BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001G07

Length=484
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009786071.1|  PREDICTED: aquaporin PIP2-7-like                   234   1e-73   Nicotiana sylvestris
ref|XP_009615789.1|  PREDICTED: aquaporin PIP2-7-like                   233   3e-73   Nicotiana tomentosiformis
tpg|DAA64677.1|  TPA: aquaporin PIP2 4a                                 233   4e-73   Nicotiana tabacum [American tobacco]
gb|AFQ23186.1|  aquaporin PIP2;1                                        232   7e-73   Eustoma exaltatum subsp. russellianum [bluebells]
ref|NP_001275065.1|  major intrinsic protein 2                          231   1e-72   Solanum tuberosum [potatoes]
gb|AAB18227.1|  MipC                                                    230   4e-72   Mesembryanthemum crystallinum
ref|NP_001289846.1|  probable aquaporin PIP2-1                          228   3e-71   
ref|XP_009780213.1|  PREDICTED: aquaporin PIP2-4-like                   228   4e-71   Nicotiana sylvestris
ref|XP_009595123.1|  PREDICTED: aquaporin PIP2-4-like                   226   2e-70   Nicotiana tomentosiformis
ref|XP_006357563.1|  PREDICTED: probable aquaporin PIP2-1-like          225   5e-70   Solanum tuberosum [potatoes]
gb|ABB13430.2|  plasma membrane intrinsic protein                       224   6e-70   Olea europaea
gb|KCW51391.1|  hypothetical protein EUGRSUZ_J00930                     221   2e-69   Eucalyptus grandis [rose gum]
ref|XP_010521765.1|  PREDICTED: aquaporin PIP2-7-like                   220   3e-68   Tarenaya hassleriana [spider flower]
gb|AFK47400.1|  unknown                                                 220   4e-68   Lotus japonicus
emb|CDP07111.1|  unnamed protein product                                219   8e-68   Coffea canephora [robusta coffee]
gb|ACU23034.1|  unknown                                                 214   8e-68   Glycine max [soybeans]
ref|XP_010031998.1|  PREDICTED: aquaporin PIP2-7-like                   219   8e-68   Eucalyptus grandis [rose gum]
gb|KDO73275.1|  hypothetical protein CISIN_1g022966mg                   218   1e-67   Citrus sinensis [apfelsine]
ref|XP_006424577.1|  hypothetical protein CICLE_v10028975mg             218   1e-67   
ref|XP_004953172.1|  PREDICTED: aquaporin PIP2-4-like                   218   2e-67   Setaria italica
ref|XP_003575410.1|  PREDICTED: aquaporin PIP2-4                        218   2e-67   Brachypodium distachyon [annual false brome]
ref|NP_001105026.1|  aquaporin PIP2-4                                   218   3e-67   Zea mays [maize]
ref|XP_006424576.1|  hypothetical protein CICLE_v10028975mg             218   3e-67   Citrus clementina [clementine]
gb|KJB62460.1|  hypothetical protein B456_009G418100                    215   3e-67   Gossypium raimondii
ref|XP_002877918.1|  hypothetical protein ARALYDRAFT_485715             217   4e-67   
gb|KJB56129.1|  hypothetical protein B456_009G107200                    215   4e-67   Gossypium raimondii
ref|XP_006291609.1|  hypothetical protein CARUB_v10017763mg             217   5e-67   Capsella rubella
gb|KJB16797.1|  hypothetical protein B456_002G2484002                   212   5e-67   Gossypium raimondii
gb|ACG33001.1|  aquaporin PIP2.2                                        216   8e-67   Zea mays [maize]
ref|NP_001105025.1|  aquaporin PIP2-3                                   216   8e-67   Zea mays [maize]
ref|XP_004505993.1|  PREDICTED: aquaporin PIP2-7-like                   216   1e-66   Cicer arietinum [garbanzo]
gb|AAC17529.1|  aquaporin 2                                             216   1e-66   Samanea saman [cow-tamarind]
gb|KHG00060.1|  putative aquaporin PIP2-2                               216   1e-66   Gossypium arboreum [tree cotton]
ref|XP_010426989.1|  PREDICTED: aquaporin PIP2-1                        216   1e-66   Camelina sativa [gold-of-pleasure]
gb|AIA83106.1|  putative aquaporin PIP2                                 216   2e-66   Citrus trifoliata [hardy orange]
gb|AFH36337.1|  aquaporin PIP2;2                                        215   2e-66   Quercus petraea [durmast oak]
gb|AEH76326.1|  plasma membrane intrinsic protein 2A                    215   2e-66   Camelina sativa [gold-of-pleasure]
gb|KJB56128.1|  hypothetical protein B456_009G107200                    215   2e-66   Gossypium raimondii
dbj|BAE02729.1|  PIP aquaporin                                          215   3e-66   Hordeum vulgare [barley]
ref|XP_002452483.1|  hypothetical protein SORBIDRAFT_04g026650          215   3e-66   Sorghum bicolor [broomcorn]
gb|KJB36606.1|  hypothetical protein B456_006G166800                    212   3e-66   Gossypium raimondii
gb|AAF61464.1|AF139815_1  plasma membrane intrinsic protein 2           214   4e-66   Triticum aestivum [Canadian hard winter wheat]
ref|NP_190910.1|  aquaporin PIP2-1                                      215   4e-66   Arabidopsis thaliana [mouse-ear cress]
gb|AEO13898.1|  aquaporin 7                                             215   4e-66   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006403691.1|  hypothetical protein EUTSA_v10010598mg             214   4e-66   Eutrema salsugineum [saltwater cress]
gb|ADK25057.1|  plasma membrane intrinsic protein                       214   4e-66   Glycine max [soybeans]
ref|NP_001240223.1|  prolactin-inducible protein                        214   4e-66   Glycine max [soybeans]
gb|KJB11821.1|  hypothetical protein B456_002G2484001                   214   4e-66   Gossypium raimondii
gb|KJB62459.1|  hypothetical protein B456_009G418100                    214   4e-66   Gossypium raimondii
ref|XP_010253676.1|  PREDICTED: aquaporin PIP2-4-like                   214   4e-66   Nelumbo nucifera [Indian lotus]
ref|XP_003606384.1|  Aquaporin PIP2-7                                   212   4e-66   
ref|XP_007143702.1|  hypothetical protein PHAVU_007G094600g             214   4e-66   Phaseolus vulgaris [French bean]
gb|ABK60195.2|  PIP2 protein                                            214   5e-66   Gossypium hirsutum [American cotton]
gb|KHG29841.1|  putative aquaporin PIP2-2                               214   5e-66   Gossypium arboreum [tree cotton]
ref|XP_008785285.1|  PREDICTED: aquaporin PIP2-4                        214   6e-66   Phoenix dactylifera
gb|AAB67868.1|  plasma membrane major intrinsic protein 1               214   6e-66   Beta vulgaris [beet]
ref|XP_010504105.1|  PREDICTED: aquaporin PIP2-1-like                   214   6e-66   Camelina sativa [gold-of-pleasure]
gb|ABK60196.1|  PIP2 protein                                            214   6e-66   Gossypium hirsutum [American cotton]
gb|AHG32324.1|  PIP2-3                                                  214   7e-66   Pisum sativum [garden pea]
ref|XP_002530280.1|  Aquaporin PIP2.1, putative                         214   7e-66   Ricinus communis
ref|XP_010920406.1|  PREDICTED: aquaporin PIP2-4 isoform X2             213   7e-66   Elaeis guineensis
gb|AEC45513.1|  plasma membrane intrinsic protein                       214   7e-66   Hevea brasiliensis [jebe]
gb|AGD98714.1|  aquaporin protein 11                                    214   8e-66   Camellia sinensis [black tea]
ref|XP_008791535.1|  PREDICTED: aquaporin PIP2-4-like                   214   8e-66   Phoenix dactylifera
ref|NP_001047491.1|  Os02g0629200                                       214   9e-66   
gb|EAY86778.1|  hypothetical protein OsI_08158                          214   9e-66   Oryza sativa Indica Group [Indian rice]
gb|AFK35635.1|  unknown                                                 209   9e-66   Medicago truncatula
gb|EMT09900.1|  Putative aquaporin PIP2-2                               214   9e-66   
ref|XP_003536353.1|  PREDICTED: aquaporin PIP2-1-like isoform 1         214   1e-65   
ref|XP_009628968.1|  PREDICTED: probable aquaporin PIP2-1               214   1e-65   Nicotiana tomentosiformis
ref|NP_001234625.1|  aquaporin                                          213   1e-65   Solanum lycopersicum
dbj|BAA23744.1|  HvPIP2;1                                               213   1e-65   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAB45651.1|  putative plasma membrane intrinsic protein             213   1e-65   Pisum sativum [garden pea]
ref|XP_009794928.1|  PREDICTED: LOW QUALITY PROTEIN: probable aqu...    213   2e-65   Nicotiana sylvestris
gb|KHN05685.1|  Aquaporin PIP2-7                                        213   2e-65   Glycine soja [wild soybean]
gb|AAO39007.1|  plasma intrinsic protein 2,1                            213   2e-65   Juglans regia
gb|AAO39008.1|  plasma intrinsic protein 2,2                            213   2e-65   Juglans regia
emb|CDY56697.1|  BnaCnng31040D                                          213   2e-65   Brassica napus [oilseed rape]
ref|NP_181254.1|  aquaporin PIP2-2                                      213   2e-65   Arabidopsis thaliana [mouse-ear cress]
emb|CAA53478.1|  plasma membrane intrinsic protein 2b                   213   2e-65   Arabidopsis thaliana [mouse-ear cress]
gb|KHN38765.1|  Aquaporin PIP2-7                                        213   2e-65   Glycine soja [wild soybean]
gb|ACU00104.1|  plasma membrane intrinsic protein PIP2.2                213   3e-65   Populus trichocarpa x Populus deltoides
ref|XP_010920407.1|  PREDICTED: probable aquaporin PIP2-2               213   3e-65   Elaeis guineensis
ref|XP_003538174.1|  PREDICTED: aquaporin PIP2-7                        213   3e-65   Glycine max [soybeans]
ref|XP_010934344.1|  PREDICTED: aquaporin PIP2-4-like                   213   3e-65   Elaeis guineensis
tpg|DAA33865.1|  TPA: aquaporin PIP2;10                                 212   3e-65   Gossypium hirsutum [American cotton]
gb|KHG30776.1|  Aquaporin PIP2-2 -like protein                          212   4e-65   Gossypium arboreum [tree cotton]
ref|XP_002519539.1|  Aquaporin PIP2.2, putative                         212   4e-65   Ricinus communis
ref|XP_002322877.1|  major intrinsic protein 1                          212   4e-65   Populus trichocarpa [western balsam poplar]
ref|NP_001289999.1|  aquaporin PIP2-1                                   212   5e-65   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU42155.1|  hypothetical protein MIMGU_mgv1a011301mg                212   5e-65   Erythranthe guttata [common monkey flower]
gb|KDP44053.1|  hypothetical protein JCGZ_05520                         212   5e-65   Jatropha curcas
ref|XP_010920405.1|  PREDICTED: aquaporin PIP2-4 isoform X1             212   5e-65   Elaeis guineensis
ref|NP_001240039.1|  uncharacterized protein LOC100782155               211   6e-65   Glycine max [soybeans]
dbj|BAA32778.1|  Plasma membrane aquaporin (PAQ2)                       212   6e-65   Raphanus sativus
gb|KHG10662.1|  Aquaporin PIP2-1 -like protein                          211   7e-65   Gossypium arboreum [tree cotton]
ref|XP_009116034.1|  PREDICTED: aquaporin PIP2-1                        211   7e-65   Brassica rapa
gb|KHN00691.1|  Aquaporin PIP2-2                                        211   7e-65   Glycine soja [wild soybean]
ref|NP_001235204.1|  Pip1 protein                                       211   7e-65   
emb|CDX74983.1|  BnaA05g07290D                                          208   8e-65   
gb|AFK47442.1|  unknown                                                 211   9e-65   Medicago truncatula
ref|XP_003606383.1|  Aquaporin PIP2-7                                   211   9e-65   Medicago truncatula
gb|KDP44363.1|  hypothetical protein JCGZ_20043                         211   1e-64   Jatropha curcas
ref|XP_007151871.1|  hypothetical protein PHAVU_004G082600g             211   1e-64   Phaseolus vulgaris [French bean]
ref|XP_006294744.1|  hypothetical protein CARUB_v10023789mg             211   1e-64   Capsella rubella
ref|XP_011015478.1|  PREDICTED: aquaporin PIP2-2-like                   211   1e-64   Populus euphratica
ref|NP_181255.1|  aquaporin PIP2-3                                      211   1e-64   Arabidopsis thaliana [mouse-ear cress]
gb|ABU94631.1|  putative aquaporin PIP2;3                               211   1e-64   Phaseolus vulgaris [French bean]
gb|KJB20285.1|  hypothetical protein B456_003G141600                    212   1e-64   Gossypium raimondii
ref|XP_003518297.1|  PREDICTED: aquaporin PIP2-2-like                   211   1e-64   Glycine max [soybeans]
ref|XP_010264685.1|  PREDICTED: aquaporin PIP2-1-like                   211   2e-64   Nelumbo nucifera [Indian lotus]
ref|XP_007151872.1|  hypothetical protein PHAVU_004G082700g             211   2e-64   Phaseolus vulgaris [French bean]
gb|AIG92831.1|  aquaporin PIP2                                          211   2e-64   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|EYU36189.1|  hypothetical protein MIMGU_mgv1a011437mg                210   2e-64   Erythranthe guttata [common monkey flower]
ref|XP_003548071.1|  PREDICTED: aquaporin PIP2-2-like                   211   2e-64   Glycine max [soybeans]
gb|AIA83104.1|  putative aquaporin PIP2                                 211   2e-64   Citrus sinensis x Citrus trifoliata [Carrizo citrange]
ref|XP_010516975.1|  PREDICTED: aquaporin PIP2-2-like                   210   3e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010505293.1|  PREDICTED: aquaporin PIP2-2                        210   3e-64   Camelina sativa [gold-of-pleasure]
emb|CDY13298.1|  BnaC06g14590D                                          210   3e-64   Brassica napus [oilseed rape]
gb|AHB33479.1|  plasma intrinsic protein 2-3                            209   4e-64   Cucumis sativus [cucumbers]
ref|NP_001105639.1|  aquaporin PIP2-7                                   209   4e-64   
ref|XP_003540176.1|  PREDICTED: aquaporin PIP2-7                        209   4e-64   
gb|ACU20229.1|  unknown                                                 209   4e-64   Glycine max [soybeans]
ref|NP_001237286.1|  PIP2,2                                             209   4e-64   
gb|ACU19125.1|  unknown                                                 209   4e-64   Glycine max [soybeans]
gb|KCW49751.1|  hypothetical protein EUGRSUZ_K03244                     209   4e-64   Eucalyptus grandis [rose gum]
ref|XP_002881493.1|  hypothetical protein ARALYDRAFT_482707             209   5e-64   Arabidopsis lyrata subsp. lyrata
ref|XP_004976254.1|  PREDICTED: aquaporin PIP2-5-like                   209   5e-64   Setaria italica
gb|ACJ85173.1|  unknown                                                 209   7e-64   Medicago truncatula
ref|XP_004156296.1|  PREDICTED: aquaporin PIP2-2-like                   209   7e-64   
ref|XP_006381453.1|  hypothetical protein POPTR_0006s12980g             209   8e-64   Populus trichocarpa [western balsam poplar]
gb|AIK66515.1|  putative aquaporin                                      209   8e-64   Vitis vinifera
gb|KHG06004.1|  Aquaporin PIP2-2 -like protein                          209   8e-64   Gossypium arboreum [tree cotton]
ref|XP_008791536.1|  PREDICTED: aquaporin PIP2-4-like                   209   8e-64   Phoenix dactylifera
ref|XP_010529747.1|  PREDICTED: aquaporin PIP2-2-like                   209   9e-64   Tarenaya hassleriana [spider flower]
gb|ABH09326.1|  putative aquaporin                                      209   9e-64   Vitis vinifera
ref|XP_011048549.1|  PREDICTED: aquaporin PIP2-1-like                   209   9e-64   Populus euphratica
ref|NP_001267922.1|  aquaporin-like                                     209   9e-64   Vitis vinifera
emb|CAN75442.1|  hypothetical protein VITISV_019657                     208   1e-63   Vitis vinifera
gb|AAV69744.1|  aquaporin                                               208   1e-63   Vitis vinifera
ref|XP_006410896.1|  hypothetical protein EUTSA_v10017874mg             208   1e-63   Eutrema salsugineum [saltwater cress]
ref|XP_008449253.1|  PREDICTED: aquaporin PIP2-2-like isoform X3        208   1e-63   Cucumis melo [Oriental melon]
gb|AAF71816.1|AF141642_1  putative aquaporin PIP2-1                     208   1e-63   Vitis cinerea var. helleri x Vitis rupestris
gb|ACX37450.1|  plasma membrane intrinsic protein                       208   1e-63   Hevea brasiliensis [jebe]
gb|AAM61438.1|  aquaporin (plasma membrane intrinsic protein 2C)        208   1e-63   Arabidopsis thaliana [mouse-ear cress]
gb|ABC69040.1|  aquaporin PIP2-1                                        208   1e-63   Rhododendron catawbiense [Catawba rosebay]
ref|XP_010037961.1|  PREDICTED: probable aquaporin PIP2-2               208   2e-63   Eucalyptus grandis [rose gum]
gb|KDP29110.1|  hypothetical protein JCGZ_16499                         207   2e-63   Jatropha curcas
emb|CDP06739.1|  unnamed protein product                                208   2e-63   Coffea canephora [robusta coffee]
ref|XP_006410897.1|  hypothetical protein EUTSA_v10017041mg             207   2e-63   Eutrema salsugineum [saltwater cress]
ref|XP_008365039.1|  PREDICTED: probable aquaporin PIP2-5               207   2e-63   
ref|XP_004304427.1|  PREDICTED: aquaporin PIP2-1-like                   207   2e-63   Fragaria vesca subsp. vesca
dbj|BAB40143.1|  plasma membrane intrinsic protein 2-2                  207   2e-63   Pyrus communis
gb|AHW81492.1|  ECFP-tagged plasma membrane intrinsic protein 2a        214   2e-63   Cloning vector pBullet-pm-n
ref|XP_011048552.1|  PREDICTED: aquaporin PIP2-2-like                   207   2e-63   Populus euphratica
ref|XP_004496281.1|  PREDICTED: aquaporin PIP2-1-like                   207   2e-63   Cicer arietinum [garbanzo]
emb|CAB46351.1|  major intrinsic protein 2                              207   3e-63   Solanum tuberosum [potatoes]
ref|XP_009345382.1|  PREDICTED: probable aquaporin PIP2-5               207   3e-63   Pyrus x bretschneideri [bai li]
emb|CAH60724.1|  putative plasma membrane intrinsic protein             207   3e-63   Populus tremula x Populus tremuloides
gb|AFH36338.1|  aquaporin PIP2;3                                        207   3e-63   Quercus petraea [durmast oak]
ref|XP_010509371.1|  PREDICTED: aquaporin PIP2-2-like                   207   3e-63   Camelina sativa [gold-of-pleasure]
ref|XP_010516976.1|  PREDICTED: aquaporin PIP2-2-like                   207   3e-63   Camelina sativa [gold-of-pleasure]
ref|XP_006381455.1|  hypothetical protein POPTR_0006s13000g             207   3e-63   Populus trichocarpa [western balsam poplar]
ref|XP_007016740.1|  Plasma membrane intrinsic protein 2,4              207   4e-63   
ref|XP_004143245.1|  PREDICTED: aquaporin PIP2-2-like                   207   4e-63   
gb|ACU21481.1|  unknown                                                 207   4e-63   Glycine max [soybeans]
ref|XP_009143524.1|  PREDICTED: aquaporin PIP2-2                        207   4e-63   Brassica rapa
emb|CDX91341.1|  BnaC04g08090D                                          207   4e-63   
gb|AHK05706.1|  plasma membrane intrinsic protein PIP2;3                207   5e-63   Hevea brasiliensis [jebe]
gb|EMS56715.1|  putative aquaporin PIP2-2                               208   5e-63   Triticum urartu
gb|KHG08488.1|  putative aquaporin PIP2-2                               206   6e-63   Gossypium arboreum [tree cotton]
gb|AGG39693.1|  aquaporin protein AQU15                                 206   8e-63   Camellia sinensis [black tea]
ref|XP_007027328.1|  Plasma membrane intrinsic protein 2                206   8e-63   Theobroma cacao [chocolate]
ref|XP_002446796.1|  hypothetical protein SORBIDRAFT_06g022840          206   8e-63   Sorghum bicolor [broomcorn]
ref|XP_009133124.1|  PREDICTED: aquaporin PIP2-2-like                   206   8e-63   Brassica rapa
dbj|BAD90699.1|  plasma membrane intrinsic protein 2;3                  206   9e-63   Mimosa pudica [sensitive-plant]
gb|AGD98708.1|  aquaporin protein 5                                     206   9e-63   Camellia sinensis [black tea]
gb|KJB21561.1|  hypothetical protein B456_004G001400                    206   9e-63   Gossypium raimondii
ref|XP_010043748.1|  PREDICTED: probable aquaporin PIP2-4               206   1e-62   Eucalyptus grandis [rose gum]
gb|ACU00103.1|  plasma membrane intrinsic protein PIP2.1                206   1e-62   Populus trichocarpa x Populus deltoides
ref|XP_010505294.1|  PREDICTED: aquaporin PIP2-2-like                   206   1e-62   Camelina sativa [gold-of-pleasure]
ref|XP_003556232.1|  PREDICTED: aquaporin PIP2-1-like                   206   1e-62   Glycine max [soybeans]
dbj|BAE06148.1|  PIP aquaporin isoform                                  206   1e-62   Hordeum vulgare [barley]
gb|AGD98707.1|  aquaporin protein 4                                     206   1e-62   Camellia sinensis [black tea]
gb|AAD31846.1|AF133530_1  water channel protein MipH                    206   1e-62   Mesembryanthemum crystallinum
dbj|BAA92261.1|  Plasma membrane aquaporin 2c                           205   2e-62   Raphanus sativus
ref|XP_009381972.1|  PREDICTED: probable aquaporin PIP2-2               205   2e-62   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAF33069.1|  aquaporin                                              205   2e-62   Hordeum vulgare [barley]
gb|ADJ67992.1|  aquaporin                                               205   2e-62   Fragaria x ananassa
gb|ABB88840.1|  aquaporin                                               205   2e-62   Stevia rebaudiana
gb|ACZ06859.1|  plasma membrane intrinsic protein                       205   2e-62   Glycine soja [wild soybean]
ref|XP_009133125.1|  PREDICTED: aquaporin PIP2-2-like                   205   3e-62   Brassica rapa
ref|NP_001268056.1|  aquaporin PIP2                                     205   3e-62   Vitis vinifera
ref|XP_009614931.1|  PREDICTED: aquaporin PIP2-1-like                   205   3e-62   Nicotiana tomentosiformis
ref|NP_001105616.1|  aquaporin PIP2-5                                   205   3e-62   Zea mays [maize]
ref|XP_007218772.1|  hypothetical protein PRUPE_ppa009540mg             204   3e-62   Prunus persica
ref|XP_008233329.1|  PREDICTED: probable aquaporin PIP2-5               204   3e-62   Prunus mume [ume]
ref|XP_011041003.1|  PREDICTED: probable aquaporin PIP2-5               204   4e-62   Populus euphratica
gb|AHA84284.1|  prolactin-inducible protein                             204   4e-62   Phaseolus vulgaris [French bean]
ref|XP_002316367.1|  putative aquaporin family protein                  204   4e-62   Populus trichocarpa [western balsam poplar]
ref|XP_007132257.1|  hypothetical protein PHAVU_011G079300g             204   4e-62   Phaseolus vulgaris [French bean]
ref|XP_009792249.1|  PREDICTED: aquaporin PIP2-1-like                   204   4e-62   Nicotiana sylvestris
emb|CDX91340.1|  BnaC04g08100D                                          204   4e-62   
dbj|BAB40141.1|  plasma membrane intrinsic protein 2-1                  204   4e-62   Pyrus communis
ref|XP_004304428.1|  PREDICTED: aquaporin PIP2-1-like                   204   4e-62   Fragaria vesca subsp. vesca
gb|ABI96813.1|  plasma membrane intrinsic protein                       204   4e-62   Triticum aestivum [Canadian hard winter wheat]
gb|AFB83068.1|  plasma intrinsic protein PIP2.2                         204   4e-62   Helianthemum almeriense
gb|AAY22203.1|  putative aquaporin                                      204   5e-62   Phaseolus vulgaris [French bean]
ref|XP_009335091.1|  PREDICTED: probable aquaporin PIP2-2               204   5e-62   Pyrus x bretschneideri [bai li]
ref|XP_006400824.1|  hypothetical protein EUTSA_v10014299mg             204   5e-62   Eutrema salsugineum [saltwater cress]
ref|XP_009398603.1|  PREDICTED: probable aquaporin PIP2-2               204   5e-62   Musa acuminata subsp. malaccensis [pisang utan]
gb|AEY75242.1|  plasma membrane intrinsic protein                       204   5e-62   Malus hupehensis
dbj|BAA92260.1|  Plasma membrane aquaporin 2b                           204   6e-62   Raphanus sativus
ref|XP_004304426.1|  PREDICTED: aquaporin PIP2-1-like                   204   7e-62   Fragaria vesca subsp. vesca
ref|XP_009624885.1|  PREDICTED: aquaporin PIP2-1-like                   204   8e-62   Nicotiana tomentosiformis
gb|KEH39328.1|  major intrinsic protein (MIP) family transporter        203   8e-62   Medicago truncatula
ref|XP_010483715.1|  PREDICTED: probable aquaporin PIP2-4               204   9e-62   Camelina sativa [gold-of-pleasure]
gb|ABN11917.1|  aquaporin                                               203   9e-62   Cucurbita ficifolia [chilacayote]
ref|NP_001280185.1|  aquaporin PIP2-2                                   203   9e-62   Prunus mume [ume]
emb|CDX67611.1|  BnaA07g16510D                                          203   9e-62   
gb|ACU24483.1|  unknown                                                 203   9e-62   Glycine max [soybeans]
gb|AGC24024.1|  plasma membrane intrinsic protein 1                     203   1e-61   Lilium hybrid cultivar
ref|XP_010689549.1|  PREDICTED: aquaporin PIP2-1-like                   203   1e-61   Beta vulgaris subsp. vulgaris [field beet]
gb|ABO69705.2|  aquaporin PIP2                                          203   1e-61   Prunus humilis
emb|CDX74984.1|  BnaA05g07300D                                          204   1e-61   
ref|NP_001274397.1|  aquaporin PIP2-1-like                              203   1e-61   Cucumis sativus [cucumbers]
ref|XP_002532756.1|  Aquaporin PIP2.1, putative                         203   2e-61   Ricinus communis
gb|KFK34721.1|  hypothetical protein AALP_AA5G183600                    203   2e-61   Arabis alpina [alpine rockcress]
ref|XP_006296058.1|  hypothetical protein CARUB_v10025207mg             203   2e-61   Capsella rubella
ref|XP_003597235.1|  Aquaporin PIP2-7                                   203   2e-61   Medicago truncatula
ref|XP_011031744.1|  PREDICTED: probable aquaporin PIP2-5               203   2e-61   Populus euphratica
ref|XP_003625627.1|  Aquaporin PIP2-1                                   203   2e-61   Medicago truncatula
ref|XP_008449255.1|  PREDICTED: aquaporin PIP2-2-like                   203   2e-61   Cucumis melo [Oriental melon]
ref|XP_009387242.1|  PREDICTED: aquaporin PIP2-5                        203   2e-61   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFK33316.1|  unknown                                                 203   2e-61   Medicago truncatula
ref|XP_009131906.1|  PREDICTED: probable aquaporin PIP2-4               202   2e-61   Brassica rapa
ref|XP_008385311.1|  PREDICTED: probable aquaporin PIP2-2               202   2e-61   
ref|XP_009126591.1|  PREDICTED: probable aquaporin PIP2-4               202   2e-61   Brassica rapa
tpg|DAA64674.1|  TPA: aquaporin PIP2 2                                  202   2e-61   Nicotiana tabacum [American tobacco]
gb|EYU39575.1|  hypothetical protein MIMGU_mgv1a011441mg                202   2e-61   Erythranthe guttata [common monkey flower]
gb|ACJ85211.1|  unknown                                                 201   2e-61   Medicago truncatula
ref|XP_007150204.1|  hypothetical protein PHAVU_005G135300g             202   2e-61   Phaseolus vulgaris [French bean]
ref|XP_009760326.1|  PREDICTED: aquaporin PIP2-1-like                   202   2e-61   Nicotiana sylvestris
tpg|DAA64673.1|  TPA: aquaporin PIP2 1                                  202   3e-61   Nicotiana tabacum [American tobacco]
gb|AHA84128.1|  plasma membrane integral protein ZmPIP2-7               202   3e-61   Phaseolus vulgaris [French bean]
ref|XP_010098191.1|  Aquaporin PIP2-7                                   202   3e-61   Morus notabilis
emb|CDX10333.1|  aquaporin                                              202   3e-61   Coffea arabica [arabica coffee]
ref|XP_004956113.1|  PREDICTED: aquaporin PIP2-1-like                   202   3e-61   Setaria italica
ref|XP_006403531.1|  hypothetical protein EUTSA_v10010603mg             202   3e-61   Eutrema salsugineum [saltwater cress]
emb|CDY07519.1|  BnaC06g15450D                                          202   3e-61   Brassica napus [oilseed rape]
ref|XP_009619670.1|  PREDICTED: aquaporin PIP2-1-like                   202   4e-61   Nicotiana tomentosiformis
gb|ABK93567.1|  unknown                                                 202   4e-61   Populus trichocarpa [western balsam poplar]
gb|ACR56613.1|  plasma intrinsic protein 2;3                            202   4e-61   Juglans regia
ref|XP_004956115.1|  PREDICTED: aquaporin PIP2-6-like                   202   4e-61   Setaria italica
gb|AEQ20672.1|  PIP2;1                                                  201   5e-61   Karelinia caspia
ref|XP_004956116.1|  PREDICTED: aquaporin PIP2-6-like                   201   5e-61   Setaria italica
gb|ABI96814.1|  plasma membrane intrinsic protein                       201   6e-61   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002311092.1|  plasma membrane intrinsic protein 1-1              201   6e-61   Populus trichocarpa [western balsam poplar]
ref|XP_004291577.1|  PREDICTED: aquaporin PIP2-2                        201   6e-61   Fragaria vesca subsp. vesca
ref|XP_002313510.1|  hypothetical protein POPTR_0009s01940g             201   6e-61   Populus trichocarpa [western balsam poplar]
gb|AAL32127.1|  aquaporin                                               201   7e-61   Medicago truncatula
ref|XP_010443868.1|  PREDICTED: probable aquaporin PIP2-4               201   9e-61   Camelina sativa [gold-of-pleasure]
ref|XP_009345759.1|  PREDICTED: probable aquaporin PIP2-5               201   9e-61   Pyrus x bretschneideri [bai li]
ref|XP_004487111.1|  PREDICTED: aquaporin PIP2-7-like                   201   9e-61   Cicer arietinum [garbanzo]
ref|XP_006846771.1|  hypothetical protein AMTR_s00148p00023270          201   1e-60   Amborella trichopoda
ref|XP_006280883.1|  hypothetical protein CARUB_v10026881mg             201   1e-60   
ref|XP_003563177.1|  PREDICTED: probable aquaporin PIP2-1               201   1e-60   Brachypodium distachyon [annual false brome]
ref|XP_010043747.1|  PREDICTED: probable aquaporin PIP2-5               201   1e-60   Eucalyptus grandis [rose gum]
ref|XP_009120600.1|  PREDICTED: LOW QUALITY PROTEIN: probable aqu...    201   1e-60   Brassica rapa
ref|XP_011044357.1|  PREDICTED: probable aquaporin PIP2-4               200   1e-60   Populus euphratica
ref|XP_010456647.1|  PREDICTED: probable aquaporin PIP2-4               200   1e-60   Camelina sativa [gold-of-pleasure]
gb|ACM50914.1|  aquaporin                                               201   1e-60   Medicago falcata [sickle alfalfa]
ref|XP_009413716.1|  PREDICTED: probable aquaporin PIP2-3 isoform X2    200   2e-60   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX73446.1|  BnaC08g25570D                                          200   2e-60   
emb|CDY46759.1|  BnaA03g17030D                                          200   2e-60   Brassica napus [oilseed rape]
ref|XP_006436426.1|  hypothetical protein CICLE_v10032302mg             197   2e-60   
ref|XP_009116159.1|  PREDICTED: probable aquaporin PIP2-5               200   2e-60   Brassica rapa
ref|NP_001268058.1|  aquaporin-like                                     200   2e-60   Vitis vinifera
ref|XP_009103935.1|  PREDICTED: probable aquaporin PIP2-5               200   2e-60   Brassica rapa
ref|XP_009413714.1|  PREDICTED: aquaporin PIP2-4-like isoform X1        200   2e-60   
emb|CAC82712.1|  major intrinsic protein 1                              200   2e-60   
emb|CAH60723.1|  putative plasma membrane intrinsic protein             200   3e-60   
gb|ABU94630.1|  putative aquaporin PIP2;2                               200   3e-60   
ref|XP_011077012.1|  PREDICTED: probable aquaporin PIP2-5               199   3e-60   
ref|XP_002461930.1|  hypothetical protein SORBIDRAFT_02g010760          200   3e-60   
ref|XP_003580150.1|  PREDICTED: aquaporin PIP2-5                        199   3e-60   
ref|XP_008366675.1|  PREDICTED: probable aquaporin PIP2-5               199   3e-60   
sp|Q8GRI8.1|PIP25_ORYSJ  RecName: Full=Aquaporin PIP2-5; AltName:...    199   3e-60   
ref|XP_010032196.1|  PREDICTED: aquaporin PIP2-1                        199   3e-60   
gb|KCW51593.1|  hypothetical protein EUGRSUZ_J01087                     201   3e-60   
gb|AEQ29857.1|  aquaporin PIP2                                          199   3e-60   
ref|XP_008345040.1|  PREDICTED: aquaporin PIP2-1-like                   196   3e-60   
gb|EMS51072.1|  Aquaporin PIP2-5                                        199   3e-60   
ref|XP_008387595.1|  PREDICTED: probable aquaporin PIP2-5               199   4e-60   
gb|KDO44717.1|  hypothetical protein CISIN_1g0196812mg                  198   5e-60   
ref|XP_008363507.1|  PREDICTED: aquaporin PIP2-2                        199   5e-60   
gb|AHG32323.1|  PIP2-2                                                  199   5e-60   
dbj|BAD90697.1|  plasma membrane intrinsic protein 2;1                  199   6e-60   
gb|AAF61463.1|AF139814_1  plasma membrane intrinsic protein 1           199   6e-60   
gb|KFK34592.1|  hypothetical protein AALP_AA5G165800                    199   6e-60   
gb|AEY75244.1|  plasma membrane intrinsic protein                       199   6e-60   
ref|XP_010555818.1|  PREDICTED: probable aquaporin PIP2-5               199   6e-60   
dbj|BAG06231.1|  plasma membrane intrinsic protein                      199   7e-60   
gb|AAV80229.1|  aquaporin 2                                             199   7e-60   
ref|XP_004493972.1|  PREDICTED: probable aquaporin PIP2-5-like          199   8e-60   
dbj|BAK20223.1|  plasma membrane intrinsic protein 2                    198   8e-60   
gb|ABX83874.1|  plasma membrane intrinsic protein                       198   9e-60   
gb|ADG03686.1|  aquaporin                                               198   1e-59   
ref|XP_002461932.1|  hypothetical protein SORBIDRAFT_02g010790          198   1e-59   
gb|AAW80918.1|  putative plasma membrane intrinsic protein              198   1e-59   
ref|XP_010554547.1|  PREDICTED: probable aquaporin PIP2-5               198   1e-59   
ref|XP_004143248.1|  PREDICTED: aquaporin PIP2-1-like                   197   1e-59   
gb|AAF65845.1|AF255795_1  aquaporin 1                                   198   2e-59   
gb|ACU87558.1|  PIP protein                                             197   2e-59   
ref|NP_001105027.1|  aquaporin PIP2-6                                   198   2e-59   
ref|XP_002461936.1|  hypothetical protein SORBIDRAFT_02g010830          197   2e-59   
gb|AAL49752.1|AF452014_1  aquaporin-like protein                        197   2e-59   
ref|XP_009342858.1|  PREDICTED: probable aquaporin PIP2-5 isoform X1    197   2e-59   
ref|XP_004307390.1|  PREDICTED: aquaporin PIP2-1                        197   2e-59   
ref|NP_001053335.1|  Os04g0521100                                       197   2e-59   
ref|NP_191042.1|  putative aquaporin PIP2-5                             197   2e-59   
ref|NP_001274386.1|  aquaporin PIP2-1-like                              197   2e-59   
ref|XP_002866389.1|  hypothetical protein ARALYDRAFT_919301             197   2e-59   
gb|KJB26182.1|  hypothetical protein B456_004G229000                    197   2e-59   
ref|XP_009342865.1|  PREDICTED: probable aquaporin PIP2-5 isoform X2    197   3e-59   
ref|XP_008345410.1|  PREDICTED: aquaporin PIP2-1-like                   195   3e-59   
gb|KCW51592.1|  hypothetical protein EUGRSUZ_J01087                     200   3e-59   
ref|XP_008449251.1|  PREDICTED: aquaporin PIP2-1-like isoform X1        196   5e-59   
ref|XP_006436425.1|  hypothetical protein CICLE_v10032302mg             196   5e-59   
ref|XP_008449252.1|  PREDICTED: aquaporin PIP2-1-like isoform X2        196   5e-59   
ref|XP_006291621.1|  hypothetical protein CARUB_v10017773mg             196   6e-59   
ref|XP_007207344.1|  hypothetical protein PRUPE_ppa009630mg             196   6e-59   
gb|AFQ23181.1|  aquaporin PIP2;2                                        196   6e-59   
ref|XP_002461933.1|  hypothetical protein SORBIDRAFT_02g010800          196   7e-59   
ref|XP_010100853.1|  Aquaporin PIP2-1                                   196   7e-59   
gb|EYU34445.1|  hypothetical protein MIMGU_mgv1a011350mg                196   9e-59   
gb|AGD98705.1|  aquaporin                                               196   1e-58   
ref|XP_010046653.1|  PREDICTED: aquaporin PIP2-1-like                   196   1e-58   
ref|XP_008463943.1|  PREDICTED: aquaporin PIP2-7                        196   1e-58   
ref|NP_001059542.1|  Os07g0448100                                       196   1e-58   
ref|XP_008243934.1|  PREDICTED: probable aquaporin PIP2-5               195   1e-58   
gb|EAZ03711.1|  hypothetical protein OsI_25843                          196   1e-58   
gb|KDO44716.1|  hypothetical protein CISIN_1g0196812mg                  197   1e-58   
ref|XP_006428786.1|  hypothetical protein CICLE_v10012379mg             195   2e-58   
ref|NP_200874.1|  putative aquaporin PIP2-4                             195   2e-58   
gb|ACV70050.1|  aquaporin PIP2;1                                        193   2e-58   
ref|XP_010427203.1|  PREDICTED: probable aquaporin PIP2-5               195   2e-58   
ref|XP_010516024.1|  PREDICTED: probable aquaporin PIP2-5               195   2e-58   
gb|KCW88816.1|  hypothetical protein EUGRSUZ_A01153                     196   3e-58   
gb|ACV70048.1|  aquaporin PIP2;1                                        192   3e-58   
ref|XP_010505564.1|  PREDICTED: probable aquaporin PIP2-6               194   3e-58   
ref|XP_010509080.1|  PREDICTED: probable aquaporin PIP2-6               194   3e-58   
gb|KCW88815.1|  hypothetical protein EUGRSUZ_A01153                     196   3e-58   
ref|XP_006291622.1|  hypothetical protein CARUB_v10017773mg             194   4e-58   
gb|EAZ39657.1|  hypothetical protein OsJ_24085                          195   4e-58   
gb|AFQ23567.1|  aquaporin PIP2;2                                        194   4e-58   
ref|XP_006481456.1|  PREDICTED: aquaporin PIP2-2-like                   191   5e-58   
gb|ACV70053.1|  aquaporin PIP2;2                                        192   5e-58   
ref|XP_010507447.1|  PREDICTED: probable aquaporin PIP2-5               195   5e-58   
ref|XP_008670063.1|  PREDICTED: aquaporin PIP2-6-like                   194   6e-58   
ref|XP_009414435.1|  PREDICTED: probable aquaporin PIP2-6               194   6e-58   
gb|EMT03221.1|  hypothetical protein F775_43871                         193   7e-58   
dbj|BAD90700.1|  plasma membrane intrinsic protein 2;4                  193   7e-58   
ref|XP_010684101.1|  PREDICTED: aquaporin PIP2-1-like                   193   8e-58   
ref|XP_006339071.1|  PREDICTED: aquaporin PIP2-1-like                   193   1e-57   
ref|XP_002461931.1|  hypothetical protein SORBIDRAFT_02g010780          193   1e-57   
ref|XP_006481459.1|  PREDICTED: aquaporin PIP2-2-like                   193   1e-57   
ref|XP_002876271.1|  PIP2_5/PIP2D                                       193   1e-57   
gb|ACV70051.1|  aquaporin PIP2;1                                        191   1e-57   
ref|XP_006294722.1|  hypothetical protein CARUB_v10023768mg             193   1e-57   
ref|XP_006428787.1|  hypothetical protein CICLE_v10012633mg             191   1e-57   
gb|ACV70049.1|  aquaporin PIP2;1                                        191   1e-57   
ref|XP_006481455.1|  PREDICTED: aquaporin PIP2-2-like                   192   2e-57   
ref|XP_002521292.1|  Aquaporin PIP2.7, putative                         192   2e-57   
ref|XP_006367009.1|  PREDICTED: probable aquaporin PIP2-2-like          189   2e-57   
ref|XP_006481457.1|  PREDICTED: aquaporin PIP2-1-like isoform X1        192   3e-57   
ref|XP_009344758.1|  PREDICTED: probable aquaporin PIP2-5               191   6e-57   
ref|NP_001274308.1|  aquaporin PIP2-1-like                              191   7e-57   
gb|ACR38689.1|  unknown                                                 189   8e-57   
gb|ACB87734.1|  aquaporin                                               191   8e-57   
ref|XP_009355655.1|  PREDICTED: probable aquaporin PIP2-8               191   8e-57   
ref|NP_001059545.1|  Os07g0448800                                       191   9e-57   
ref|XP_011094668.1|  PREDICTED: aquaporin PIP2-4-like                   191   9e-57   
gb|ABM54183.1|  aquaporin                                               191   9e-57   
ref|XP_008446888.1|  PREDICTED: aquaporin PIP2-1-like                   191   1e-56   
gb|ACV70052.1|  aquaporin PIP2;1                                        189   1e-56   
gb|EAZ39662.1|  hypothetical protein OsJ_24090                          191   1e-56   
tpg|DAA39707.1|  TPA: plasma membrane intrinsic protein2                189   1e-56   
ref|XP_007162747.1|  hypothetical protein PHAVU_001G177000g             191   1e-56   
tpg|DAA60471.1|  TPA: plasma membrane intrinsic protein2                189   1e-56   
ref|XP_004157526.1|  PREDICTED: aquaporin PIP2-7-like                   190   1e-56   
ref|XP_009772697.1|  PREDICTED: aquaporin PIP2-2-like                   190   1e-56   
tpg|DAA64687.1|  TPA: aquaporin PIP2 10                                 190   1e-56   
gb|AAM63463.1|  aquaporin (plasma membrane intrinsic protein 2B)        190   2e-56   
gb|AGD98712.1|  aquaporin protein 9                                     190   2e-56   
gb|KDO41796.1|  hypothetical protein CISIN_1g023108mg                   190   2e-56   
ref|XP_006652526.1|  PREDICTED: probable aquaporin PIP2-3-like          190   2e-56   
ref|XP_008807132.1|  PREDICTED: probable aquaporin PIP2-6               190   2e-56   
dbj|BAD90698.1|  plasma membrane intrinsic protein 2;2                  190   2e-56   
gb|ABH09328.1|  putative aquaporin                                      190   2e-56   
ref|NP_001289823.1|  aquaporin PIP2-1-like                              189   2e-56   
ref|NP_001274381.1|  aquaporin PIP2-7-like                              189   3e-56   
gb|ADJ57599.1|  plasma membrane intrinsic protein PIP2;1                189   3e-56   
ref|XP_006846905.1|  hypothetical protein AMTR_s00152p00041700          189   3e-56   
gb|ACV70057.1|  aquaporin PIP2;3                                        187   3e-56   
ref|XP_009593453.1|  PREDICTED: aquaporin PIP2-2-like                   189   3e-56   
gb|AAC16545.1|  aquaporin                                               189   3e-56   
gb|ACV70056.1|  aquaporin PIP2;3                                        187   4e-56   
gb|EPS68613.1|  hypothetical protein M569_06155                         189   5e-56   
gb|AAG44947.1|AF290620_1  putative PIP2                                 189   6e-56   
ref|XP_006422583.1|  hypothetical protein CICLE_v10029003mg             186   6e-56   
ref|NP_001105638.1|  aquaporin PIP2-2                                   189   6e-56   
ref|NP_001267957.1|  aquaporin PIP2;2                                   188   6e-56   
ref|NP_001105024.1|  aquaporin PIP2-1                                   188   8e-56   
ref|XP_010920097.1|  PREDICTED: probable aquaporin PIP2-6               188   8e-56   
gb|AAO86707.1|  aquaporin                                               188   9e-56   
gb|ABH09327.1|  putative aquaporin                                      188   1e-55   
ref|XP_009414436.1|  PREDICTED: probable aquaporin PIP2-6               188   1e-55   
ref|XP_009367074.1|  PREDICTED: aquaporin PIP2-2                        188   1e-55   
ref|XP_006367007.1|  PREDICTED: aquaporin PIP2-1-like isoform X1        188   1e-55   
gb|EAZ03714.1|  hypothetical protein OsI_25847                          187   1e-55   
tpg|DAA60472.1|  TPA: plasma membrane intrinsic protein2                189   1e-55   
gb|ACF79873.1|  unknown                                                 188   1e-55   
ref|NP_179277.1|  putative aquaporin PIP2-8                             187   1e-55   
ref|XP_006367008.1|  PREDICTED: aquaporin PIP2-1-like isoform X2        187   1e-55   
gb|AAF71820.1|AF141900_1  putative aquaporin PIP2-2                     187   2e-55   
ref|XP_004142421.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin PI...    187   2e-55   
ref|XP_008377729.1|  PREDICTED: probable aquaporin PIP2-8               187   2e-55   
ref|XP_006657662.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin PI...    187   3e-55   
gb|ACV70054.1|  aquaporin PIP2;3                                        184   3e-55   
gb|ACV70047.1|  aquaporin PIP2;1                                        185   3e-55   
ref|XP_006428788.1|  hypothetical protein CICLE_v10012375mg             187   3e-55   
ref|XP_004290727.1|  PREDICTED: aquaporin PIP2-7                        186   3e-55   
gb|ACE60220.1|  plasma membrane aquaporin                               186   3e-55   
ref|XP_006367014.1|  PREDICTED: aquaporin PIP2-1-like                   186   4e-55   
ref|XP_007041805.1|  Plasma membrane intrinsic protein 3 isoform 2      184   4e-55   
ref|XP_006422584.1|  hypothetical protein CICLE_v10029003mg             186   6e-55   
ref|XP_006384579.1|  hypothetical protein POPTR_0004s18240g             183   6e-55   
gb|KDO68091.1|  hypothetical protein CISIN_1g023370mg                   185   6e-55   
dbj|BAF32042.1|  putative aquaporin                                     186   7e-55   
ref|XP_002879778.1|  PIP2_6/PIP2E                                       186   1e-54   
ref|NP_181434.1|  plasma membrane intrinsic protein 2E                  186   1e-54   
gb|ACB71281.1|  plasma membrane intrinsic protein                       185   1e-54   
dbj|BAF32141.1|  putative aquaporin                                     184   2e-54   
gb|AFH36336.1|  aquaporin PIP2;1                                        184   2e-54   
gb|ABK21046.1|  unknown                                                 184   2e-54   
gb|ACG39551.1|  aquaporin PIP2.1                                        184   2e-54   
ref|XP_007205689.1|  hypothetical protein PRUPE_ppa009689mg             184   3e-54   
gb|EMS55627.1|  Aquaporin PIP2-3                                        179   4e-54   
ref|XP_008809438.1|  PREDICTED: probable aquaporin PIP2-6               184   5e-54   
gb|KCW55550.1|  hypothetical protein EUGRSUZ_I01429                     183   6e-54   
ref|XP_009389186.1|  PREDICTED: probable aquaporin PIP2-6               183   6e-54   
gb|KCW55551.1|  hypothetical protein EUGRSUZ_I01429                     183   6e-54   
gb|AEF32110.1|  aquaporin PIP2                                          183   6e-54   
ref|XP_011046666.1|  PREDICTED: probable aquaporin PIP2-8               183   7e-54   
gb|KJB73581.1|  hypothetical protein B456_011G239500                    182   7e-54   
ref|XP_009138343.1|  PREDICTED: aquaporin PIP2-7-like                   183   8e-54   
gb|ACV70055.1|  aquaporin PIP2;3                                        181   8e-54   
ref|XP_006412151.1|  hypothetical protein EUTSA_v10025940mg             182   8e-54   
ref|XP_009412922.1|  PREDICTED: probable aquaporin PIP2-6               183   9e-54   
ref|XP_007041804.1|  Plasma membrane intrinsic protein 2,8 isoform 1    182   9e-54   
ref|XP_006846005.1|  hypothetical protein AMTR_s00155p00061840          183   9e-54   
gb|ACV66986.1|  plasma membrane aquaporin 2                             182   1e-53   
ref|XP_009105909.1|  PREDICTED: aquaporin PIP2-7                        182   1e-53   
emb|CDX69112.1|  BnaC01g03410D                                          182   1e-53   
ref|XP_003604054.1|  Aquaporin PIP22                                    182   1e-53   
ref|NP_195236.1|  plasma membrane intrinsic protein 3                   182   1e-53   
ref|XP_010526891.1|  PREDICTED: probable aquaporin PIP2-8               182   1e-53   
ref|XP_006412152.1|  hypothetical protein EUTSA_v10025940mg             182   1e-53   
dbj|BAG68662.1|  plasma membrane intrinsic protein                      182   1e-53   
ref|XP_008367680.1|  PREDICTED: probable aquaporin PIP2-5               182   1e-53   
dbj|BAG68661.1|  plasma membrane intrinsic protein                      182   2e-53   
gb|ABK22146.1|  unknown                                                 182   2e-53   
ref|XP_002884019.1|  PIP2_8/PIP3B                                       182   2e-53   
gb|ACG32567.1|  aquaporin PIP2.1                                        182   2e-53   
ref|XP_002306187.1|  membrane intrinsic family protein                  182   2e-53   
gb|AFN53630.1|  putative aquaporin PIP2-8                               190   2e-53   
ref|XP_003563179.1|  PREDICTED: aquaporin PIP2-6                        182   2e-53   
ref|XP_006360898.1|  PREDICTED: aquaporin PIP2-7-like                   182   2e-53   
gb|ACU00102.1|  plasma membrane intrinsic protein PIP2.6                182   2e-53   
ref|XP_009376943.1|  PREDICTED: probable aquaporin PIP2-8               182   2e-53   
ref|XP_010325988.1|  PREDICTED: aquaporin PIP2-1-like                   181   3e-53   
gb|AFO63679.1|  plasma intrinsic protein 2                              181   3e-53   
emb|CDX76314.1|  BnaA08g10860D                                          181   3e-53   
ref|XP_010467415.1|  PREDICTED: probable aquaporin PIP2-8               181   3e-53   
gb|AFN53685.1|  putative aquaporin PIP2-8                               189   4e-53   
gb|KFK30134.1|  hypothetical protein AALP_AA7G221400                    181   4e-53   
ref|XP_006298288.1|  hypothetical protein CARUB_v10014353mg             181   4e-53   
gb|ADL16407.1|  aquaporin                                               181   4e-53   
gb|ABL76066.1|  aquaporin 2                                             181   5e-53   
ref|XP_010266027.1|  PREDICTED: aquaporin PIP2-7-like                   181   5e-53   
emb|CDY17511.1|  BnaC03g65520D                                          181   5e-53   
ref|XP_009400343.1|  PREDICTED: probable aquaporin PIP2-6               181   6e-53   
gb|AAG30607.1|AF314656_1  aquaporin                                     181   6e-53   
gb|KHG01329.1|  Aquaporin PIP2-7 -like protein                          179   6e-53   
gb|ACR56615.1|  plasma intrinsic protein 2;5                            181   7e-53   
gb|AAG02208.1|AF290201_1  plasma membrane intrinsic protein PIP2        181   7e-53   
gb|KFK36606.1|  hypothetical protein AALP_AA4G145300                    181   7e-53   
gb|KJB73580.1|  hypothetical protein B456_011G239500                    181   7e-53   
gb|KHG20375.1|  putative aquaporin PIP2-5 -like protein                 181   7e-53   



>ref|XP_009786071.1| PREDICTED: aquaporin PIP2-7-like [Nicotiana sylvestris]
 tpg|DAA64678.1| TPA_exp: aquaporin PIP2 4b [Nicotiana tabacum]
Length=287

 Score =   234 bits (597),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            MTK+VEAV EQPAE+SAKDY DPPP+PLIDF+ELTKWS YRA IAEFIATLLFLYVTVLT
Sbjct  1    MTKEVEAVSEQPAEYSAKDYTDPPPTPLIDFEELTKWSLYRACIAEFIATLLFLYVTVLT  60

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYKHQ+D K GG  CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   VIGYKHQSDTKDGGDICGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  120

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAVLYM++QCLGAICGV
Sbjct  121  KVSLMRAVLYMVSQCLGAICGV  142



>ref|XP_009615789.1| PREDICTED: aquaporin PIP2-7-like [Nicotiana tomentosiformis]
Length=287

 Score =   233 bits (594),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M+K+VEAV EQPAE+SAKDY DPPP+PLIDF+ELTKWS YRA IAEFIATLLFLYVTVLT
Sbjct  1    MSKEVEAVSEQPAEYSAKDYTDPPPTPLIDFEELTKWSLYRACIAEFIATLLFLYVTVLT  60

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYKHQ+D K GG  CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   VIGYKHQSDTKDGGDICGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  120

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAVLYM++QCLGAICGV
Sbjct  121  KVSLIRAVLYMVSQCLGAICGV  142



>tpg|DAA64677.1| TPA_exp: aquaporin PIP2 4a [Nicotiana tabacum]
Length=287

 Score =   233 bits (593),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M+K+VEAV EQPAE+SAKDY DPPP+PLIDF+ELTKWS YRA IAEFIATLLFLYVTVLT
Sbjct  1    MSKEVEAVSEQPAEYSAKDYTDPPPTPLIDFEELTKWSLYRACIAEFIATLLFLYVTVLT  60

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYKHQ+D K GG  CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   VIGYKHQSDTKDGGDICGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  120

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAVLYM++QCLGAICGV
Sbjct  121  KVSLIRAVLYMVSQCLGAICGV  142



>gb|AFQ23186.1| aquaporin PIP2;1 [Eustoma exaltatum subsp. russellianum]
Length=286

 Score =   232 bits (592),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 129/142 (91%), Gaps = 1/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M K+VE V EQP E+SAKDYHDPPP+   D DELTKWSFYRA+IAEF+ATLLFLY+ VLT
Sbjct  1    MAKEVEGVSEQP-EYSAKDYHDPPPAAFFDLDELTKWSFYRALIAEFVATLLFLYIKVLT  59

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYKHQTDP AGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   VIGYKHQTDPDAGGADCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  119

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+LPRA  YM+AQCLGAICGV
Sbjct  120  KVSLPRAFFYMVAQCLGAICGV  141



>ref|NP_001275065.1| major intrinsic protein 2 [Solanum tuberosum]
 gb|ABB29939.1| major intrinsic protein 2-like [Solanum tuberosum]
 emb|CBI99236.1| major intrinsic protein 2 [Solanum tuberosum]
Length=287

 Score =   231 bits (590),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            MTK+VEAV EQ AE+SAKDY DPPP+PLIDF+ELTKWS YRAVIAEFIATLLFLY+TVLT
Sbjct  1    MTKEVEAVHEQAAEYSAKDYTDPPPAPLIDFEELTKWSLYRAVIAEFIATLLFLYITVLT  60

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYKHQ D  AGG  CGGVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   VIGYKHQADVDAGGDVCGGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  120

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAVLYM+AQCLGAICGV
Sbjct  121  KVSLIRAVLYMVAQCLGAICGV  142



>gb|AAB18227.1| MipC [Mesembryanthemum crystallinum]
Length=287

 Score =   230 bits (586),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            MTKDVE   +Q  EFSAKDYHDPPP+PLIDF+EL KWSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MTKDVEVAEQQAPEFSAKDYHDPPPAPLIDFEELRKWSFYRAVIAEFIATLLFLYITVLT  60

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK QTDP      CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   VIGYKSQTDPNTNADQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  120

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L +AVLYM+AQCLGAICGV
Sbjct  121  KVSLIKAVLYMVAQCLGAICGV  142



>ref|NP_001289846.1| probable aquaporin PIP2-1 [Solanum lycopersicum]
 dbj|BAO18629.1| plasmamembrane intrinsic protein 2;6 [Solanum lycopersicum]
Length=287

 Score =   228 bits (581),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            MTK+VEA  EQ  E+SAKDY DPPP+PLIDF+ELTKWS YRA IAEFIATLLFLY+T+LT
Sbjct  1    MTKEVEAAHEQAVEYSAKDYTDPPPAPLIDFEELTKWSLYRAAIAEFIATLLFLYITILT  60

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYKHQ D KAGG  CGGVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   VIGYKHQADVKAGGDICGGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  120

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RA+LYM+AQCLGAICGV
Sbjct  121  KVSLIRAILYMVAQCLGAICGV  142



>ref|XP_009780213.1| PREDICTED: aquaporin PIP2-4-like [Nicotiana sylvestris]
 tpg|DAA64686.1| TPA_exp: aquaporin PIP2 9b [Nicotiana tabacum]
Length=287

 Score =   228 bits (580),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            MTK+VE   EQP EFSAKDY DPPP+PL+DF+ELT+WS YRAVIAEFIATLLFLYVTVLT
Sbjct  1    MTKEVEVATEQPTEFSAKDYTDPPPAPLVDFEELTQWSLYRAVIAEFIATLLFLYVTVLT  60

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q+D KA G  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   VIGYKVQSDVKADGDICGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  120

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAVLYM+AQCLGAICGV
Sbjct  121  KVSLIRAVLYMVAQCLGAICGV  142



>ref|XP_009595123.1| PREDICTED: aquaporin PIP2-4-like [Nicotiana tomentosiformis]
 tpg|DAA64685.1| TPA_exp: aquaporin PIP2 9a [Nicotiana tabacum]
Length=287

 Score =   226 bits (575),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            MTK+VE   EQ AEFSAKDY DPPP+PL+DF+ELT+WS YRAVIAEFIATLLFLYVTVLT
Sbjct  1    MTKEVEVAREQAAEFSAKDYTDPPPAPLVDFEELTQWSLYRAVIAEFIATLLFLYVTVLT  60

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q+D KA G  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   VIGYKVQSDVKADGDICGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  120

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAVLYM+AQCLGAICGV
Sbjct  121  KVSLIRAVLYMVAQCLGAICGV  142



>ref|XP_006357563.1| PREDICTED: probable aquaporin PIP2-1-like [Solanum tuberosum]
Length=286

 Score =   225 bits (573),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 132/142 (93%), Gaps = 1/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            MTK+VE+V E+  EFSAKDY DPPP+PL+DF+ELT+WSFYRA+IAEFIATLLFLY+T+LT
Sbjct  1    MTKEVESVTER-GEFSAKDYTDPPPAPLVDFEELTQWSFYRAIIAEFIATLLFLYITILT  59

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGY+HQ D  AGG  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   VIGYQHQADVDAGGDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  119

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAVLYM+AQCLGAICGV
Sbjct  120  KVSLIRAVLYMVAQCLGAICGV  141



>gb|ABB13430.2| plasma membrane intrinsic protein [Olea europaea]
Length=287

 Score =   224 bits (572),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            MTKDVE+  E   E+SAKDYHDPPP+PLIDFDEL+ WSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MTKDVESHVEPAEEYSAKDYHDPPPAPLIDFDELSSWSFYRALIAEFVATLLFLYVTVLT  60

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q DP  GG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVT GLFL R
Sbjct  61   VIGYKSQIDPAHGGDDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTLGLFLGR  120

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAVLYM+AQCLGAICGV
Sbjct  121  KVSLIRAVLYMVAQCLGAICGV  142



>gb|KCW51391.1| hypothetical protein EUGRSUZ_J00930 [Eucalyptus grandis]
Length=209

 Score =   221 bits (562),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 127/141 (90%), Gaps = 2/141 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE    +PAEF+AKDYHDPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEVA--EPAEFAAKDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK QTDP   G DC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQTDPALKGTDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RAV YM+AQCLGAICG
Sbjct  119  KVSLIRAVSYMVAQCLGAICG  139



>ref|XP_010521765.1| PREDICTED: aquaporin PIP2-7-like [Tarenaya hassleriana]
Length=286

 Score =   220 bits (560),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 121/141 (86%), Positives = 129/141 (91%), Gaps = 1/141 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE V E   EF+AKDY DPPP+PLID +ELTKWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVE-VQESAPEFTAKDYTDPPPAPLIDPEELTKWSFYRALIAEFIATLLFLYVTVLT  59

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q+D KAGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   VIGYKVQSDTKAGGDDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  119

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RA+LYM+AQCLGAICG
Sbjct  120  KVSLVRALLYMVAQCLGAICG  140



>gb|AFK47400.1| unknown [Lotus japonicus]
Length=287

 Score =   220 bits (560),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 128/142 (90%), Gaps = 2/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE    +   FS+KDYHDPPP+PLID +ELTKWSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--AERGSFSSKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q+D K GG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKVQSDVKNGGDDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RA+LYM+AQCLGAICGV
Sbjct  119  KVSLIRAILYMVAQCLGAICGV  140



>emb|CDP07111.1| unnamed protein product [Coffea canephora]
 emb|CDX10334.1| aquaporin [Coffea arabica]
Length=288

 Score =   219 bits (558),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 125/143 (87%), Gaps = 1/143 (1%)
 Frame = +2

Query  59   MTKDVEAV-PEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvl  235
            M KDVE V   +  EFSAKDYHDPPP+   D DELTKWSF+RA+IAEF+ATLLFLYVTVL
Sbjct  1    MAKDVEGVVAAEQGEFSAKDYHDPPPAAFFDLDELTKWSFHRALIAEFVATLLFLYVTVL  60

Query  236  tvIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  415
            TVIGYKHQTD  AGG DC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  61   TVIGYKHQTDATAGGDDCNGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  120

Query  416  RKVTLPRAVLYMIAQCLGAICGV  484
            RKV+L RA  YM+AQCLGAICGV
Sbjct  121  RKVSLLRAFFYMVAQCLGAICGV  143



>gb|ACU23034.1| unknown [Glycine max]
Length=158

 Score =   214 bits (546),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 125/142 (88%), Gaps = 2/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE    +   FS KDY DPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEVA--ERGSFSGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGY HQTD K  G+ CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYNHQTDLKENGEICGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RA++YM+AQCLGAICGV
Sbjct  119  KVSLIRAIMYMVAQCLGAICGV  140



>ref|XP_010031998.1| PREDICTED: aquaporin PIP2-7-like [Eucalyptus grandis]
 gb|KCW51390.1| hypothetical protein EUGRSUZ_J00930 [Eucalyptus grandis]
Length=285

 Score =   219 bits (558),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 127/141 (90%), Gaps = 2/141 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE    +PAEF+AKDYHDPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--AEPAEFAAKDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK QTDP   G DC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQTDPALKGTDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RAV YM+AQCLGAICG
Sbjct  119  KVSLIRAVSYMVAQCLGAICG  139



>gb|KDO73275.1| hypothetical protein CISIN_1g022966mg [Citrus sinensis]
Length=264

 Score =   218 bits (555),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 125/143 (87%), Gaps = 2/143 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPA--EFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtv  232
            M KDVE   +Q    EFSAKDYHDPPP+PLIDF+EL KWSFYRAVIAEFIATLLFLYVTV
Sbjct  1    MGKDVEVAEQQGGGGEFSAKDYHDPPPAPLIDFEELGKWSFYRAVIAEFIATLLFLYVTV  60

Query  233  ltvIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  412
            LTVIGYK QTDP      CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  61   LTVIGYKSQTDPNLNTDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  120

Query  413  ARKVTLPRAVLYMIAQCLGAICG  481
             RKV+L RA+LYM+AQCLGAICG
Sbjct  121  GRKVSLIRALLYMVAQCLGAICG  143



>ref|XP_006424577.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
 gb|ESR37817.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
Length=264

 Score =   218 bits (555),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 125/143 (87%), Gaps = 2/143 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPA--EFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtv  232
            M KDVE   +Q    EFSAKDYHDPPP+PLIDF+EL KWSFYRAVIAEFIATLLFLYVTV
Sbjct  1    MGKDVEVAEQQGGGGEFSAKDYHDPPPAPLIDFEELGKWSFYRAVIAEFIATLLFLYVTV  60

Query  233  ltvIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  412
            LTVIGYK QTDP      CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  61   LTVIGYKSQTDPNLNTDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  120

Query  413  ARKVTLPRAVLYMIAQCLGAICG  481
             RKV+L RA+LYM+AQCLGAICG
Sbjct  121  GRKVSLIRALLYMVAQCLGAICG  143



>ref|XP_004953172.1| PREDICTED: aquaporin PIP2-4-like [Setaria italica]
Length=288

 Score =   218 bits (555),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 126/144 (88%), Gaps = 2/144 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+EA   +  EFSAKDY DPPP+PLID +ELTKWS YRA IAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEASGPEAGEFSAKDYSDPPPAPLIDAEELTKWSLYRAAIAEFVATLLFLYITVAT  60

Query  239  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  412
            VIGYKHQTD  A G D  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  61   VIGYKHQTDAAASGPDAACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  120

Query  413  ARKVTLPRAVLYMIAQCLGAICGV  484
            ARKV+L RAVLY+IAQCLGAICGV
Sbjct  121  ARKVSLVRAVLYIIAQCLGAICGV  144



>ref|XP_003575410.1| PREDICTED: aquaporin PIP2-4 [Brachypodium distachyon]
Length=288

 Score =   218 bits (555),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 127/144 (88%), Gaps = 2/144 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+EA   +  EFSAKDY DPPP+P++DF+ELTKWS YRA IAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEASAPEGGEFSAKDYSDPPPAPIVDFEELTKWSLYRAAIAEFVATLLFLYITVAT  60

Query  239  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  412
            VIGYKHQTD  A G D  CGGVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLFL
Sbjct  61   VIGYKHQTDVSASGPDAACGGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFL  120

Query  413  ARKVTLPRAVLYMIAQCLGAICGV  484
            ARKV+L RAVLY++AQCLGAICGV
Sbjct  121  ARKVSLVRAVLYIVAQCLGAICGV  144



>ref|NP_001105026.1| aquaporin PIP2-4 [Zea mays]
 sp|Q9ATM6.1|PIP24_MAIZE RecName: Full=Aquaporin PIP2-4; AltName: Full=Plasma membrane 
intrinsic protein 2-4; AltName: Full=ZmPIP2-4; AltName: Full=ZmPIP2;4 
[Zea mays]
 gb|AAK26761.1| plasma membrane integral protein ZmPIP2-4 [Zea mays]
 gb|ACN28082.1| unknown [Zea mays]
 gb|AFW72774.1| plasma membrane intrinsic protein2 [Zea mays]
Length=288

 Score =   218 bits (554),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 127/144 (88%), Gaps = 2/144 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+EA   +  EFSAKDY DPPP+PLID +ELT+WS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MAKDIEASGPEAGEFSAKDYTDPPPAPLIDAEELTQWSLYRAVIAEFIATLLFLYITVAT  60

Query  239  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  412
            VIGYKHQTD  A G D  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  61   VIGYKHQTDASASGPDAACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  120

Query  413  ARKVTLPRAVLYMIAQCLGAICGV  484
            ARKV+L RA+LY+IAQCLGAICGV
Sbjct  121  ARKVSLVRALLYIIAQCLGAICGV  144



>ref|XP_006424576.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
 ref|XP_006488095.1| PREDICTED: aquaporin PIP2-1-like [Citrus sinensis]
 gb|ESR37816.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
 gb|KDO73274.1| hypothetical protein CISIN_1g022966mg [Citrus sinensis]
Length=289

 Score =   218 bits (554),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 125/143 (87%), Gaps = 2/143 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPA--EFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtv  232
            M KDVE   +Q    EFSAKDYHDPPP+PLIDF+EL KWSFYRAVIAEFIATLLFLYVTV
Sbjct  1    MGKDVEVAEQQGGGGEFSAKDYHDPPPAPLIDFEELGKWSFYRAVIAEFIATLLFLYVTV  60

Query  233  ltvIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  412
            LTVIGYK QTDP      CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  61   LTVIGYKSQTDPNLNTDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  120

Query  413  ARKVTLPRAVLYMIAQCLGAICG  481
             RKV+L RA+LYM+AQCLGAICG
Sbjct  121  GRKVSLIRALLYMVAQCLGAICG  143



>gb|KJB62460.1| hypothetical protein B456_009G418100 [Gossypium raimondii]
Length=202

 Score =   215 bits (547),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 123/141 (87%), Gaps = 4/141 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E       EF AKDYHDPPP+PL+D  EL KWSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEV----GGEFQAKDYHDPPPAPLVDAQELAKWSFYRAVIAEFIATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK QTDP  GG+DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKTQTDPAKGGEDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RA+ YM AQCLGAICG
Sbjct  117  KVSLVRAIFYMGAQCLGAICG  137



>ref|XP_002877918.1| hypothetical protein ARALYDRAFT_485715 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54177.1| hypothetical protein ARALYDRAFT_485715 [Arabidopsis lyrata subsp. 
lyrata]
Length=287

 Score =   217 bits (553),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 127/142 (89%), Gaps = 2/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVEAVP +   F  +DYHDPPP+P ID  EL KWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEAVPGE--GFQTRDYHDPPPAPFIDGAELKKWSFYRAVIAEFVATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q+D  AGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKIQSDTTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+LPRA+LY++AQCLGAICGV
Sbjct  119  KVSLPRAILYIVAQCLGAICGV  140



>gb|KJB56129.1| hypothetical protein B456_009G107200 [Gossypium raimondii]
Length=232

 Score =   215 bits (548),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 126/143 (88%), Gaps = 2/143 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            MTKD+E   +   EFSAKDYHDPPP+PLID +ELTKWSFYRAVIAEFIATLLFLYVTVLT
Sbjct  1    MTKDIETAEQHGGEFSAKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYVTVLT  60

Query  239  vIGYKHQTDPKAG--GQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  412
            VIGYK QTDP       DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF+
Sbjct  61   VIGYKVQTDPAKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFV  120

Query  413  ARKVTLPRAVLYMIAQCLGAICG  481
             RKV+L RA++YM+AQCLGAICG
Sbjct  121  GRKVSLIRALMYMVAQCLGAICG  143



>ref|XP_006291609.1| hypothetical protein CARUB_v10017763mg [Capsella rubella]
 gb|EOA24507.1| hypothetical protein CARUB_v10017763mg [Capsella rubella]
Length=287

 Score =   217 bits (553),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 126/142 (89%), Gaps = 2/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE VP +   F  +DY DPPP+P  D  ELTKWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVETVPGE--GFQTRDYQDPPPAPFFDGAELTKWSFYRAVIAEFVATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q+D KAGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKLQSDLKAGGDDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+LPRAVLY+IAQCLGAICGV
Sbjct  119  KVSLPRAVLYIIAQCLGAICGV  140



>gb|KJB16797.1| hypothetical protein B456_002G2484002, partial [Gossypium raimondii]
Length=142

 Score =   212 bits (540),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 122/141 (87%), Gaps = 4/141 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE       EF AKDYHDPPP+P +D  ELT+WSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV----GGEFQAKDYHDPPPAPFVDAQELTQWSFYRAIIAEFIATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q DP  GGQDC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQVDPDKGGQDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RA+LYM AQCLGAICG
Sbjct  117  KVSLVRAILYMAAQCLGAICG  137



>gb|ACG33001.1| aquaporin PIP2.2 [Zea mays]
Length=288

 Score =   216 bits (551),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 127/144 (88%), Gaps = 2/144 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+EA   +  EFSAKDY DPPP+PL+D +ELT+WS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MAKDIEASGPEAGEFSAKDYTDPPPAPLVDAEELTQWSLYRAVIAEFIATLLFLYITVAT  60

Query  239  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  412
            VIGYKHQTD  A G D  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  61   VIGYKHQTDASASGPDAACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  120

Query  413  ARKVTLPRAVLYMIAQCLGAICGV  484
            ARKV+L RA+LY++AQCLGAICGV
Sbjct  121  ARKVSLVRALLYIVAQCLGAICGV  144



>ref|NP_001105025.1| aquaporin PIP2-3 [Zea mays]
 sp|Q9ATM7.1|PIP23_MAIZE RecName: Full=Aquaporin PIP2-3; AltName: Full=Plasma membrane 
intrinsic protein 2-3; AltName: Full=ZmPIP2-3; AltName: Full=ZmPIP2;3 
[Zea mays]
 gb|AAK26760.1| plasma membrane integral protein ZmPIP2-3 [Zea mays]
 gb|ACR38296.1| unknown [Zea mays]
 gb|AFW63074.1| plasma membrane intrinsic protein2 [Zea mays]
Length=289

 Score =   216 bits (551),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 126/142 (89%), Gaps = 2/142 (1%)
 Frame = +2

Query  65   KDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvltvI  244
            +D+EA   +  EFSAKDY DPPP+PLID DELTKWS YRAVIAEFIATLLFLY+TV TVI
Sbjct  4    QDIEASGPEAGEFSAKDYTDPPPAPLIDADELTKWSLYRAVIAEFIATLLFLYITVATVI  63

Query  245  GYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            GYKHQTD  A G D  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  64   GYKHQTDAAASGPDAACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  123

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RA+LY+IAQCLGAICGV
Sbjct  124  KVSLVRALLYIIAQCLGAICGV  145



>ref|XP_004505993.1| PREDICTED: aquaporin PIP2-7-like [Cicer arietinum]
Length=285

 Score =   216 bits (550),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 125/141 (89%), Gaps = 2/141 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE   ++  EFSAKDY DPPP+PLIDFDELTKWSFYRA+IAEF+ATLLFLYVT+LT
Sbjct  1    MAKDVEV--QEHGEFSAKDYQDPPPAPLIDFDELTKWSFYRALIAEFVATLLFLYVTILT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            +IGY HQ+DPKAGG DC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF+ R
Sbjct  59   IIGYSHQSDPKAGGTDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFVGR  118

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RAV YM AQC GAI G
Sbjct  119  KVSLLRAVFYMAAQCAGAISG  139



>gb|AAC17529.1| aquaporin 2 [Samanea saman]
Length=287

 Score =   216 bits (550),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 127/142 (89%), Gaps = 2/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE    +   +SAKDYHDPPP+PLID +EL KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--AERGSYSAKDYHDPPPAPLIDAEELGKWSFYRALIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q+D KAGG  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQSDTKAGGDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RA+LYM+AQCLGAICGV
Sbjct  119  KVSLIRAILYMVAQCLGAICGV  140



>gb|KHG00060.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=289

 Score =   216 bits (550),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 127/143 (89%), Gaps = 2/143 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            MTKD+E   ++  EFSAKDYHDPPP+PLID +ELTKWSFYRAVIAEFIATLLFLYVTVLT
Sbjct  1    MTKDIETAEQRGGEFSAKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYVTVLT  60

Query  239  vIGYKHQTDPKAG--GQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  412
            VIGYK QTDP       DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF+
Sbjct  61   VIGYKVQTDPAKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFV  120

Query  413  ARKVTLPRAVLYMIAQCLGAICG  481
             RKV+L RA++YM+AQCLGAICG
Sbjct  121  GRKVSLIRALMYMVAQCLGAICG  143



>ref|XP_010426989.1| PREDICTED: aquaporin PIP2-1 [Camelina sativa]
Length=287

 Score =   216 bits (550),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 126/142 (89%), Gaps = 2/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVEAVP +   F  +DY DPPP+P  D  EL KWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEAVPGE--GFQTRDYQDPPPAPFFDGAELKKWSFYRAVIAEFVATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q+D KAGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKIQSDVKAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+LPRAVLY+IAQCLGAICGV
Sbjct  119  KVSLPRAVLYIIAQCLGAICGV  140



>gb|AIA83106.1| putative aquaporin PIP2 [Citrus trifoliata]
Length=292

 Score =   216 bits (549),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 124/146 (85%), Gaps = 5/146 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPA-----EFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllfly  223
            M KDVE   +Q       EFSAKDYHD PP+PLIDFDEL KWSFYRAVIAEFIATLLFLY
Sbjct  1    MGKDVEVAEQQGGGGGGGEFSAKDYHDSPPAPLIDFDELGKWSFYRAVIAEFIATLLFLY  60

Query  224  vtvltvIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFG  403
            VTVLTVIGYK QTDP      CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFG
Sbjct  61   VTVLTVIGYKSQTDPTLNTDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFG  120

Query  404  LFLARKVTLPRAVLYMIAQCLGAICG  481
            LFL RKV+L RA+LYM+AQCLGAICG
Sbjct  121  LFLGRKVSLIRALLYMVAQCLGAICG  146



>gb|AFH36337.1| aquaporin PIP2;2 [Quercus petraea]
Length=285

 Score =   215 bits (548),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 126/142 (89%), Gaps = 2/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE    +  E+SAKDYHDPPP+PLID +ELT+WSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--AERGEYSAKDYHDPPPAPLIDPEELTQWSFYRALIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK QTDP      CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQTDPLKNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAVLYM+AQCLGAICGV
Sbjct  119  KVSLIRAVLYMVAQCLGAICGV  140



>gb|AEH76326.1| plasma membrane intrinsic protein 2A [Camelina sativa]
Length=287

 Score =   215 bits (548),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 126/142 (89%), Gaps = 2/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVEAVP +   F  +DY DPPP+P  D  EL KWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEAVPGE--GFQTRDYQDPPPAPFFDGAELKKWSFYRAVIAEFVATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q+D KAGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKIQSDVKAGGFDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+LPRAVLY+IAQCLGAICGV
Sbjct  119  KVSLPRAVLYIIAQCLGAICGV  140



>gb|KJB56128.1| hypothetical protein B456_009G107200 [Gossypium raimondii]
Length=289

 Score =   215 bits (548),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 126/143 (88%), Gaps = 2/143 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            MTKD+E   +   EFSAKDYHDPPP+PLID +ELTKWSFYRAVIAEFIATLLFLYVTVLT
Sbjct  1    MTKDIETAEQHGGEFSAKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYVTVLT  60

Query  239  vIGYKHQTDPKAG--GQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  412
            VIGYK QTDP       DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF+
Sbjct  61   VIGYKVQTDPAKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFV  120

Query  413  ARKVTLPRAVLYMIAQCLGAICG  481
             RKV+L RA++YM+AQCLGAICG
Sbjct  121  GRKVSLIRALMYMVAQCLGAICG  143



>dbj|BAE02729.1| PIP aquaporin [Hordeum vulgare]
Length=286

 Score =   215 bits (548),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 127/144 (88%), Gaps = 3/144 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+EA P Q  EFS+KDY DPPP+P++DF+ELTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAAP-QGGEFSSKDYSDPPPAPIVDFEELTKWSLYRAVIAEFVATLLFLYITVAT  59

Query  239  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  412
            VIGYKHQ+DP     D  C GVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLFL
Sbjct  60   VIGYKHQSDPTVNTTDAACSGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFL  119

Query  413  ARKVTLPRAVLYMIAQCLGAICGV  484
            ARKV+L RA+LY+IAQCLGAICGV
Sbjct  120  ARKVSLIRALLYIIAQCLGAICGV  143



>ref|XP_002452483.1| hypothetical protein SORBIDRAFT_04g026650 [Sorghum bicolor]
 gb|EES05459.1| hypothetical protein SORBIDRAFT_04g026650 [Sorghum bicolor]
Length=289

 Score =   215 bits (548),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 126/144 (88%), Gaps = 2/144 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+EA   +  EFSAKDY DPPP+PLID  ELT+WS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MAKDIEASGPEAGEFSAKDYTDPPPAPLIDAAELTQWSLYRAVIAEFIATLLFLYITVAT  60

Query  239  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  412
            VIGYKHQTD  A G D  CGGVGILGIAW+FGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  61   VIGYKHQTDATASGPDAACGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAVTFGLFL  120

Query  413  ARKVTLPRAVLYMIAQCLGAICGV  484
            ARKV+L RA+LY+IAQCLGAICGV
Sbjct  121  ARKVSLVRALLYIIAQCLGAICGV  144



>gb|KJB36606.1| hypothetical protein B456_006G166800 [Gossypium raimondii]
Length=203

 Score =   212 bits (540),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 122/141 (87%), Gaps = 4/141 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE       EF AKDYHDPPP+PL+D +ELTKWSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV----GGEFQAKDYHDPPPAPLVDGEELTKWSFYRAVIAEFIATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q DP  G  +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQVDPDKGSDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RA+ YM AQCLGAICG
Sbjct  117  KVSLVRAIFYMAAQCLGAICG  137



>gb|AAF61464.1|AF139815_1 plasma membrane intrinsic protein 2 [Triticum aestivum]
Length=257

 Score =   214 bits (544),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 126/144 (88%), Gaps = 3/144 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+EA P Q  EFS KDY DPPP+P++DF+ELTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAAP-QGGEFSTKDYSDPPPAPIVDFEELTKWSLYRAVIAEFVATLLFLYITVAT  59

Query  239  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  412
            VIGYKHQ+DP     D  C GVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLFL
Sbjct  60   VIGYKHQSDPTVNTTDAACSGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFL  119

Query  413  ARKVTLPRAVLYMIAQCLGAICGV  484
            ARKV+L RA+LY+IAQCLGAICGV
Sbjct  120  ARKVSLIRALLYIIAQCLGAICGV  143



>ref|NP_190910.1| aquaporin PIP2-1 [Arabidopsis thaliana]
 ref|NP_001030851.1| aquaporin PIP2-1 [Arabidopsis thaliana]
 sp|P43286.1|PIP21_ARATH RecName: Full=Aquaporin PIP2-1; AltName: Full=Plasma membrane 
intrinsic protein 2-1; Short=AtPIP2;1; AltName: Full=Plasma 
membrane intrinsic protein 2a; Short=PIP2a; Contains: RecName: 
Full=Aquaporin PIP2-1, N-terminally processed [Arabidopsis 
thaliana]
 gb|AAL16195.1|AF428426_1 AT3g53420/F4P12_120 [Arabidopsis thaliana]
 emb|CAA53477.1| plasma membrane intrinsic protein 2a [Arabidopsis thaliana]
 emb|CAB67649.1| plasma membrane intrinsic protein 2a [Arabidopsis thaliana]
 gb|AAK62634.1| AT3g53420/F4P12_120 [Arabidopsis thaliana]
 gb|AAK73268.1| plasma membrane intrinsic protein 2a [Arabidopsis thaliana]
 gb|AAL06973.1| AT3g53420/F4P12_120 [Arabidopsis thaliana]
 gb|AAL62366.1| plasma membrane intrinsic protein 2a [Arabidopsis thaliana]
 gb|AAM65406.1| plasma membrane intrinsic protein 2a [Arabidopsis thaliana]
 gb|AEE79083.1| aquaporin PIP2-1 [Arabidopsis thaliana]
 gb|AEE79084.1| aquaporin PIP2-1 [Arabidopsis thaliana]
Length=287

 Score =   215 bits (547),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 126/142 (89%), Gaps = 2/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVEAVP +   F  +DY DPPP+P ID  EL KWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEAVPGE--GFQTRDYQDPPPAPFIDGAELKKWSFYRAVIAEFVATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q+D  AGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKIQSDTDAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+LPRA+LY+IAQCLGAICGV
Sbjct  119  KVSLPRALLYIIAQCLGAICGV  140



>gb|AEO13898.1| aquaporin 7 [Triticum aestivum]
Length=286

 Score =   215 bits (547),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 126/144 (88%), Gaps = 3/144 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+EA P Q  EFS KDY DPPP+P++DF+ELTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAAP-QGGEFSTKDYSDPPPAPIVDFEELTKWSLYRAVIAEFVATLLFLYITVAT  59

Query  239  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  412
            VIGYKHQ+DP     D  C GVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLFL
Sbjct  60   VIGYKHQSDPTVNTTDAACSGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFL  119

Query  413  ARKVTLPRAVLYMIAQCLGAICGV  484
            ARKV+L RA+LY+IAQCLGAICGV
Sbjct  120  ARKVSLIRALLYIIAQCLGAICGV  143



>ref|XP_006403691.1| hypothetical protein EUTSA_v10010598mg [Eutrema salsugineum]
 gb|ESQ45144.1| hypothetical protein EUTSA_v10010598mg [Eutrema salsugineum]
Length=287

 Score =   214 bits (546),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 126/142 (89%), Gaps = 2/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVEAVP +   F  +DY DPPP+PL D +ELTKWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEAVPGE--GFQTRDYQDPPPAPLFDPEELTKWSFYRAVIAEFVATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q+D  AGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL LAR
Sbjct  59   VIGYKIQSDTTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLAR  118

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RA+LYM+AQCLGAICGV
Sbjct  119  KVSLVRAILYMVAQCLGAICGV  140



>gb|ADK25057.1| plasma membrane intrinsic protein [Glycine max]
Length=286

 Score =   214 bits (546),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 125/141 (89%), Gaps = 1/141 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE V EQ  E+SAKDYHDPPP+PL D +ELT+WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVE-VQEQGGEYSAKDYHDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  59

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            +IGYK QTD   GG DC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  60   IIGYKRQTDTTVGGTDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  119

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RA+LYM+AQC GAICG
Sbjct  120  KVSLIRALLYMVAQCAGAICG  140



>ref|NP_001240223.1| prolactin-inducible protein [Glycine max]
 gb|ACU20043.1| unknown [Glycine max]
Length=286

 Score =   214 bits (546),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 125/141 (89%), Gaps = 1/141 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE V EQ  E+SAKDYHDPPP+PL D +ELT+WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVE-VQEQGGEYSAKDYHDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  59

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            +IGYK QTD   GG DC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  60   IIGYKRQTDTTVGGTDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  119

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RA+LYM+AQC GAICG
Sbjct  120  KVSLIRALLYMVAQCAGAICG  140



>gb|KJB11821.1| hypothetical protein B456_002G2484001 [Gossypium raimondii]
Length=285

 Score =   214 bits (546),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 123/141 (87%), Gaps = 4/141 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE       EF AKDYHDPPP+PL+D  ELT+WSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV----GGEFQAKDYHDPPPAPLVDAQELTQWSFYRAIIAEFIATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q DP  GGQDC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQVDPDKGGQDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RA+LYM AQCLGAICG
Sbjct  117  KVSLVRAILYMAAQCLGAICG  137



>gb|KJB62459.1| hypothetical protein B456_009G418100 [Gossypium raimondii]
Length=285

 Score =   214 bits (546),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 123/141 (87%), Gaps = 4/141 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E       EF AKDYHDPPP+PL+D  EL KWSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEV----GGEFQAKDYHDPPPAPLVDAQELAKWSFYRAVIAEFIATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK QTDP  GG+DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKTQTDPAKGGEDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RA+ YM AQCLGAICG
Sbjct  117  KVSLVRAIFYMGAQCLGAICG  137



>ref|XP_010253676.1| PREDICTED: aquaporin PIP2-4-like [Nelumbo nucifera]
Length=287

 Score =   214 bits (546),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 128/142 (90%), Gaps = 2/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE+   + ++FSAKDYHDPPP+ LID DEL+KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVES--SEHSQFSAKDYHDPPPASLIDPDELSKWSFYRALIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK QTD    G DCGGVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKRQTDSSHNGTDCGGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAV+Y+IAQCLGAICGV
Sbjct  119  KVSLIRAVMYIIAQCLGAICGV  140



>ref|XP_003606384.1| Aquaporin PIP2-7 [Medicago truncatula]
 gb|AES88581.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=204

 Score =   212 bits (539),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 124/141 (88%), Gaps = 2/141 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE   ++  E+SAKDY DPPP+PLID +ELTKWSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEV--QEQGEYSAKDYQDPPPAPLIDVEELTKWSFYRALIAEFVATLLFLYVTVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            +IGY HQ+DPKAGG DC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF+ R
Sbjct  59   IIGYSHQSDPKAGGTDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFVGR  118

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RAV YM AQ  GAICG
Sbjct  119  KVSLIRAVFYMAAQSAGAICG  139



>ref|XP_007143702.1| hypothetical protein PHAVU_007G094600g [Phaseolus vulgaris]
 gb|AGV54658.1| aquaporin PIP2 [Phaseolus vulgaris]
 gb|ESW15696.1| hypothetical protein PHAVU_007G094600g [Phaseolus vulgaris]
Length=287

 Score =   214 bits (546),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 126/142 (89%), Gaps = 2/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE    +   FS KDYHDPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEVT--ERGSFSGKDYHDPPPAPLIDTEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYKHQ+D K  G  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKHQSDLKDHGDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RA++YM+AQCLGAICGV
Sbjct  119  KVSLIRAIMYMVAQCLGAICGV  140



>gb|ABK60195.2| PIP2 protein [Gossypium hirsutum]
Length=285

 Score =   214 bits (546),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 122/141 (87%), Gaps = 4/141 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE       EF AKDYHDPPP+PL+D  ELT+WSFYRA+IAEFIA LLFLY+TVLT
Sbjct  1    MAKDVEV----GGEFQAKDYHDPPPAPLVDAQELTQWSFYRAIIAEFIAALLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q DP  GGQDC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQVDPDKGGQDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RA+LYM AQCLGAICG
Sbjct  117  KVSLVRAILYMAAQCLGAICG  137



>gb|KHG29841.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=291

 Score =   214 bits (546),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 126/145 (87%), Gaps = 4/145 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQP--AEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtv  232
            MTKD+E   EQ   AEFSAKDYHDPPP+PLID +ELTKWS YRA IAEFIATLLFLYVTV
Sbjct  1    MTKDIETTAEQGGGAEFSAKDYHDPPPAPLIDMEELTKWSLYRAAIAEFIATLLFLYVTV  60

Query  233  ltvIGYKHQTDP--KAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL  406
            LTVIGYK QTDP       DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL
Sbjct  61   LTVIGYKVQTDPVKNTNDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL  120

Query  407  FLARKVTLPRAVLYMIAQCLGAICG  481
            F+ RKV+L RA+LYM+AQCLGAICG
Sbjct  121  FVGRKVSLIRALLYMVAQCLGAICG  145



>ref|XP_008785285.1| PREDICTED: aquaporin PIP2-4 [Phoenix dactylifera]
Length=287

 Score =   214 bits (546),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 125/143 (87%), Gaps = 3/143 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVEA  E   EF+AKDY DPPP+PLID +ELTKWS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MGKDVEAAAEA-GEFTAKDYTDPPPAPLIDAEELTKWSLYRAVIAEFIATLLFLYITVAT  59

Query  239  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  412
            VIGYKHQ+D   GG D  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  60   VIGYKHQSDANVGGADAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  119

Query  413  ARKVTLPRAVLYMIAQCLGAICG  481
            ARKV+L RA+LYMIAQCLGAICG
Sbjct  120  ARKVSLIRALLYMIAQCLGAICG  142



>gb|AAB67868.1| plasma membrane major intrinsic protein 1 [Beta vulgaris]
Length=288

 Score =   214 bits (546),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 127/143 (89%), Gaps = 1/143 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPA-EFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvl  235
            MTKDVEAV EQ   EFS KDYHDPPP+PLID +EL KWSFYRA+IAEF+ATLLFLYVTVL
Sbjct  1    MTKDVEAVSEQQQPEFSTKDYHDPPPAPLIDMEELKKWSFYRAIIAEFVATLLFLYVTVL  60

Query  236  tvIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  415
            TVIG+    D + GG++C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  61   TVIGHFRSADLENGGENCTGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  120

Query  416  RKVTLPRAVLYMIAQCLGAICGV  484
            RKV+L RA+ YM+AQCLGAICGV
Sbjct  121  RKVSLIRALAYMVAQCLGAICGV  143



>ref|XP_010504105.1| PREDICTED: aquaporin PIP2-1-like [Camelina sativa]
 ref|XP_010515832.1| PREDICTED: aquaporin PIP2-1-like [Camelina sativa]
Length=287

 Score =   214 bits (545),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 125/142 (88%), Gaps = 2/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE VP +   F  +DY DPPP+P  D  EL KWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVETVPGE--GFQTRDYQDPPPAPFFDGAELKKWSFYRAVIAEFVATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q+D KAGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKIQSDVKAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+LPRAVLY+IAQCLGAICGV
Sbjct  119  KVSLPRAVLYIIAQCLGAICGV  140



>gb|ABK60196.1| PIP2 protein [Gossypium hirsutum]
Length=286

 Score =   214 bits (545),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 123/141 (87%), Gaps = 4/141 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E       EF AKDYHDPPP+PL+D  EL KWSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEV----GGEFQAKDYHDPPPAPLVDAQELAKWSFYRAVIAEFIATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK QTDP  GG+DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKTQTDPAKGGEDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RA+ YM AQCLGAICG
Sbjct  117  KVSLVRAIFYMGAQCLGAICG  137



>gb|AHG32324.1| PIP2-3 [Pisum sativum]
Length=287

 Score =   214 bits (545),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 126/142 (89%), Gaps = 2/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE    +   FS KDYHDPPP+PLID +ELTKWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVEV--AERGSFSNKDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYVTVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGY  QTD KAGG +CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYSIQTDVKAGGDECGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAV+YM+AQ LGAICGV
Sbjct  119  KVSLIRAVMYMVAQSLGAICGV  140



>ref|XP_002530280.1| Aquaporin PIP2.1, putative [Ricinus communis]
 gb|EEF32087.1| Aquaporin PIP2.1, putative [Ricinus communis]
Length=287

 Score =   214 bits (545),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE       EFSAKDYHDPPP+PLID DEL KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEVAEATGGEFSAKDYHDPPPAPLIDVDELGKWSFYRALIAEFIATLLFLYITVLT  60

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK QTDP      CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  61   VIGYKSQTDPDKNADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  120

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RA+ YM+AQCLGAICG
Sbjct  121  KVSLIRALGYMVAQCLGAICG  141



>ref|XP_010920406.1| PREDICTED: aquaporin PIP2-4 isoform X2 [Elaeis guineensis]
Length=238

 Score =   213 bits (541),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 126/144 (88%), Gaps = 6/144 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+EA     AEF+AKDY DPPP+PL+D +ELTKWS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MRKDMEA----GAEFTAKDYTDPPPAPLVDAEELTKWSLYRAVIAEFIATLLFLYITVAT  56

Query  239  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  412
            VIGYKHQ+DP   G D  C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFL
Sbjct  57   VIGYKHQSDPNVSGPDAACNGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFL  116

Query  413  ARKVTLPRAVLYMIAQCLGAICGV  484
            ARKV+L RA+LYMIAQCLGAICGV
Sbjct  117  ARKVSLIRALLYMIAQCLGAICGV  140



>gb|AEC45513.1| plasma membrane intrinsic protein [Hevea brasiliensis]
Length=278

 Score =   214 bits (544),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 122/141 (87%), Gaps = 1/141 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE V E P EFSAKDYHDPPP+PLID +EL KWS YRA+IAEFIATLLFLY TVLT
Sbjct  1    MAKDVE-VAENPGEFSAKDYHDPPPAPLIDVEELGKWSLYRALIAEFIATLLFLYNTVLT  59

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK QTDP      CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVT GLFL R
Sbjct  60   VIGYKSQTDPLKNADVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTLGLFLGR  119

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RA+LYM+AQCLGAICG
Sbjct  120  KVSLIRALLYMVAQCLGAICG  140



>gb|AGD98714.1| aquaporin protein 11 [Camellia sinensis]
Length=287

 Score =   214 bits (545),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M K+VE       EFSAKDYHDPPP+PL+D  ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKEVEETVVTEQEFSAKDYHDPPPAPLVDAVELTKWSFYRAIIAEFIATLLFLYITVLT  60

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK QTDP      CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   VIGYKSQTDPIKNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  120

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RA+LYM+AQC GAICGV
Sbjct  121  KVSLIRALLYMVAQCSGAICGV  142



>ref|XP_008791535.1| PREDICTED: aquaporin PIP2-4-like [Phoenix dactylifera]
Length=287

 Score =   214 bits (545),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 124/143 (87%), Gaps = 3/143 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVEA  E   EF+AKDY DPPP+PLID +ELT WS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MGKDVEAAAEA-GEFTAKDYMDPPPAPLIDVEELTTWSLYRAVIAEFIATLLFLYITVAT  59

Query  239  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  412
            VIGYKHQ+DP   G D  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  60   VIGYKHQSDPNVNGTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  119

Query  413  ARKVTLPRAVLYMIAQCLGAICG  481
            ARKV+L RA+LYMIAQCLGAICG
Sbjct  120  ARKVSLIRALLYMIAQCLGAICG  142



>ref|NP_001047491.1| Os02g0629200 [Oryza sativa Japonica Group]
 sp|Q6K215.1|PIP22_ORYSJ RecName: Full=Probable aquaporin PIP2-2; AltName: Full=OsPIP2;2; 
AltName: Full=Plasma membrane intrinsic protein 2-2 [Oryza 
sativa Japonica Group]
 dbj|BAD23735.1| putative plasma membrane integral protein [Oryza sativa Japonica 
Group]
 dbj|BAF09405.1| Os02g0629200 [Oryza sativa Japonica Group]
 dbj|BAG88109.1| unnamed protein product [Oryza sativa Japonica Group]
Length=288

 Score =   214 bits (544),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 124/144 (86%), Gaps = 2/144 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+EA   +  EFSAKDY DPPP+PLID +ELTKWS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MAKDIEASAPEGGEFSAKDYTDPPPAPLIDVEELTKWSLYRAVIAEFIATLLFLYITVAT  60

Query  239  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  412
            VIGYKHQ+D      D  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  61   VIGYKHQSDATVNTTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  120

Query  413  ARKVTLPRAVLYMIAQCLGAICGV  484
            ARKV+L RAVLY+IAQCLGAICGV
Sbjct  121  ARKVSLIRAVLYIIAQCLGAICGV  144



>gb|EAY86778.1| hypothetical protein OsI_08158 [Oryza sativa Indica Group]
Length=288

 Score =   214 bits (544),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 124/144 (86%), Gaps = 2/144 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+EA   +  EFSAKDY DPPP+PLID +ELTKWS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MAKDIEASAPEGGEFSAKDYTDPPPAPLIDVEELTKWSLYRAVIAEFIATLLFLYITVAT  60

Query  239  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  412
            VIGYKHQ+D      D  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  61   VIGYKHQSDATVNTTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  120

Query  413  ARKVTLPRAVLYMIAQCLGAICGV  484
            ARKV+L RAVLY+IAQCLGAICGV
Sbjct  121  ARKVSLIRAVLYIIAQCLGAICGV  144



>gb|AFK35635.1| unknown [Medicago truncatula]
Length=162

 Score =   209 bits (533),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 124/142 (87%), Gaps = 2/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE    +   FS KDYHDPPP+PLID +ELTKWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVEV--AERGSFSNKDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYVTVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGY  QTD KAGG  CGGVGILGIAWAFGGMIF+LVYC AGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYSIQTDVKAGGDACGGVGILGIAWAFGGMIFVLVYCIAGISGGHINPAVTFGLFLAR  118

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RA++YM+AQCLGAI GV
Sbjct  119  KVSLIRAIMYMVAQCLGAIAGV  140



>gb|EMT09900.1| Putative aquaporin PIP2-2 [Aegilops tauschii]
Length=315

 Score =   214 bits (546),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 126/144 (88%), Gaps = 3/144 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+EA P Q  EFS KDY DPPP+P++DF+ELTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAAP-QGGEFSTKDYSDPPPAPIVDFEELTKWSLYRAVIAEFVATLLFLYITVAT  59

Query  239  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  412
            VIGYKHQ+DP     D  C GVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLFL
Sbjct  60   VIGYKHQSDPTVNTTDAACSGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFL  119

Query  413  ARKVTLPRAVLYMIAQCLGAICGV  484
            ARKV+L RA+LY+IAQCLGAICGV
Sbjct  120  ARKVSLIRALLYIIAQCLGAICGV  143



>ref|XP_003536353.1| PREDICTED: aquaporin PIP2-1-like isoform 1 [Glycine max]
 gb|KHN17135.1| Aquaporin PIP2-2 [Glycine soja]
Length=287

 Score =   214 bits (544),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 125/142 (88%), Gaps = 2/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE    +   FS KDY DPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--AERGSFSGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGY HQTD K  G+ CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYNHQTDLKENGEICGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RA++YM+AQCLGAICGV
Sbjct  119  KVSLIRAIMYMVAQCLGAICGV  140



>ref|XP_009628968.1| PREDICTED: probable aquaporin PIP2-1 [Nicotiana tomentosiformis]
 tpg|DAA64679.1| TPA_exp: aquaporin PIP2 5 [Nicotiana tabacum]
Length=283

 Score =   214 bits (544),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 126/142 (89%), Gaps = 4/142 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVEA      EFSAKDY DPPP+PLIDF+EL +WSFYRA IAEFIATLLFLYVTVLT
Sbjct  1    MGKDVEA----ATEFSAKDYTDPPPAPLIDFEELKQWSFYRAAIAEFIATLLFLYVTVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYKHQ+D  A G  CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKHQSDVDANGDVCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  116

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RA++YM+AQCLGAICGV
Sbjct  117  KVSLIRALVYMVAQCLGAICGV  138



>ref|NP_001234625.1| aquaporin [Solanum lycopersicum]
 gb|ADU34070.1| aquaporin [Solanum lycopersicum]
 dbj|BAO18627.1| plasmamembrane intrinsic protein 2;4 [Solanum lycopersicum]
Length=280

 Score =   213 bits (543),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 126/142 (89%), Gaps = 7/142 (5%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            MTK+V        +FSAKDY DPPP+PL+DF+EL +WSFYRA+IAEFIATLLFLYVT+LT
Sbjct  1    MTKEVT-------DFSAKDYTDPPPAPLVDFEELRQWSFYRAIIAEFIATLLFLYVTILT  53

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYKHQ D  AGG  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  54   VIGYKHQADVDAGGDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  113

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAVLYM+AQCLGAICGV
Sbjct  114  KVSLIRAVLYMVAQCLGAICGV  135



>dbj|BAA23744.1| HvPIP2;1 [Hordeum vulgare subsp. vulgare]
Length=286

 Score =   213 bits (543),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 126/144 (88%), Gaps = 3/144 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+EA P Q  EFS+KDY DPPP+P++DF+ELTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAAP-QGGEFSSKDYSDPPPAPIVDFEELTKWSLYRAVIAEFVATLLFLYITVAT  59

Query  239  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  412
            VIGYKHQ+DP     D  C GVG LGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLFL
Sbjct  60   VIGYKHQSDPTVNTTDAACSGVGTLGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFL  119

Query  413  ARKVTLPRAVLYMIAQCLGAICGV  484
            ARKV+L RA+LY+IAQCLGAICGV
Sbjct  120  ARKVSLIRALLYIIAQCLGAICGV  143



>emb|CAB45651.1| putative plasma membrane intrinsic protein [Pisum sativum]
Length=285

 Score =   213 bits (543),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 123/141 (87%), Gaps = 2/141 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE   ++  E+SAKDY DPPP+PLID DELTKWSFYRA+IAEF+ATLLFLYVT+LT
Sbjct  1    MAKDVEV--QEQGEYSAKDYQDPPPAPLIDLDELTKWSFYRALIAEFVATLLFLYVTILT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            +IGY HQTD  AGG DC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF+ R
Sbjct  59   IIGYSHQTDANAGGTDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFVGR  118

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RAV YM AQC GA+CG
Sbjct  119  KVSLLRAVFYMAAQCAGAVCG  139



>ref|XP_009794928.1| PREDICTED: LOW QUALITY PROTEIN: probable aquaporin PIP2-1 [Nicotiana 
sylvestris]
Length=282

 Score =   213 bits (542),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 125/142 (88%), Gaps = 4/142 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVEA      EFSAKDY DPPP+PLIDF+EL +WSFYRA IAEFIATLLFLYVTV T
Sbjct  1    MGKDVEAA----TEFSAKDYTDPPPAPLIDFEELKQWSFYRAAIAEFIATLLFLYVTVFT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYKHQ+D  A G  CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKHQSDVDANGDVCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  116

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RA++YM+AQCLGAICGV
Sbjct  117  KVSLIRALVYMVAQCLGAICGV  138



>gb|KHN05685.1| Aquaporin PIP2-7 [Glycine soja]
Length=286

 Score =   213 bits (542),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 125/141 (89%), Gaps = 1/141 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE V EQ  E+SAKDYHDPPP+PL D +ELT+WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVE-VQEQGGEYSAKDYHDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  59

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            +IGYK QTD   GG +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  60   IIGYKRQTDTTVGGTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  119

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RA+LYM+AQC GAICG
Sbjct  120  KVSLIRALLYMVAQCAGAICG  140



>gb|AAO39007.1| plasma intrinsic protein 2,1 [Juglans regia]
Length=287

 Score =   213 bits (542),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 124/141 (88%), Gaps = 2/141 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+EA  +    FSAKDYHDPPP+PLID +E T+WSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEAAGQ--GGFSAKDYHDPPPAPLIDAEEFTQWSFYRAIIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK QTD   GG DCGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQTDKAKGGDDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RAV YM AQCLGA+CG
Sbjct  119  KVSLVRAVFYMAAQCLGAVCG  139



>gb|AAO39008.1| plasma intrinsic protein 2,2 [Juglans regia]
Length=287

 Score =   213 bits (542),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 124/141 (88%), Gaps = 2/141 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+EA  +    FSAKDYHDPPP+PLID +E T+WSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEAAGQ--GGFSAKDYHDPPPAPLIDAEEFTQWSFYRAIIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK QTD   GG DCGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQTDKAKGGDDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RAV YM AQCLGA+CG
Sbjct  119  KVSLVRAVFYMAAQCLGAVCG  139



>emb|CDY56697.1| BnaCnng31040D [Brassica napus]
Length=287

 Score =   213 bits (542),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 125/142 (88%), Gaps = 2/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVEAV  +   F  +DY DPPP+PL D +ELTKWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEAVSGE--GFQTRDYQDPPPAPLFDPEELTKWSFYRAVIAEFVATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK QTD  AGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL LAR
Sbjct  59   VIGYKIQTDSTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLAR  118

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RA+LYM+AQCLGAICGV
Sbjct  119  KVSLVRAILYMVAQCLGAICGV  140



>ref|NP_181254.1| aquaporin PIP2-2 [Arabidopsis thaliana]
 sp|P43287.2|PIP22_ARATH RecName: Full=Aquaporin PIP2-2; AltName: Full=Plasma membrane 
intrinsic protein 2-2; Short=AtPIP2;2; AltName: Full=Plasma 
membrane intrinsic protein 2b; Short=PIP2b; AltName: Full=TMP2b; 
Contains: RecName: Full=Aquaporin PIP2-2, N-terminally 
processed [Arabidopsis thaliana]
 gb|AAD18142.1| aquaporin (plasma membrane intrinsic protein 2B) [Arabidopsis 
thaliana]
 gb|AEC09362.1| aquaporin PIP2-2 [Arabidopsis thaliana]
Length=285

 Score =   213 bits (542),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 123/142 (87%), Gaps = 4/142 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE     P  F  +DY DPPP+P  D DELTKWS YRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEG----PEGFQTRDYEDPPPTPFFDADELTKWSLYRAVIAEFVATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q+D KAGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKIQSDTKAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAVLYM+AQCLGAICGV
Sbjct  117  KVSLIRAVLYMVAQCLGAICGV  138



>emb|CAA53478.1| plasma membrane intrinsic protein 2b [Arabidopsis thaliana]
Length=285

 Score =   213 bits (542),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 123/142 (87%), Gaps = 4/142 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE     P  F  +DY DPPP+P  D DELTKWS YRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEG----PEGFQTRDYEDPPPTPFFDADELTKWSLYRAVIAEFVATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q+D KAGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKIQSDTKAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAVLYM+AQCLGAICGV
Sbjct  117  KVSLIRAVLYMVAQCLGAICGV  138



>gb|KHN38765.1| Aquaporin PIP2-7 [Glycine soja]
Length=286

 Score =   213 bits (541),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 125/141 (89%), Gaps = 1/141 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE V EQ  E+SAKDYHDPPP+PL D +ELT+WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVE-VQEQGGEYSAKDYHDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  59

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            +IGYK QTD   GG +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  60   IIGYKRQTDATLGGTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  119

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RA+LYM+AQC GAICG
Sbjct  120  KVSLIRALLYMVAQCAGAICG  140



>gb|ACU00104.1| plasma membrane intrinsic protein PIP2.2 [Populus trichocarpa 
x Populus deltoides]
Length=285

 Score =   213 bits (541),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 125/141 (89%), Gaps = 4/141 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E       EFSAKDYHDPPP+PLID +E+T+WSFYRA+IAEF+ATLLFLY+TVLT
Sbjct  1    MGKDIEV----GGEFSAKDYHDPPPAPLIDAEEITQWSFYRAIIAEFVATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK QTD    G +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQTDVNKNGDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RA+LYM+AQCLGAICG
Sbjct  117  KVSLVRAILYMVAQCLGAICG  137



>ref|XP_010920407.1| PREDICTED: probable aquaporin PIP2-2 [Elaeis guineensis]
Length=287

 Score =   213 bits (541),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 125/144 (87%), Gaps = 3/144 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVEA  E   EF+AKDY DPPP+ LID +E+ KWS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MGKDVEAAAEG-GEFTAKDYTDPPPAALIDAEEMIKWSLYRAVIAEFIATLLFLYITVAT  59

Query  239  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  412
            VIGYKHQ+DP  GG D  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  60   VIGYKHQSDPNVGGADAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  119

Query  413  ARKVTLPRAVLYMIAQCLGAICGV  484
            ARKV+L RA+LYMIAQCLGAICGV
Sbjct  120  ARKVSLVRALLYMIAQCLGAICGV  143



>ref|XP_003538174.1| PREDICTED: aquaporin PIP2-7 [Glycine max]
Length=286

 Score =   213 bits (541),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 125/141 (89%), Gaps = 1/141 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE V EQ  E+SAKDYHDPPP+PL D +ELT+WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVE-VQEQGGEYSAKDYHDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  59

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            +IGYK QTD   GG +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  60   IIGYKRQTDATLGGTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  119

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RA+LYM+AQC GAICG
Sbjct  120  KVSLIRALLYMVAQCAGAICG  140



>ref|XP_010934344.1| PREDICTED: aquaporin PIP2-4-like [Elaeis guineensis]
Length=282

 Score =   213 bits (541),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 125/144 (87%), Gaps = 8/144 (6%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVEA      EF+AKDY DPPP+PLID +EL KWS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MGKDVEA------EFTAKDYTDPPPAPLIDAEELAKWSLYRAVIAEFIATLLFLYITVAT  54

Query  239  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  412
            VIGYKHQ+DP  GG D  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  55   VIGYKHQSDPNVGGADAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  114

Query  413  ARKVTLPRAVLYMIAQCLGAICGV  484
            ARKV+L RA+LYMIAQCLGAICGV
Sbjct  115  ARKVSLIRALLYMIAQCLGAICGV  138



>tpg|DAA33865.1| TPA_inf: aquaporin PIP2;10 [Gossypium hirsutum]
Length=271

 Score =   212 bits (540),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 125/145 (86%), Gaps = 4/145 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQP--AEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtv  232
            MTKD+E   EQ   AEFSAKDY DPPP+PLID +ELTKWS YRA IAEFIATLLFLYVTV
Sbjct  1    MTKDIETTAEQGGGAEFSAKDYQDPPPAPLIDLEELTKWSLYRAAIAEFIATLLFLYVTV  60

Query  233  ltvIGYKHQTDP--KAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL  406
            LTVIGYK QTDP       DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL
Sbjct  61   LTVIGYKVQTDPVKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL  120

Query  407  FLARKVTLPRAVLYMIAQCLGAICG  481
            F+ RKV+L RA+LYM+AQCLGAICG
Sbjct  121  FVGRKVSLIRALLYMVAQCLGAICG  145



>gb|KHG30776.1| Aquaporin PIP2-2 -like protein [Gossypium arboreum]
Length=285

 Score =   212 bits (540),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 122/141 (87%), Gaps = 4/141 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE       EF AKDYHDPPP+PL+D  ELT+WSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV----GGEFQAKDYHDPPPAPLVDAQELTQWSFYRAIIAEFIATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q DP  G QDC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQVDPDKGSQDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RA+LYM AQCLGAICG
Sbjct  117  KVSLVRAILYMAAQCLGAICG  137



>ref|XP_002519539.1| Aquaporin PIP2.2, putative [Ricinus communis]
 gb|EEF42953.1| Aquaporin PIP2.2, putative [Ricinus communis]
Length=288

 Score =   212 bits (540),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 123/141 (87%), Gaps = 1/141 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE V     EF AKDYHDPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDVE-VGGHGGEFHAKDYHDPPPAPLIDAEELTKWSFYRAIIAEFIATLLFLYITVLT  59

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK QTDP      CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   VIGYKSQTDPAKNADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  119

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RA++YM AQCLGAICG
Sbjct  120  KVSLVRAIMYMAAQCLGAICG  140



>ref|XP_002322877.1| major intrinsic protein 1 [Populus trichocarpa]
 gb|ABK93143.1| unknown [Populus trichocarpa]
 gb|ABK94547.1| unknown [Populus trichocarpa]
 gb|EEF04638.1| major intrinsic protein 1 [Populus trichocarpa]
Length=285

 Score =   212 bits (539),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 125/141 (89%), Gaps = 4/141 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E       EFSAKDYHDPPP+PLID +E+T+WSFYRA+IAEF+ATLLFLY+TVLT
Sbjct  1    MGKDIEV----GGEFSAKDYHDPPPAPLIDAEEITQWSFYRAIIAEFVATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK QTD    G +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQTDVNKNGDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RA+LYM+AQCLGAICG
Sbjct  117  KVSLVRAILYMVAQCLGAICG  137



>ref|NP_001289999.1| aquaporin PIP2-1 [Beta vulgaris subsp. vulgaris]
 gb|ACT22630.1| plasma membrane intrinsic protein PIP2;2 [Beta vulgaris subsp. 
vulgaris]
Length=288

 Score =   212 bits (540),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 126/143 (88%), Gaps = 1/143 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPA-EFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvl  235
            MTKDVEAV EQ   EFS KDYHDPPP+PLID +EL KWSFYRA+IAEF+ATLLFLYVTVL
Sbjct  1    MTKDVEAVSEQQQPEFSTKDYHDPPPAPLIDMEELKKWSFYRAIIAEFVATLLFLYVTVL  60

Query  236  tvIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  415
            TVIG+    D + GG++C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVT GLFLA
Sbjct  61   TVIGHFRSADLENGGENCTGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTIGLFLA  120

Query  416  RKVTLPRAVLYMIAQCLGAICGV  484
            RKV+L RA+ YM+AQCLGAICGV
Sbjct  121  RKVSLIRALAYMVAQCLGAICGV  143



>gb|EYU42155.1| hypothetical protein MIMGU_mgv1a011301mg [Erythranthe guttata]
Length=286

 Score =   212 bits (539),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 125/142 (88%), Gaps = 1/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE   + PA FSAKDYHDPPP+PL D  ELT+WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVECA-DPPAGFSAKDYHDPPPAPLFDCGELTQWSFYRALIAEFIATLLFLYVTVLT  59

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q+D   GG  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  60   VIGYKVQSDAVHGGDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  119

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAVLYM+AQCLGAICGV
Sbjct  120  KVSLIRAVLYMVAQCLGAICGV  141



>gb|KDP44053.1| hypothetical protein JCGZ_05520 [Jatropha curcas]
Length=286

 Score =   212 bits (539),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 122/141 (87%), Gaps = 1/141 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE V E   EFS KDYHDPPP+PLID DEL +WSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVE-VAEPTGEFSGKDYHDPPPAPLIDMDELGQWSFYRALIAEFIATLLFLYITVLT  59

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK QTDP      CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  60   VIGYKSQTDPNKNADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  119

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RA+ YMIAQCLGAICG
Sbjct  120  KVSLIRALGYMIAQCLGAICG  140



>ref|XP_010920405.1| PREDICTED: aquaporin PIP2-4 isoform X1 [Elaeis guineensis]
Length=285

 Score =   212 bits (539),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 126/144 (88%), Gaps = 6/144 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+EA     AEF+AKDY DPPP+PL+D +ELTKWS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MRKDMEA----GAEFTAKDYTDPPPAPLVDAEELTKWSLYRAVIAEFIATLLFLYITVAT  56

Query  239  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  412
            VIGYKHQ+DP   G D  C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFL
Sbjct  57   VIGYKHQSDPNVSGPDAACNGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFL  116

Query  413  ARKVTLPRAVLYMIAQCLGAICGV  484
            ARKV+L RA+LYMIAQCLGAICGV
Sbjct  117  ARKVSLIRALLYMIAQCLGAICGV  140



>ref|NP_001240039.1| uncharacterized protein LOC100782155 [Glycine max]
 gb|ACU23140.1| unknown [Glycine max]
 gb|KHN32778.1| Aquaporin PIP2-2 [Glycine soja]
Length=285

 Score =   211 bits (538),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = +2

Query  89   QPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTDP  268
            +   FSAKDYHDPPP+PLID +ELT+WSFYRA+IAEFIAT+LFLY+TVLTVIGYK Q+D 
Sbjct  7    EGGSFSAKDYHDPPPAPLIDAEELTQWSFYRALIAEFIATMLFLYITVLTVIGYKSQSDV  66

Query  269  KAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLY  448
            KAGG  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV+L RA++Y
Sbjct  67   KAGGDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAIMY  126

Query  449  MIAQCLGAICGV  484
            M+AQCLGAICGV
Sbjct  127  MVAQCLGAICGV  138



>dbj|BAA32778.1| Plasma membrane aquaporin (PAQ2) [Raphanus sativus]
Length=287

 Score =   212 bits (539),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 125/142 (88%), Gaps = 2/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVEAV  +   F  +DY DPPP+PL D +ELTKWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEAVSGE--GFQTRDYQDPPPAPLFDPEELTKWSFYRAVIAEFVATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK +TD  AGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL LAR
Sbjct  59   VIGYKIETDSTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLAR  118

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RA+LYM+AQCLGAICGV
Sbjct  119  KVSLVRAILYMVAQCLGAICGV  140



>gb|KHG10662.1| Aquaporin PIP2-1 -like protein [Gossypium arboreum]
 gb|KJB36605.1| hypothetical protein B456_006G166800 [Gossypium raimondii]
 gb|KJB36607.1| hypothetical protein B456_006G166800 [Gossypium raimondii]
Length=285

 Score =   211 bits (538),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 122/141 (87%), Gaps = 4/141 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE       EF AKDYHDPPP+PL+D +ELTKWSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV----GGEFQAKDYHDPPPAPLVDGEELTKWSFYRAVIAEFIATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q DP  G  +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQVDPDKGSDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RA+ YM AQCLGAICG
Sbjct  117  KVSLVRAIFYMAAQCLGAICG  137



>ref|XP_009116034.1| PREDICTED: aquaporin PIP2-1 [Brassica rapa]
 gb|AAD39373.1|AF118382_1 plasma membrane intrinsic protein 1 [Brassica napus]
 emb|CDX78177.1| BnaA09g33720D [Brassica napus]
Length=287

 Score =   211 bits (538),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 124/142 (87%), Gaps = 2/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVEAV  +   F  +DY DPPP+PL D  ELTKWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEAVSGE--GFQTRDYQDPPPAPLFDPAELTKWSFYRAVIAEFVATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK QTD  AGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL LAR
Sbjct  59   VIGYKIQTDSTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLAR  118

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RA+LYM+AQCLGAICGV
Sbjct  119  KVSLVRAILYMVAQCLGAICGV  140



>gb|KHN00691.1| Aquaporin PIP2-2 [Glycine soja]
Length=285

 Score =   211 bits (538),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = +2

Query  89   QPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTDP  268
            +   FSAKDYHDPPP+PLID +ELT+WSFYRA+IAEFIATLLFLY+TVLTVIGYK Q+D 
Sbjct  7    EGGSFSAKDYHDPPPAPLIDAEELTQWSFYRALIAEFIATLLFLYITVLTVIGYKSQSDV  66

Query  269  KAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLY  448
            KAGG  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV+L RA++Y
Sbjct  67   KAGGDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAIMY  126

Query  449  MIAQCLGAICGV  484
            M+AQCLGAICGV
Sbjct  127  MVAQCLGAICGV  138



>ref|NP_001235204.1| Pip1 protein [Glycine max]
 gb|AAA69490.1| putative water channel protein; plasmalemma intrinsic protein; 
similar to Arabidopsis Pip2a gene product, PIR Accession Number 
S44084 [Glycine max]
Length=285

 Score =   211 bits (538),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = +2

Query  89   QPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTDP  268
            +   FSAKDYHDPPP+PLID +ELT+WSFYRA+IAEFIATLLFLY+TVLTVIGYK Q+D 
Sbjct  7    EGGSFSAKDYHDPPPAPLIDAEELTQWSFYRALIAEFIATLLFLYITVLTVIGYKSQSDV  66

Query  269  KAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLY  448
            KAGG  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV+L RA++Y
Sbjct  67   KAGGDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAIMY  126

Query  449  MIAQCLGAICGV  484
            M+AQCLGAICGV
Sbjct  127  MVAQCLGAICGV  138



>emb|CDX74983.1| BnaA05g07290D [Brassica napus]
Length=197

 Score =   208 bits (530),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 123/142 (87%), Gaps = 4/142 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE        F+A+DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEGAEG----FAARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK  +D KAGG +CGGVGILGI+WAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKISSDTKAGGDECGGVGILGISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAVLYM+AQCLGAICGV
Sbjct  117  KVSLIRAVLYMVAQCLGAICGV  138



>gb|AFK47442.1| unknown [Medicago truncatula]
Length=287

 Score =   211 bits (538),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 125/142 (88%), Gaps = 2/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE    +   FS KDYHDPPP+PLID +ELTKWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVEV--AERGSFSNKDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYVTVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGY  QTD KAGG  CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYSIQTDVKAGGDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RA++YM+AQCLGAI GV
Sbjct  119  KVSLIRAIMYMVAQCLGAIAGV  140



>ref|XP_003606383.1| Aquaporin PIP2-7 [Medicago truncatula]
 gb|AES88580.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
 gb|AFK45158.1| unknown [Medicago truncatula]
Length=285

 Score =   211 bits (538),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 124/141 (88%), Gaps = 2/141 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE   ++  E+SAKDY DPPP+PLID +ELTKWSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEV--QEQGEYSAKDYQDPPPAPLIDVEELTKWSFYRALIAEFVATLLFLYVTVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            +IGY HQ+DPKAGG DC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF+ R
Sbjct  59   IIGYSHQSDPKAGGTDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFVGR  118

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RAV YM AQ  GAICG
Sbjct  119  KVSLIRAVFYMAAQSAGAICG  139



>gb|KDP44363.1| hypothetical protein JCGZ_20043 [Jatropha curcas]
Length=285

 Score =   211 bits (537),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 123/142 (87%), Gaps = 4/142 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDV     +   FSAKDYHDPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MVKDVA----EQGSFSAKDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK QTDP      CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQTDPAKNADSCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAV+YM+AQ LGAICGV
Sbjct  117  KVSLVRAVMYMVAQSLGAICGV  138



>ref|XP_007151871.1| hypothetical protein PHAVU_004G082600g [Phaseolus vulgaris]
 gb|ESW23865.1| hypothetical protein PHAVU_004G082600g [Phaseolus vulgaris]
Length=285

 Score =   211 bits (537),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +2

Query  89   QPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTDP  268
            +   FSAKDYHDPPP+PLID  ELT+WSFYRA+IAEFIATLLFLY+TVLTVIGYK Q+D 
Sbjct  7    EGGSFSAKDYHDPPPAPLIDAQELTQWSFYRALIAEFIATLLFLYITVLTVIGYKSQSDA  66

Query  269  KAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLY  448
            KAGG  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV+L RA++Y
Sbjct  67   KAGGDLCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAIMY  126

Query  449  MIAQCLGAICGV  484
            M+AQCLGAICGV
Sbjct  127  MVAQCLGAICGV  138



>ref|XP_006294744.1| hypothetical protein CARUB_v10023789mg [Capsella rubella]
 gb|EOA27642.1| hypothetical protein CARUB_v10023789mg [Capsella rubella]
Length=285

 Score =   211 bits (537),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 122/142 (86%), Gaps = 4/142 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE     P  F  +DY DPPP+P  D DELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEG----PEGFQTRDYEDPPPTPFFDADELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q+D  AGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKIQSDTTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAVLYM+AQCLGAICGV
Sbjct  117  KVSLIRAVLYMVAQCLGAICGV  138



>ref|XP_011015478.1| PREDICTED: aquaporin PIP2-2-like [Populus euphratica]
Length=285

 Score =   211 bits (537),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 124/141 (88%), Gaps = 4/141 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E       EFSAKDYHDPPP+PLID +E+T+WSFYRA+IAEF+ATLLFLY+TVLT
Sbjct  1    MGKDIEV----GGEFSAKDYHDPPPAPLIDAEEITQWSFYRAIIAEFVATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK QTD    G  CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQTDVNKNGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  116

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RA+LYM+AQCLGAICG
Sbjct  117  KVSLVRAILYMVAQCLGAICG  137



>ref|NP_181255.1| aquaporin PIP2-3 [Arabidopsis thaliana]
 sp|P30302.1|PIP23_ARATH RecName: Full=Aquaporin PIP2-3; AltName: Full=Plasma membrane 
intrinsic protein 2-3; Short=AtPIP2;3; AltName: Full=Plasma 
membrane intrinsic protein 2c; Short=PIP2c; AltName: Full=RD28-PIP; 
AltName: Full=TMP2C; AltName: Full=Water stress-induced 
tonoplast intrinsic protein; Short=WSI-TIP; Contains: RecName: 
Full=Aquaporin PIP2-3, N-terminally processed [Arabidopsis 
thaliana]
 dbj|BAA02520.1| transmembrane channel protein [Arabidopsis thaliana]
 gb|AAD18141.1| aquaporin (plasma membrane intrinsic protein 2C) [Arabidopsis 
thaliana]
 gb|AAL36385.1| putative aquaporin, plasma membrane intrinsic protein 2C [Arabidopsis 
thaliana]
 gb|AAM20335.1| putative aquaporin protein [Arabidopsis thaliana]
 gb|AEC09363.1| aquaporin PIP2-3 [Arabidopsis thaliana]
 prf||1905411A transmembrane channel
Length=285

 Score =   211 bits (537),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 123/142 (87%), Gaps = 4/142 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE     P  F  +DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEG----PDGFQTRDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q+D KAGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKIQSDTKAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAVLYM+AQCLGAICGV
Sbjct  117  KVSLIRAVLYMVAQCLGAICGV  138



>gb|ABU94631.1| putative aquaporin PIP2;3 [Phaseolus vulgaris]
Length=287

 Score =   211 bits (537),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 125/142 (88%), Gaps = 2/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE    +   FS KDYHDPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEVT--ERGSFSGKDYHDPPPAPLIDTEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYKHQ+D K  G  CGGVGILGIAWAFGGMIFILVY TAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKHQSDLKDHGDACGGVGILGIAWAFGGMIFILVYWTAGISGGHINPAVTFGLFLAR  118

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RA++YM+AQCLGAICGV
Sbjct  119  KVSLIRAIMYMVAQCLGAICGV  140



>gb|KJB20285.1| hypothetical protein B456_003G141600 [Gossypium raimondii]
Length=320

 Score =   212 bits (539),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 130/160 (81%), Gaps = 6/160 (4%)
 Frame = +2

Query  14   HSRKYPFSSLISLAAMTKDVEAVPEQP--AEFSAKDYHDPPPSPLIDFDELTKWSFYRAV  187
            HS    F SL     MTKD+E   EQ   AEFSAKDY DPPP+PLID +ELTKWS YRA 
Sbjct  17   HSLNEHFHSLKH--NMTKDIETTAEQGGGAEFSAKDYQDPPPAPLIDLEELTKWSLYRAA  74

Query  188  IAEFIAtllflyvtvltvIGYKHQTDP--KAGGQDCGGVGILGIAWAFGGMIFILVYCTA  361
            IAEFIATLLFLYVTVLTVIGYK QTDP       DCGGVGILGIAWAFGGMIFILVYCTA
Sbjct  75   IAEFIATLLFLYVTVLTVIGYKVQTDPVKNTVDPDCGGVGILGIAWAFGGMIFILVYCTA  134

Query  362  GISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICG  481
            GISGGHINPAVTFGLF+ RKV+L RA+LYM+AQCLGAICG
Sbjct  135  GISGGHINPAVTFGLFVGRKVSLIRALLYMVAQCLGAICG  174



>ref|XP_003518297.1| PREDICTED: aquaporin PIP2-2-like [Glycine max]
Length=285

 Score =   211 bits (536),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = +2

Query  89   QPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTDP  268
            +   FSAKDYHDPPP+PLID +ELT+WSFYRA+IAEFIATLLFLY+TVLTVIGYK Q+D 
Sbjct  7    EGGSFSAKDYHDPPPAPLIDAEELTQWSFYRALIAEFIATLLFLYITVLTVIGYKSQSDV  66

Query  269  KAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLY  448
            KAGG  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV+L RA++Y
Sbjct  67   KAGGDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAIMY  126

Query  449  MIAQCLGAICGV  484
            M+AQCLGA+CGV
Sbjct  127  MVAQCLGAMCGV  138



>ref|XP_010264685.1| PREDICTED: aquaporin PIP2-1-like [Nelumbo nucifera]
Length=287

 Score =   211 bits (536),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 124/142 (87%), Gaps = 2/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE    +   FSAKDYHDPPP+PLID  ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDVEV--AEHGHFSAKDYHDPPPTPLIDAVELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGY+ QTD    G DC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYRSQTDQAHNGGDCEGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAV+YM+AQCLGAICGV
Sbjct  119  KVSLIRAVMYMVAQCLGAICGV  140



>ref|XP_007151872.1| hypothetical protein PHAVU_004G082700g [Phaseolus vulgaris]
 gb|ESW23866.1| hypothetical protein PHAVU_004G082700g [Phaseolus vulgaris]
Length=285

 Score =   211 bits (536),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +2

Query  89   QPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTDP  268
            +   FSAKDYHDPPP+PLID  ELT+WSFYRA+IAEFIATLLFLY+TVLTVIGYK Q+D 
Sbjct  7    EGGSFSAKDYHDPPPAPLIDAQELTQWSFYRALIAEFIATLLFLYITVLTVIGYKSQSDV  66

Query  269  KAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLY  448
            KAGG  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV+L RA++Y
Sbjct  67   KAGGDLCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAIMY  126

Query  449  MIAQCLGAICGV  484
            M+AQCLGAICGV
Sbjct  127  MVAQCLGAICGV  138



>gb|AIG92831.1| aquaporin PIP2 [Chrysanthemum x morifolium]
Length=285

 Score =   211 bits (536),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 124/142 (87%), Gaps = 4/142 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            MTKDV   PEQ   FSAKDYHDPPP+PLID  EL KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MTKDV---PEQ-GSFSAKDYHDPPPAPLIDPGELAKWSFYRALIAEFIATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK  TDP      CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSTTDPALNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  116

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RA++YM+AQCLGAICGV
Sbjct  117  KVSLIRAIMYMVAQCLGAICGV  138



>gb|EYU36189.1| hypothetical protein MIMGU_mgv1a011437mg [Erythranthe guttata]
Length=282

 Score =   210 bits (535),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 127/142 (89%), Gaps = 5/142 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M K+VE   E  AEF+AKDYHDPPP+PLID+DELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKEVECA-EPAAEFAAKDYHDPPPAPLIDYDELTKWSFYRALIAEFIATLLFLYITVLT  59

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q++       CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   VIGYKSQSEY----DQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  115

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAVLYM+AQCLGAICGV
Sbjct  116  KVSLIRAVLYMVAQCLGAICGV  137



>ref|XP_003548071.1| PREDICTED: aquaporin PIP2-2-like [Glycine max]
Length=285

 Score =   211 bits (536),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = +2

Query  89   QPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTDP  268
            +   F+AKDYHDPPP+PLID +ELT+WSFYRA+IAEFIAT+LFLY+TVLTVIGYK Q+D 
Sbjct  7    EGGSFAAKDYHDPPPAPLIDAEELTQWSFYRALIAEFIATMLFLYITVLTVIGYKSQSDV  66

Query  269  KAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLY  448
            KAGG  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV+L RA++Y
Sbjct  67   KAGGDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAIMY  126

Query  449  MIAQCLGAICGV  484
            M+AQCLGAICGV
Sbjct  127  MVAQCLGAICGV  138



>gb|AIA83104.1| putative aquaporin PIP2 [Citrus sinensis x Citrus trifoliata]
Length=290

 Score =   211 bits (536),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 122/144 (85%), Gaps = 3/144 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAE---FSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvt  229
            M KDVE   +Q      FSAKDYHDPPP+PLIDF+EL KWSFYRAVIAEFIATL FLYVT
Sbjct  1    MGKDVEVAEQQGGGGGEFSAKDYHDPPPAPLIDFEELGKWSFYRAVIAEFIATLSFLYVT  60

Query  230  vltvIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  409
            VLT IGYK QTDP      CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF
Sbjct  61   VLTAIGYKSQTDPTLNTDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  120

Query  410  LARKVTLPRAVLYMIAQCLGAICG  481
            L RKV+L RA+LYM+AQCLGAICG
Sbjct  121  LGRKVSLIRALLYMVAQCLGAICG  144



>ref|XP_010516975.1| PREDICTED: aquaporin PIP2-2-like [Camelina sativa]
Length=285

 Score =   210 bits (534),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 123/142 (87%), Gaps = 4/142 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE     P  F ++DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEG----PEGFQSRDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q+D  AGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKIQSDTTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAVLYM+AQCLGAICGV
Sbjct  117  KVSLIRAVLYMVAQCLGAICGV  138



>ref|XP_010505293.1| PREDICTED: aquaporin PIP2-2 [Camelina sativa]
 ref|XP_010509372.1| PREDICTED: aquaporin PIP2-2 [Camelina sativa]
Length=285

 Score =   210 bits (534),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 123/142 (87%), Gaps = 4/142 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE     P  F ++DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEG----PEGFQSRDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q+D  AGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKIQSDTTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAVLYM+AQCLGAICGV
Sbjct  117  KVSLIRAVLYMVAQCLGAICGV  138



>emb|CDY13298.1| BnaC06g14590D [Brassica napus]
Length=287

 Score =   210 bits (534),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 125/142 (88%), Gaps = 2/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVEAV  +   F ++DY DPPP+PL D +ELTKWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEAVAGE--GFQSRDYQDPPPAPLFDPEELTKWSFYRAVIAEFVATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VI YK QTD  AGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL LAR
Sbjct  59   VICYKIQTDSTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLAR  118

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RA+LYM+AQCLGAICGV
Sbjct  119  KVSLVRAILYMVAQCLGAICGV  140



>gb|AHB33479.1| plasma intrinsic protein 2-3 [Cucumis sativus]
 gb|KGN48149.1| hypothetical protein Csa_6G445140 [Cucumis sativus]
Length=284

 Score =   209 bits (533),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 125/141 (89%), Gaps = 5/141 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M+KD+EA       F+ KDY DPPP+PLID +ELT+WSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MSKDLEA-----GGFAVKDYQDPPPAPLIDAEELTQWSFYRAIIAEFVATLLFLYVTVLT  55

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGY  Q+D K GGQ CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  56   VIGYSSQSDTKNGGQICGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  115

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RA+LYM+AQCLGAICG
Sbjct  116  KVSLTRAILYMVAQCLGAICG  136



>ref|NP_001105639.1| aquaporin PIP2-7 [Zea mays]
 sp|Q9ATM4.1|PIP27_MAIZE RecName: Full=Aquaporin PIP2-7; AltName: Full=Plasma membrane 
intrinsic protein 2-7; AltName: Full=ZmPIP2-7; AltName: Full=ZmPIP2;7 
[Zea mays]
 gb|AAK26763.1| plasma membrane integral protein ZmPIP2-7 [Zea mays]
 gb|ACU23788.1| unknown [Glycine max]
 gb|KHN21518.1| Aquaporin PIP2-7 [Glycine soja]
Length=287

 Score =   209 bits (533),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 124/142 (87%), Gaps = 2/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE V EQ  E+SAKDYHDPPP+PLID DELTKWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQ-GEYSAKDYHDPPPAPLIDPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  239  vIGYKHQTDPKA-GGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  415
            +IGYK Q+D K  G  +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL 
Sbjct  60   IIGYKRQSDTKIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  119

Query  416  RKVTLPRAVLYMIAQCLGAICG  481
            RKV+L RA+LYMIAQC GAICG
Sbjct  120  RKVSLVRALLYMIAQCAGAICG  141



>ref|XP_003540176.1| PREDICTED: aquaporin PIP2-7 [Glycine max]
 gb|KHN11201.1| Aquaporin PIP2-7 [Glycine soja]
Length=287

 Score =   209 bits (533),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 124/142 (87%), Gaps = 2/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE V EQ  E+SAKDYHDPPP+PLID DELTKWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQ-GEYSAKDYHDPPPAPLIDPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  239  vIGYKHQTDPKA-GGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  415
            +IGYK Q+D K  G  +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL 
Sbjct  60   IIGYKRQSDTKIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  119

Query  416  RKVTLPRAVLYMIAQCLGAICG  481
            RKV+L RA+LYMIAQC GAICG
Sbjct  120  RKVSLVRALLYMIAQCAGAICG  141



>gb|ACU20229.1| unknown [Glycine max]
Length=285

 Score =   209 bits (533),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +2

Query  89   QPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTDP  268
            +   FSAKDYHDPPP+PLID +ELT+WS YRA+IAEFIATLLFLY+TVLTVIGYK Q+D 
Sbjct  7    EGGSFSAKDYHDPPPAPLIDAEELTQWSLYRALIAEFIATLLFLYITVLTVIGYKSQSDV  66

Query  269  KAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLY  448
            KAGG  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV+L RA++Y
Sbjct  67   KAGGDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAIMY  126

Query  449  MIAQCLGAICGV  484
            M+AQCLGAICGV
Sbjct  127  MVAQCLGAICGV  138



>ref|NP_001237286.1| PIP2,2 [Glycine max]
 gb|AAX86046.1| PIP2,2 [Glycine max]
Length=287

 Score =   209 bits (533),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 124/142 (87%), Gaps = 2/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE V EQ  E+SAKDYHDPPP+PLID DELTKWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQ-GEYSAKDYHDPPPAPLIDPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  239  vIGYKHQTDPKA-GGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  415
            +IGYK Q+D K  G  +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL 
Sbjct  60   IIGYKRQSDTKIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  119

Query  416  RKVTLPRAVLYMIAQCLGAICG  481
            RKV+L RA+LYMIAQC GAICG
Sbjct  120  RKVSLVRALLYMIAQCAGAICG  141



>gb|ACU19125.1| unknown [Glycine max]
Length=287

 Score =   209 bits (533),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 124/142 (87%), Gaps = 2/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE V EQ  E+SAKDYHDPPP+PLID DELTKWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQ-GEYSAKDYHDPPPAPLIDPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  239  vIGYKHQTDPKA-GGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  415
            +IGYK Q+D K  G  +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL 
Sbjct  60   IIGYKRQSDTKIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  119

Query  416  RKVTLPRAVLYMIAQCLGAICG  481
            RKV+L RA+LYMIAQC GAICG
Sbjct  120  RKVSLVRALLYMIAQCAGAICG  141



>gb|KCW49751.1| hypothetical protein EUGRSUZ_K03244 [Eucalyptus grandis]
Length=258

 Score =   209 bits (531),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD E V +Q  EF  KDY DPPP+PL+D +EL KWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDDEVVEQQGGEFHGKDYRDPPPAPLVDAEELVKWSFYRAVIAEFVATLLFLYITVLT  60

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGY  Q+D   GG  C GVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   VIGYSRQSDTTHGGDQCDGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  120

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            +V+L RA+LYM+AQCLGA+CG
Sbjct  121  RVSLVRAILYMVAQCLGAVCG  141



>ref|XP_002881493.1| hypothetical protein ARALYDRAFT_482707 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57752.1| hypothetical protein ARALYDRAFT_482707 [Arabidopsis lyrata subsp. 
lyrata]
Length=285

 Score =   209 bits (533),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 122/142 (86%), Gaps = 4/142 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE     P  F  +DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEG----PEGFQTRDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q+D  AGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKIQSDKTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAVLYM+AQCLGAICGV
Sbjct  117  KVSLIRAVLYMVAQCLGAICGV  138



>ref|XP_004976254.1| PREDICTED: aquaporin PIP2-5-like [Setaria italica]
Length=290

 Score =   209 bits (533),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 126/145 (87%), Gaps = 3/145 (2%)
 Frame = +2

Query  59   MTKDVEAVPE-QPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvl  235
            M KD+EA    +  E++AKDY DPPP+PLID +ELTKWS YRAVIAEF+ATLLFLY+TV 
Sbjct  1    MAKDIEAAAAPEGGEYTAKDYSDPPPAPLIDAEELTKWSLYRAVIAEFVATLLFLYITVA  60

Query  236  tvIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  409
            TVIGYKHQTD  A G D  CGGVGILGIAWAFGGMIFILVYCTAG+SGGHINPAVT GLF
Sbjct  61   TVIGYKHQTDAAASGPDAACGGVGILGIAWAFGGMIFILVYCTAGVSGGHINPAVTLGLF  120

Query  410  LARKVTLPRAVLYMIAQCLGAICGV  484
            LARKV+L RA+LY++AQCLGAICGV
Sbjct  121  LARKVSLVRALLYIVAQCLGAICGV  145



>gb|ACJ85173.1| unknown [Medicago truncatula]
Length=287

 Score =   209 bits (532),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 124/142 (87%), Gaps = 2/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE    +   FS KDYHDPPP+PLID +ELTKWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVEV--AERGSFSNKDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYVTVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGY  QTD KAGG  CGGVGILGIAWAFGGMIF+LVYC AGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYSIQTDVKAGGDACGGVGILGIAWAFGGMIFVLVYCIAGISGGHINPAVTFGLFLAR  118

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RA++YM+AQCLGAI GV
Sbjct  119  KVSLIRAIMYMVAQCLGAIAGV  140



>ref|XP_004156296.1| PREDICTED: aquaporin PIP2-2-like [Cucumis sativus]
Length=284

 Score =   209 bits (531),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 125/141 (89%), Gaps = 5/141 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M+KD+EA       F+ KDY DPPP+PLID +ELT+WSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MSKDLEA-----GGFAVKDYQDPPPAPLIDAEELTQWSFYRAIIAEFVATLLFLYVTVLT  55

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGY  Q+D K GGQ CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  56   VIGYSSQSDTKNGGQICGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  115

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RA+LYM+AQCLGAICG
Sbjct  116  KVSLIRAILYMVAQCLGAICG  136



>ref|XP_006381453.1| hypothetical protein POPTR_0006s12980g [Populus trichocarpa]
 gb|ABK96511.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ERP59250.1| hypothetical protein POPTR_0006s12980g [Populus trichocarpa]
Length=285

 Score =   209 bits (531),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 122/141 (87%), Gaps = 4/141 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E       EFSAKDYHDPPP+PLID +ELT+WS YRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDIEV----GGEFSAKDYHDPPPAPLIDAEELTQWSLYRAIIAEFIATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK QTD       CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQTDTTKNSDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  116

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RAVLYM+AQCLGAICG
Sbjct  117  KVSLVRAVLYMVAQCLGAICG  137



>gb|AIK66515.1| putative aquaporin [Vitis vinifera]
Length=284

 Score =   209 bits (531),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 125/142 (88%), Gaps = 5/142 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            MTKDVE    +   FSAKDYHDPPP+PL D  ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MTKDVEV--AEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK QT   AGG  CGGVGILGIAW+FGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQT---AGGDPCGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  115

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RA+LYM+AQCLGAICGV
Sbjct  116  KVSLIRAILYMVAQCLGAICGV  137



>gb|KHG06004.1| Aquaporin PIP2-2 -like protein [Gossypium arboreum]
Length=285

 Score =   209 bits (531),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = +2

Query  86   EQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTD  265
            E   EF AKDYHDPPP+PL+D  EL KWSFYRAVIAEFIATL FLY+TVLTVIGYK QTD
Sbjct  6    EVGGEFQAKDYHDPPPAPLVDAQELAKWSFYRAVIAEFIATLFFLYITVLTVIGYKTQTD  65

Query  266  PKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVL  445
               GG+DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV+L RA+ 
Sbjct  66   LAKGGEDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAIF  125

Query  446  YMIAQCLGAICG  481
            YM AQCLGAICG
Sbjct  126  YMGAQCLGAICG  137



>ref|XP_008791536.1| PREDICTED: aquaporin PIP2-4-like [Phoenix dactylifera]
Length=288

 Score =   209 bits (531),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 124/143 (87%), Gaps = 5/143 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+EA     A F+AKDY DPPP+PLID +ELTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MGKDMEA---GAAGFTAKDYTDPPPAPLIDAEELTKWSLYRAVIAEFVATLLFLYITVAT  57

Query  239  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  412
            VIGYKHQ+DP   G D  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  58   VIGYKHQSDPNVNGTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  117

Query  413  ARKVTLPRAVLYMIAQCLGAICG  481
            ARKV+L RA+LYMIAQCLGAICG
Sbjct  118  ARKVSLIRALLYMIAQCLGAICG  140



>ref|XP_010529747.1| PREDICTED: aquaporin PIP2-2-like [Tarenaya hassleriana]
Length=288

 Score =   209 bits (531),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 123/142 (87%), Gaps = 1/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE        F A+DY DPPP+ L+D +ELT+WSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEGGVAGEG-FPARDYTDPPPAALVDAEELTRWSFYRAVIAEFIATLLFLYITVLT  59

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK QTD KAGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL L R
Sbjct  60   VIGYKSQTDTKAGGDDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLGR  119

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KVTL RA+LYM+AQCLGAICGV
Sbjct  120  KVTLVRALLYMVAQCLGAICGV  141



>gb|ABH09326.1| putative aquaporin [Vitis vinifera]
Length=284

 Score =   209 bits (531),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 125/142 (88%), Gaps = 5/142 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            MTKDVE    +   FSAKDYHDPPP+PL D  ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MTKDVEV--AEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK QT   AGG  CGGVGILGIAW+FGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQT---AGGDPCGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  115

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RA+LYM+AQCLGAICGV
Sbjct  116  KVSLIRAILYMVAQCLGAICGV  137



>ref|XP_011048549.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
 ref|XP_011048550.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
 ref|XP_011048551.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
Length=285

 Score =   209 bits (531),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 122/141 (87%), Gaps = 4/141 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E       EFSAKDYHDPPP+PLID +ELT+WS YRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDIEV----GGEFSAKDYHDPPPAPLIDAEELTQWSLYRAIIAEFIATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q D    G  CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQIDTTKNGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  116

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RA+LYM+AQCLGAICG
Sbjct  117  KVSLVRAILYMVAQCLGAICG  137



>ref|NP_001267922.1| aquaporin-like [Vitis vinifera]
 gb|ABN14353.1| aquaporin PIP2;4 [Vitis vinifera]
Length=284

 Score =   209 bits (531),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 125/142 (88%), Gaps = 5/142 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            MTKDVE    +   FSAKDYHDPPP+PL D  ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MTKDVEV--AEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK QT   AGG  CGGVGILGIAW+FGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQT---AGGDPCGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  115

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RA+LYM+AQCLGAICGV
Sbjct  116  KVSLIRAILYMVAQCLGAICGV  137



>emb|CAN75442.1| hypothetical protein VITISV_019657 [Vitis vinifera]
Length=284

 Score =   208 bits (530),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 125/142 (88%), Gaps = 5/142 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            MTKDVE    +   FSAKDYHDPPP+PL D  ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MTKDVEV--AEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK QT   AGG  CGGVGILGIAW+FGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQT---AGGDPCGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  115

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RA+LYM+AQCLGAICGV
Sbjct  116  KVSLIRAILYMVAQCLGAICGV  137



>gb|AAV69744.1| aquaporin [Vitis vinifera]
Length=284

 Score =   208 bits (530),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 125/142 (88%), Gaps = 5/142 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            MTKDVE    +   FSAKDYHDPPP+PL D  ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MTKDVEV--AEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK QT   AGG  CGGVGILGIAW+FGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQT---AGGDPCGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  115

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RA+LYM+AQCLGAICGV
Sbjct  116  KVSLIRAILYMVAQCLGAICGV  137



>ref|XP_006410896.1| hypothetical protein EUTSA_v10017874mg [Eutrema salsugineum]
 gb|ESQ52349.1| hypothetical protein EUTSA_v10017874mg [Eutrema salsugineum]
Length=284

 Score =   208 bits (530),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 123/142 (87%), Gaps = 5/142 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE        F+A+DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEG-----EGFTARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  55

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q+D  AGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  56   VIGYKIQSDTAAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  115

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAVLYM+AQCLGAICGV
Sbjct  116  KVSLIRAVLYMVAQCLGAICGV  137



>ref|XP_008449253.1| PREDICTED: aquaporin PIP2-2-like isoform X3 [Cucumis melo]
Length=284

 Score =   208 bits (530),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 125/141 (89%), Gaps = 5/141 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M+KD+EA       F+ KDY DPPP+PLID +ELT+WSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MSKDLEA-----GGFAVKDYQDPPPAPLIDAEELTQWSFYRAIIAEFVATLLFLYVTVLT  55

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGY  Q+D K+GGQ CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  56   VIGYSSQSDTKSGGQICGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  115

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RA+LYM AQCLGAICG
Sbjct  116  KVSLIRAILYMAAQCLGAICG  136



>gb|AAF71816.1|AF141642_1 putative aquaporin PIP2-1 [Vitis cinerea var. helleri x Vitis 
rupestris]
Length=284

 Score =   208 bits (530),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 125/142 (88%), Gaps = 5/142 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            MTKDVE    +   FSAKDYHDPPP+PL D  ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MTKDVEV--AEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK QT   AGG  CGGVGILGIAW+FGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQT---AGGDPCGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  115

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RA+LYM+AQCLGAICGV
Sbjct  116  KVSLIRAILYMVAQCLGAICGV  137



>gb|ACX37450.1| plasma membrane intrinsic protein [Hevea brasiliensis]
Length=288

 Score =   208 bits (530),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 122/141 (87%), Gaps = 1/141 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE V  Q  EF AKDY+DPPP+PLID +E T+WSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVE-VGGQGGEFQAKDYNDPPPAPLIDAEEFTQWSFYRAIIAEFIATLLFLYITVLT  59

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK QTDP      CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVT GLFLAR
Sbjct  60   VIGYKSQTDPAKNADPCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTLGLFLAR  119

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RA+LYM AQCLGAICG
Sbjct  120  KVSLVRAILYMAAQCLGAICG  140



>gb|AAM61438.1| aquaporin (plasma membrane intrinsic protein 2C) [Arabidopsis 
thaliana]
Length=285

 Score =   208 bits (530),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 122/142 (86%), Gaps = 4/142 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE        F  +DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEG----SDGFQTRDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q+D KAGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKIQSDTKAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAVLYM+AQCLGAICGV
Sbjct  117  KVSLIRAVLYMVAQCLGAICGV  138



>gb|ABC69040.1| aquaporin PIP2-1 [Rhododendron catawbiense]
Length=281

 Score =   208 bits (529),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 128/144 (89%), Gaps = 10/144 (7%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M+KDVE V EQPA +SAKDYHDPPP+ LID +EL KWSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MSKDVE-VAEQPA-YSAKDYHDPPPARLIDMEELIKWSFYRAVIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQT--DPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  412
            VIGYK QT  DP      CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFL
Sbjct  59   VIGYKSQTTTDP------CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFL  112

Query  413  ARKVTLPRAVLYMIAQCLGAICGV  484
            ARKV+L RAVLYM+AQCLGAICGV
Sbjct  113  ARKVSLFRAVLYMVAQCLGAICGV  136



>ref|XP_010037961.1| PREDICTED: probable aquaporin PIP2-2 [Eucalyptus grandis]
 gb|KCW49750.1| hypothetical protein EUGRSUZ_K03244 [Eucalyptus grandis]
Length=289

 Score =   208 bits (529),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD E V +Q  EF  KDY DPPP+PL+D +EL KWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDDEVVEQQGGEFHGKDYRDPPPAPLVDAEELVKWSFYRAVIAEFVATLLFLYITVLT  60

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGY  Q+D   GG  C GVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   VIGYSRQSDTTHGGDQCDGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  120

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            +V+L RA+LYM+AQCLGA+CG
Sbjct  121  RVSLVRAILYMVAQCLGAVCG  141



>gb|KDP29110.1| hypothetical protein JCGZ_16499 [Jatropha curcas]
Length=284

 Score =   207 bits (528),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 121/141 (86%), Gaps = 5/141 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE       +F AKDYHDPPP+PLID +E T+WSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDVEG-----GDFQAKDYHDPPPAPLIDAEEFTQWSFYRAIIAEFIATLLFLYITVLT  55

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK QTDP      CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  56   VIGYKSQTDPSKNSDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  115

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RA+LYM AQCLGAICG
Sbjct  116  KVSLVRAILYMAAQCLGAICG  136



>emb|CDP06739.1| unnamed protein product [Coffea canephora]
Length=287

 Score =   208 bits (529),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E        + AKDY DPPP+PL+D +ELT+WSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEVGGNTHEHYGAKDYQDPPPAPLVDPEELTQWSFYRAIIAEFIATLLFLYITVLT  60

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q+D KA G  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  61   VIGYKSQSDTKANGDICGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  120

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RAVLYM+AQCLGAICG
Sbjct  121  KVSLVRAVLYMVAQCLGAICG  141



>ref|XP_006410897.1| hypothetical protein EUTSA_v10017041mg [Eutrema salsugineum]
 gb|ESQ52350.1| hypothetical protein EUTSA_v10017041mg [Eutrema salsugineum]
Length=285

 Score =   207 bits (528),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 122/142 (86%), Gaps = 4/142 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE     PA    +DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEGAEGFPA----RDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q+D  AGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKIQSDTTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAVLYM+AQCLGAICGV
Sbjct  117  KVSLIRAVLYMVAQCLGAICGV  138



>ref|XP_008365039.1| PREDICTED: probable aquaporin PIP2-5 [Malus domestica]
Length=287

 Score =   207 bits (528),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 122/142 (86%), Gaps = 2/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E    +   FSAKDYHDPPP+PLID  ELTKWSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MAKDMEV--AERGSFSAKDYHDPPPAPLIDSAELTKWSFYRALIAEFVATLLFLYVTVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK QTDP      CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQTDPATNADACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAVLYM+AQ LGAI GV
Sbjct  119  KVSLVRAVLYMVAQSLGAIAGV  140



>ref|XP_004304427.1| PREDICTED: aquaporin PIP2-1-like [Fragaria vesca subsp. vesca]
Length=287

 Score =   207 bits (528),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 124/141 (88%), Gaps = 2/141 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E  P+    FSAKDY+DPPP+PLID +E  KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDIEVGPQ--GGFSAKDYNDPPPTPLIDAEEFGKWSFYRAIIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q+D   GG  CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQSDTLKGGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+LPRAVLY++AQ LGAICG
Sbjct  119  KVSLPRAVLYIVAQSLGAICG  139



>dbj|BAB40143.1| plasma membrane intrinsic protein 2-2 [Pyrus communis]
Length=287

 Score =   207 bits (528),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 122/142 (86%), Gaps = 2/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E    +   FSAKDYHDPPP+PLID  ELTKWSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MAKDMEV--AERGSFSAKDYHDPPPAPLIDAAELTKWSFYRALIAEFVATLLFLYVTVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK QTDP      CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQTDPAVNADACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAVLYM+AQ LGAI GV
Sbjct  119  KVSLVRAVLYMVAQSLGAIAGV  140



>gb|AHW81492.1| ECFP-tagged plasma membrane intrinsic protein 2a [Cloning vector 
pBullet-pm-n]
 gb|AHW81510.1| ECFP-tagged plasma membrane intrinsic protein 2a [Cloning vector 
pBullet-pm-c]
Length=531

 Score =   214 bits (546),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 126/142 (89%), Gaps = 2/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVEAVP +   F  +DY DPPP+P ID  EL KWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEAVPGE--GFQTRDYQDPPPAPFIDGAELKKWSFYRAVIAEFVATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q+D  AGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKIQSDTDAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+LPRA+LY+IAQCLGAICGV
Sbjct  119  KVSLPRALLYIIAQCLGAICGV  140



>ref|XP_011048552.1| PREDICTED: aquaporin PIP2-2-like [Populus euphratica]
Length=285

 Score =   207 bits (528),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 122/141 (87%), Gaps = 4/141 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E       EF+AKDYHDPPP+PLID +ELT+WS YRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDIEV----GGEFNAKDYHDPPPAPLIDAEELTQWSLYRAIIAEFIATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q D    G  CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQIDTTKNGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  116

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RA+LYM+AQCLGAICG
Sbjct  117  KVSLVRAILYMVAQCLGAICG  137



>ref|XP_004496281.1| PREDICTED: aquaporin PIP2-1-like [Cicer arietinum]
Length=287

 Score =   207 bits (528),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 124/142 (87%), Gaps = 2/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M K+VE    +   FS KDYHDPPP+P ID  ELTKWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKNVEV--AERGSFSNKDYHDPPPAPFIDAAELTKWSFYRALIAEFIATLLFLYVTVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGY  QTD KAGG  CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYSIQTDIKAGGDVCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RA++Y++AQCLGAICGV
Sbjct  119  KVSLIRAIMYIVAQCLGAICGV  140



>emb|CAB46351.1| major intrinsic protein 2 [Solanum tuberosum]
Length=286

 Score =   207 bits (528),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 125/142 (88%), Gaps = 1/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            MTK+VEAV EQ AE+S KDY DPPP+PLIDF+ELTKWS YRAVIA+FIATLLFLY+TVL 
Sbjct  1    MTKEVEAVHEQAAEYSRKDYTDPPPAPLIDFEELTKWSLYRAVIADFIATLLFLYITVLI  60

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGY  +   K     CGGVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   VIGYNIKPMLKPA-SVCGGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  119

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAVLYM+AQCLGAICGV
Sbjct  120  KVSLIRAVLYMVAQCLGAICGV  141



>ref|XP_009345382.1| PREDICTED: probable aquaporin PIP2-5 [Pyrus x bretschneideri]
Length=287

 Score =   207 bits (528),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 122/142 (86%), Gaps = 2/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E    +   FSAKDYHDPPP+PLID  ELTKWSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MAKDMEV--AERGSFSAKDYHDPPPAPLIDAAELTKWSFYRALIAEFVATLLFLYVTVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK QTDP      CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQTDPAVNADACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAVLYM+AQ LGAI GV
Sbjct  119  KVSLVRAVLYMVAQSLGAIAGV  140



>emb|CAH60724.1| putative plasma membrane intrinsic protein [Populus tremula x 
Populus tremuloides]
Length=285

 Score =   207 bits (527),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 122/141 (87%), Gaps = 4/141 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E       EF AKDYHDPPP+PLID +ELT+WS YRAVIAEFIATLLFLY+TVLT
Sbjct  1    MGKDIEV----GGEFIAKDYHDPPPAPLIDAEELTQWSLYRAVIAEFIATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK QTD    G  CGGVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQTDTAKNGDVCGGVGVLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  116

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RA+LYM+AQCLGAICG
Sbjct  117  KVSLVRAILYMVAQCLGAICG  137



>gb|AFH36338.1| aquaporin PIP2;3 [Quercus petraea]
Length=286

 Score =   207 bits (527),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 122/142 (86%), Gaps = 4/142 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            MTKDV     +   F AKDYHDPPP+PL D  ELTKWSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MTKDVA----EHGSFPAKDYHDPPPAPLFDPVELTKWSFYRALIAEFVATLLFLYVTVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q DP   G  CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQIDPALKGDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  116

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAVLYM+AQCLGAICGV
Sbjct  117  KVSLIRAVLYMVAQCLGAICGV  138



>ref|XP_010509371.1| PREDICTED: aquaporin PIP2-2-like [Camelina sativa]
Length=285

 Score =   207 bits (527),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 122/142 (86%), Gaps = 4/142 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE        + A+DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEGAEG----YQARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q+D  AGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKIQSDTTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAVLYM+AQCLGAICGV
Sbjct  117  KVSLIRAVLYMVAQCLGAICGV  138



>ref|XP_010516976.1| PREDICTED: aquaporin PIP2-2-like [Camelina sativa]
Length=285

 Score =   207 bits (527),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 121/142 (85%), Gaps = 4/142 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M K VE        + A+DY DPPP+P  D DELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKGVEGAEG----YQARDYEDPPPTPFFDADELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q+D  AGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKIQSDTTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KVTL RAVLYM+AQCLGAICGV
Sbjct  117  KVTLIRAVLYMVAQCLGAICGV  138



>ref|XP_006381455.1| hypothetical protein POPTR_0006s13000g [Populus trichocarpa]
 gb|ABK94847.1| unknown [Populus trichocarpa]
 gb|ERP59252.1| hypothetical protein POPTR_0006s13000g [Populus trichocarpa]
Length=285

 Score =   207 bits (527),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 121/141 (86%), Gaps = 4/141 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE       EF AKDYHDPPP+PLID +ELT+WS YRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDVEV----RGEFIAKDYHDPPPAPLIDAEELTQWSLYRAIIAEFIATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK QTD       CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQTDTTKNSDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  116

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RAVLYM+AQCLGAICG
Sbjct  117  KVSLVRAVLYMVAQCLGAICG  137



>ref|XP_007016740.1| Plasma membrane intrinsic protein 2,4 [Theobroma cacao]
 gb|EOY34359.1| Plasma membrane intrinsic protein 2,4 [Theobroma cacao]
Length=289

 Score =   207 bits (527),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 123/143 (86%), Gaps = 2/143 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M K+VE   +   EFSAKDYHDPPP+PLID +EL KWSFYRA+IAEFIATLLFLYV+VLT
Sbjct  1    MAKEVETAEQGGGEFSAKDYHDPPPAPLIDAEELFKWSFYRALIAEFIATLLFLYVSVLT  60

Query  239  vIGYKHQTD--PKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  412
            VIGYK QTD        DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  61   VIGYKVQTDTLKNTVDADCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  120

Query  413  ARKVTLPRAVLYMIAQCLGAICG  481
             RKV+L RA++YM+AQCLGAICG
Sbjct  121  GRKVSLIRAIMYMVAQCLGAICG  143



>ref|XP_004143245.1| PREDICTED: aquaporin PIP2-2-like [Cucumis sativus]
Length=284

 Score =   207 bits (526),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 124/141 (88%), Gaps = 5/141 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M+KD+EA       F+ KDY DPPP+PLID +ELT+WSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MSKDLEA-----GGFAVKDYQDPPPAPLIDAEELTQWSFYRAIIAEFVATLLFLYVTVLT  55

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGY  Q+D K GGQ CGGVGILGIAWAFGGMIF+LVYCTAGISG HINPAVTFGLFLAR
Sbjct  56   VIGYSSQSDTKNGGQICGGVGILGIAWAFGGMIFVLVYCTAGISGDHINPAVTFGLFLAR  115

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RA+LYM+AQCLGAICG
Sbjct  116  KVSLTRAILYMVAQCLGAICG  136



>gb|ACU21481.1| unknown [Glycine max]
Length=287

 Score =   207 bits (526),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 123/142 (87%), Gaps = 2/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE V EQ  E+SAKDYHDPPP+PLI  DELTKWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQ-GEYSAKDYHDPPPAPLIHPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  239  vIGYKHQTDPKA-GGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  415
            +IGYK Q+D K  G  +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL 
Sbjct  60   IIGYKRQSDTKIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  119

Query  416  RKVTLPRAVLYMIAQCLGAICG  481
            RKV+L RA+LYMIAQC GAICG
Sbjct  120  RKVSLVRALLYMIAQCAGAICG  141



>ref|XP_009143524.1| PREDICTED: aquaporin PIP2-2 [Brassica rapa]
Length=285

 Score =   207 bits (526),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 123/142 (87%), Gaps = 4/142 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE        F+A+DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEGAEG----FAARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK  +D KAGG +CGGVGILGI+WAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKISSDTKAGGDECGGVGILGISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAVLYM+AQCLGAICGV
Sbjct  117  KVSLVRAVLYMVAQCLGAICGV  138



>emb|CDX91341.1| BnaC04g08090D [Brassica napus]
Length=285

 Score =   207 bits (526),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 123/142 (87%), Gaps = 4/142 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE        F+A+DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEGAEG----FAARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK  +D KAGG +CGGVGILGI+WAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKISSDTKAGGDECGGVGILGISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAVLYM+AQCLGAICGV
Sbjct  117  KVSLIRAVLYMVAQCLGAICGV  138



>gb|AHK05706.1| plasma membrane intrinsic protein PIP2;3 [Hevea brasiliensis]
Length=285

 Score =   207 bits (526),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 121/142 (85%), Gaps = 4/142 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDV     +   F AKDYHDPPP+PLID  ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MVKDVT----EQGSFPAKDYHDPPPAPLIDAVELTKWSFYRALIAEFIATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK QTDP      CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQTDPAKNADSCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAV+YM+AQCLGAI GV
Sbjct  117  KVSLVRAVMYMVAQCLGAIAGV  138



>gb|EMS56715.1| putative aquaporin PIP2-2 [Triticum urartu]
Length=341

 Score =   208 bits (530),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 124/144 (86%), Gaps = 3/144 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+EA P Q  EFS K Y  PPP+P++DF+ELTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAAP-QGGEFSTKSYAAPPPAPIVDFEELTKWSLYRAVIAEFVATLLFLYITVAT  59

Query  239  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  412
            VIGYKHQ+DP     D  C GVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLFL
Sbjct  60   VIGYKHQSDPTVNTTDAACSGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFL  119

Query  413  ARKVTLPRAVLYMIAQCLGAICGV  484
            ARKV+L RA+LY+IAQCLGAICGV
Sbjct  120  ARKVSLIRALLYIIAQCLGAICGV  143



>gb|KHG08488.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=285

 Score =   206 bits (525),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 124/143 (87%), Gaps = 5/143 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E+  EQ    S KDYHDPPP+PLID +ELTKWSFYRAVIAEFIATLLFLYVTVLT
Sbjct  1    MGKDIESSVEQ---VSGKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYVTVLT  57

Query  239  vIGYKHQTDP--KAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  412
            VIGYK QTDP       DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  58   VIGYKVQTDPLKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  117

Query  413  ARKVTLPRAVLYMIAQCLGAICG  481
             RKV+L RA++YM+AQCLGAICG
Sbjct  118  GRKVSLIRAIMYMVAQCLGAICG  140



>gb|AGG39693.1| aquaporin protein AQU15 [Camellia sinensis]
 gb|AGG39694.1| aquaporin protein AQU16 [Camellia sinensis]
Length=287

 Score =   206 bits (525),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 124/142 (87%), Gaps = 2/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+  V EQ   +SAKDY DPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+T+LT
Sbjct  1    MAKDM-GVAEQ-GSYSAKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITILT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q DP      CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQVDPVKNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAV+Y++AQCLGAICGV
Sbjct  119  KVSLIRAVMYIVAQCLGAICGV  140



>ref|XP_007027328.1| Plasma membrane intrinsic protein 2 [Theobroma cacao]
 gb|EOY07830.1| Plasma membrane intrinsic protein 2 [Theobroma cacao]
Length=283

 Score =   206 bits (524),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 123/141 (87%), Gaps = 6/141 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E       +F AKDYHDPPP+PL+D +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEV----GGQFQAKDYHDPPPAPLVDAEELTKWSFYRAIIAEFIATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q D   GG +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQIDK--GGDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  114

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RA+LYM AQCLGAICG
Sbjct  115  KVSLVRAILYMAAQCLGAICG  135



>ref|XP_002446796.1| hypothetical protein SORBIDRAFT_06g022840 [Sorghum bicolor]
 gb|EES11124.1| hypothetical protein SORBIDRAFT_06g022840 [Sorghum bicolor]
Length=292

 Score =   206 bits (525),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 126/147 (86%), Gaps = 5/147 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPA---EFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvt  229
            M KD+EA         E++AKDY DPPP+PL+D +ELTKWS YRAVIAEF+ATLLFLY+T
Sbjct  1    MAKDIEAAAAAHGGGGEYTAKDYSDPPPAPLVDAEELTKWSLYRAVIAEFVATLLFLYIT  60

Query  230  vltvIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFG  403
            V TVIGYKHQTD  + G D  CGGVGILGIAWAFGGMIFILVYCTAG+SGGHINPAVTFG
Sbjct  61   VATVIGYKHQTDASSSGPDAACGGVGILGIAWAFGGMIFILVYCTAGVSGGHINPAVTFG  120

Query  404  LFLARKVTLPRAVLYMIAQCLGAICGV  484
            LFLARKV+L RA+LY++AQCLGAICGV
Sbjct  121  LFLARKVSLVRALLYIVAQCLGAICGV  147



>ref|XP_009133124.1| PREDICTED: aquaporin PIP2-2-like [Brassica rapa]
 gb|AAD39374.1|AF118383_1 plasma membrane intrinsic protein 2 [Brassica napus]
 emb|CDY46758.1| BnaA03g17020D [Brassica napus]
Length=283

 Score =   206 bits (524),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 122/142 (86%), Gaps = 4/142 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE         +A+DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEGAEG----VTARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK  +D KAGG DCGGVGILGI+WAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKISSDTKAGGDDCGGVGILGISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAVLYM+AQCLGAICGV
Sbjct  117  KVSLVRAVLYMVAQCLGAICGV  138



>dbj|BAD90699.1| plasma membrane intrinsic protein 2;3 [Mimosa pudica]
Length=288

 Score =   206 bits (524),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 125/143 (87%), Gaps = 3/143 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE    +   +SAKDYHDPPP+PLID +EL KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--AERGSYSAKDYHDPPPAPLIDAEELGKWSFYRALIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPK-AGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  415
            VIGYK QTD   A G  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  59   VIGYKSQTDTTVATGDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  118

Query  416  RKVTLPRAVLYMIAQCLGAICGV  484
            RKV+L RA+LY++AQCLGAICGV
Sbjct  119  RKVSLIRAILYIVAQCLGAICGV  141



>gb|AGD98708.1| aquaporin protein 5 [Camellia sinensis]
Length=285

 Score =   206 bits (524),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 124/142 (87%), Gaps = 2/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+  V EQ   +SAKDY DPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+T+LT
Sbjct  1    MAKDM-GVAEQ-GSYSAKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITILT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q DP      CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQVDPVKNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAV+Y++AQCLGAICGV
Sbjct  119  KVSLIRAVMYIVAQCLGAICGV  140



>gb|KJB21561.1| hypothetical protein B456_004G001400 [Gossypium raimondii]
Length=285

 Score =   206 bits (524),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 124/143 (87%), Gaps = 5/143 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E+  EQ    S KDYHDPPP+PLID +ELTKWSFYRAVIAEFIATLLFLYVTVLT
Sbjct  1    MGKDIESSVEQG---SGKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYVTVLT  57

Query  239  vIGYKHQTDP--KAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  412
            VIGYK QTDP       DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  58   VIGYKVQTDPLKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  117

Query  413  ARKVTLPRAVLYMIAQCLGAICG  481
             RKV+L RA++YM+AQCLGAICG
Sbjct  118  GRKVSLIRAIMYMVAQCLGAICG  140



>ref|XP_010043748.1| PREDICTED: probable aquaporin PIP2-4 [Eucalyptus grandis]
 gb|KCW85737.1| hypothetical protein EUGRSUZ_B02499 [Eucalyptus grandis]
Length=284

 Score =   206 bits (524),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 124/141 (88%), Gaps = 3/141 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E    QP   +A+DY DPPP+PL+D +EL KWSFYRA+IAEFIAT+LFLY+TVLT
Sbjct  1    MGKDLEG--AQP-PLAARDYQDPPPAPLVDPEELGKWSFYRALIAEFIATMLFLYITVLT  57

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK QTDP   G DCGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  58   VIGYKSQTDPTMNGSDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  117

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RAV+YM+AQCLGAICG
Sbjct  118  KVSLVRAVMYMVAQCLGAICG  138



>gb|ACU00103.1| plasma membrane intrinsic protein PIP2.1 [Populus trichocarpa 
x Populus deltoides]
Length=285

 Score =   206 bits (524),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 121/141 (86%), Gaps = 4/141 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E       EF AKDYHDPPP+PLID +ELT+WS YRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDIEV----GREFIAKDYHDPPPAPLIDAEELTQWSLYRAIIAEFIATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK QTD       CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQTDTTKNSDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  116

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RAVLYM+AQCLGAICG
Sbjct  117  KVSLVRAVLYMVAQCLGAICG  137



>ref|XP_010505294.1| PREDICTED: aquaporin PIP2-2-like [Camelina sativa]
Length=285

 Score =   206 bits (524),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 121/142 (85%), Gaps = 4/142 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M K VE        + A+DY DPPP+P  D DELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKGVEGAEG----YQARDYEDPPPTPFFDADELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q+D  AGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKIQSDTTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAVLYM+AQCLGAICGV
Sbjct  117  KVSLIRAVLYMVAQCLGAICGV  138



>ref|XP_003556232.1| PREDICTED: aquaporin PIP2-1-like [Glycine max]
 gb|KHN00839.1| Putative aquaporin PIP2-5 [Glycine soja]
Length=284

 Score =   206 bits (523),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 123/142 (87%), Gaps = 5/142 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE    +   FS KDY DPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--AERGSFSGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYKHQTD       CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKHQTDHA---DACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  115

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RA++YM+AQCLGAICGV
Sbjct  116  KVSLIRAIMYMVAQCLGAICGV  137



>dbj|BAE06148.1| PIP aquaporin isoform [Hordeum vulgare]
Length=290

 Score =   206 bits (523),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 123/145 (85%), Gaps = 4/145 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+EA P    E++AKDY DPPP+PL D +ELTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAAPPG-GEYAAKDYSDPPPAPLFDAEELTKWSLYRAVIAEFVATLLFLYITVAT  59

Query  239  vIGYKHQTDP---KAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  409
            VIGYKHQ DP    A    C GVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLF
Sbjct  60   VIGYKHQADPAGPNAADAACSGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLF  119

Query  410  LARKVTLPRAVLYMIAQCLGAICGV  484
            LARKV+L RAVLY+IAQCLGAICGV
Sbjct  120  LARKVSLVRAVLYIIAQCLGAICGV  144



>gb|AGD98707.1| aquaporin protein 4 [Camellia sinensis]
Length=287

 Score =   206 bits (523),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 123/142 (87%), Gaps = 2/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+  V EQ   +SAKDY DPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+T+LT
Sbjct  1    MAKDM-GVAEQ-GSYSAKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITILT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q DP      CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQVDPVKNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RA LYM+AQCLGAICGV
Sbjct  119  KVSLIRAGLYMVAQCLGAICGV  140



>gb|AAD31846.1|AF133530_1 water channel protein MipH [Mesembryanthemum crystallinum]
Length=291

 Score =   206 bits (523),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 124/144 (86%), Gaps = 3/144 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD E    +  +  AKDY DPPPSPL D +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDFETGGGEVRDV-AKDYQDPPPSPLFDMEELTKWSFYRALIAEFIATLLFLYITVLT  59

Query  239  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  412
            VIGYKHQ+DP   G D  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  60   VIGYKHQSDPLVSGADAGCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  119

Query  413  ARKVTLPRAVLYMIAQCLGAICGV  484
            ARK++L RA++YM+AQCLGAICGV
Sbjct  120  ARKLSLIRAIMYMVAQCLGAICGV  143



>dbj|BAA92261.1| Plasma membrane aquaporin 2c [Raphanus sativus]
Length=283

 Score =   205 bits (522),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 122/142 (86%), Gaps = 4/142 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE         +A+DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEGAEG----VTARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK  +D KAGG +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKISSDTKAGGDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAVLYM+AQCLGAICGV
Sbjct  117  KVSLVRAVLYMVAQCLGAICGV  138



>ref|XP_009381972.1| PREDICTED: probable aquaporin PIP2-2 [Musa acuminata subsp. malaccensis]
Length=287

 Score =   205 bits (522),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 125/144 (87%), Gaps = 4/144 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E V EQ  E++AKDY DPPP+PL+D +ELTKWS YRA IAEFIAT+LFLYVTVLT
Sbjct  1    MAKDIE-VAEQ-GEYTAKDYTDPPPAPLVDVEELTKWSLYRAAIAEFIATMLFLYVTVLT  58

Query  239  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  412
            VIGYKHQ+DP     D  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  59   VIGYKHQSDPNVNPTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  118

Query  413  ARKVTLPRAVLYMIAQCLGAICGV  484
            ARKV+L RA LY++AQCLGAICGV
Sbjct  119  ARKVSLVRAFLYIVAQCLGAICGV  142



>dbj|BAF33069.1| aquaporin [Hordeum vulgare]
 dbj|BAJ85080.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK07275.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=290

 Score =   205 bits (522),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 122/145 (84%), Gaps = 4/145 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+EA P    E+ AKDY DPPP+PL D +ELTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAAPPG-GEYGAKDYSDPPPAPLFDAEELTKWSLYRAVIAEFVATLLFLYITVAT  59

Query  239  vIGYKHQTDP---KAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  409
            VIGYKHQ DP    A    C GVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLF
Sbjct  60   VIGYKHQADPAGPNAADAACSGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLF  119

Query  410  LARKVTLPRAVLYMIAQCLGAICGV  484
            LARKV+L RAVLY+IAQCLGAICGV
Sbjct  120  LARKVSLVRAVLYIIAQCLGAICGV  144



>gb|ADJ67992.1| aquaporin [Fragaria x ananassa]
Length=285

 Score =   205 bits (521),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 121/142 (85%), Gaps = 2/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE    +   FSAKDYHDPPP+PL D  ELTKWSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--AERGSFSAKDYHDPPPAPLFDSVELTKWSFYRAVIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q D   GG  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQIDADLGGDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAV+Y++AQ LGAI GV
Sbjct  119  KVSLVRAVMYIVAQSLGAIAGV  140



>gb|ABB88840.1| aquaporin [Stevia rebaudiana]
Length=281

 Score =   205 bits (521),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +2

Query  110  KDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTDPKAGGQDC  289
            KDYHDPPP+PLID +ELTKWSFYRAVIAEFIATLLFLYVTVLTVIGYK QTDP      C
Sbjct  12   KDYHDPPPAPLIDGEELTKWSFYRAVIAEFIATLLFLYVTVLTVIGYKSQTDPNLNTDQC  71

Query  290  GGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLG  469
            GGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV+L RA+LYM+AQCLG
Sbjct  72   GGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRALLYMVAQCLG  131

Query  470  AICGV  484
            AICGV
Sbjct  132  AICGV  136



>gb|ACZ06859.1| plasma membrane intrinsic protein [Glycine soja]
Length=284

 Score =   205 bits (521),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 123/142 (87%), Gaps = 5/142 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E    +   FS KDY DPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEV--AERGSFSGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYKHQTD       CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKHQTDHA---DACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  115

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RA++YM+AQCLGAICGV
Sbjct  116  KVSLIRAIMYMVAQCLGAICGV  137



>ref|XP_009133125.1| PREDICTED: aquaporin PIP2-2-like [Brassica rapa]
Length=285

 Score =   205 bits (521),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 122/142 (86%), Gaps = 4/142 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE        F+A+DY DPPP+P  D +ELT+WS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEGAEG----FAARDYQDPPPTPFFDAEELTRWSLYRAVIAEFVATLLFLYVTVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK  +D  AGG +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKISSDTTAGGVECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KVTL RA+LYM+AQCLGAICGV
Sbjct  117  KVTLVRALLYMVAQCLGAICGV  138



>ref|NP_001268056.1| aquaporin PIP2 [Vitis vinifera]
 gb|ABC84558.1| aquaporin PIP2 [Vitis vinifera]
Length=280

 Score =   205 bits (521),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 124/142 (87%), Gaps = 7/142 (5%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            MTKDVE   +   EFS KDYHDPPP+PLID DELT+WS YRA+IAEFIATLLFLY+TVLT
Sbjct  1    MTKDVETSGQ---EFSNKDYHDPPPAPLIDPDELTQWSLYRAIIAEFIATLLFLYITVLT  57

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q+D       CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  58   VIGYKSQSDT----DPCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  113

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RA++YMIAQCLGA+CGV
Sbjct  114  KVSLVRALMYMIAQCLGAVCGV  135



>ref|XP_009614931.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana tomentosiformis]
 tpg|DAA64676.1| TPA_exp: aquaporin PIP2 3b [Nicotiana tabacum]
Length=285

 Score =   205 bits (521),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 123/141 (87%), Gaps = 2/141 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E   +Q A    KDY DPPP+PLID +EL KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEYGTDQYAP--NKDYQDPPPAPLIDAEELGKWSFYRAIIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q+D K  G +CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQSDTKHNGDECGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            K++L RAV+YMIAQCLGAICG
Sbjct  119  KISLARAVMYMIAQCLGAICG  139



>ref|NP_001105616.1| aquaporin PIP2-5 [Zea mays]
 sp|Q9XF58.1|PIP25_MAIZE RecName: Full=Aquaporin PIP2-5; AltName: Full=Plasma membrane 
intrinsic protein 2-5; AltName: Full=ZmPIP2-5; AltName: Full=ZmPIP2;5; 
AltName: Full=ZmPIP2a [Zea mays]
 gb|AAD28761.1| plasma membrane intrinsic protein [Zea mays]
 gb|AAO86708.1| aquaporin [Zea mays]
 tpg|DAA36903.1| TPA: plasma membrane intrinsic protein2 [Zea mays]
Length=285

 Score =   205 bits (521),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 123/144 (85%), Gaps = 6/144 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+EA     A    KDY DPPP+PL+D +ELTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAA----AAHEGKDYSDPPPAPLVDAEELTKWSLYRAVIAEFVATLLFLYITVAT  56

Query  239  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  412
            VIGYKHQTD  A G D  CGGVG+LGIAWAFGGMIFILVYCTAG+SGGHINPAVTFGLFL
Sbjct  57   VIGYKHQTDAAASGPDAACGGVGVLGIAWAFGGMIFILVYCTAGVSGGHINPAVTFGLFL  116

Query  413  ARKVTLPRAVLYMIAQCLGAICGV  484
            ARKV+L RA+LY++AQCLGAICGV
Sbjct  117  ARKVSLVRALLYIVAQCLGAICGV  140



>ref|XP_007218772.1| hypothetical protein PRUPE_ppa009540mg [Prunus persica]
 gb|EMJ19971.1| hypothetical protein PRUPE_ppa009540mg [Prunus persica]
Length=287

 Score =   204 bits (520),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 120/142 (85%), Gaps = 2/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE    +   FSAKDYHDPPP+PL D  ELTKWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVEV--AERGSFSAKDYHDPPPAPLFDAVELTKWSFYRALIAEFIATLLFLYVTVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK QTD       CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQTDTTVNADACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAVLYM+AQ LGAI GV
Sbjct  119  KVSLVRAVLYMVAQSLGAIAGV  140



>ref|XP_008233329.1| PREDICTED: probable aquaporin PIP2-5 [Prunus mume]
Length=287

 Score =   204 bits (520),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 120/142 (85%), Gaps = 2/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE    +   FSAKDYHDPPP+PL D  ELTKWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVEV--AERGSFSAKDYHDPPPAPLFDAVELTKWSFYRALIAEFIATLLFLYVTVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK QTD       CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQTDTAVNADACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAVLYM+AQ LGAI GV
Sbjct  119  KVSLVRAVLYMVAQSLGAIAGV  140



>ref|XP_011041003.1| PREDICTED: probable aquaporin PIP2-5 [Populus euphratica]
Length=285

 Score =   204 bits (520),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 122/142 (86%), Gaps = 4/142 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E    +   FSAKDYHDPPP+PL D  ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDMEV--AEAGSFSAKDYHDPPPAPLFDAKELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q D  A    CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQIDGNA--DSCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  116

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAV+YM+AQCLGAICGV
Sbjct  117  KVSLIRAVMYMVAQCLGAICGV  138



>gb|AHA84284.1| prolactin-inducible protein [Phaseolus vulgaris]
Length=285

 Score =   204 bits (520),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 124/141 (88%), Gaps = 2/141 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE V EQ  E++AKDY DPPP+PL D +ELT+WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVE-VQEQ-GEYAAKDYQDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            +IGYK QTD   GG +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  59   IIGYKRQTDANVGGTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  118

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RA+LY++AQC GAICG
Sbjct  119  KVSLIRALLYIVAQCAGAICG  139



>ref|XP_002316367.1| putative aquaporin family protein [Populus trichocarpa]
 gb|ABK92446.1| unknown [Populus trichocarpa]
 gb|EEF02538.1| putative aquaporin family protein [Populus trichocarpa]
Length=285

 Score =   204 bits (520),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 122/142 (86%), Gaps = 4/142 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E    +   FSAKDYHDPPP+PL D  ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDMEV--AEAGSFSAKDYHDPPPAPLFDAKELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q D  A    CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQIDGSA--DSCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  116

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAV+YM+AQCLGAICGV
Sbjct  117  KVSLIRAVMYMVAQCLGAICGV  138



>ref|XP_007132257.1| hypothetical protein PHAVU_011G079300g [Phaseolus vulgaris]
 gb|ESW04251.1| hypothetical protein PHAVU_011G079300g [Phaseolus vulgaris]
Length=285

 Score =   204 bits (520),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 124/141 (88%), Gaps = 2/141 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE V EQ  E++AKDY DPPP+PL D +ELT+WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVE-VQEQ-GEYAAKDYQDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            +IGYK QTD   GG +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  59   IIGYKRQTDANVGGTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  118

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RA+LY++AQC GAICG
Sbjct  119  KVSLIRALLYIVAQCAGAICG  139



>ref|XP_009792249.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana sylvestris]
 tpg|DAA64675.1| TPA_exp: aquaporin PIP2 3a [Nicotiana tabacum]
Length=285

 Score =   204 bits (520),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 123/141 (87%), Gaps = 2/141 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E   +Q A    KDY DPPP+PLID +EL KWSFYRA++AEFIATLLFLY+TVLT
Sbjct  1    MAKDIEYGTDQYAP--NKDYQDPPPAPLIDAEELGKWSFYRAIVAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q+D K  G +CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQSDTKHNGDECGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            K++L RAV+YMIAQCLGAICG
Sbjct  119  KISLARAVMYMIAQCLGAICG  139



>emb|CDX91340.1| BnaC04g08100D [Brassica napus]
Length=285

 Score =   204 bits (520),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 123/142 (87%), Gaps = 4/142 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M K+VE        F+++DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKEVEGAEG----FASRDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK  +D KAGG +CGGVGILGI+WAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKISSDTKAGGDECGGVGILGISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAVLYM+AQCLGAICGV
Sbjct  117  KVSLVRAVLYMVAQCLGAICGV  138



>dbj|BAB40141.1| plasma membrane intrinsic protein 2-1 [Pyrus communis]
Length=281

 Score =   204 bits (519),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 124/142 (87%), Gaps = 6/142 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE    +  EF+AKDYHDPPP+PL D +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEVA--EHGEFAAKDYHDPPPTPLFDAEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q++       CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQSE----ADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  114

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAVLY+IAQCLGAICGV
Sbjct  115  KVSLIRAVLYIIAQCLGAICGV  136



>ref|XP_004304428.1| PREDICTED: aquaporin PIP2-1-like [Fragaria vesca subsp. vesca]
Length=284

 Score =   204 bits (520),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 122/141 (87%), Gaps = 5/141 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E        F+AKDYHDPPP+PLID +E  KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEV-----GGFAAKDYHDPPPTPLIDPEEFGKWSFYRAIIAEFIATLLFLYITVLT  55

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q+D   GG  CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  56   VIGYKSQSDTLKGGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  115

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+LPRAV+Y++AQ LGAICG
Sbjct  116  KVSLPRAVMYIVAQSLGAICG  136



>gb|ABI96813.1| plasma membrane intrinsic protein [Triticum aestivum]
Length=290

 Score =   204 bits (520),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 123/145 (85%), Gaps = 4/145 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+EA P    E++AKDY DPPP+PL D +ELTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAAPPG-GEYAAKDYSDPPPAPLFDAEELTKWSLYRAVIAEFVATLLFLYITVAT  59

Query  239  vIGYKHQTDP---KAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  409
            VIGYKHQ DP    A    C GVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLF
Sbjct  60   VIGYKHQADPAGPNAADAACSGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLF  119

Query  410  LARKVTLPRAVLYMIAQCLGAICGV  484
            LARKV+L RA+LY+IAQCLGAICGV
Sbjct  120  LARKVSLVRALLYIIAQCLGAICGV  144



>gb|AFB83068.1| plasma intrinsic protein PIP2.2 [Helianthemum almeriense]
Length=281

 Score =   204 bits (519),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 122/141 (87%), Gaps = 7/141 (5%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M K+ EA      EF AKDYHDPPP+PL D +EL KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKEAEAA----GEFRAKDYHDPPPAPLFDAEELGKWSFYRAIIAEFIATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q D   GG +CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQID---GGDECGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  113

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RA+LYM+AQCLGAICG
Sbjct  114  KVSLVRAILYMVAQCLGAICG  134



>gb|AAY22203.1| putative aquaporin [Phaseolus vulgaris]
Length=285

 Score =   204 bits (519),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 124/141 (88%), Gaps = 2/141 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE V EQ  E++AKDY DPPP+PL D +ELT+WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVE-VQEQ-GEYAAKDYQDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            +IGYK QTD   GG +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  59   IIGYKRQTDANVGGTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  118

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RA+LY++AQC GAICG
Sbjct  119  KVSLIRALLYIVAQCAGAICG  139



>ref|XP_009335091.1| PREDICTED: probable aquaporin PIP2-2 [Pyrus x bretschneideri]
Length=281

 Score =   204 bits (519),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 124/142 (87%), Gaps = 6/142 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE    +  EF+AKDYHDPPP+PL D +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEGA--EHGEFAAKDYHDPPPTPLFDAEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q++       CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQSE----ADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  114

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAVLY+IAQCLGAICGV
Sbjct  115  KVSLIRAVLYIIAQCLGAICGV  136



>ref|XP_006400824.1| hypothetical protein EUTSA_v10014299mg [Eutrema salsugineum]
 gb|ESQ42277.1| hypothetical protein EUTSA_v10014299mg [Eutrema salsugineum]
Length=285

 Score =   204 bits (519),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 123/141 (87%), Gaps = 2/141 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E   ++    +A+DY DPPP+PL+D +EL KWS YRAVIAEF+ATLLFLYV++LT
Sbjct  1    MAKDLEV--QEGGATAARDYADPPPAPLLDMEELRKWSLYRAVIAEFVATLLFLYVSILT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK QTD  AGG DCGGVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLFLAR
Sbjct  59   VIGYKAQTDASAGGVDCGGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFLAR  118

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L R VLY++AQCLGAICG
Sbjct  119  KVSLVRTVLYIVAQCLGAICG  139



>ref|XP_009398603.1| PREDICTED: probable aquaporin PIP2-2 [Musa acuminata subsp. malaccensis]
Length=288

 Score =   204 bits (519),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 121/144 (84%), Gaps = 3/144 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVEA      E++ KDY DPPP+PL D++ELTKWS YRA IAEFIAT+LFLYVTV T
Sbjct  1    MAKDVEAAAGH-GEYAVKDYTDPPPAPLFDWEELTKWSLYRAAIAEFIATMLFLYVTVAT  59

Query  239  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  412
            VIGYKHQ+DP     D  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  60   VIGYKHQSDPNVNPTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  119

Query  413  ARKVTLPRAVLYMIAQCLGAICGV  484
            ARKV+L RA+LYMI QCLGAICGV
Sbjct  120  ARKVSLIRALLYMIGQCLGAICGV  143



>gb|AEY75242.1| plasma membrane intrinsic protein [Malus hupehensis]
Length=287

 Score =   204 bits (519),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 121/142 (85%), Gaps = 2/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E    +   FSAKDY DPPP+PLID  ELTKWSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MAKDMEV--GERGSFSAKDYQDPPPAPLIDAAELTKWSFYRALIAEFVATLLFLYVTVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK QTDP      CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQTDPATNADACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAV+YM+AQ LGAI GV
Sbjct  119  KVSLVRAVMYMVAQSLGAIAGV  140



>dbj|BAA92260.1| Plasma membrane aquaporin 2b [Raphanus sativus]
Length=283

 Score =   204 bits (518),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 122/142 (86%), Gaps = 4/142 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M K+VE        F+ +DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKEVEGAEG----FATRDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK  +D KAGG +CGGVGILGI+WAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKISSDTKAGGDECGGVGILGISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAVLYM+AQCLGAICGV
Sbjct  117  KVSLVRAVLYMVAQCLGAICGV  138



>ref|XP_004304426.1| PREDICTED: aquaporin PIP2-1-like [Fragaria vesca subsp. vesca]
Length=284

 Score =   204 bits (518),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 122/141 (87%), Gaps = 5/141 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M +D+E        F+AKDY DPPP+PLID +E  KWSFYRA+IAEF+ATLLFLY+TVLT
Sbjct  1    MGRDIEV-----GGFAAKDYQDPPPTPLIDPEEFGKWSFYRAIIAEFVATLLFLYITVLT  55

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q+D   GG  CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  56   VIGYKSQSDTLKGGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  115

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+LPRAVLY++AQCLGAICG
Sbjct  116  KVSLPRAVLYIVAQCLGAICG  136



>ref|XP_009624885.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana tomentosiformis]
Length=291

 Score =   204 bits (518),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 124/148 (84%), Gaps = 4/148 (3%)
 Frame = +2

Query  38   SLISLAAMTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllf  217
            SL     M KD E       E++ KDY DPPP+PLID +EL KWSFYRA+IAEFIATLLF
Sbjct  2    SLFFGEQMAKDTEV----GTEYAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLF  57

Query  218  lyvtvltvIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVT  397
            LY+TVLTVIGYK QTDP   G+ CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVT
Sbjct  58   LYITVLTVIGYKSQTDPDHKGEQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVT  117

Query  398  FGLFLARKVTLPRAVLYMIAQCLGAICG  481
            FGLFLARKV+L RA++YM+AQCLGAICG
Sbjct  118  FGLFLARKVSLVRAIMYMLAQCLGAICG  145



>gb|KEH39328.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=268

 Score =   203 bits (516),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 121/142 (85%), Gaps = 2/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE V EQ  EFSAKDY DPPP+PL D DELTKWS YRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MGKDVE-VQEQGGEFSAKDYQDPPPAPLFDLDELTKWSLYRAVIAEFVATLLFLYITVLT  59

Query  239  vIGYKHQTDPK-AGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  415
            +IGY  Q+D    G  +C GVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF+ 
Sbjct  60   IIGYSRQSDTTIKGNTECDGVGVLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFVG  119

Query  416  RKVTLPRAVLYMIAQCLGAICG  481
            RKV+L RA LY++AQCLGAICG
Sbjct  120  RKVSLIRAFLYIVAQCLGAICG  141



>ref|XP_010483715.1| PREDICTED: probable aquaporin PIP2-4 [Camelina sativa]
Length=286

 Score =   204 bits (518),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 123/141 (87%), Gaps = 1/141 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD++ V E  A  +A+DY DPPP+PL+D +EL KWS YRAVIAEF+ATLLFLYV+VLT
Sbjct  1    MAKDLD-VQEGGAPAAARDYADPPPAPLLDMEELRKWSLYRAVIAEFVATLLFLYVSVLT  59

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK QTD  AGG DCGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVT GLFLAR
Sbjct  60   VIGYKAQTDANAGGVDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTMGLFLAR  119

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L R VLY++AQCLGAICG
Sbjct  120  KVSLVRTVLYIVAQCLGAICG  140



>gb|ABN11917.1| aquaporin [Cucurbita ficifolia]
Length=284

 Score =   203 bits (517),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 121/141 (86%), Gaps = 5/141 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD EA       F+AKDYHDPPP+PLID +E T+WSFYRA+IAEFI TLLFLYVTVLT
Sbjct  1    MAKDSEA-----GGFAAKDYHDPPPAPLIDVEEFTQWSFYRAIIAEFITTLLFLYVTVLT  55

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGY  Q+D   GG  CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  56   VIGYSSQSDVDNGGHICGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  115

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RAVLYM+AQC+GAICG
Sbjct  116  KVSLVRAVLYMVAQCVGAICG  136



>ref|NP_001280185.1| aquaporin PIP2-2 [Prunus mume]
 dbj|BAE48656.1| aquaporin [Prunus mume]
Length=281

 Score =   203 bits (517),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 123/142 (87%), Gaps = 6/142 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE    +  EF+AKDYHDPPP+P  D +ELTKWSFYRA+IAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEGA--EHGEFAAKDYHDPPPTPFFDAEELTKWSFYRALIAEFVATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q+     G  CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQSS----GDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  114

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+LPRAVLY+IAQ LGAICGV
Sbjct  115  KVSLPRAVLYIIAQSLGAICGV  136



>emb|CDX67611.1| BnaA07g16510D [Brassica napus]
Length=286

 Score =   203 bits (517),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 118/142 (83%), Gaps = 3/142 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            MTKDV     +   FS KDY DPPP PL D  EL +WSFYRA+IAEFIATLLFLYVTV+T
Sbjct  1    MTKDVAG---EKGSFSGKDYQDPPPEPLFDATELGRWSFYRALIAEFIATLLFLYVTVMT  57

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK QTDP      C GVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  58   VIGYKSQTDPTLNPDQCAGVGVLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  117

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KVTL RAV+YM+AQCLGAICGV
Sbjct  118  KVTLVRAVMYMVAQCLGAICGV  139



>gb|ACU24483.1| unknown [Glycine max]
Length=284

 Score =   203 bits (517),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 122/142 (86%), Gaps = 5/142 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE    +   FS KDY DPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--AERGSFSGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYKHQTD       CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKHQTDH---ADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  115

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RA++YM+AQCL AICGV
Sbjct  116  KVSLIRAIMYMVAQCLSAICGV  137



>gb|AGC24024.1| plasma membrane intrinsic protein 1 [Lilium hybrid cultivar]
Length=288

 Score =   203 bits (517),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 121/144 (84%), Gaps = 3/144 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+EA      EF AKDY DPPP+P +   ELTKWSFYRA+IAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAA-AGAGEFPAKDYTDPPPAPFLGIGELTKWSFYRALIAEFVATLLFLYITVAT  59

Query  239  vIGYKHQTDPKAG--GQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  412
            VIGYKHQ+D   G    DC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  60   VIGYKHQSDTTLGTPNADCEGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  119

Query  413  ARKVTLPRAVLYMIAQCLGAICGV  484
            ARKV+L RAVLYMIAQCLGAICGV
Sbjct  120  ARKVSLIRAVLYMIAQCLGAICGV  143



>ref|XP_010689549.1| PREDICTED: aquaporin PIP2-1-like [Beta vulgaris subsp. vulgaris]
Length=274

 Score =   203 bits (516),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 123/143 (86%), Gaps = 1/143 (1%)
 Frame = +2

Query  59   MTKDVEAVP-EQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvl  235
            MTKDVEAV  +Q  EF   DYHDPPP+PLID +EL KW FYRA+IAEF+ATLLFLYVT+L
Sbjct  1    MTKDVEAVSVQQQPEFLDIDYHDPPPAPLIDMEELKKWPFYRAIIAEFVATLLFLYVTIL  60

Query  236  tvIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  415
            TVIG+   +D  AGG+ CGGVGILGIAW FGGMIFILVYCTA ISGGHINPAVTFGLFLA
Sbjct  61   TVIGHSRNSDLGAGGKSCGGVGILGIAWTFGGMIFILVYCTAPISGGHINPAVTFGLFLA  120

Query  416  RKVTLPRAVLYMIAQCLGAICGV  484
            RKV+L RA+ YM+AQCLGAICGV
Sbjct  121  RKVSLIRALAYMVAQCLGAICGV  143



>gb|ABO69705.2| aquaporin PIP2 [Prunus humilis]
Length=281

 Score =   203 bits (516),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 123/142 (87%), Gaps = 6/142 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE    +  EF+AKDYHDPPP+P  D +ELTKWSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEGA--EHGEFAAKDYHDPPPTPFFDAEELTKWSFYRALIAEFVATLLFLYVTVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q+     G  CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQSS----GDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  114

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+LPRAVLY++AQ LGAICGV
Sbjct  115  KVSLPRAVLYIVAQSLGAICGV  136



>emb|CDX74984.1| BnaA05g07300D [Brassica napus]
Length=310

 Score =   204 bits (519),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 123/142 (87%), Gaps = 4/142 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M K+VE        F+++DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKEVEGAEG----FASRDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK  +D KAGG +CGGVGILGI+WAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKISSDTKAGGDECGGVGILGISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAVLYM+AQCLGAICGV
Sbjct  117  KVSLVRAVLYMVAQCLGAICGV  138



>ref|NP_001274397.1| aquaporin PIP2-1-like [Cucumis sativus]
 gb|AHB33478.1| plasma intrinsic protein 2-2 [Cucumis sativus]
 gb|KGN48147.1| Aquaporin [Cucumis sativus]
Length=284

 Score =   203 bits (516),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 121/141 (86%), Gaps = 5/141 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD +A       F+AKDYHDPPP+P ID  E T+WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDSDA-----GAFAAKDYHDPPPAPFIDPHEFTQWSFYRAIIAEFIATLLFLYVTVLT  55

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGY  Q+D K  GQ CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  56   VIGYSSQSDIKHNGQICGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  115

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RAVLYM+AQCLGAICG
Sbjct  116  KVSLVRAVLYMVAQCLGAICG  136



>ref|XP_002532756.1| Aquaporin PIP2.1, putative [Ricinus communis]
 gb|EEF29633.1| Aquaporin PIP2.1, putative [Ricinus communis]
Length=283

 Score =   203 bits (516),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 124/142 (87%), Gaps = 6/142 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E     P  FSAKDYHDPPP+PLID  ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MVKDMEVGERGP--FSAKDYHDPPPAPLIDAVELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q++  +    CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQSESDS----CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  114

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RA++YM+AQCLGAICGV
Sbjct  115  KVSLVRAIMYMVAQCLGAICGV  136



>gb|KFK34721.1| hypothetical protein AALP_AA5G183600 [Arabis alpina]
Length=286

 Score =   203 bits (516),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 119/142 (84%), Gaps = 3/142 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            MTK+V     +   FS KDYHDPPP P+ D  EL KWSFYRA+IAEFIATLLFLYVTV+T
Sbjct  1    MTKEVVG---ENRSFSGKDYHDPPPEPIFDATELGKWSFYRALIAEFIATLLFLYVTVMT  57

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK QTDP      C GVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  58   VIGYKSQTDPTLNPDQCAGVGVLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  117

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KVTL RAV+YM+AQCLGAICGV
Sbjct  118  KVTLLRAVMYMVAQCLGAICGV  139



>ref|XP_006296058.1| hypothetical protein CARUB_v10025207mg [Capsella rubella]
 gb|EOA28956.1| hypothetical protein CARUB_v10025207mg [Capsella rubella]
Length=285

 Score =   203 bits (516),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 120/142 (85%), Gaps = 4/142 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M K+VE        F  +DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKNVEGADG----FQTRDYQDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGY  Q+D  AGG +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYNIQSDTTAGGVECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAVLYM+AQCLGAICGV
Sbjct  117  KVSLVRAVLYMVAQCLGAICGV  138



>ref|XP_003597235.1| Aquaporin PIP2-7 [Medicago truncatula]
 gb|AES67486.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=287

 Score =   203 bits (516),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 121/142 (85%), Gaps = 2/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE V EQ  EFSAKDY DPPP+PL D DELTKWS YRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MGKDVE-VQEQGGEFSAKDYQDPPPAPLFDLDELTKWSLYRAVIAEFVATLLFLYITVLT  59

Query  239  vIGYKHQTDPK-AGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  415
            +IGY  Q+D    G  +C GVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF+ 
Sbjct  60   IIGYSRQSDTTIKGNTECDGVGVLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFVG  119

Query  416  RKVTLPRAVLYMIAQCLGAICG  481
            RKV+L RA LY++AQCLGAICG
Sbjct  120  RKVSLIRAFLYIVAQCLGAICG  141



>ref|XP_011031744.1| PREDICTED: probable aquaporin PIP2-5 [Populus euphratica]
Length=285

 Score =   203 bits (516),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 122/142 (86%), Gaps = 4/142 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E    +   FSAKDY DPPP+PLID +ELTKWSFYRA+IAEFIAT+LFLY+TVLT
Sbjct  1    MAKDIEV--AEAGSFSAKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATMLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q D  A    C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQIDGNA--DPCNGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  116

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAV+YM+AQCLGAICGV
Sbjct  117  KVSLIRAVMYMVAQCLGAICGV  138



>ref|XP_003625627.1| Aquaporin PIP2-1 [Medicago truncatula]
 gb|ABD32807.1| Major intrinsic protein [Medicago truncatula]
 gb|AES81845.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=287

 Score =   203 bits (516),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 121/142 (85%), Gaps = 2/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+EA P+       KDYHDPPP+PL D  EL +WSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MAKDIEAEPQ--GGVPHKDYHDPPPAPLFDTAELGQWSFYRALIAEFVATLLFLYVTVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGY  QTDP   G +C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYNAQTDPAHNGTNCDGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAVLYM+AQCLGAICGV
Sbjct  119  KVSLIRAVLYMVAQCLGAICGV  140



>ref|XP_008449255.1| PREDICTED: aquaporin PIP2-2-like [Cucumis melo]
Length=284

 Score =   203 bits (516),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 121/141 (86%), Gaps = 5/141 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD +A       F+AKDYHDPPP+P ID  E T+WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDSDA-----GAFAAKDYHDPPPAPFIDPHEFTQWSFYRAIIAEFIATLLFLYVTVLT  55

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGY  Q+D K  GQ CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  56   VIGYSSQSDIKHNGQICGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  115

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RAVLYM+AQCLGAICG
Sbjct  116  KVSLVRAVLYMVAQCLGAICG  136



>ref|XP_009387242.1| PREDICTED: aquaporin PIP2-5 [Musa acuminata subsp. malaccensis]
Length=286

 Score =   203 bits (516),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 120/144 (83%), Gaps = 4/144 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVEA      E+  KDY DPPP PL+D +ELTKWS YRA IAEF+AT+LFLYVTV T
Sbjct  1    MAKDVEAGGR--GEYGGKDYSDPPPEPLVDAEELTKWSLYRAAIAEFVATMLFLYVTVAT  58

Query  239  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  412
            VIGYKHQ+DP     D  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  59   VIGYKHQSDPAVNPTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  118

Query  413  ARKVTLPRAVLYMIAQCLGAICGV  484
            ARK++L RA+LYMIAQCLGAICGV
Sbjct  119  ARKISLVRALLYMIAQCLGAICGV  142



>gb|AFK33316.1| unknown [Medicago truncatula]
Length=287

 Score =   203 bits (516),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 121/142 (85%), Gaps = 2/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+EA P+       KDYHDPPP+PL D  EL +WSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MAKDIEAEPQ--GGVPHKDYHDPPPAPLFDTAELGQWSFYRALIAEFVATLLFLYVTVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGY  QTDP   G +C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYNAQTDPAHNGTNCDGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAVLYM+AQCLGAICGV
Sbjct  119  KVSLIRAVLYMVAQCLGAICGV  140



>ref|XP_009131906.1| PREDICTED: probable aquaporin PIP2-4 [Brassica rapa]
Length=285

 Score =   202 bits (515),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 121/141 (86%), Gaps = 2/141 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E   ++    +A+DY DPPP+PL D +EL KWS YRAVIAEF+ATLLFLYV++LT
Sbjct  1    MAKDLEV--QEGGAMAARDYQDPPPAPLFDMEELGKWSLYRAVIAEFVATLLFLYVSILT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK QTD  AGG DCGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVT GLFLAR
Sbjct  59   VIGYKAQTDANAGGVDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTVGLFLAR  118

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L R VLY++AQCLGAICG
Sbjct  119  KVSLVRTVLYIVAQCLGAICG  139



>ref|XP_008385311.1| PREDICTED: probable aquaporin PIP2-2 [Malus domestica]
Length=281

 Score =   202 bits (515),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 123/142 (87%), Gaps = 6/142 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE    +  EF+ KDYHDPPP+PL D +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEGA--EHGEFATKDYHDPPPTPLFDAEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q++       CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQSE----ADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  114

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAVLY+IAQCLGAICGV
Sbjct  115  KVSLIRAVLYIIAQCLGAICGV  136



>ref|XP_009126591.1| PREDICTED: probable aquaporin PIP2-4 [Brassica rapa]
Length=283

 Score =   202 bits (515),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 122/141 (87%), Gaps = 4/141 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E V E  A   A+DY DPPP+PL D +EL KWS YRAVIAEF+ATLLFLYV++LT
Sbjct  1    MAKDLE-VQEGRA---ARDYQDPPPAPLFDMEELGKWSLYRAVIAEFVATLLFLYVSILT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK QTD  AGG DCGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKAQTDASAGGADCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  116

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L R VLY++AQCLGAICG
Sbjct  117  KVSLVRTVLYIVAQCLGAICG  137



>tpg|DAA64674.1| TPA_exp: aquaporin PIP2 2 [Nicotiana tabacum]
Length=283

 Score =   202 bits (515),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 122/141 (87%), Gaps = 4/141 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E       E++ KDY DPPP+PLID +EL KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDIEV----GTEYAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q DP   G+ CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQIDPDHNGEQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  116

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RA++YM+AQCLGAICG
Sbjct  117  KVSLVRAIMYMLAQCLGAICG  137



>gb|EYU39575.1| hypothetical protein MIMGU_mgv1a011441mg [Erythranthe guttata]
Length=281

 Score =   202 bits (514),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 121/142 (85%), Gaps = 8/142 (6%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDV     +   F AKDYHDPPP+PLID +ELTKWSFYRAVIAEFIATLLFLY+TV T
Sbjct  1    MAKDVA----EQGSFGAKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYITVAT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q    A   +CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQ----AAVDECGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  112

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAV+YM+AQCLGAICGV
Sbjct  113  KVSLVRAVMYMVAQCLGAICGV  134



>gb|ACJ85211.1| unknown [Medicago truncatula]
Length=259

 Score =   201 bits (512),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 121/142 (85%), Gaps = 2/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+EA P+       KDYHDPPP+PL D  EL +WSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MAKDIEAEPQ--GGVPHKDYHDPPPAPLFDTAELGQWSFYRALIAEFVATLLFLYVTVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGY  QTDP   G +C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYNAQTDPAHNGTNCDGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RAVLYM+AQCLGAICGV
Sbjct  119  KVSLIRAVLYMVAQCLGAICGV  140



>ref|XP_007150204.1| hypothetical protein PHAVU_005G135300g [Phaseolus vulgaris]
 gb|ESW22198.1| hypothetical protein PHAVU_005G135300g [Phaseolus vulgaris]
Length=287

 Score =   202 bits (515),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 121/142 (85%), Gaps = 2/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE V EQP E+SAKDYHDPPP+PL D DELTKWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQP-EYSAKDYHDPPPAPLFDPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  239  vIGYKHQTDPKA-GGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  415
            +IGYK QTD    G  +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVT GLFL 
Sbjct  60   IIGYKRQTDTSIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTLGLFLG  119

Query  416  RKVTLPRAVLYMIAQCLGAICG  481
            RKV+L RA+LY++AQC GAI G
Sbjct  120  RKVSLVRALLYIVAQCAGAISG  141



>ref|XP_009760326.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana sylvestris]
Length=283

 Score =   202 bits (514),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 122/141 (87%), Gaps = 4/141 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E       E++ KDY DPPP+PLID +EL KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDIEV----GTEYAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q DP   G+ CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQIDPDHNGEQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  116

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RA++YM+AQCLGAICG
Sbjct  117  KVSLVRAIMYMLAQCLGAICG  137



>tpg|DAA64673.1| TPA_exp: aquaporin PIP2 1 [Nicotiana tabacum]
Length=291

 Score =   202 bits (515),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 123/148 (83%), Gaps = 4/148 (3%)
 Frame = +2

Query  38   SLISLAAMTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllf  217
            SL     M KD E       E++ KDY DPPP+PLID +EL KWSFYRA+IAEFIATLLF
Sbjct  2    SLFFGEQMAKDTEV----GTEYAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLF  57

Query  218  lyvtvltvIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVT  397
            LY+TVLTVIGYK Q DP   G+ CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVT
Sbjct  58   LYITVLTVIGYKSQIDPDHNGEQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVT  117

Query  398  FGLFLARKVTLPRAVLYMIAQCLGAICG  481
            FGLFLARKV+L RA++YM+AQCLGAICG
Sbjct  118  FGLFLARKVSLVRAIMYMLAQCLGAICG  145



>gb|AHA84128.1| plasma membrane integral protein ZmPIP2-7 [Phaseolus vulgaris]
Length=287

 Score =   202 bits (515),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 121/142 (85%), Gaps = 2/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE V EQP E+SAKDYHDPPP+PL D DELTKWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQP-EYSAKDYHDPPPAPLFDPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  239  vIGYKHQTDPKA-GGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  415
            +IGYK QTD    G  +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVT GLFL 
Sbjct  60   IIGYKRQTDTSIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTLGLFLG  119

Query  416  RKVTLPRAVLYMIAQCLGAICG  481
            RKV+L RA+LY++AQC GAI G
Sbjct  120  RKVSLVRALLYIVAQCAGAISG  141



>ref|XP_010098191.1| Aquaporin PIP2-7 [Morus notabilis]
 gb|EXB74647.1| Aquaporin PIP2-7 [Morus notabilis]
Length=281

 Score =   202 bits (514),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 124/141 (88%), Gaps = 6/141 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE V  +  EF AKDYHDPPP+PLID +ELT+WSFYRA+IAEFIATLLFLYVT+LT
Sbjct  1    MAKDVEVV--EGGEFQAKDYHDPPPAPLIDPEELTQWSFYRALIAEFIATLLFLYVTILT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q+       +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQSAT----DECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  114

Query  419  KVTLPRAVLYMIAQCLGAICG  481
            KV+L RAVLY++AQCLGAICG
Sbjct  115  KVSLVRAVLYIVAQCLGAICG  135



>emb|CDX10333.1| aquaporin [Coffea arabica]
Length=288

 Score =   202 bits (515),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 122/142 (86%), Gaps = 2/142 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+  V E    F+ KDYHDPPP+PLID +ELTKWSF+RA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDM-GVAEH-GSFTTKDYHDPPPAPLIDLEELTKWSFFRAIIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK Q D    G  CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQIDVAHQGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KV+L RA+ YM+AQC+GAICGV
Sbjct  119  KVSLTRALAYMVAQCVGAICGV  140



>ref|XP_004956113.1| PREDICTED: aquaporin PIP2-1-like [Setaria italica]
Length=289

 Score =   202 bits (514),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 118/130 (91%), Gaps = 1/130 (1%)
 Frame = +2

Query  98   EFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTDPKAG  277
            EF+AKDY DPPP+PLID  EL  WS YRAVIAEFIATLLFLY+TVLTVIGYKHQTDP   
Sbjct  15   EFAAKDYTDPPPAPLIDAAELGSWSLYRAVIAEFIATLLFLYITVLTVIGYKHQTDPNVA  74

Query  278  GQD-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMI  454
            G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV+L RA+LY++
Sbjct  75   GTDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYIV  134

Query  455  AQCLGAICGV  484
            AQCLGAICGV
Sbjct  135  AQCLGAICGV  144



>ref|XP_006403531.1| hypothetical protein EUTSA_v10010603mg [Eutrema salsugineum]
 gb|ESQ44984.1| hypothetical protein EUTSA_v10010603mg [Eutrema salsugineum]
Length=286

 Score =   202 bits (514),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 118/142 (83%), Gaps = 3/142 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            MTK+V     +   FS KDY DPPP PL D  EL KWSFYRA+IAEFIATLLFLYVTV+T
Sbjct  1    MTKEVVG---EKRSFSGKDYQDPPPEPLFDAAELGKWSFYRALIAEFIATLLFLYVTVMT  57

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK QTDP      C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  58   VIGYKSQTDPTLNPDQCAGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  117

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KVTL RAV+YM+AQCLGAICGV
Sbjct  118  KVTLVRAVMYMVAQCLGAICGV  139



>emb|CDY07519.1| BnaC06g15450D [Brassica napus]
Length=286

 Score =   202 bits (514),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 118/142 (83%), Gaps = 3/142 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            MTKDV     +   FS KDY DPPP PL D  EL +WSFYRA+IAEFIATLLFLYVTV+T
Sbjct  1    MTKDVAG---EKGSFSGKDYQDPPPEPLFDATELGRWSFYRALIAEFIATLLFLYVTVMT  57

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  418
            VIGYK QTDP      C GVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  58   VIGYKSQTDPTLYPDQCAGVGVLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  117

Query  419  KVTLPRAVLYMIAQCLGAICGV  484
            KVTL RAV+YM+AQCLGAICGV
Sbjct  118  KVTLVRAVMYMVAQCLGAICGV  139



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562360051550