solanum tuberosum [potatoes]
ref|XP_011088914.1|  PREDICTED: uncharacterized protein LOC105170030  77.8    1e-14   Sesamum indicum [beniseed]
gb|KHN38621.1|  hypothetical protein glysoja_008170                   71.6    2e-12   Glycine soja [wild soybean]
ref|NP_001238654.1|  uncharacterized protein LOC100306681 precursor   71.6    2e-12   
ref|XP_002274217.1|  PREDICTED: uncharacterized protein LOC100258720  71.2    3e-12   Vitis vinifera
gb|AFK38933.1|  unknown                                               70.9    3e-12   Medicago truncatula
ref|XP_010102007.1|  hypothetical protein L484_016297                 70.1    6e-12   Morus notabilis
ref|XP_004291583.1|  PREDICTED: uncharacterized protein LOC101302722  70.1    7e-12   Fragaria vesca subsp. vesca
ref|XP_008342303.1|  PREDICTED: uncharacterized protein LOC103405117  69.7    9e-12   
ref|XP_009377823.1|  PREDICTED: uncharacterized protein LOC103966390  68.6    2e-11   Pyrus x bretschneideri [bai li]
ref|XP_008391136.1|  PREDICTED: uncharacterized protein LOC103453370  68.2    3e-11   Malus domestica [apple tree]
gb|EYU26724.1|  hypothetical protein MIMGU_mgv1a014687mg              67.8    4e-11   Erythranthe guttata [common monkey flower]
ref|XP_007206001.1|  hypothetical protein PRUPE_ppa012312mg           67.4    6e-11   Prunus persica
gb|KHN21162.1|  hypothetical protein glysoja_006641                   67.0    7e-11   Glycine soja [wild soybean]
ref|NP_001237809.1|  uncharacterized protein LOC100305605 precursor   65.9    1e-10   
ref|XP_003596840.1|  hypothetical protein MTR_2g086680                64.3    6e-10   Medicago truncatula
ref|XP_007132452.1|  hypothetical protein PHAVU_011G095400g           63.9    9e-10   Phaseolus vulgaris [French bean]
ref|XP_004487486.1|  PREDICTED: uncharacterized protein LOC101502277  63.5    1e-09   Cicer arietinum [garbanzo]
emb|CDP06891.1|  unnamed protein product                              63.2    1e-09   Coffea canephora [robusta coffee]
ref|XP_002523833.1|  conserved hypothetical protein                   62.4    2e-09   Ricinus communis
ref|XP_008229128.1|  PREDICTED: uncharacterized protein LOC103328506  62.4    3e-09   Prunus mume [ume]
ref|XP_010045194.1|  PREDICTED: uncharacterized protein LOC104433964  61.6    5e-09   Eucalyptus grandis [rose gum]
ref|XP_007015774.1|  Pollen Ole e 1 allergen and extensin family ...  61.2    9e-09   
ref|XP_004514371.1|  PREDICTED: uncharacterized protein LOC101498249  60.1    2e-08   Cicer arietinum [garbanzo]
gb|AFK37535.1|  unknown                                               58.5    4e-08   Lotus japonicus
gb|KDO35857.1|  hypothetical protein CISIN_1g030378mg                 58.5    7e-08   Citrus sinensis [apfelsine]
ref|XP_006424206.1|  hypothetical protein CICLE_v10029378mg           58.2    1e-07   Citrus clementina [clementine]
gb|AFK49274.1|  unknown                                               57.0    1e-07   Medicago truncatula
ref|XP_006487907.1|  PREDICTED: uncharacterized protein LOC102623586  57.0    3e-07   Citrus sinensis [apfelsine]
gb|KJB54179.1|  hypothetical protein B456_009G084200                  56.6    3e-07   Gossypium raimondii
ref|XP_011014926.1|  PREDICTED: uncharacterized protein LOC105118643  56.2    4e-07   Populus euphratica
ref|XP_002313489.1|  hypothetical protein POPTR_0009s02440g           56.2    4e-07   Populus trichocarpa [western balsam poplar]
ref|XP_007150057.1|  hypothetical protein PHAVU_005G122600g           56.2    4e-07   Phaseolus vulgaris [French bean]
gb|AFK40698.1|  unknown                                               55.5    6e-07   Lotus japonicus
gb|AFK41233.1|  unknown                                               55.5    7e-07   Lotus japonicus
gb|KHN32866.1|  hypothetical protein glysoja_038795                   54.7    2e-06   Glycine soja [wild soybean]
gb|KHG28557.1|  Bile acid-inducible operon CD                         54.7    2e-06   Gossypium arboreum [tree cotton]
gb|EPS71447.1|  hypothetical protein M569_03316                       54.3    2e-06   Genlisea aurea
ref|NP_001158898.1|  hypothetical protein precursor                   55.1    2e-06   Zea mays [maize]
ref|XP_010271608.1|  PREDICTED: uncharacterized protein LOC104607635  53.9    3e-06   Nelumbo nucifera [Indian lotus]
ref|XP_010421032.1|  PREDICTED: uncharacterized protein LOC104706531  52.8    7e-06   Camelina sativa [gold-of-pleasure]
ref|NP_001144082.1|  uncharacterized protein LOC100276913 precursor   53.1    9e-06   
gb|KDP34426.1|  hypothetical protein JCGZ_12707                       52.4    1e-05   Jatropha curcas
ref|NP_001234951.1|  uncharacterized protein LOC100306432 precursor   52.4    1e-05   
gb|AAM65948.1|  unknown                                               51.6    2e-05   Arabidopsis thaliana [mouse-ear cress]
gb|EMT13967.1|  hypothetical protein F775_04212                       52.0    2e-05   
ref|XP_010493327.1|  PREDICTED: uncharacterized protein LOC104770577  51.6    2e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010454505.1|  PREDICTED: uncharacterized protein LOC104736250  50.8    4e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010931111.1|  PREDICTED: uncharacterized protein LOC105052104  50.8    5e-05   Elaeis guineensis
ref|XP_006400748.1|  hypothetical protein EUTSA_v10014830mg           50.1    6e-05   Eutrema salsugineum [saltwater cress]
ref|XP_010236804.1|  PREDICTED: uncharacterized protein LOC104584272  50.4    8e-05   Brachypodium distachyon [annual false brome]
ref|XP_004139493.1|  PREDICTED: uncharacterized protein LOC101207654  49.7    1e-04   Cucumis sativus [cucumbers]
ref|NP_568418.1|  pollen Ole e 1 allergen and extensin family pro...  49.3    1e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006288782.1|  hypothetical protein CARUB_v10002103mg           49.3    2e-04   Capsella rubella
ref|XP_003581209.1|  PREDICTED: uncharacterized protein LOC100827343  49.7    2e-04   Brachypodium distachyon [annual false brome]
ref|XP_008461260.1|  PREDICTED: uncharacterized protein LOC103499896  48.9    2e-04   Cucumis melo [Oriental melon]
gb|KJB54178.1|  hypothetical protein B456_009G084200                  48.1    3e-04   Gossypium raimondii
emb|CDY35685.1|  BnaC02g09510D                                        47.4    6e-04   Brassica napus [oilseed rape]
ref|XP_009126543.1|  PREDICTED: uncharacterized protein LOC103851442  47.4    6e-04   Brassica rapa
ref|XP_002872002.1|  hypothetical protein ARALYDRAFT_351266           47.0    9e-04   Arabidopsis lyrata subsp. lyrata



>ref|XP_009604184.1| PREDICTED: uncharacterized protein LOC104099022 [Nicotiana tomentosiformis]
Length=166

 Score = 92.8 bits (229),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 72/117 (62%), Gaps = 11/117 (9%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
            HV KGSVTCLDC    N    LSG+KVSVKC   K +AMATTEEDGSFET +   ++ + 
Sbjct  26   HVLKGSVTCLDC----NQHSDLSGIKVSVKCNQVKTLAMATTEEDGSFETNLPFDTTPTS  81

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTKY  475
            ++   C AKILG  +QL++  K  +  VV      + D S +   T S+PL+FYT Y
Sbjct  82   TAAHICYAKILGGPKQLFVSKKDTDPTVV----KSQEDDSSY---TISKPLKFYTNY  131



>ref|XP_009787253.1| PREDICTED: uncharacterized protein LOC104235230 [Nicotiana sylvestris]
Length=168

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 73/117 (62%), Gaps = 11/117 (9%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
            HV KGSVTCLDC    NH   LSG+KVSVKC   K +AMATTEEDGSF + +   +S + 
Sbjct  28   HVLKGSVTCLDC----NHHSDLSGIKVSVKCSQVKTLAMATTEEDGSFVSNLPFDTSPTS  83

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTKY  475
            ++   C AKILG  +QL++  K  +  VV    + E D+S     T S+PL FYT+Y
Sbjct  84   TAANICYAKILGGPKQLFVSKKDTDPTVV---KSQEVDNS----YTISKPLNFYTRY  133



>ref|XP_010322440.1| PREDICTED: uncharacterized protein LOC101253793 [Solanum lycopersicum]
Length=171

 Score = 83.6 bits (205),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 69/119 (58%), Gaps = 17/119 (14%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
            +V KGSVTCLDC+  HN    LSG++V VKCG  K +AMATTEEDGSFET          
Sbjct  25   YVLKGSVTCLDCSQ-HND---LSGIEVLVKCGQVKRLAMATTEEDGSFET------KLPS  74

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTKYPN  481
            +    C AKILG   QL++     +  +V    + E D+S     T S PL+FYTK P+
Sbjct  75   TPPNKCYAKILGGPNQLFVSRIETDPNIV---KSQEDDNS----YTISNPLKFYTKCPS  126



>ref|XP_006361081.1| PREDICTED: uncharacterized protein LOC102600541 [Solanum tuberosum]
Length=171

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 69/126 (55%), Gaps = 17/126 (13%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
            +V KGSVTCLDC+   +    LSG+KVSVKC   K + MATTEEDG FET          
Sbjct  25   YVLKGSVTCLDCSQHID----LSGIKVSVKCSQVKTLTMATTEEDGFFET------KLPF  74

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTKYPNA  484
            +    C AKILG   QL+I  K  +  +V    + E D+S     T S PL+FYTK P++
Sbjct  75   TPTNKCYAKILGGPNQLFISRKETDPNIV---KSQEDDNS----YTISNPLKFYTKCPSS  127

Query  485  KCVGGG  502
                 G
Sbjct  128  NKNANG  133



>ref|XP_011088914.1| PREDICTED: uncharacterized protein LOC105170030 [Sesamum indicum]
Length=174

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 69/125 (55%), Gaps = 14/125 (11%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
            HV KGSV CLDC    +    LSG++V VKC   K +AMA TEEDG+FET  +   S   
Sbjct  26   HVLKGSVACLDCPRRSD----LSGIQVLVKCNKVKKLAMAYTEEDGTFETN-LPSDSPKT  80

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTKYP-N  481
            S   +C AK++G   QLY+ MK   + +V  A   ES H      TTS+PL FY   P  
Sbjct  81   SDPSNCMAKLMGGPHQLYVAMK---NSIVPVAKTEESGH-----FTTSKPLNFYRSCPVE  132

Query  482  AKCVG  496
             KC G
Sbjct  133  GKCGG  137



>gb|KHN38621.1| hypothetical protein glysoja_008170 [Glycine soja]
Length=173

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 76/126 (60%), Gaps = 13/126 (10%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             V +G V+C+DCTH ++    LS +KVSV+C G K +A+ATTE DGSF+  + L  +K  
Sbjct  25   QVVQGKVSCVDCTHNYD----LSDIKVSVRCDGVKKLALATTENDGSFKVDLPLDHTKPS  80

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTKYP-N  481
            SSV +C AK+LG   QLY+  +   S+++     G+  +S  Y ++TS  L F T  P  
Sbjct  81   SSVNNCLAKLLGGPVQLYVSRENQVSQII----KGKDQNS--YTISTS--LSFRTSCPLT  132

Query  482  AKCVGG  499
             KC GG
Sbjct  133  TKCKGG  138



>ref|NP_001238654.1| uncharacterized protein LOC100306681 precursor [Glycine max]
 gb|ACU14977.1| unknown [Glycine max]
Length=173

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 76/126 (60%), Gaps = 13/126 (10%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             V +G V+C+DCTH ++    LS +KVSV+C G K +A+ATTE DGSF+  + L  +K  
Sbjct  25   QVVQGKVSCVDCTHNYD----LSDIKVSVRCDGVKKLALATTENDGSFKVDLPLDHTKPS  80

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTKYP-N  481
            SSV +C AK+LG   QLY+  +   S+++     G+  +S  Y ++TS  L F T  P  
Sbjct  81   SSVNNCLAKLLGGPVQLYVSRENQVSQII----KGKDQNS--YTISTS--LSFRTSCPLT  132

Query  482  AKCVGG  499
             KC GG
Sbjct  133  TKCKGG  138



>ref|XP_002274217.1| PREDICTED: uncharacterized protein LOC100258720 [Vitis vinifera]
 emb|CAN68427.1| hypothetical protein VITISV_031997 [Vitis vinifera]
 emb|CBI28296.3| unnamed protein product [Vitis vinifera]
Length=172

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 68/120 (57%), Gaps = 13/120 (11%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
            HV KGSVTCLDC   H+     SG+KV VKC   K +AMATTE DGSF+T  +   +++ 
Sbjct  25   HVMKGSVTCLDCHRHHD----FSGIKVLVKCDRVKKLAMATTEADGSFKTN-LPSDTQTS  79

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTKYPNA  484
            S  ++C AK+LG   QLY   K   SK+V        D S +   T S PL F T  P++
Sbjct  80   SPPLNCLAKLLGGPNQLYAFRKNTVSKIV-----KARDDSSY---TISTPLSFSTTCPSS  131



>gb|AFK38933.1| unknown [Medicago truncatula]
Length=170

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 72/123 (59%), Gaps = 16/123 (13%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             + +G V+C+DCTH+++    LS +KV+VKC G KN+AM TTEEDGSF+       S + 
Sbjct  25   EILQGKVSCVDCTHSYD----LSDIKVTVKCEGVKNLAMTTTEEDGSFKVN---LPSDNT  77

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTKYP-N  481
             + ++C AK+LG   QLY    A +   V +   G+ ++S  YI++T  PL F    P N
Sbjct  78   KTSMNCLAKLLGGPIQLY----AKKQNQVSQVIKGKEENS--YIIST--PLSFLISCPQN  129

Query  482  AKC  490
              C
Sbjct  130  TNC  132



>ref|XP_010102007.1| hypothetical protein L484_016297 [Morus notabilis]
 gb|EXB91227.1| hypothetical protein L484_016297 [Morus notabilis]
Length=178

 Score = 70.1 bits (170),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 68/125 (54%), Gaps = 15/125 (12%)
 Frame = +2

Query  128  VFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksps  307
            + KG V+CLDC    +     +G+KV VKC   K +AMATT++DGSFE      ++  P 
Sbjct  27   LIKGKVSCLDCKSKSDL---TAGIKVLVKCDKVKKLAMATTKDDGSFEVEAPSDNTPQPR  83

Query  308  svvscsAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTKYP---  478
            S+ +C +K+LG   QLY   K   S++V      E+D S  Y  T S PL  YT  P   
Sbjct  84   SLSNCLSKLLGGPNQLYTSKKFMTSQIV------ETDDSNSY--TISSPLSIYTSCPPTI  135

Query  479  -NAKC  490
             +AKC
Sbjct  136  DHAKC  140



>ref|XP_004291583.1| PREDICTED: uncharacterized protein LOC101302722 [Fragaria vesca 
subsp. vesca]
Length=178

 Score = 70.1 bits (170),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 62/118 (53%), Gaps = 13/118 (11%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             V K  VTCLDC   ++     SG+KV VKC   K +A ATTE DGSFE   +       
Sbjct  27   QVLKAKVTCLDCHKNYD----FSGIKVLVKCDQVKKLATATTEADGSFE-VKLPSDDSKS  81

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTKYP  478
             + + C AKILG T+QLY+  K   SK++      ++  S  Y  T S PL F+T  P
Sbjct  82   PASLHCLAKILGGTKQLYVSRKVVASKIL------KTHDSNSY--TISTPLSFFTSCP  131



>ref|XP_008342303.1| PREDICTED: uncharacterized protein LOC103405117 [Malus domestica]
Length=176

 Score = 69.7 bits (169),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 60/118 (51%), Gaps = 12/118 (10%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             V K  VTCLDC   ++     SG+KV VKC   K MAMA TE DGSFE  +   ++   
Sbjct  25   QVLKAKVTCLDCHQNYD----FSGIKVLVKCDKVKKMAMAITENDGSFEAKLPSNNNTKS  80

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTKYP  478
                +C A+ILG   QLY   K   S++V      ++  S  Y  TT+ PL F T  P
Sbjct  81   PDAKNCLARILGGPDQLYTSRKFMASEIV------KTQDSNSY--TTTTPLGFSTSCP  130



>ref|XP_009377823.1| PREDICTED: uncharacterized protein LOC103966390 [Pyrus x bretschneideri]
Length=176

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 59/118 (50%), Gaps = 12/118 (10%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             V K  VTCLDC   ++     SG+KV VKC   K MAMA TE DGSFE  +   ++   
Sbjct  25   QVLKAKVTCLDCHQNYD----FSGIKVLVKCDKVKKMAMAVTENDGSFEAKLPSNNNTKS  80

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTKYP  478
                +C A+ILG   QLY   K   S++V      +   S  Y  TT+ PL F T  P
Sbjct  81   PDAKNCLARILGGPDQLYASRKFMASEIV------KIQDSNSY--TTTTPLGFSTSCP  130



>ref|XP_008391136.1| PREDICTED: uncharacterized protein LOC103453370 [Malus domestica]
Length=176

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 62/118 (53%), Gaps = 12/118 (10%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             V KG VTCLDC   ++     S +KV VKC   K +AMA TE+DGSFE  +   ++   
Sbjct  25   QVLKGKVTCLDCHQNYD----FSEIKVLVKCDKVKKLAMAITEKDGSFEAKLPSNNNPKT  80

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTKYP  478
               ++C A+ILG   QLY   K   S++V      ++  S  Y  TTS PL F T  P
Sbjct  81   PEAMNCLARILGGPDQLYSSRKFLASEIV------KTQDSNTY--TTSTPLGFSTSCP  130



>gb|EYU26724.1| hypothetical protein MIMGU_mgv1a014687mg [Erythranthe guttata]
Length=181

 Score = 67.8 bits (164),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 67/125 (54%), Gaps = 10/125 (8%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             + KGSV C+DC    +    LSGV+V VKC   K +A+  T+EDG+F T +        
Sbjct  29   QLLKGSVACVDCPQDFD----LSGVQVLVKCDKVKKLAVTYTQEDGTFITELPSDEPTKS  84

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTKYP-N  481
             +  +C AKI+G   QL++  K   + V+  A A ES  S   + TT++PL FY+  P  
Sbjct  85   ENPSNCMAKIMGGPHQLFVSTKDAFAPVI--ANARESSGS---LFTTAKPLGFYSTCPLK  139

Query  482  AKCVG  496
             KC+ 
Sbjct  140  GKCIA  144



>ref|XP_007206001.1| hypothetical protein PRUPE_ppa012312mg [Prunus persica]
 gb|EMJ07200.1| hypothetical protein PRUPE_ppa012312mg [Prunus persica]
Length=174

 Score = 67.4 bits (163),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 61/118 (52%), Gaps = 15/118 (13%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             V K  VTCLDC    +     SG+KV VKCG  K +AMATTE+DGSFET        + 
Sbjct  26   QVVKAKVTCLDCHQNTD----FSGIKVLVKCGQVKKLAMATTEKDGSFET---KLPVGNS  78

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTKYP  478
             S ++C A+ILG   QLY   K   S++V      ++     Y  T S PL F T  P
Sbjct  79   KSPMNCLARILGGPDQLYASRKVVASEIV------KTQEPNSY--TISTPLGFTTSCP  128



>gb|KHN21162.1| hypothetical protein glysoja_006641 [Glycine soja]
Length=172

 Score = 67.0 bits (162),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 71/126 (56%), Gaps = 14/126 (11%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             + +G V C+DCTH ++    LS +KVSV+C G K +A+ATTE DGSF+   +      P
Sbjct  25   QMVQGRVFCVDCTHNYD----LSDIKVSVRCDGVKKLALATTENDGSFKVD-LPLDHTKP  79

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTKYP-N  481
            SSV +C AK+LG   QLY+  +   S+++     G+  +S     T S PL F T  P N
Sbjct  80   SSVKNCLAKLLGGPVQLYVSRENQVSQII----KGKEQNS----YTISTPLSFRTSCPLN  131

Query  482  AKCVGG  499
             KC  G
Sbjct  132  TKCKAG  137



>ref|NP_001237809.1| uncharacterized protein LOC100305605 precursor [Glycine max]
 gb|ACU13371.1| unknown [Glycine max]
Length=134

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 70/123 (57%), Gaps = 14/123 (11%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             + +G V C+DCTH ++    LS +KVSV+C G K +A+ATTE DGSF+   +      P
Sbjct  25   QMVQGRVFCVDCTHNYD----LSDIKVSVRCDGVKKLALATTENDGSFKVD-LPLDHTKP  79

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTKYP-N  481
            SSV +C AK+LG   QLY+  +   S+++     G+  +S     T S PL F T  P N
Sbjct  80   SSVKNCLAKLLGGPVQLYVSRENQVSQII----KGKEQNS----YTISTPLSFRTSCPLN  131

Query  482  AKC  490
             KC
Sbjct  132  TKC  134



>ref|XP_003596840.1| hypothetical protein MTR_2g086680 [Medicago truncatula]
 gb|AES67091.1| pollen Ole e I family allergen [Medicago truncatula]
Length=172

 Score = 64.3 bits (155),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 66/121 (55%), Gaps = 14/121 (12%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             + KG V+C DC   ++     SG+KVS+KC G KNMAMATTE DGSF   V L +S + 
Sbjct  25   QMVKGKVSCNDCAQDYD----FSGIKVSMKCEGVKNMAMATTENDGSF--MVDLSTSHAK  78

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTKYPNA  484
                +C AK+LG    LY   +   S++V     G+ ++S     T S PL F+T  P  
Sbjct  79   LPYDNCHAKLLGGPNNLYASRRNQFSQIV----KGKEENS----YTLSTPLSFFTSCPQN  130

Query  485  K  487
            K
Sbjct  131  K  131



>ref|XP_007132452.1| hypothetical protein PHAVU_011G095400g [Phaseolus vulgaris]
 gb|ESW04446.1| hypothetical protein PHAVU_011G095400g [Phaseolus vulgaris]
Length=166

 Score = 63.9 bits (154),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 50/126 (40%), Positives = 67/126 (53%), Gaps = 20/126 (16%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             + +G V+C+DCT  ++    LS VKVSVKC G K + +ATTE DGSF+        + P
Sbjct  25   QILQGKVSCVDCTLNYD----LSDVKVSVKCDGVKKLGVATTENDGSFKV-------ELP  73

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTK-YPN  481
            S   +C AK+LG   QLY+  K   S++V     G+  +S     T S PL F T   P 
Sbjct  74   SDKGNCLAKVLGGPVQLYVSGKDQISEIV----KGKEQNS----YTISTPLIFRTSCPPR  125

Query  482  AKCVGG  499
              C GG
Sbjct  126  TSCKGG  131



>ref|XP_004487486.1| PREDICTED: uncharacterized protein LOC101502277 [Cicer arietinum]
Length=172

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 63/121 (52%), Gaps = 14/121 (12%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             + KG V+C DCT  ++     SG+KVSVKC G +N+A+ATT++DGSF     + +  + 
Sbjct  26   QIVKGKVSCTDCTQDYD----FSGIKVSVKCEGVQNLAVATTQDDGSFMVD--ISTYHAK  79

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTKYPNA  484
                +C AKILG    LY   K   S+ +V+   G S        T S P+ F T  P  
Sbjct  80   LPYDNCLAKILGGPNYLYASRKNQFSQ-IVKGKDGNS-------YTISTPISFLTSCPQN  131

Query  485  K  487
            K
Sbjct  132  K  132



>emb|CDP06891.1| unnamed protein product [Coffea canephora]
Length=175

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 66/121 (55%), Gaps = 13/121 (11%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
            +V +GSVTCLDC   HN    LSG+K+ VKC   K + +ATT++DG+FE T +   + + 
Sbjct  25   NVLRGSVTCLDC-DGHND---LSGIKIVVKCSNVKMVDVATTKKDGTFE-TELAKGTTTS  79

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTKYPNA  484
             + + C AKILG    LY   K   SKV       + +   HY  T +EPL FY   P  
Sbjct  80   PNSLKCLAKILGGPSLLYTSGKKTISKV------EKVEGHDHY--TNTEPLNFYKSCPAE  131

Query  485  K  487
            K
Sbjct  132  K  132



>ref|XP_002523833.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38559.1| conserved hypothetical protein [Ricinus communis]
Length=169

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 64/125 (51%), Gaps = 13/125 (10%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             V K  V+CLDCT  ++     SG+KV VKC   K +A  TT+  GSFE   +   +   
Sbjct  25   QVLKAKVSCLDCTAHYD----FSGIKVLVKCANVKKLATTTTKSKGSFE-VELPSGNSKA  79

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTKYPNA  484
             + ++C AK++G T Q+Y   K   S++V      ++  S  Y  T S PL F T +P  
Sbjct  80   ETPLNCLAKLIGGTSQIYATRKNMVSRIV------KTKDSSSY--TISTPLAFSTAFPEG  131

Query  485  KCVGG  499
            +  GG
Sbjct  132  QLKGG  136



>ref|XP_008229128.1| PREDICTED: uncharacterized protein LOC103328506 [Prunus mume]
Length=174

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 60/118 (51%), Gaps = 15/118 (13%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             V K  VTC DC    +     SG+KV VKCG  K +AMATTE+DGSFET        + 
Sbjct  26   QVVKAKVTCHDCHQNTD----FSGIKVLVKCGQVKKLAMATTEKDGSFET---KLPLGNS  78

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTKYP  478
             S ++C A+ILG   QLY   K   S++V      ++     Y  T S PL F T  P
Sbjct  79   KSPMNCLARILGGPDQLYASRKFMASEIV------KTQEPNSY--TISTPLGFTTSCP  128



>ref|XP_010045194.1| PREDICTED: uncharacterized protein LOC104433964 [Eucalyptus grandis]
 gb|KCW87355.1| hypothetical protein EUGRSUZ_B03836 [Eucalyptus grandis]
Length=195

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 63/131 (48%), Gaps = 18/131 (14%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlps----  292
            HV KG ++CLDC   H+    LSG+KV VKC G K  ++ATTE+DGSFE  +        
Sbjct  33   HVVKGKLSCLDCKQDHD----LSGIKVMVKCDGVKKASVATTEDDGSFEAELPSTKAAAA  88

Query  293  ------skspssvvscsAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEP  454
                    + +  +SC AK+LG   QLY       +KVV     G    +  Y + T  P
Sbjct  89   TTTDEGKTAAAPTLSCLAKVLGGPDQLYASRDHVVAKVV--EVEGRDGTATSYGLAT--P  144

Query  455  LRFYTKYPNAK  487
            L   T  P  K
Sbjct  145  LAVSTACPPTK  155



>ref|XP_007015774.1| Pollen Ole e 1 allergen and extensin family protein, putative 
[Theobroma cacao]
 gb|EOY33393.1| Pollen Ole e 1 allergen and extensin family protein, putative 
[Theobroma cacao]
Length=175

 Score = 61.2 bits (147),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 64/126 (51%), Gaps = 17/126 (13%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
            HV +G ++CLDCT  ++     SG+KV VKC   K +A A T+E+GSF+   +   +   
Sbjct  25   HVLEGKISCLDCTRDYD----FSGIKVQVKCAQVKKLATANTQENGSFK-VELPSDTSKT  79

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTKYP--  478
                +C AK+LG   QLY   +   SKVV      ++     Y  T S PL F T  P  
Sbjct  80   PRAETCLAKLLGGPDQLYAWKRNLVSKVV------KAHELNSY--TISTPLAFSTTCPLA  131

Query  479  --NAKC  490
              +AKC
Sbjct  132  SRDAKC  137



>ref|XP_004514371.1| PREDICTED: uncharacterized protein LOC101498249 [Cicer arietinum]
Length=170

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 64/123 (52%), Gaps = 16/123 (13%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             + KG V+C+DCTH +N    LS + VS+KC G K +AM TT++DGSF+       S   
Sbjct  25   QMVKGKVSCVDCTHNNN----LSDINVSLKCEGVKKLAMTTTKDDGSFKVN---LPSDHT  77

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTKYP-N  481
             + ++C A +LG   QLY+  +   S+++      +    + Y  T S PL F    P N
Sbjct  78   KTSMNCFATLLGGPIQLYVSKQNQVSQII------KGKEKKDY--TISTPLSFMISCPKN  129

Query  482  AKC  490
              C
Sbjct  130  TNC  132



>gb|AFK37535.1| unknown [Lotus japonicus]
Length=149

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 69/121 (57%), Gaps = 16/121 (13%)
 Frame = +2

Query  134  KGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAM-ATTEEDGSFETTvvlpsskspss  310
            KG+V+C DCT  ++     SG+KVSVKC G +N A+  TTEEDGSF+    LPS  + S 
Sbjct  3    KGNVSCTDCTDNYD----FSGIKVSVKCEGVQNKALTTTTEEDGSFKV--HLPSHYAKSP  56

Query  311  vvscsAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTKYP-NAK  487
             + C AK+LG    LY   K   ++V +   A E +     I T S PL F+T  P N++
Sbjct  57   SMKCLAKLLGGPDLLYASRK---NRVSLIVKAKEEN-----IYTISTPLSFFTYCPQNSE  108

Query  488  C  490
            C
Sbjct  109  C  109



>gb|KDO35857.1| hypothetical protein CISIN_1g030378mg [Citrus sinensis]
Length=178

 Score = 58.5 bits (140),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 63/119 (53%), Gaps = 12/119 (10%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             V KG V+C DC++ ++    LSGVKV VKC   K +AMATT+  GSF+  +   ++   
Sbjct  27   EVLKGKVSCSDCSNDYD----LSGVKVLVKCNHLKKLAMATTQVSGSFKVNLPSDAAMKT  82

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTKYPN  481
             S + C AK+ G   QLY   K   SKV+      +  +S  Y ++T  PL F    P+
Sbjct  83   PSPLHCHAKLFGGPVQLYASKKNMVSKVM------KPKNSNSYKIST--PLAFSISCPS  133



>ref|XP_006424206.1| hypothetical protein CICLE_v10029378mg [Citrus clementina]
 gb|ESR37446.1| hypothetical protein CICLE_v10029378mg [Citrus clementina]
Length=178

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 62/119 (52%), Gaps = 12/119 (10%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             V KG V+C DC+  ++    LSGVKV VKC   K +AMATT+  GSF+  +   ++   
Sbjct  27   EVLKGKVSCSDCSKDYD----LSGVKVLVKCNHLKKLAMATTQVSGSFKVNLPSDAAMKT  82

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTKYPN  481
             S + C AK+ G   QLY   K   SKV+      +  +S  Y ++T  PL F    P+
Sbjct  83   PSPLHCHAKLFGGPVQLYASKKNMVSKVM------KPKNSNSYKIST--PLAFSISCPS  133



>gb|AFK49274.1| unknown [Medicago truncatula]
Length=112

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 51/89 (57%), Gaps = 6/89 (7%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             + KG V+C DC   ++     SG+KVS+KC G KNMAMATTE DGSF     L +S + 
Sbjct  25   QMVKGKVSCNDCAQDYD----FSGIKVSMKCEGVKNMAMATTENDGSFMVD--LSTSHAK  78

Query  305  ssvvscsAKILGATRQLYIPMKACESKVV  391
                +C AK+LG    LY   +   S++V
Sbjct  79   LPYDNCHAKLLGGPNNLYASRRNQFSQIV  107



>ref|XP_006487907.1| PREDICTED: uncharacterized protein LOC102623586 [Citrus sinensis]
Length=178

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 62/119 (52%), Gaps = 12/119 (10%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             V KG V+C DC++ ++    LSGVKV VKC   K +AMATT   GSF+  +   ++   
Sbjct  27   EVLKGKVSCSDCSNDYD----LSGVKVLVKCNHVKKLAMATTLVSGSFKVNLPSDAAMKT  82

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTKYPN  481
             S + C AK+ G   QLY   K   SKV+      +  +S  Y ++T  PL F    P+
Sbjct  83   PSPLHCHAKLFGGPVQLYASKKNMVSKVM------KPKNSNSYKIST--PLAFSISCPS  133



>gb|KJB54179.1| hypothetical protein B456_009G084200 [Gossypium raimondii]
Length=175

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 59/118 (50%), Gaps = 16/118 (14%)
 Frame = +2

Query  131  FKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpsskspss  310
                ++C DC H ++     SG++V+VKC   K +A ATTEE+GSF+         S  S
Sbjct  29   LNAKISCFDCPHNYD----FSGIQVAVKCEKVKKLATATTEENGSFKV-----QLPSGIS  79

Query  311  vvscsAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTKYPNA  484
              +C AK+LG   QLY   K   SKVV     G   ++     T S PL F T  P+A
Sbjct  80   NTNCLAKLLGGPNQLYSKKKNLVSKVV---KVGHQPNT----YTLSTPLAFSTSCPSA  130



>ref|XP_011014926.1| PREDICTED: uncharacterized protein LOC105118643 [Populus euphratica]
Length=173

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 66/126 (52%), Gaps = 18/126 (14%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             V KG V+CLDC   +++    S +KV VKC   + +A  TT+ DGSFE   + P S + 
Sbjct  25   QVLKGKVSCLDCGGHYDY----SEIKVGVKCDKVRKLATTTTQSDGSFE-VKLPPGSSTA  79

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTKYPNA  484
            ++ + C AK+LG   QLY+  +   SK+V      ++  S  Y  T S PL F     ++
Sbjct  80   ATPLICLAKLLGGPSQLYVSRQNMVSKIV------QTHDSNSY--TISTPLSF-----SS  126

Query  485  KCVGGG  502
             C  GG
Sbjct  127  TCSAGG  132



>ref|XP_002313489.1| hypothetical protein POPTR_0009s02440g [Populus trichocarpa]
 gb|ABK96060.1| unknown [Populus trichocarpa]
 gb|EEE87444.1| hypothetical protein POPTR_0009s02440g [Populus trichocarpa]
Length=173

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 66/126 (52%), Gaps = 18/126 (14%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             V KG V+CLDC   +++    S +KV VKC   + +A  TT+ DGSFE   + P + + 
Sbjct  25   QVLKGKVSCLDCGGHYDY----SEIKVGVKCDKVRKLATTTTQSDGSFE-VKLPPGTSTA  79

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTKYPNA  484
            ++ + C AK+LG   QLY+  +   SK+V      ++  S  Y  T S PL F     ++
Sbjct  80   ATPLICLAKLLGGPSQLYVSRQNMVSKIV------QTHDSNSY--TISTPLAF-----SS  126

Query  485  KCVGGG  502
             C  GG
Sbjct  127  TCSAGG  132



>ref|XP_007150057.1| hypothetical protein PHAVU_005G122600g [Phaseolus vulgaris]
 gb|ESW22051.1| hypothetical protein PHAVU_005G122600g [Phaseolus vulgaris]
Length=174

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 63/123 (51%), Gaps = 15/123 (12%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
               +G V+C DCTH ++     SG+ +SVKC G KN+AMA TEE G F+    LP   + 
Sbjct  25   QTLEGKVSCTDCTHNYD----FSGIMISVKCEGVKNLAMAITEEKGFFKVD--LPRDHTK  78

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTKYP-N  481
               V+C  K+LG    LY   K   S++V     G+  ++     T S PL F T  P N
Sbjct  79   PPSVNCVVKLLGGPNHLYATKKNKVSEIV----KGKEKNT----YTISTPLSFLTSCPQN  130

Query  482  AKC  490
             +C
Sbjct  131  TEC  133



>gb|AFK40698.1| unknown [Lotus japonicus]
Length=172

 Score = 55.5 bits (132),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 63/123 (51%), Gaps = 14/123 (11%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             V  G V+C+DCT  H+    LS +KV VKC G K +A+A+TE++G F+   +      P
Sbjct  25   QVVNGKVSCVDCTQNHD----LSDIKVLVKCEGVKKLALASTEDNGFFKVD-LPSDKTKP  79

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTKYP-N  481
            SS  +C AK++G   QLY   +   S+++      +S     Y  T S PL F    P N
Sbjct  80   SSAGNCLAKLVGGPVQLYATRQNQVSQII------KSQEPNSY--TISTPLSFMKSCPQN  131

Query  482  AKC  490
              C
Sbjct  132  TNC  134



>gb|AFK41233.1| unknown [Lotus japonicus]
Length=172

 Score = 55.5 bits (132),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 63/123 (51%), Gaps = 14/123 (11%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             V  G V+C+DCT  H+    LS +KV VKC G K +A+A+TE++G F+   +      P
Sbjct  25   QVVNGKVSCVDCTQNHD----LSDIKVLVKCEGVKKLALASTEDNGFFKVD-LPSDKTKP  79

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTKYP-N  481
            SS  +C AK++G   QLY   +   S+++      +S     Y  T S PL F    P N
Sbjct  80   SSAGNCLAKLVGGPVQLYATRQNQVSQII------KSQEPNSY--TISTPLSFMKSCPQN  131

Query  482  AKC  490
              C
Sbjct  132  TNC  134



>gb|KHN32866.1| hypothetical protein glysoja_038795 [Glycine soja]
Length=174

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 66/124 (53%), Gaps = 16/124 (13%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
               +G V+C DC   ++     SG+KVSVKC G KN+AMATTE+ G F+    LPS ++ 
Sbjct  25   QTVEGKVSCTDCADNYD----FSGIKVSVKCEGVKNLAMATTEDKGFFQVD--LPSDQTK  78

Query  305  ssvvscsAKILGATR-QLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTKYP-  478
               V+C  K+LG     LY    A +  +V +   G+  ++     T S PL F+T  P 
Sbjct  79   PPSVNCFTKLLGGPNTNLY----ASKKNLVSQIVKGKEKNT----YTISTPLSFFTSCPQ  130

Query  479  NAKC  490
            N +C
Sbjct  131  NTEC  134



>gb|KHG28557.1| Bile acid-inducible operon CD [Gossypium arboreum]
Length=175

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/114 (39%), Positives = 58/114 (51%), Gaps = 16/114 (14%)
 Frame = +2

Query  143  VTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpsskspssvvsc  322
            ++C DC H ++     SG++V+VKC   K +A ATTEE+GSF+         S  S  +C
Sbjct  33   ISCFDCPHNYD----FSGIQVAVKCEKVKKLATATTEENGSFKV-----QLPSGISNPNC  83

Query  323  sAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTKYPNA  484
             AK+LG   QLY   K   SKVV      +  H  +   T S PL F T  P A
Sbjct  84   LAKLLGGPNQLYSKKKNLVSKVV------KVGHQLN-TYTLSTPLAFSTSCPLA  130



>gb|EPS71447.1| hypothetical protein M569_03316, partial [Genlisea aurea]
Length=180

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 59/118 (50%), Gaps = 12/118 (10%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             V KGSV+C DC    +    LSG++V +KC G K ++MA T+  G F+   +   +  P
Sbjct  31   SVVKGSVSCADCKPGSD----LSGIQVLMKCDGVKKLSMAYTDTRGRFQAD-LPSDAAPP  85

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTKYP  478
                +C AKI+G   QLY+  KA E+ V V  T       R  +   S+P+ F    P
Sbjct  86   PPSSNCMAKIMGGPYQLYV--KASEASVPVSRT-----QRRAGVFAVSKPMSFVRDCP  136



>ref|NP_001158898.1| hypothetical protein precursor [Zea mays]
 gb|ACF84309.1| unknown [Zea mays]
 gb|AFW71695.1| hypothetical protein ZEAMMB73_204218 [Zea mays]
Length=225

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 63/118 (53%), Gaps = 13/118 (11%)
 Frame = +2

Query  131  FKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKN----MAMATTEEDGSFETTvvlpssk  298
             +GSV CLDC   H+    LSGV V+VKC G+ +    +  A T+  G+F+       ++
Sbjct  42   LRGSVACLDCAEGHD----LSGVVVAVKCAGDGDGSAGLHAAQTDGRGNFDVA---VPAE  94

Query  299  spssvvscsAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTK  472
            + +S   C+A++LGAT QL  P     ++VV     G + +   Y++ +   L F+T+
Sbjct  95   ASASGAPCAARVLGATEQLCAPWGLTVARVVPARGPGSASYPASYVLGSR--LAFFTR  150



>ref|XP_010271608.1| PREDICTED: uncharacterized protein LOC104607635 [Nelumbo nucifera]
Length=179

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 63/115 (55%), Gaps = 15/115 (13%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
            H  KGSV+CLDCTH  +    LSG+KV VKC   K ++MATT+  GSFET      + S 
Sbjct  25   HQVKGSVSCLDCTHHES----LSGLKVVVKCDKVKKLSMATTDNTGSFET---ELPTDSS  77

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYT  469
                +C AK+LG  RQL    K   SK+V    A E+D       T S PL FYT
Sbjct  78   VPSSNCLAKLLGGPRQLCSYKKNLVSKIV---KAHETDA-----YTISTPLNFYT  124



>ref|XP_010421032.1| PREDICTED: uncharacterized protein LOC104706531 [Camelina sativa]
Length=172

 Score = 52.8 bits (125),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 54/114 (47%), Gaps = 14/114 (12%)
 Frame = +2

Query  137  GSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpsskspssvv  316
            G V+CLDC H  +     SG++V VKC GEK    A    DGSF T      +      +
Sbjct  31   GKVSCLDCHHDFD----FSGIRVLVKCDGEKKQITAMAASDGSFLTV---LPAAYKKGSM  83

Query  317  scsAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTKYP  478
            +C AK+LG   QLY       S++V+      S H    ++TTS PL F    P
Sbjct  84   NCLAKLLGGPEQLYAHKHNLVSELVM------SKHDSK-VLTTSNPLPFSLSCP  130



>ref|NP_001144082.1| uncharacterized protein LOC100276913 precursor [Zea mays]
 gb|ACG37784.1| hypothetical protein [Zea mays]
Length=225

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 62/118 (53%), Gaps = 13/118 (11%)
 Frame = +2

Query  131  FKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKN----MAMATTEEDGSFETTvvlpssk  298
             +GSV CLDC   H+    LSGV V+VKC G+ +    +  A T+  G+F+       + 
Sbjct  42   LRGSVACLDCDEEHD----LSGVVVAVKCAGDDDGGAGLHAAQTDGRGNFDVA---VPAA  94

Query  299  spssvvscsAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTK  472
            + +S   C+A++LGAT QL  P     ++VV     G + +   Y++ +   L F+T+
Sbjct  95   ASASGAPCAARVLGATEQLCAPWGLTXARVVPARAPGSASYPASYVLGSR--LAFFTR  150



>gb|KDP34426.1| hypothetical protein JCGZ_12707 [Jatropha curcas]
Length=169

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 63/124 (51%), Gaps = 11/124 (9%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             + K +V+CL C   ++    LSG+K++VKC   K +A  TT   GSFE  +   +S++ 
Sbjct  26   QILKANVSCLQCISHYD----LSGIKIAVKCENVKRIATTTTRSKGSFEVKLPSETSRNH  81

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTKYPNA  484
             + ++C AK++G   Q+    K   SK+V      ++ HS     T S PL F T  P A
Sbjct  82   QTPLNCLAKLIGGKNQICASRKNMVSKIV---KTQKNSHS----YTISTPLAFSTTCPKA  134

Query  485  KCVG  496
               G
Sbjct  135  AGFG  138



>ref|NP_001234951.1| uncharacterized protein LOC100306432 precursor [Glycine max]
 gb|ACU14606.1| unknown [Glycine max]
Length=174

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 60/123 (49%), Gaps = 14/123 (11%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
               +G V+C DC   ++     SG+KVSVKC G KN+AMATTE+ G F    +      P
Sbjct  25   QTVEGKVSCTDCADNYD----FSGIKVSVKCEGVKNLAMATTEDKG-FSQVDLPSDQTKP  79

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTKYP-N  481
             SV   +  + G    LY    A +  +V +   G+  ++     T S PL F+T  P N
Sbjct  80   PSVNCFTKLLGGPNTNLY----ASKKNLVSQIVKGKEKNT----YTISTPLSFFTSCPQN  131

Query  482  AKC  490
             +C
Sbjct  132  TEC  134



>gb|AAM65948.1| unknown [Arabidopsis thaliana]
Length=172

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 54/114 (47%), Gaps = 14/114 (12%)
 Frame = +2

Query  137  GSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpsskspssvv  316
            G ++CLDC H  +     SG+KV +KC GEK    A    DGSF +      +      +
Sbjct  31   GKISCLDCHHDFD----FSGIKVLLKCDGEKKQITAMAAADGSFRSV---LPTADKKGSI  83

Query  317  scsAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTKYP  478
            +C AK+LG   QLY       S++V      +S H    ++TTS PL F    P
Sbjct  84   NCLAKLLGGPEQLYAHKHNLVSELV------KSKHDSK-VLTTSNPLAFSLSCP  130



>gb|EMT13967.1| hypothetical protein F775_04212 [Aegilops tauschii]
Length=191

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 51/108 (47%), Gaps = 11/108 (10%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKC-GGEKNMAMATTEEDGSFETTvvlpssks  301
               +GSVTCLDC   H    HLSGV V+V+C GG     +A T+  G+F           
Sbjct  31   QTLRGSVTCLDCPAGH----HLSGVVVTVECSGGAGPHVVARTDGGGNFGVA-----VPE  81

Query  302  pssvvscsAKILGATRQLYIPMKACESKVVVRATAGE-SDHSRHYIMT  442
                  C A++LG T QL  P +   ++VVV    G  +  SR  + T
Sbjct  82   SVLASRCPARVLGGTEQLCAPRRLTVARVVVAGRPGSYARGSRSAVFT  129



>ref|XP_010493327.1| PREDICTED: uncharacterized protein LOC104770577 [Camelina sativa]
Length=172

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 54/114 (47%), Gaps = 14/114 (12%)
 Frame = +2

Query  137  GSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpsskspssvv  316
            G V+CLDC    +     SG+KV +KC GEK    A    DGSF +      +      +
Sbjct  31   GKVSCLDCHRNFD----FSGIKVLIKCNGEKKQITAMAASDGSFRSV---LPAAEKKGSI  83

Query  317  scsAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTKYP  478
            +C AK+LG   QLY    +  S++V+      S H    ++TTS PL F    P
Sbjct  84   NCLAKLLGGPEQLYAHKHSMVSELVM------SKHDSK-VLTTSNPLAFSLSCP  130



>ref|XP_010454505.1| PREDICTED: uncharacterized protein LOC104736250 [Camelina sativa]
Length=172

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 54/117 (46%), Gaps = 14/117 (12%)
 Frame = +2

Query  128  VFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksps  307
            +  G V+CLDC    +     SG+KV VKC GEK    A    DGSF +      +    
Sbjct  28   LVSGKVSCLDCHRDFD----FSGIKVLVKCDGEKKQITAMASSDGSFRSV---LPAADKK  80

Query  308  svvscsAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTKYP  478
              ++C AK+LG   QLY       S++V+      S H    ++TTS PL F    P
Sbjct  81   GSMNCLAKLLGGPEQLYAHKHNLVSELVM------SKHDSK-VLTTSNPLAFSLSCP  130



>ref|XP_010931111.1| PREDICTED: uncharacterized protein LOC105052104 [Elaeis guineensis]
Length=194

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 58/119 (49%), Gaps = 12/119 (10%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
            H  KGSV C DCT +HN    L+GV V+VKC  EK +  A T   G FE  +   SS   
Sbjct  26   HSLKGSVACFDCT-SHN----LAGVFVAVKCNHEKRLLPALTNNKGYFEVEIPTKSSPPS  80

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTKYPN  481
            SS   C  ++LG   QL    K+  SK+V      ES     Y + T  PL F+   P+
Sbjct  81   SSPPDCLVRLLGGPEQLCSFKKSMTSKIVKAQGLEES-----YALAT--PLTFFRSCPS  132



>ref|XP_006400748.1| hypothetical protein EUTSA_v10014830mg [Eutrema salsugineum]
 gb|ESQ42201.1| hypothetical protein EUTSA_v10014830mg [Eutrema salsugineum]
Length=172

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 52/112 (46%), Gaps = 14/112 (13%)
 Frame = +2

Query  143  VTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpsskspssvvsc  322
            VTCLDC H  +     SGVKV +KC GEK      T  DG+F +      +      + C
Sbjct  33   VTCLDCHHDFD----FSGVKVLLKCDGEKKTITVMTASDGTFRSV---LPTADNKRSMKC  85

Query  323  sAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTKYP  478
             AK+LG   QLY       S++V+      S H+   + TTS PL F    P
Sbjct  86   LAKLLGGPEQLYAHRHNLVSELVM------SKHNSK-VFTTSNPLSFSLSCP  130



>ref|XP_010236804.1| PREDICTED: uncharacterized protein LOC104584272 [Brachypodium 
distachyon]
Length=191

 Score = 50.4 bits (119),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 41/78 (53%), Gaps = 10/78 (13%)
 Frame = +2

Query  131  FKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpsskspss  310
             +GSVTCLDC   H    HLSGV V+VKC G   +  A T+  GSF+           +S
Sbjct  34   LRGSVTCLDCAAGH----HLSGVVVAVKCTGGAGLHAAQTDGSGSFDVA------VPAAS  83

Query  311  vvscsAKILGATRQLYIP  364
               C+A++LG   QL  P
Sbjct  84   GSRCAARVLGGAEQLCAP  101



>ref|XP_004139493.1| PREDICTED: uncharacterized protein LOC101207654 [Cucumis sativus]
 gb|KGN64941.1| hypothetical protein Csa_1G165730 [Cucumis sativus]
Length=178

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 58/116 (50%), Gaps = 13/116 (11%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
            +  K  ++CLDC   ++     SG  + VKC   KN+ +A T+ DGSFET++    +   
Sbjct  27   NTLKAKISCLDCQSNYD----FSGNLIMVKCERAKNLTIAITKADGSFETSLPSNMASEA  82

Query  305  ssvvsc-sAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYT  469
            +       AK+LG + QL+   K   S ++      +  +S+ + + T+  L+F T
Sbjct  83   APSSPKCIAKLLGGSHQLFASRKEMVSTII------KETNSKFFTIATA--LKFST  130



>ref|NP_568418.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
 gb|AAK44030.1|AF370215_1 unknown protein [Arabidopsis thaliana]
 dbj|BAB08342.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL15213.1| unknown protein [Arabidopsis thaliana]
 gb|AED93025.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
Length=172

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 53/114 (46%), Gaps = 14/114 (12%)
 Frame = +2

Query  137  GSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpsskspssvv  316
            G ++CLDC    +     SG+KV +KC GEK    A    DGSF +      +      +
Sbjct  31   GKISCLDCHRDFD----FSGIKVLLKCDGEKKQITAVAAADGSFRSV---LPTADKKGSI  83

Query  317  scsAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTKYP  478
            +C AK+LG   QLY       S++V      +S H    ++TTS PL F    P
Sbjct  84   NCLAKLLGGPEQLYAHKHNLVSELV------KSKHDSK-VLTTSNPLAFSLSCP  130



>ref|XP_006288782.1| hypothetical protein CARUB_v10002103mg [Capsella rubella]
 gb|EOA21680.1| hypothetical protein CARUB_v10002103mg [Capsella rubella]
Length=172

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 53/114 (46%), Gaps = 14/114 (12%)
 Frame = +2

Query  137  GSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpsskspssvv  316
            G V+CLDC    +     SG+KV +KC GEK    A    DGSF +      +      +
Sbjct  31   GKVSCLDCHRDFD----FSGIKVLLKCDGEKKQITAMAASDGSFRSV---LPAADKKGSM  83

Query  317  scsAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTKYP  478
            +C AK+LG   QLY       S++V+      S H    ++TTS PL F    P
Sbjct  84   NCLAKLLGGPDQLYAHKHDLFSELVM------SKHDSK-VLTTSNPLAFSLSCP  130



>ref|XP_003581209.1| PREDICTED: uncharacterized protein LOC100827343 [Brachypodium 
distachyon]
Length=224

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 54/120 (45%), Gaps = 20/120 (17%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
               +G+V CLDC    N    LSGV V+VKC     +  A T+  G FE       +   
Sbjct  29   DTLRGTVACLDCAQQRN----LSGVVVAVKCANGTGVRAAETDGQGRFEVA---VPASRS  81

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRATAGESDHSR----HYIMTTSEPLRFYTK  472
                 C+A+ILG   QL  P +   S+VVV        H+R     Y +T+  PL  +T+
Sbjct  82   KPGSPCAARILGGPEQLCAPPRFAASRVVVA-------HARPGGGSYALTS--PLGVFTQ  132



>ref|XP_008461260.1| PREDICTED: uncharacterized protein LOC103499896 [Cucumis melo]
Length=184

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 61/127 (48%), Gaps = 17/127 (13%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
            +  K  ++CLDC   ++     SG  + VKC   KN+ +A T+ DGSFET +    +   
Sbjct  29   NTLKAKISCLDCQSNYD----FSGNLIMVKCERVKNLTIAITKADGSFETPLPSDMASVD  84

Query  305  ssvvsc----sAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYT-  469
            S          AK++G + QL+   K   S ++      +  +S+ + + T+  LRF T 
Sbjct  85   SEAAPPPPKCIAKLVGGSHQLFASRKELVSTII------KETNSKFFTIATA--LRFSTC  136

Query  470  KYPNAKC  490
            K  N KC
Sbjct  137  KEINRKC  143



>gb|KJB54178.1| hypothetical protein B456_009G084200 [Gossypium raimondii]
Length=170

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 54/118 (46%), Gaps = 21/118 (18%)
 Frame = +2

Query  131  FKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpsskspss  310
                ++C DC H ++          SVKC   K +A ATTEE+GSF+         S  S
Sbjct  29   LNAKISCFDCPHNYDF---------SVKCEKVKKLATATTEENGSFKV-----QLPSGIS  74

Query  311  vvscsAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTKYPNA  484
              +C AK+LG   QLY   K   SKVV     G   ++     T S PL F T  P+A
Sbjct  75   NTNCLAKLLGGPNQLYSKKKNLVSKVV---KVGHQPNT----YTLSTPLAFSTSCPSA  125



>emb|CDY35685.1| BnaC02g09510D [Brassica napus]
Length=171

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 54/117 (46%), Gaps = 14/117 (12%)
 Frame = +2

Query  128  VFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksps  307
            +F G V+CLDC    +     SGVKV +KC GEK         DGSF +      +    
Sbjct  27   LFHGKVSCLDCHRGFD----FSGVKVLLKCEGEKKHITTMATSDGSFRSV---LPTNDRK  79

Query  308  svvscsAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTKYP  478
              ++C AK+LG   QLY       S++V      +S H    ++TTS PL F    P
Sbjct  80   HSMNCLAKLLGGPEQLYAHKHNMVSELV------KSKHDTK-VLTTSNPLSFSLSCP  129



>ref|XP_009126543.1| PREDICTED: uncharacterized protein LOC103851442 [Brassica rapa]
Length=172

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 53/114 (46%), Gaps = 14/114 (12%)
 Frame = +2

Query  137  GSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpsskspssvv  316
            G V+CLDC +  +     SGVKV +KC GEK         DGSF +      +      +
Sbjct  31   GKVSCLDCHNDFD----FSGVKVLLKCEGEKKTITTMATSDGSFRSV---LLTADKKRSM  83

Query  317  scsAKILGATRQLYIPMKACESKVVVRATAGESDHSRHYIMTTSEPLRFYTKYP  478
            +C AK+LG   QLY       S++V      +S H    ++TTS PL F    P
Sbjct  84   NCLAKLLGGPEQLYAHKHNMVSELV------KSKHDTK-VLTTSNPLSFSLSCP  130



>ref|XP_002872002.1| hypothetical protein ARALYDRAFT_351266 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48261.1| hypothetical protein ARALYDRAFT_351266 [Arabidopsis lyrata subsp. 
lyrata]
Length=172

 Score = 47.0 bits (110),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 52/116 (45%), Gaps = 18/116 (16%)
 Frame = +2

Query  137  GSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpsskspssvv  316
            G ++CLDC    +     SG+KV +KC GEK    A    DGSF +      +       
Sbjct  31   GKISCLDCHRDFD----FSGIKVLLKCDGEKKQITAMAASDGSFRSV---LPTADKKGSE  83

Query  317  scsAKILGATRQLYIPMKACESKVVVRATAGESDHSRH--YIMTTSEPLRFYTKYP  478
            +C AK+LG   QLY       S++V         +S+H   ++T S PL F    P
Sbjct  84   NCLAKLLGGPEQLYAHKHNLVSELV---------NSKHDSKVLTISNPLAFSLSCP  130



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564814758300