BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001G06

Length=577
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDO97380.1|  unnamed protein product                                137   5e-38   Coffea canephora [robusta coffee]
gb|ABD28547.2|  Protein C6orf115, putative                              137   3e-37   Medicago truncatula
ref|XP_003593273.1|  hypothetical protein MTR_2g009660                  137   4e-37   
gb|AFK48356.1|  unknown                                                 133   3e-36   Medicago truncatula
ref|XP_011087958.1|  PREDICTED: costars family protein                  133   3e-36   Sesamum indicum [beniseed]
ref|XP_010030000.1|  PREDICTED: costars family protein                  133   3e-36   Eucalyptus grandis [rose gum]
emb|CBI38229.3|  unnamed protein product                                131   1e-35   Vitis vinifera
ref|XP_004290405.1|  PREDICTED: costars family protein                  129   7e-35   Fragaria vesca subsp. vesca
gb|KDP29995.1|  hypothetical protein JCGZ_18762                         129   8e-35   Jatropha curcas
ref|XP_008454461.1|  PREDICTED: costars family protein                  128   2e-34   Cucumis melo [Oriental melon]
ref|XP_010691385.1|  PREDICTED: costars family protein                  128   2e-34   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010254575.1|  PREDICTED: costars family protein-like             128   2e-34   Nelumbo nucifera [Indian lotus]
ref|XP_002466642.1|  hypothetical protein SORBIDRAFT_01g011530          127   4e-34   Sorghum bicolor [broomcorn]
ref|XP_004485613.1|  PREDICTED: costars family protein-like             127   5e-34   Cicer arietinum [garbanzo]
ref|XP_007159157.1|  hypothetical protein PHAVU_002G213700g             127   5e-34   Phaseolus vulgaris [French bean]
ref|NP_001050950.1|  Os03g0690000                                       127   5e-34   
ref|XP_004982127.1|  PREDICTED: costars family protein-like             127   6e-34   Setaria italica
ref|XP_004504856.1|  PREDICTED: costars family protein-like             127   6e-34   Cicer arietinum [garbanzo]
ref|XP_010098215.1|  hypothetical protein L484_001044                   131   7e-34   
ref|XP_009343817.1|  PREDICTED: costars family protein-like             127   7e-34   Pyrus x bretschneideri [bai li]
ref|XP_008796657.1|  PREDICTED: costars family protein                  126   8e-34   Phoenix dactylifera
ref|XP_007201455.1|  hypothetical protein PRUPE_ppa013924mg             127   8e-34   Prunus persica
ref|XP_009368310.1|  PREDICTED: costars family protein                  126   1e-33   Pyrus x bretschneideri [bai li]
ref|XP_006423704.1|  hypothetical protein CICLE_v10029672mg             126   1e-33   Citrus clementina [clementine]
ref|XP_007042821.1|  C6orf115, putative                                 126   1e-33   Theobroma cacao [chocolate]
ref|XP_006650425.1|  PREDICTED: costars family protein-like             126   1e-33   Oryza brachyantha
ref|XP_009366325.1|  PREDICTED: costars family protein-like             125   2e-33   Pyrus x bretschneideri [bai li]
ref|XP_002522688.1|  Protein C6orf115, putative                         125   3e-33   Ricinus communis
ref|XP_008382197.1|  PREDICTED: costars family protein                  127   3e-33   
gb|ACG31036.1|  hypothetical protein                                    124   4e-33   Zea mays [maize]
ref|XP_009792409.1|  PREDICTED: costars family protein                  125   5e-33   Nicotiana sylvestris
ref|XP_010923309.1|  PREDICTED: costars family protein                  124   5e-33   Elaeis guineensis
ref|XP_006359368.1|  PREDICTED: costars family protein-like             124   5e-33   Solanum tuberosum [potatoes]
gb|EMS63642.1|  hypothetical protein TRIUR3_05750                       124   8e-33   Triticum urartu
ref|XP_010277586.1|  PREDICTED: costars family protein                  124   8e-33   Nelumbo nucifera [Indian lotus]
ref|XP_006284841.1|  hypothetical protein CARUB_v10006123mg             124   8e-33   Capsella rubella
ref|XP_009412481.1|  PREDICTED: costars family protein                  124   1e-32   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX68993.1|  BnaC01g04600D                                          124   1e-32   
ref|XP_008358397.1|  PREDICTED: costars family protein-like             124   1e-32   
ref|XP_009620459.1|  PREDICTED: costars family protein                  124   1e-32   Nicotiana tomentosiformis
ref|XP_002309860.1|  hypothetical protein POPTR_0007s03140g             123   2e-32   Populus trichocarpa [western balsam poplar]
ref|XP_010645168.1|  PREDICTED: LOW QUALITY PROTEIN: costars fami...    123   2e-32   Vitis vinifera
ref|XP_011023072.1|  PREDICTED: costars family protein                  123   3e-32   Populus euphratica
ref|XP_010231394.1|  PREDICTED: costars family protein                  122   3e-32   Brachypodium distachyon [annual false brome]
ref|XP_003529267.1|  PREDICTED: costars family protein-like             121   8e-32   Glycine max [soybeans]
ref|XP_003531014.1|  PREDICTED: costars family protein At4g33640-...    121   8e-32   Glycine max [soybeans]
gb|EYU18406.1|  hypothetical protein MIMGU_mgv1a017197mg                119   6e-31   Erythranthe guttata [common monkey flower]
ref|NP_567930.1|  uncharacterized protein                               119   9e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008237249.1|  PREDICTED: costars family protein                  119   1e-30   Prunus mume [ume]
ref|XP_010432532.1|  PREDICTED: costars family protein At4g33640        118   1e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010437738.1|  PREDICTED: costars family protein At4g33640-...    118   1e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010447216.1|  PREDICTED: costars family protein At4g33640-...    118   1e-30   Camelina sativa [gold-of-pleasure]
gb|KFK29986.1|  hypothetical protein AALP_AA7G203000                    118   1e-30   Arabis alpina [alpine rockcress]
emb|CAA20577.1|  putative protein                                       120   2e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867166.1|  hypothetical protein ARALYDRAFT_491316             117   3e-30   Arabidopsis lyrata subsp. lyrata
ref|XP_006412331.1|  hypothetical protein EUTSA_v10026671mg             117   3e-30   Eutrema salsugineum [saltwater cress]
ref|XP_010547923.1|  PREDICTED: costars family protein ST45-2           117   4e-30   Tarenaya hassleriana [spider flower]
ref|XP_003608396.1|  hypothetical protein MTR_4g093660                  116   6e-30   Medicago truncatula
ref|XP_009120730.1|  PREDICTED: costars family protein ST45-2           116   8e-30   Brassica rapa
gb|ACG47970.1|  hypothetical protein                                    116   1e-29   Zea mays [maize]
ref|XP_004147507.1|  PREDICTED: costars family protein-like             117   1e-29   
ref|XP_006852895.1|  hypothetical protein AMTR_s00033p00221650          115   2e-29   Amborella trichopoda
sp|A9NK39.1|COSA_PICSI  RecName: Full=Costars family protein WS02...    114   7e-29   Picea sitchensis
ref|XP_009062533.1|  hypothetical protein LOTGIDRAFT_207050             108   7e-27   Lottia gigantea
ref|XP_002131888.1|  PREDICTED: costars family protein ABRACL-like      107   3e-26   Ciona intestinalis [sea vase]
gb|KGN53893.1|  hypothetical protein Csa_4G182240                       105   9e-26   Cucumis sativus [cucumbers]
ref|XP_002963364.1|  hypothetical protein SELMODRAFT_8583               105   2e-25   
ref|XP_003971945.1|  PREDICTED: costars family protein ABRACL-like      104   2e-25   
ref|XP_005102609.1|  PREDICTED: costars family protein ABRACL-lik...    103   6e-25   Aplysia californica
ref|XP_011423954.1|  PREDICTED: costars family protein ABRACL-like      103   7e-25   Crassostrea gigas
ref|NP_001154032.1|  CF115 protein                                      103   9e-25   Oncorhynchus mykiss
ref|XP_002974652.1|  hypothetical protein SELMODRAFT_8582               102   2e-24   
ref|XP_008112706.1|  PREDICTED: costars family protein ABRACL iso...    102   2e-24   Anolis carolinensis [Carolina anole]
ref|NP_998807.1|  costars family protein ABRACL                         101   3e-24   Danio rerio [leopard danio]
ref|XP_010880879.1|  PREDICTED: costars family protein ABRACL           101   3e-24   Esox lucius
ref|XP_003387508.1|  PREDICTED: costars family protein ABRACL-like      101   4e-24   Amphimedon queenslandica
ref|NP_001165090.1|  costars family protein ABRACL                      101   4e-24   Xenopus laevis [clawed frog]
gb|ETO27738.1|  hypothetical protein RFI_09392                          101   5e-24   Reticulomyxa filosa
gb|KFP31952.1|  Costars family protein ABRACL                           100   7e-24   Colius striatus
gb|KFQ69396.1|  Costars family protein ABRACL                           100   7e-24   Phaethon lepturus
ref|NP_001134634.1|  costars family protein ABRACL                      100   7e-24   Salmo salar
gb|KFR07389.1|  Costars family protein ABRACL                           100   8e-24   Opisthocomus hoazin [hoatzin]
ref|NP_001165089.1|  costars family protein ABRACL                      100   8e-24   Xenopus tropicalis [western clawed frog]
gb|AAQ55814.1|  hypothetical protein                                    101   9e-24   Coturnix coturnix
gb|KFO13502.1|  Costars family protein ABRACL                           100   9e-24   Balearica regulorum gibbericeps
ref|XP_003446311.1|  PREDICTED: costars family protein ABRACL-lik...    100   1e-23   
gb|KFZ52453.1|  Costars family protein ABRACL                           100   1e-23   Antrostomus carolinensis
gb|KGL81992.1|  Costars family protein ABRACL                           100   1e-23   Tinamus guttatus
ref|XP_008311631.1|  PREDICTED: costars family protein ABRACL           100   1e-23   Cynoglossus semilaevis [half-smooth tongue sole]
gb|KFQ08843.1|  Costars family protein ABRACL                           100   1e-23   Leptosomus discolor
ref|XP_002158724.1|  PREDICTED: costars family protein ABRACL-like      100   2e-23   Hydra vulgaris
ref|XP_009687213.1|  PREDICTED: costars family protein ABRACL iso...    100   2e-23   Struthio camelus australis
ref|XP_010200782.1|  PREDICTED: costars family protein ABRACL         99.8    2e-23   Colius striatus
gb|EMC83349.1|  UPF0727 protein C6orf115 like protein                 99.8    2e-23   
ref|XP_003223326.1|  PREDICTED: costars family protein ABRACL iso...  99.8    2e-23   Anolis carolinensis [Carolina anole]
ref|XP_010737667.1|  PREDICTED: costars family protein ABRACL         99.4    2e-23   Larimichthys crocea [croceine croaker]
ref|XP_783554.1|  PREDICTED: costars family protein ABRACL-like       99.4    2e-23   
dbj|GAM18052.1|  hypothetical protein SAMD00019534_012270             99.4    2e-23   Acytostelium subglobosum LB1
gb|KFO73634.1|  Costars family protein ABRACL                         99.4    2e-23   Cuculus canorus
ref|XP_003770544.1|  PREDICTED: costars family protein ABRACL-like    99.4    2e-23   Sarcophilus harrisii
gb|ACO09013.1|  C6orf115                                              99.4    3e-23   Osmerus mordax
gb|KFZ55568.1|  Costars family protein ABRACL                         99.4    3e-23   Podiceps cristatus
gb|KFV63720.1|  Costars family protein ABRACL                         99.4    3e-23   Picoides pubescens
gb|KFM09004.1|  Costars family protein ABRACL                         99.4    3e-23   Aptenodytes forsteri
ref|XP_007423586.1|  PREDICTED: costars family protein ABRACL iso...  99.0    3e-23   Python bivittatus
gb|KFV46510.1|  Costars family protein ABRACL                         99.0    3e-23   Tyto alba [Schleiereule]
gb|KFQ52259.1|  Costars family protein ABRACL                         99.0    3e-23   Pelecanus crispus
ref|XP_002714893.1|  PREDICTED: costars family protein ABRACL         99.0    4e-23   Oryctolagus cuniculus [domestic rabbit]
ref|XP_002505679.1|  predicted protein                                99.0    4e-23   Micromonas commoda
gb|KFP80599.1|  Costars family protein ABRACL                         99.0    4e-23   Apaloderma vittatum
ref|XP_010284041.1|  PREDICTED: costars family protein ABRACL         99.0    4e-23   Phaethon lepturus
ref|XP_009930257.1|  PREDICTED: costars family protein ABRACL         99.0    4e-23   Opisthocomus hoazin [hoatzin]
gb|KFV88505.1|  Costars family protein ABRACL                         99.0    4e-23   Struthio camelus australis
ref|XP_010306042.1|  PREDICTED: costars family protein ABRACL         98.6    5e-23   Balearica regulorum gibbericeps
ref|XP_008304863.1|  PREDICTED: costars family protein ABRACL-like    98.6    5e-23   Stegastes partitus
ref|XP_005043771.1|  PREDICTED: costars family protein ABRACL         98.6    5e-23   Ficedula albicollis
gb|KFP01035.1|  Costars family protein ABRACL                         98.6    5e-23   Calypte anna
ref|XP_005361042.1|  PREDICTED: costars family protein ABRACL iso...  98.6    6e-23   Microtus ochrogaster [prairie voles]
gb|KFU90284.1|  Costars family protein ABRACL                         98.6    6e-23   Chaetura pelagica
ref|XP_003204212.1|  PREDICTED: costars family protein ABRACL         98.2    6e-23   Meleagris gallopavo [common turkey]
ref|XP_006642989.1|  PREDICTED: costars family protein ABRACL-like    98.2    7e-23   Lepisosteus oculatus
ref|XP_010176388.1|  PREDICTED: costars family protein ABRACL         98.2    7e-23   Antrostomus carolinensis
gb|KFQ22819.1|  Costars family protein ABRACL                         98.2    8e-23   Mesitornis unicolor
ref|XP_010219792.1|  PREDICTED: costars family protein ABRACL         98.2    8e-23   Tinamus guttatus
gb|KFQ35820.1|  Costars family protein ABRACL                         98.2    8e-23   Merops nubicus
ref|XP_004587333.1|  PREDICTED: costars family protein ABRACL         97.8    9e-23   Ochotona princeps [southern American pika]
ref|XP_009946947.1|  PREDICTED: costars family protein ABRACL         97.8    9e-23   Leptosomus discolor
ref|XP_005280433.1|  PREDICTED: costars family protein ABRACL iso...  99.4    9e-23   
ref|XP_004550622.1|  PREDICTED: costars family protein ABRACL-like    97.8    1e-22   Maylandia zebra
ref|XP_007245508.1|  PREDICTED: costars family protein ABRACL         98.6    1e-22   Astyanax mexicanus [blind cave fish]
gb|EDL03471.1|  mCG7517, isoform CRA_a                                97.8    1e-22   Mus musculus [mouse]
ref|XP_005509479.1|  PREDICTED: costars family protein ABRACL         97.8    1e-22   Columba livia [carrier pigeon]
ref|XP_007649289.1|  PREDICTED: costars family protein ABRACL iso...  97.8    1e-22   
gb|KFW11356.1|  Costars family protein ABRACL                         97.8    1e-22   Eurypyga helias
ref|XP_004628595.1|  PREDICTED: costars family protein ABRACL         97.4    1e-22   Octodon degus
ref|XP_005230222.1|  PREDICTED: costars family protein ABRACL         97.4    1e-22   Falco peregrinus [peregrine]
ref|XP_004636782.1|  PREDICTED: costars family protein ABRACL-like    97.4    1e-22   
ref|NP_001289105.1|  costars family protein ABRACL                    97.4    1e-22   Gallus gallus [bantam]
ref|XP_002197784.1|  PREDICTED: costars family protein ABRACL         97.4    1e-22   Taeniopygia guttata
ref|XP_003340441.1|  PREDICTED: costars family protein ABRACL         97.4    1e-22   Monodelphis domestica
ref|XP_009909861.1|  PREDICTED: costars family protein ABRACL         97.1    2e-22   Picoides pubescens
gb|KFQ49984.1|  Costars family protein ABRACL                         97.1    2e-22   Nestor notabilis
ref|XP_009482515.1|  PREDICTED: costars family protein ABRACL         97.1    2e-22   Pelecanus crispus
ref|XP_005518508.1|  PREDICTED: costars family protein ABRACL         97.1    2e-22   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_005017805.1|  PREDICTED: costars family protein ABRACL         97.1    2e-22   
ref|XP_009961435.1|  PREDICTED: costars family protein ABRACL         97.1    2e-22   Tyto alba [Schleiereule]
ref|XP_008820248.1|  PREDICTED: costars family protein ABRACL         97.1    2e-22   Nannospalax galili
ref|XP_006112767.1|  PREDICTED: costars family protein ABRACL         97.1    2e-22   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_005420151.1|  PREDICTED: costars family protein ABRACL         97.1    2e-22   Geospiza fortis
gb|KFQ75069.1|  Costars family protein ABRACL                         97.1    2e-22   Phoenicopterus ruber ruber
ref|XP_006885004.1|  PREDICTED: costars family protein ABRACL         97.1    2e-22   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_009876408.1|  PREDICTED: costars family protein ABRACL         97.1    2e-22   Apaloderma vittatum
ref|XP_006020731.1|  PREDICTED: costars family protein ABRACL iso...  97.1    2e-22   
ref|XP_009687214.1|  PREDICTED: costars family protein ABRACL iso...  97.1    2e-22   Struthio camelus australis
ref|XP_004368930.1|  PREDICTED: costars family protein ABRACL         96.7    2e-22   Trichechus manatus latirostris
ref|XP_001640937.1|  predicted protein                                96.7    2e-22   Nematostella vectensis
ref|XP_005280434.1|  PREDICTED: costars family protein ABRACL iso...  96.7    3e-22   Chrysemys picta bellii
ref|XP_004609058.1|  PREDICTED: costars family protein ABRACL         96.7    3e-22   Sorex araneus [Eurasian shrew]
ref|XP_003986651.1|  PREDICTED: costars family protein ABRACL         96.7    3e-22   Felis catus [cat]
gb|EPQ03269.1|  hypothetical protein D623_10035727                    97.1    3e-22   Myotis brandtii
ref|XP_002817467.1|  PREDICTED: costars family protein ABRACL         96.7    3e-22   Pongo abelii [orang utan]
ref|XP_001513946.1|  PREDICTED: costars family protein ABRACL         96.7    3e-22   
ref|XP_005329869.1|  PREDICTED: costars family protein ABRACL         96.7    3e-22   Ictidomys tridecemlineatus
ref|XP_005065907.1|  PREDICTED: costars family protein ABRACL         96.7    3e-22   Mesocricetus auratus [Syrian golden hamster]
ref|XP_009996826.1|  PREDICTED: costars family protein ABRACL         96.7    3e-22   Chaetura pelagica
ref|XP_008492282.1|  PREDICTED: costars family protein ABRACL         96.7    3e-22   Calypte anna
ref|XP_004083943.1|  PREDICTED: costars family protein ABRACL         96.3    3e-22   Oryzias latipes [Japanese rice fish]
ref|XP_005489295.1|  PREDICTED: costars family protein ABRACL iso...  96.3    3e-22   Zonotrichia albicollis
ref|XP_008005040.1|  PREDICTED: costars family protein ABRACL iso...  97.1    4e-22   Chlorocebus sabaeus
ref|XP_008689265.1|  PREDICTED: costars family protein ABRACL         99.8    4e-22   Ursus maritimus [white bear]
ref|XP_006834682.1|  PREDICTED: costars family protein ABRACL         96.3    4e-22   Chrysochloris asiatica
ref|XP_008516613.1|  PREDICTED: costars family protein ABRACL         96.7    4e-22   Equus przewalskii [Przewalski horse]
ref|XP_004702032.1|  PREDICTED: costars family protein ABRACL         96.3    4e-22   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_005859127.1|  PREDICTED: costars family protein ABRACL         96.3    4e-22   Myotis brandtii
ref|XP_002912685.1|  PREDICTED: costars family protein ABRACL         96.3    4e-22   Ailuropoda melanoleuca
ref|NP_001180288.1|  uncharacterized protein LOC708266                96.3    4e-22   Macaca mulatta [rhesus macaque]
ref|XP_007058144.1|  PREDICTED: costars family protein ABRACL         96.3    4e-22   Chelonia mydas [green seaturtle]
ref|XP_004442153.1|  PREDICTED: costars family protein ABRACL         96.3    4e-22   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_010182672.1|  PREDICTED: costars family protein ABRACL         96.3    5e-22   Mesitornis unicolor
ref|XP_008945039.1|  PREDICTED: costars family protein ABRACL         96.3    5e-22   Merops nubicus
ref|XP_003404025.1|  PREDICTED: costars family protein ABRACL         95.9    5e-22   Loxodonta africana [African bush elephant]
ref|XP_006986145.1|  PREDICTED: costars family protein ABRACL iso...  95.9    5e-22   Peromyscus maniculatus bairdii
ref|NP_001160033.1|  costars family protein ABRACL                    95.9    5e-22   Bos taurus [bovine]
ref|XP_005973408.1|  PREDICTED: costars family protein ABRACL         95.9    5e-22   Pantholops hodgsonii [Tibetan antelope]
ref|XP_006915428.1|  PREDICTED: costars family protein ABRACL         95.9    5e-22   Pteropus alecto
ref|XP_004410330.1|  PREDICTED: costars family protein ABRACL         95.9    5e-22   Odobenus rosmarus divergens
ref|NP_001093117.1|  costars family protein ABRACL                    95.9    5e-22   Rattus norvegicus [brown rat]
ref|NP_067066.1|  costars family protein ABRACL                       95.9    6e-22   Homo sapiens [man]
gb|EDL03473.1|  mCG7517, isoform CRA_c                                97.4    6e-22   Mus musculus [mouse]
ref|XP_003465701.1|  PREDICTED: costars family protein ABRACL iso...  95.9    6e-22   Cavia porcellus [guinea pig]
ref|XP_010156542.1|  PREDICTED: costars family protein ABRACL         95.9    6e-22   Eurypyga helias
ref|XP_004673954.1|  PREDICTED: costars family protein ABRACL         95.9    6e-22   Condylura cristata
ref|XP_010624898.1|  PREDICTED: costars family protein ABRACL         95.9    6e-22   Fukomys damarensis [Damara mole rat]
gb|AAH39801.1|  3110003A17Rik protein                                 96.3    6e-22   Mus musculus [mouse]
ref|XP_008005039.1|  PREDICTED: costars family protein ABRACL iso...  97.8    7e-22   Chlorocebus sabaeus
ref|XP_003121220.1|  PREDICTED: costars family protein ABRACL iso...  95.9    7e-22   
gb|AAF28958.1|AF161398_1  HSPC280                                     97.4    7e-22   Homo sapiens [man]
ref|XP_004459985.1|  PREDICTED: costars family protein ABRACL iso...  95.9    7e-22   Dasypus novemcinctus
ref|XP_007944483.1|  PREDICTED: costars family protein ABRACL         95.5    7e-22   Orycteropus afer afer
ref|XP_006188561.1|  PREDICTED: costars family protein ABRACL         95.5    7e-22   Camelus ferus
ref|XP_003496586.1|  PREDICTED: costars family protein ABRACL iso...  95.5    7e-22   Cricetulus griseus [Chinese hamsters]
gb|KFW92191.1|  Costars family protein ABRACL                         95.5    7e-22   Phalacrocorax carbo [common cormorant]
ref|XP_003353243.1|  PREDICTED: costars family protein ABRACL iso...  95.5    8e-22   
gb|KFO32243.1|  hypothetical protein H920_06346                       95.9    8e-22   Fukomys damarensis [Damara mole rat]
ref|XP_005389319.1|  PREDICTED: costars family protein ABRACL iso...  95.9    8e-22   
ref|XP_533427.3|  PREDICTED: costars family protein ABRACL            95.5    8e-22   Canis lupus familiaris [dogs]
ref|NP_082716.1|  costars family protein ABRACL                       95.5    8e-22   Mus musculus [mouse]
ref|XP_005805218.1|  PREDICTED: costars family protein ABRACL-like    95.5    8e-22   Xiphophorus maculatus
ref|XP_010013288.1|  PREDICTED: costars family protein ABRACL         95.5    9e-22   Nestor notabilis
ref|XP_006151148.1|  PREDICTED: costars family protein ABRACL         95.5    9e-22   Tupaia chinensis
ref|XP_007191007.1|  PREDICTED: costars family protein ABRACL iso...  95.5    9e-22   Balaenoptera acutorostrata scammoni
ref|XP_001764433.1|  predicted protein                                95.1    9e-22   
ref|XP_006197837.1|  PREDICTED: costars family protein ABRACL         95.1    1e-21   Vicugna pacos
ref|XP_007531554.1|  PREDICTED: costars family protein ABRACL         94.7    1e-21   Erinaceus europaeus [common hedgehog]
ref|XP_004459984.1|  PREDICTED: costars family protein ABRACL iso...  95.5    1e-21   
ref|XP_006776246.1|  PREDICTED: uncharacterized protein LOC102758438  99.4    1e-21   
ref|XP_007191008.1|  PREDICTED: costars family protein ABRACL iso...  94.7    1e-21   Balaenoptera acutorostrata scammoni
ref|XP_007101089.1|  PREDICTED: costars family protein ABRACL         94.7    2e-21   Physeter catodon
ref|XP_007467653.1|  PREDICTED: costars family protein ABRACL         94.7    2e-21   Lipotes vexillifer [baiji]
gb|ERE84208.1|  putative costars family protein                       96.7    2e-21   Cricetulus griseus [Chinese hamsters]
gb|EHB16825.1|  hypothetical protein GW7_19800                        94.4    2e-21   Heterocephalus glaber [naked mole rat]
ref|XP_004263816.1|  PREDICTED: costars family protein ABRACL         94.4    2e-21   Orcinus orca [Orca]
ref|XP_005154833.1|  PREDICTED: costars family protein ABRACL         94.0    2e-21   Melopsittacus undulatus
ref|XP_007909195.1|  PREDICTED: costars family protein ABRACL         94.0    3e-21   Callorhinchus milii [Australian ghost shark]
ref|XP_008067195.1|  PREDICTED: costars family protein ABRACL         94.0    3e-21   Carlito syrichta
ref|XP_009505112.1|  PREDICTED: costars family protein ABRACL         93.6    4e-21   Phalacrocorax carbo [common cormorant]
ref|XP_004651218.1|  PREDICTED: costars family protein ABRACL         92.8    8e-21   Jaculus jaculus
pdb|2L2O|A  Chain A, Solution Structure Of Human Hspc280 Protein      92.8    1e-20   Homo sapiens [man]
gb|ACO51940.1|  C6orf115                                              92.4    1e-20   Rana catesbeiana [bullfrog]
ref|XP_006013904.1|  PREDICTED: costars family protein ABRACL-like    92.0    1e-20   Latimeria chalumnae
gb|KGL85702.1|  Costars family protein ABRACL                         91.3    2e-20   Tinamus guttatus
ref|XP_006373008.1|  hypothetical protein POPTR_0017s06990g           91.7    2e-20   
gb|KDQ20442.1|  hypothetical protein BOTBODRAFT_26447                 91.7    3e-20   Botryobasidium botryosum FD-172 SS1
ref|XP_003059997.1|  predicted protein                                91.3    3e-20   Micromonas pusilla CCMP1545
gb|AIC62228.1|  ABRACL                                                90.9    4e-20   synthetic construct
ref|XP_004347370.1|  hypothetical protein CAOG_04623                  89.7    1e-19   Capsaspora owczarzaki ATCC 30864
gb|EFB26624.1|  hypothetical protein PANDA_000424                     89.0    1e-19   Ailuropoda melanoleuca
gb|EDL03472.1|  mCG7517, isoform CRA_b                                89.7    1e-19   Mus musculus [mouse]
gb|EFA82987.1|  hypothetical protein PPL_03765                        89.4    1e-19   Heterostelium album PN500
gb|EOB02642.1|  Uncharacterized protein C6orf115                      89.0    2e-19   Anas platyrhynchos [duck]
ref|XP_004350571.1|  hypothetical protein DFA_11624                   89.4    2e-19   Cavenderia fasciculata
ref|XP_010793085.1|  PREDICTED: costars family protein ABRACL         88.2    4e-19   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_009985907.1|  PREDICTED: costars family protein ABRACL         87.8    4e-19   Tauraco erythrolophus
gb|KFV18849.1|  Costars family protein ABRACL                         87.8    4e-19   Tauraco erythrolophus
ref|XP_006898818.1|  PREDICTED: costars family protein ABRACL-like    88.2    5e-19   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_644929.1|  hypothetical protein DDB_G0272861                   87.8    5e-19   Dictyostelium discoideum AX4
gb|KII85529.1|  hypothetical protein PLICRDRAFT_166123                88.2    6e-19   Plicaturopsis crispa FD-325 SS-3
ref|XP_003294793.1|  hypothetical protein DICPUDRAFT_43951            85.5    5e-18   Dictyostelium purpureum
gb|AAH89921.1|  LOC685045 protein                                     86.7    6e-18   Rattus norvegicus [brown rat]
gb|EGV96086.1|  Epithelial cell transforming sequence 2 oncogene-...  92.0    7e-18   Cricetulus griseus [Chinese hamsters]
gb|KIM26800.1|  hypothetical protein M408DRAFT_330399                 83.6    2e-17   Serendipita vermifera MAFF 305830
ref|XP_008395555.1|  PREDICTED: costars family protein ABRACL         83.2    2e-17   Poecilia reticulata
ref|XP_004639488.1|  PREDICTED: costars family protein ABRACL-like    83.2    4e-17   
ref|XP_008869272.1|  hypothetical protein H310_06125                  84.0    6e-17   Aphanomyces invadans
ref|XP_006680866.1|  hypothetical protein BATDEDRAFT_90678            80.1    5e-16   Batrachochytrium dendrobatidis JAM81
ref|XP_009826595.1|  hypothetical protein H257_03965                  79.0    1e-15   Aphanomyces astaci
ref|XP_005711868.1|  unnamed protein product                          80.5    1e-15   Chondrus crispus [carageen]
ref|XP_007380682.1|  hypothetical protein PUNSTDRAFT_50252            78.6    2e-15   Punctularia strigosozonata HHB-11173 SS5
gb|KDO26616.1|  hypothetical protein SPRG_08020                       77.0    6e-15   Saprolegnia parasitica CBS 223.65
ref|XP_008613602.1|  hypothetical protein SDRG_09447                  76.6    9e-15   Saprolegnia diclina VS20
ref|XP_007578289.1|  PREDICTED: costars family protein ABRACL         75.5    2e-14   Poecilia formosa
ref|XP_005647616.1|  hypothetical protein COCSUDRAFT_15911            73.9    8e-14   Coccomyxa subellipsoidea C-169
emb|CEF99870.1|  Costars domain                                       73.6    1e-13   Ostreococcus tauri
ref|XP_004992837.1|  hypothetical protein PTSG_05945                  73.9    2e-13   Salpingoeca rosetta
ref|XP_003082307.1|  : chromosome 6 open reading frame 115 (ISS)      73.6    2e-13   
emb|CCO29730.1|  Costars family protein C6orf115 homolog              72.8    3e-13   Rhizoctonia solani AG-1 IB
ref|XP_004037464.1|  hypothetical protein IMG5_051560                 72.4    3e-13   Ichthyophthirius multifiliis
gb|KIJ35689.1|  hypothetical protein M422DRAFT_34493                  72.4    3e-13   Sphaerobolus stellatus SS14
gb|KIJ27841.1|  hypothetical protein M422DRAFT_37582                  72.0    4e-13   Sphaerobolus stellatus SS14
ref|XP_007512035.1|  predicted protein                                71.6    5e-13   Bathycoccus prasinos
ref|XP_004335921.1|  hypothetical protein ACA1_364340                 72.0    7e-13   Acanthamoeba castellanii str. Neff
ref|XP_001742113.1|  hypothetical protein                             69.3    4e-12   Monosiga brevicollis MX1
gb|KJB79573.1|  hypothetical protein B456_013G055100                  68.6    1e-11   Gossypium raimondii
ref|XP_008050924.1|  PREDICTED: LOW QUALITY PROTEIN: costars fami...  66.2    4e-11   Carlito syrichta
ref|XP_002179660.1|  predicted protein                                65.9    9e-11   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_004992723.1|  hypothetical protein PTSG_05830                  69.3    3e-10   Salpingoeca rosetta
ref|XP_005835879.1|  hypothetical protein GUITHDRAFT_105523           63.5    5e-10   Guillardia theta CCMP2712
ref|XP_001749846.1|  hypothetical protein                             68.2    6e-10   Monosiga brevicollis MX1
ref|XP_001420796.1|  predicted protein                                61.6    2e-09   Ostreococcus lucimarinus CCE9901
ref|XP_005756890.1|  hypothetical protein EMIHUDRAFT_446656           63.9    4e-09   
ref|XP_007851551.1|  costars family protein-like protein              60.5    9e-09   
ref|XP_001454917.1|  hypothetical protein                             60.1    9e-09   
gb|KIJ96469.1|  hypothetical protein K443DRAFT_682322                 59.7    1e-08   
gb|KIK66364.1|  hypothetical protein GYMLUDRAFT_38174                 57.8    5e-08   
gb|ELU37620.1|  hypothetical protein AG1IA_08349                      60.5    8e-08   
ref|XP_004999053.1|  hypothetical protein PTSG_00510                  61.2    1e-07   
gb|KDR71025.1|  hypothetical protein GALMADRAFT_254174                56.6    1e-07   
gb|KIM42687.1|  hypothetical protein M413DRAFT_444360                 54.7    6e-07   
ref|XP_004353765.1|  SAM domain (Sterile alpha motif) domain cont...  58.2    9e-07   
ref|XP_003026251.1|  hypothetical protein SCHCODRAFT_114702           53.5    2e-06   
gb|ACO12078.1|  C6orf115                                              52.8    4e-06   
ref|XP_009047040.1|  hypothetical protein LOTGIDRAFT_138665           53.1    5e-06   
gb|EMC81732.1|  Actin-binding Rho-activating protein                  52.0    1e-05   
ref|XP_005042451.1|  PREDICTED: actin-binding Rho-activating prot...  54.3    1e-05   
ref|XP_005042450.1|  PREDICTED: actin-binding Rho-activating prot...  54.3    1e-05   
gb|KJA16100.1|  hypothetical protein HYPSUDRAFT_148201                50.8    2e-05   
ref|XP_005510609.1|  PREDICTED: actin-binding Rho-activating prot...  52.4    2e-05   
ref|XP_001346146.2|  PREDICTED: actin-binding Rho-activating prot...  51.6    3e-05   
gb|KFP70294.1|  Actin-binding Rho-activating protein                  50.8    3e-05   
ref|XP_009813616.1|  PREDICTED: actin-binding Rho-activating protein  53.1    3e-05   
gb|KFV44215.1|  Actin-binding Rho-activating protein                  53.1    3e-05   
gb|KFQ34311.1|  Actin-binding Rho-activating protein                  50.4    4e-05   
ref|XP_009072536.1|  PREDICTED: actin-binding Rho-activating prot...  51.2    4e-05   
gb|KGL98679.1|  Actin-binding Rho-activating protein                  52.8    4e-05   
ref|XP_002199130.2|  PREDICTED: actin-binding Rho-activating protein  52.8    4e-05   
ref|XP_009890103.1|  PREDICTED: actin-binding Rho-activating protein  52.8    4e-05   
ref|XP_009085781.1|  PREDICTED: actin-binding Rho-activating prot...  52.8    5e-05   
ref|XP_009085790.1|  PREDICTED: actin-binding Rho-activating prot...  52.4    5e-05   
ref|XP_005517022.1|  PREDICTED: actin-binding Rho-activating protein  52.8    5e-05   
ref|XP_005423534.1|  PREDICTED: actin-binding Rho-activating protein  52.8    5e-05   
ref|XP_005479486.1|  PREDICTED: actin-binding Rho-activating protein  52.8    5e-05   
gb|KFV96821.1|  Actin-binding Rho-activating protein                  50.1    6e-05   
ref|XP_011452627.1|  PREDICTED: actin-binding Rho-activating prot...  50.4    6e-05   
ref|XP_011452630.1|  PREDICTED: actin-binding Rho-activating prot...  50.4    6e-05   
ref|XP_009047039.1|  hypothetical protein LOTGIDRAFT_172211           50.8    6e-05   
pdb|2KRH|A  Chain A, Structure Of The C-Terminal Actin Binding Do...  49.3    6e-05   
gb|EGT37963.1|  hypothetical protein CAEBREN_00688                    50.1    7e-05   
ref|XP_007432788.1|  PREDICTED: actin-binding Rho-activating prot...  50.4    7e-05   
ref|XP_010181360.1|  PREDICTED: actin-binding Rho-activating prot...  50.8    8e-05   
emb|CAP31404.2|  Protein CBG12421                                     50.1    8e-05   
ref|XP_007432787.1|  PREDICTED: actin-binding Rho-activating prot...  50.4    8e-05   
ref|XP_002639700.1|  Hypothetical protein CBG12421                    49.7    1e-04   
ref|XP_003205273.2|  PREDICTED: actin-binding Rho-activating protein  51.6    1e-04   
ref|XP_010158358.1|  PREDICTED: actin-binding Rho-activating prot...  50.1    1e-04   
emb|CAG11090.1|  unnamed protein product                              51.2    1e-04   
ref|XP_008630504.1|  PREDICTED: actin-binding Rho-activating prot...  51.2    1e-04   
ref|XP_005150976.1|  PREDICTED: actin-binding Rho-activating protein  51.2    1e-04   
gb|EOB08643.1|  Actin-binding Rho-activating protein                  48.5    1e-04   
gb|KFO53042.1|  Actin-binding Rho-activating protein                  51.2    1e-04   
ref|XP_008630497.1|  PREDICTED: actin-binding Rho-activating prot...  51.2    1e-04   
ref|XP_003256148.1|  PREDICTED: actin-binding Rho-activating protein  51.2    1e-04   
ref|XP_009272593.1|  PREDICTED: actin-binding Rho-activating protein  51.2    1e-04   
ref|XP_005367574.1|  PREDICTED: actin-binding Rho-activating protein  51.2    1e-04   
ref|XP_003215605.1|  PREDICTED: actin-binding Rho-activating prot...  49.3    1e-04   
ref|XP_009500662.1|  PREDICTED: actin-binding Rho-activating protein  51.2    1e-04   
ref|XP_007488281.1|  PREDICTED: actin-binding Rho-activating protein  51.2    1e-04   
gb|KFM04195.1|  Actin-binding Rho-activating protein                  51.2    1e-04   
ref|XP_004073983.2|  PREDICTED: actin-binding Rho-activating protein  51.2    1e-04   
gb|KFW89775.1|  Actin-binding Rho-activating protein                  51.2    1e-04   
ref|XP_005431869.1|  PREDICTED: actin-binding Rho-activating protein  51.2    1e-04   
ref|XP_005231026.1|  PREDICTED: actin-binding Rho-activating protein  51.2    2e-04   
gb|KFW66454.1|  Actin-binding Rho-activating protein                  51.2    2e-04   
ref|XP_009321378.1|  PREDICTED: actin-binding Rho-activating protein  51.2    2e-04   
gb|KFQ83813.1|  Actin-binding Rho-activating protein                  51.2    2e-04   
gb|KFQ13779.1|  Actin-binding Rho-activating protein                  51.2    2e-04   
gb|KFO85281.1|  Actin-binding Rho-activating protein                  51.2    2e-04   
ref|XP_009967488.1|  PREDICTED: actin-binding Rho-activating protein  51.2    2e-04   
ref|XP_010142747.1|  PREDICTED: actin-binding Rho-activating prot...  51.2    2e-04   
ref|XP_010142746.1|  PREDICTED: actin-binding Rho-activating prot...  51.2    2e-04   
gb|KFV54362.1|  Actin-binding Rho-activating protein                  51.2    2e-04   
ref|XP_010575304.1|  PREDICTED: actin-binding Rho-activating protein  51.2    2e-04   
gb|KFP58635.1|  Actin-binding Rho-activating protein                  51.2    2e-04   
ref|XP_009467625.1|  PREDICTED: actin-binding Rho-activating protein  51.2    2e-04   
gb|KFQ33218.1|  Actin-binding Rho-activating protein                  48.5    2e-04   
ref|XP_010310598.1|  PREDICTED: actin-binding Rho-activating protein  51.2    2e-04   
ref|XP_009953127.1|  PREDICTED: actin-binding Rho-activating protein  51.2    2e-04   
gb|KFR13087.1|  Actin-binding Rho-activating protein                  51.2    2e-04   
ref|XP_009935826.1|  PREDICTED: actin-binding Rho-activating protein  51.2    2e-04   
ref|XP_009702220.1|  PREDICTED: actin-binding Rho-activating protein  50.8    2e-04   
gb|KFP66894.1|  Actin-binding Rho-activating protein                  50.8    2e-04   
gb|KFO72725.1|  Actin-binding Rho-activating protein                  50.8    2e-04   
gb|KFQ04336.1|  Actin-binding Rho-activating protein                  50.8    2e-04   
gb|KFO07771.1|  Actin-binding Rho-activating protein                  50.8    2e-04   
ref|XP_010292172.1|  PREDICTED: actin-binding Rho-activating protein  50.8    2e-04   
ref|XP_009917644.1|  PREDICTED: actin-binding Rho-activating protein  50.8    2e-04   
ref|XP_009554553.1|  PREDICTED: actin-binding Rho-activating protein  50.8    2e-04   
gb|KFR01764.1|  Actin-binding Rho-activating protein                  50.8    2e-04   
gb|KFP15585.1|  Actin-binding Rho-activating protein                  50.8    2e-04   
ref|XP_010165430.1|  PREDICTED: actin-binding Rho-activating protein  50.8    2e-04   
ref|XP_008940256.1|  PREDICTED: actin-binding Rho-activating protein  50.8    2e-04   
gb|KFZ57406.1|  Actin-binding Rho-activating protein                  50.8    2e-04   
gb|KFQ81656.1|  Actin-binding Rho-activating protein                  50.8    2e-04   
ref|XP_009636685.1|  PREDICTED: actin-binding Rho-activating protein  50.8    2e-04   
ref|XP_009988652.1|  PREDICTED: actin-binding Rho-activating protein  50.8    2e-04   
ref|XP_008254048.1|  PREDICTED: actin-binding Rho-activating protein  49.3    2e-04   
gb|KFV20348.1|  Actin-binding Rho-activating protein                  50.8    2e-04   
ref|XP_010018447.1|  PREDICTED: actin-binding Rho-activating protein  50.8    2e-04   
gb|KFQ43375.1|  Actin-binding Rho-activating protein                  50.8    2e-04   
ref|XP_010113543.1|  PREDICTED: actin-binding Rho-activating protein  50.8    2e-04   
ref|XP_007188832.1|  PREDICTED: actin-binding Rho-activating protein  50.8    2e-04   
ref|XP_010004773.1|  PREDICTED: actin-binding Rho-activating protein  50.8    2e-04   
gb|KFU96296.1|  Actin-binding Rho-activating protein                  50.8    2e-04   
ref|XP_006818368.1|  PREDICTED: actin-binding Rho-activating prot...  48.9    2e-04   
gb|KFO62369.1|  Actin-binding Rho-activating protein                  48.1    2e-04   
ref|XP_004642300.1|  PREDICTED: actin-binding Rho-activating protein  50.4    2e-04   
ref|XP_428503.3|  PREDICTED: actin-binding Rho-activating protein     50.4    3e-04   
ref|XP_005025940.1|  PREDICTED: actin-binding Rho-activating protein  50.4    3e-04   
gb|KFV77218.1|  Actin-binding Rho-activating protein                  48.1    3e-04   
ref|XP_007446599.1|  PREDICTED: actin-binding Rho-activating protein  50.4    3e-04   
gb|EOA96796.1|  Actin-binding Rho-activating protein                  50.4    3e-04   
emb|CAG11089.1|  unnamed protein product                              50.4    3e-04   
ref|XP_009869076.1|  PREDICTED: actin-binding Rho-activating protein  50.4    3e-04   
ref|XP_009483239.1|  PREDICTED: actin-binding Rho-activating protein  50.1    3e-04   
gb|KFP89610.1|  Actin-binding Rho-activating protein                  50.1    3e-04   
gb|KFQ62269.1|  Actin-binding Rho-activating protein                  50.1    3e-04   
ref|XP_004174266.1|  PREDICTED: actin-binding Rho-activating prot...  48.5    3e-04   
gb|ERE52450.1|  actin-binding Rho-activating protein                  50.1    4e-04   
ref|XP_001632640.1|  predicted protein                                47.4    4e-04   
ref|XP_005316309.1|  PREDICTED: actin-binding Rho-activating protein  49.7    4e-04   
gb|KFP34253.1|  Actin-binding Rho-activating protein                  50.1    4e-04   
ref|XP_008922255.1|  PREDICTED: actin-binding Rho-activating protein  49.7    4e-04   
ref|XP_003502478.1|  PREDICTED: actin-binding Rho-activating protein  49.7    4e-04   
ref|XP_001506562.1|  PREDICTED: actin-binding Rho-activating protein  49.7    4e-04   
ref|XP_010206402.1|  PREDICTED: actin-binding Rho-activating protein  49.7    4e-04   
gb|KFW81048.1|  Actin-binding Rho-activating protein                  49.7    4e-04   
dbj|BAE23828.1|  unnamed protein product                              49.7    4e-04   
gb|ELT99495.1|  hypothetical protein CAPTEDRAFT_172541                48.5    4e-04   
ref|XP_007608478.1|  PREDICTED: actin-binding Rho-activating protein  49.7    4e-04   
ref|XP_005072681.1|  PREDICTED: actin-binding Rho-activating protein  49.7    4e-04   
sp|Q8K4K7.2|ABRA_RAT  RecName: Full=Actin-binding Rho-activating ...  49.7    4e-04   
ref|NP_787038.1|  actin-binding Rho-activating protein                49.7    4e-04   
ref|XP_006978776.1|  PREDICTED: actin-binding Rho-activating protein  49.7    5e-04   
gb|ETE65966.1|  Actin-binding Rho-activating protein                  48.9    5e-04   
gb|KFP98297.1|  Actin-binding Rho-activating protein                  47.4    5e-04   
gb|EMS19864.1|  hypothetical protein RHTO_03907                       47.0    5e-04   
dbj|BAC32252.1|  unnamed protein product                              49.7    5e-04   
gb|AAM28877.1|AF504061_1  striated muscle activator of Rho-depend...  49.7    5e-04   
gb|EDL08763.1|  actin-binding Rho activating protein                  49.7    5e-04   
ref|NP_780665.1|  actin-binding Rho-activating protein                49.7    5e-04   
ref|XP_001619805.1|  hypothetical protein NEMVEDRAFT_v1g150245        47.4    5e-04   
ref|XP_008849733.1|  PREDICTED: actin-binding Rho-activating protein  49.7    5e-04   
ref|XP_004672778.1|  PREDICTED: actin-binding Rho-activating protein  49.7    5e-04   
gb|KGL80469.1|  Actin-binding Rho-activating protein                  49.7    6e-04   
ref|NP_001003986.1|  actin-binding Rho-activating protein             49.3    6e-04   
ref|XP_010217551.1|  PREDICTED: actin-binding Rho-activating protein  49.3    6e-04   
ref|XP_008290603.1|  PREDICTED: actin-binding Rho-activating prot...  49.3    6e-04   
ref|XP_006639814.1|  PREDICTED: actin-binding Rho-activating prot...  49.3    6e-04   
ref|XP_004328503.1|  PREDICTED: LOW QUALITY PROTEIN: actin-bindin...  49.3    6e-04   
ref|XP_007124559.1|  PREDICTED: actin-binding Rho-activating protein  49.3    6e-04   
ref|XP_002710776.1|  PREDICTED: actin-binding Rho-activating protein  49.3    7e-04   
ref|XP_008420602.1|  PREDICTED: actin-binding Rho-activating protein  49.3    7e-04   
ref|XP_004580734.1|  PREDICTED: actin-binding Rho-activating protein  49.3    7e-04   
ref|XP_007578312.1|  PREDICTED: actin-binding Rho-activating protein  49.3    7e-04   
gb|KFZ66670.1|  Actin-binding Rho-activating protein                  49.3    7e-04   
gb|KFO77658.1|  Actin-binding Rho-activating protein                  47.0    8e-04   
ref|XP_003219495.1|  PREDICTED: actin-binding Rho-activating protein  48.9    8e-04   
gb|KFW02141.1|  Actin-binding Rho-activating protein                  48.9    8e-04   
ref|XP_009572968.1|  PREDICTED: actin-binding Rho-activating protein  48.9    8e-04   
ref|XP_005689222.1|  PREDICTED: LOW QUALITY PROTEIN: actin-bindin...  48.9    8e-04   
gb|KFP79413.1|  Actin-binding Rho-activating protein                  46.6    8e-04   
ref|XP_003760364.1|  PREDICTED: actin-binding Rho-activating protein  48.9    9e-04   
ref|XP_004607732.1|  PREDICTED: actin-binding Rho-activating protein  48.9    9e-04   
ref|XP_001088098.1|  PREDICTED: actin-binding Rho-activating protein  48.9    9e-04   
gb|EHH28705.1|  Striated muscle activator of Rho-dependent signaling  48.9    9e-04   
ref|XP_528210.1|  PREDICTED: actin-binding Rho-activating protein     48.9    9e-04   
ref|XP_005563978.1|  PREDICTED: actin-binding Rho-activating protein  48.9    9e-04   
ref|XP_005894685.1|  PREDICTED: actin-binding Rho-activating protein  48.9    9e-04   
ref|XP_003821796.1|  PREDICTED: actin-binding Rho-activating protein  48.9    0.001   
ref|XP_010369120.1|  PREDICTED: actin-binding Rho-activating protein  48.9    0.001   
ref|XP_004047475.1|  PREDICTED: actin-binding Rho-activating protein  48.9    0.001   
ref|XP_004012042.1|  PREDICTED: actin-binding Rho-activating protein  48.9    0.001   
ref|XP_006076870.1|  PREDICTED: actin-binding Rho-activating prot...  48.1    0.001   
ref|XP_008146680.1|  PREDICTED: actin-binding Rho-activating protein  48.9    0.001   
ref|XP_003903113.1|  PREDICTED: actin-binding Rho-activating protein  48.9    0.001   
ref|XP_005963092.1|  PREDICTED: actin-binding Rho-activating protein  48.9    0.001   
ref|XP_006731782.1|  PREDICTED: actin-binding Rho-activating protein  48.9    0.001   
gb|KFU90730.1|  Actin-binding Rho-activating protein                  46.6    0.001   
ref|XP_004283005.1|  PREDICTED: actin-binding Rho-activating protein  48.9    0.001   
ref|XP_005382011.1|  PREDICTED: actin-binding Rho-activating protein  48.9    0.001   
ref|XP_007999537.1|  PREDICTED: actin-binding Rho-activating protein  48.9    0.001   
ref|XP_010861767.1|  PREDICTED: actin-binding Rho-activating protein  48.9    0.001   
ref|XP_006167980.1|  PREDICTED: actin-binding Rho-activating protein  48.9    0.001   
ref|NP_001179163.1|  actin-binding Rho-activating protein             48.9    0.001   
gb|EPY77909.1|  actin-binding Rho-activating protein                  48.9    0.001   
ref|XP_006189137.1|  PREDICTED: actin-binding Rho-activating protein  48.9    0.001   
ref|XP_006830699.1|  PREDICTED: actin-binding Rho-activating protein  48.5    0.001   



>emb|CDO97380.1| unnamed protein product [Coffea canephora]
Length=93

 Score =   137 bits (346),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 79/90 (88%), Positives = 83/90 (92%), Gaps = 0/90 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVEEEVERL+EEIKRLGK QDDGSYKVTFGVLFNDD+CANIFEALVGTLRAAKKRKV+ 
Sbjct  1    MNVEEEVERLKEEIKRLGKPQDDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKKRKVLT  60

Query  236  YDGELLLQGVHDNVEITLKPTPAA*SC*AM  325
            YDGELLLQGVHDNVEI LKPTP A S  A+
Sbjct  61   YDGELLLQGVHDNVEILLKPTPTATSAEAV  90



>gb|ABD28547.2| Protein C6orf115, putative [Medicago truncatula]
Length=158

 Score =   137 bits (346),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +2

Query  29   VRNRHQTGTMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLR  208
            V +R ++ +MNVEEEV RL+EEIKRLGK Q DGSYKVTFG LF+DDQCANIFEALVGTLR
Sbjct  62   VGSRSRSRSMNVEEEVGRLKEEIKRLGKLQSDGSYKVTFGTLFHDDQCANIFEALVGTLR  121

Query  209  AAKKRKVVAYDGELLLQGVHDNVEITLKPTPAA  307
            AAKKRKV+ Y+GELLLQGVHDNVEITL PTPAA
Sbjct  122  AAKKRKVLTYEGELLLQGVHDNVEITLNPTPAA  154



>ref|XP_003593273.1| hypothetical protein MTR_2g009660 [Medicago truncatula]
 gb|AES63524.1| costars family protein abracl protein [Medicago truncatula]
Length=150

 Score =   137 bits (345),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +2

Query  29   VRNRHQTGTMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLR  208
            V +R ++ +MNVEEEV RL+EEIKRLGK Q DGSYKVTFG LF+DDQCANIFEALVGTLR
Sbjct  54   VGSRSRSRSMNVEEEVGRLKEEIKRLGKLQSDGSYKVTFGTLFHDDQCANIFEALVGTLR  113

Query  209  AAKKRKVVAYDGELLLQGVHDNVEITLKPTPAA  307
            AAKKRKV+ Y+GELLLQGVHDNVEITL PTPAA
Sbjct  114  AAKKRKVLTYEGELLLQGVHDNVEITLNPTPAA  146



>gb|AFK48356.1| unknown [Medicago truncatula]
Length=88

 Score =   133 bits (334),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/84 (88%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVEEEV RL+EEIKRLGK Q DGSYKVTFG LF+DDQCANIFEALVGTLRAAKKRKV+ 
Sbjct  1    MNVEEEVGRLKEEIKRLGKLQSDGSYKVTFGTLFHDDQCANIFEALVGTLRAAKKRKVLT  60

Query  236  YDGELLLQGVHDNVEITLKPTPAA  307
            Y+GELLLQGVHDNVEITL PTPAA
Sbjct  61   YEGELLLQGVHDNVEITLNPTPAA  84



>ref|XP_011087958.1| PREDICTED: costars family protein [Sesamum indicum]
Length=91

 Score =   133 bits (334),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/84 (88%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV EEVERL+EEIKRLG+ QDDGSYKVTFGVLFNDD+CANIFEALVGTLRAAKKRK+V 
Sbjct  1    MNVGEEVERLKEEIKRLGQPQDDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKKRKIVT  60

Query  236  YDGELLLQGVHDNVEITLKPTPAA  307
            YDGELLLQGVHDNVEITLKP   A
Sbjct  61   YDGELLLQGVHDNVEITLKPEATA  84



>ref|XP_010030000.1| PREDICTED: costars family protein [Eucalyptus grandis]
 gb|KCW56938.1| hypothetical protein EUGRSUZ_I02615 [Eucalyptus grandis]
Length=90

 Score =   133 bits (334),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVEEEVERL+EEIKRLGK Q DGSYKVTFGVLF+DD+CANIFEALVGTLRAAKKRKV+ 
Sbjct  1    MNVEEEVERLKEEIKRLGKIQADGSYKVTFGVLFHDDKCANIFEALVGTLRAAKKRKVLT  60

Query  236  YDGELLLQGVHDNVEITLKPTPAA  307
            YDGELLLQGVHDNVEITLKP PAA
Sbjct  61   YDGELLLQGVHDNVEITLKPPPAA  84



>emb|CBI38229.3| unnamed protein product [Vitis vinifera]
Length=86

 Score =   131 bits (329),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/84 (88%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVEEEV RL+EEI RLGK QDDGSYKVTFGVLF+DD+CANIFEALVGTLRAAKKRKVVA
Sbjct  1    MNVEEEVGRLKEEITRLGKIQDDGSYKVTFGVLFHDDRCANIFEALVGTLRAAKKRKVVA  60

Query  236  YDGELLLQGVHDNVEITLKPTPAA  307
            Y+GELLLQGVHDNVEI LKPTP  
Sbjct  61   YEGELLLQGVHDNVEIVLKPTPTT  84



>ref|XP_004290405.1| PREDICTED: costars family protein [Fragaria vesca subsp. vesca]
Length=95

 Score =   129 bits (325),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVEEEVERL+EEIKRLGK Q DGSYKVTFGVLFNDD+CANIFEALVGTLRAAK+RK++ 
Sbjct  1    MNVEEEVERLKEEIKRLGKVQADGSYKVTFGVLFNDDRCANIFEALVGTLRAAKRRKLLT  60

Query  236  YDGELLLQGVHDNVEITLKPTPAA  307
            Y+GELLLQGVHDNVEI LKPTP A
Sbjct  61   YEGELLLQGVHDNVEIILKPTPTA  84



>gb|KDP29995.1| hypothetical protein JCGZ_18762 [Jatropha curcas]
Length=96

 Score =   129 bits (325),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +2

Query  95   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVAYDGELLLQGVHDN  274
            I+RLGK Q DGSYKVTFGVLFNDD+CANIFEALVGTLRAAKKRK+V YDGELLLQGVHDN
Sbjct  14   IERLGKIQPDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKKRKIVTYDGELLLQGVHDN  73

Query  275  VEITLKPT  298
            VEITLKPT
Sbjct  74   VEITLKPT  81



>ref|XP_008454461.1| PREDICTED: costars family protein [Cucumis melo]
Length=95

 Score =   128 bits (322),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/82 (88%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVEEEV+RL+EEIKRLGK QDDGSYKVTFGVLFNDD+CANIFEALVGTLRAAKKRK+V 
Sbjct  1    MNVEEEVDRLKEEIKRLGKLQDDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKKRKIVT  60

Query  236  YDGELLLQGVHDNVEITLKPTP  301
            YDGELLLQGVHD VEI LK  P
Sbjct  61   YDGELLLQGVHDKVEIILKAIP  82



>ref|XP_010691385.1| PREDICTED: costars family protein [Beta vulgaris subsp. vulgaris]
Length=93

 Score =   128 bits (322),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVEEEV +L+EEIKRLG+ Q+DGSYKVTFGVLFNDD+CANIFEALVGTLRAAKKRK++ 
Sbjct  1    MNVEEEVGKLQEEIKRLGQIQEDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKKRKILT  60

Query  236  YDGELLLQGVHDNVEITLKPTPAA*SC*AME  328
            YDGELLLQGVHDN  IT+KP+  A S  A E
Sbjct  61   YDGELLLQGVHDNTVITMKPSATASSTDATE  91



>ref|XP_010254575.1| PREDICTED: costars family protein-like [Nelumbo nucifera]
Length=91

 Score =   128 bits (321),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/81 (89%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVEEE+ERL+EEIKRLG+ Q DGSYKVTFGVLFNDD+CANIFEALVGTLRAAKKRK+VA
Sbjct  1    MNVEEEIERLKEEIKRLGQLQSDGSYKVTFGVLFNDDKCANIFEALVGTLRAAKKRKIVA  60

Query  236  YDGELLLQGVHDNVEITLKPT  298
            YDGELLLQGVHDNVEITLK +
Sbjct  61   YDGELLLQGVHDNVEITLKSS  81



>ref|XP_002466642.1| hypothetical protein SORBIDRAFT_01g011530 [Sorghum bicolor]
 gb|EER93640.1| hypothetical protein SORBIDRAFT_01g011530 [Sorghum bicolor]
Length=87

 Score =   127 bits (320),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVEEEV +L+EEI+RLG++Q DGSYKV FGVLFNDD+CANIFEALVGTLRAAKKRKV+ 
Sbjct  1    MNVEEEVGKLKEEIQRLGQQQPDGSYKVKFGVLFNDDRCANIFEALVGTLRAAKKRKVLT  60

Query  236  YDGELLLQGVHDNVEITLKPTPA  304
            YDGELLLQGVHDNVEITL P PA
Sbjct  61   YDGELLLQGVHDNVEITLLPPPA  83



>ref|XP_004485613.1| PREDICTED: costars family protein-like [Cicer arietinum]
Length=87

 Score =   127 bits (319),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 74/85 (87%), Positives = 77/85 (91%), Gaps = 1/85 (1%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVEEEV RL+EEIKRLGK Q DGSYKVTFG LFNDDQCANIFEALVGTLRAAKKRKV+ 
Sbjct  1    MNVEEEVGRLKEEIKRLGKLQSDGSYKVTFGTLFNDDQCANIFEALVGTLRAAKKRKVLT  60

Query  236  YDGELLLQGVHDNVEITLKP-TPAA  307
            Y+GELLLQGVHDNVEITL P TP A
Sbjct  61   YEGELLLQGVHDNVEITLNPLTPDA  85



>ref|XP_007159157.1| hypothetical protein PHAVU_002G213700g [Phaseolus vulgaris]
 gb|ESW31151.1| hypothetical protein PHAVU_002G213700g [Phaseolus vulgaris]
Length=87

 Score =   127 bits (319),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVEEEV+RL++EIKRLG+ Q+DGSYKVTFG LFNDD+CANIFEALVGTLRAAKKRKV+ 
Sbjct  1    MNVEEEVQRLKQEIKRLGEVQEDGSYKVTFGTLFNDDECANIFEALVGTLRAAKKRKVLT  60

Query  236  YDGELLLQGVHDNVEITLKPTPAA  307
            Y+GELLLQGVHDNVEI L P  AA
Sbjct  61   YEGELLLQGVHDNVEIILSPASAA  84



>ref|NP_001050950.1| Os03g0690000 [Oryza sativa Japonica Group]
 sp|Q6AVK1.1|COSA_ORYSJ RecName: Full=Costars family protein [Oryza sativa Japonica Group]
 sp|A2XKU9.1|COSA_ORYSI RecName: Full=Costars family protein [Oryza sativa Indica Group]
 gb|AAT81723.1| striated muscle activator-like protein [Oryza sativa Japonica 
Group]
 gb|ABF98283.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF12864.1| Os03g0690000 [Oryza sativa Japonica Group]
 gb|EAY91459.1| hypothetical protein OsI_13088 [Oryza sativa Indica Group]
 gb|EAZ28197.1| hypothetical protein OsJ_12170 [Oryza sativa Japonica Group]
 dbj|BAG88433.1| unnamed protein product [Oryza sativa Japonica Group]
Length=87

 Score =   127 bits (319),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVEEEV +L+EEI+RLG++Q DGSYKVTFGV+FNDD+CANIFEALVGTLRAAKKRK+V 
Sbjct  1    MNVEEEVGKLKEEIQRLGQKQPDGSYKVTFGVIFNDDRCANIFEALVGTLRAAKKRKIVK  60

Query  236  YDGELLLQGVHDNVEITLKPTPA  304
            YDGELLLQG HDNVEITL P PA
Sbjct  61   YDGELLLQGAHDNVEITLLPPPA  83



>ref|XP_004982127.1| PREDICTED: costars family protein-like [Setaria italica]
Length=87

 Score =   127 bits (318),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVEEEV +L+EEI+RLG++Q DGSYKV FGVLFNDD+CANIFEALVGTLRAAKKRK++ 
Sbjct  1    MNVEEEVGKLKEEIQRLGQQQPDGSYKVKFGVLFNDDRCANIFEALVGTLRAAKKRKILT  60

Query  236  YDGELLLQGVHDNVEITLKPTPA  304
            YDGELLLQGVHDNVEITL P PA
Sbjct  61   YDGELLLQGVHDNVEITLLPPPA  83



>ref|XP_004504856.1| PREDICTED: costars family protein-like [Cicer arietinum]
Length=87

 Score =   127 bits (318),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +2

Query  95   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVAYDGELLLQGVHDN  274
            I RLGK Q DGSYKVTFG LF+DD+CANIFEALVGTLRAAKKRKVVAYDGELLLQGVHDN
Sbjct  15   ITRLGKVQTDGSYKVTFGTLFHDDRCANIFEALVGTLRAAKKRKVVAYDGELLLQGVHDN  74

Query  275  VEITLKPTPAA  307
            VEITL   PAA
Sbjct  75   VEITLNHVPAA  85



>ref|XP_010098215.1| hypothetical protein L484_001044 [Morus notabilis]
 gb|EXC43846.1| hypothetical protein L484_001044 [Morus notabilis]
Length=250

 Score =   131 bits (330),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 74/82 (90%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVEEEVERL+EEIKRLGK Q DGSYKVTFGVLF+DD+CANIFEALVGTLRAAKKRK VA
Sbjct  1    MNVEEEVERLKEEIKRLGKIQADGSYKVTFGVLFHDDKCANIFEALVGTLRAAKKRKFVA  60

Query  236  YDGELLLQGVHDNVEITLKPTP  301
            YDGELLLQGVHDNVEI LKP+P
Sbjct  61   YDGELLLQGVHDNVEIMLKPSP  82



>ref|XP_009343817.1| PREDICTED: costars family protein-like [Pyrus x bretschneideri]
Length=95

 Score =   127 bits (318),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +2

Query  95   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVAYDGELLLQGVHDN  274
            I+RLGK QDDGSYKVTFGVLFNDD+CANIFEALVGTLRAAK+RK + YDGELLLQGVHDN
Sbjct  14   IQRLGKLQDDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKRRKFLTYDGELLLQGVHDN  73

Query  275  VEITLKPTP  301
            VEI LKP P
Sbjct  74   VEIVLKPKP  82



>ref|XP_008796657.1| PREDICTED: costars family protein [Phoenix dactylifera]
Length=86

 Score =   126 bits (317),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVEEEV+RL+EEIKRLG+ Q DGSYKV FGVLFNDD+CANIFEALVGTLRAAKKR+VV 
Sbjct  1    MNVEEEVDRLKEEIKRLGQHQQDGSYKVKFGVLFNDDRCANIFEALVGTLRAAKKRRVVT  60

Query  236  YDGELLLQGVHDNVEITLKPTPAA  307
            YDGELLLQGVHDNVEITL P+  A
Sbjct  61   YDGELLLQGVHDNVEITLLPSAVA  84



>ref|XP_007201455.1| hypothetical protein PRUPE_ppa013924mg [Prunus persica]
 gb|EMJ02654.1| hypothetical protein PRUPE_ppa013924mg [Prunus persica]
Length=96

 Score =   127 bits (318),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 73/83 (88%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVEEEVERL+EEI+RLGK QDDGSYKVTFGVLFNDD+CANIFEALVGTLRAAKKRK + 
Sbjct  1    MNVEEEVERLKEEIQRLGKVQDDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKKRKFLT  60

Query  236  YDGELLLQGVHDNVEITLKPTPA  304
            Y+GELLLQGVHDNVEI LKPT A
Sbjct  61   YEGELLLQGVHDNVEIILKPTLA  83



>ref|XP_009368310.1| PREDICTED: costars family protein [Pyrus x bretschneideri]
Length=97

 Score =   126 bits (317),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/82 (89%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVEEEVERLREEI+RLGK QDDGSYKVTFGVLFNDD+CANIFEALVGTLRAAK+RK + 
Sbjct  1    MNVEEEVERLREEIQRLGKLQDDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKRRKFLT  60

Query  236  YDGELLLQGVHDNVEITLKPTP  301
            YDGELLLQGVHDNVEI LKP P
Sbjct  61   YDGELLLQGVHDNVEIILKPKP  82



>ref|XP_006423704.1| hypothetical protein CICLE_v10029672mg [Citrus clementina]
 ref|XP_006487464.1| PREDICTED: costars family protein ST45-2-like [Citrus sinensis]
 gb|ESR36944.1| hypothetical protein CICLE_v10029672mg [Citrus clementina]
 gb|KDO53981.1| hypothetical protein CISIN_1g034452mg [Citrus sinensis]
Length=94

 Score =   126 bits (317),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/82 (88%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVEEEVERL+EEI+RLGK Q DGSYKVTFGVLF+DD+CANIFEALVGTLRAAKKRK + 
Sbjct  1    MNVEEEVERLKEEIQRLGKIQPDGSYKVTFGVLFHDDRCANIFEALVGTLRAAKKRKFLT  60

Query  236  YDGELLLQGVHDNVEITLKPTP  301
            YDGELLLQGVHDNVEITLKP P
Sbjct  61   YDGELLLQGVHDNVEITLKPPP  82



>ref|XP_007042821.1| C6orf115, putative [Theobroma cacao]
 gb|EOX98652.1| C6orf115, putative [Theobroma cacao]
Length=92

 Score =   126 bits (316),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 74/85 (87%), Positives = 77/85 (91%), Gaps = 2/85 (2%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVEEEV RL+EEI RLGK Q DGSYKVTFGVLFNDD+CANIFEALVGTLRAAKKRKV+ 
Sbjct  1    MNVEEEVGRLKEEITRLGKIQPDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKKRKVLT  60

Query  236  YDGELLLQGVHDNVEITLK--PTPA  304
            YDGELLLQGVHDNVEITLK  P PA
Sbjct  61   YDGELLLQGVHDNVEITLKAIPPPA  85



>ref|XP_006650425.1| PREDICTED: costars family protein-like [Oryza brachyantha]
Length=87

 Score =   126 bits (316),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/83 (86%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVEEEV +LREEI+RLG++Q DGS KVTFGVLFNDD+CANIFEALVGTLRAAKKRK+V 
Sbjct  1    MNVEEEVGKLREEIQRLGQKQPDGSCKVTFGVLFNDDRCANIFEALVGTLRAAKKRKIVT  60

Query  236  YDGELLLQGVHDNVEITLKPTPA  304
            YDGELLLQGVHDNVEITL P PA
Sbjct  61   YDGELLLQGVHDNVEITLLPPPA  83



>ref|XP_009366325.1| PREDICTED: costars family protein-like [Pyrus x bretschneideri]
Length=95

 Score =   125 bits (315),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +2

Query  95   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVAYDGELLLQGVHDN  274
            I+RLG+ QDDGSYKVTFGVLFNDD+CANIFEALVGTLRAAK+RK + YDGELLLQGVHDN
Sbjct  14   IQRLGQLQDDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKRRKFLTYDGELLLQGVHDN  73

Query  275  VEITLKPTP  301
            VEI LKP P
Sbjct  74   VEIVLKPKP  82



>ref|XP_002522688.1| Protein C6orf115, putative [Ricinus communis]
 gb|EEF39775.1| Protein C6orf115, putative [Ricinus communis]
Length=96

 Score =   125 bits (315),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVEEEVERLREEI+R+GK Q DGSYKVTFGVLFNDD+CANIFEALVGTLRAAKKRK++ 
Sbjct  1    MNVEEEVERLREEIQRIGKIQPDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKKRKILT  60

Query  236  YDGELLLQGVHDNVEITLKPTPAA*SC*AMEGV  334
            YDGELLLQGVHDNVEI LK  P   S  A + V
Sbjct  61   YDGELLLQGVHDNVEIILKAAPEPASATAADSV  93



>ref|XP_008382197.1| PREDICTED: costars family protein [Malus domestica]
Length=145

 Score =   127 bits (318),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 73/90 (81%), Positives = 79/90 (88%), Gaps = 0/90 (0%)
 Frame = +2

Query  26   CVRNRHQTGTMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTL  205
            C     ++  MNVEEEVERLREEI+RLGK QDDGSYKVTFGVLFNDD+CANIFEALVGTL
Sbjct  39   CRSEAIKSSAMNVEEEVERLREEIQRLGKLQDDGSYKVTFGVLFNDDRCANIFEALVGTL  98

Query  206  RAAKKRKVVAYDGELLLQGVHDNVEITLKP  295
            RAAK+RK + YDGELLLQGVHDNVEI LKP
Sbjct  99   RAAKRRKFLTYDGELLLQGVHDNVEIILKP  128



>gb|ACG31036.1| hypothetical protein [Zea mays]
 gb|ACG33628.1| hypothetical protein [Zea mays]
 tpg|DAA50758.1| TPA: hypothetical protein ZEAMMB73_943086 [Zea mays]
Length=87

 Score =   124 bits (312),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVEEEV RL+EEI RLG++Q DGSYKV FGVLFNDD+CANIFEALVGTLRAAKKRK++ 
Sbjct  1    MNVEEEVGRLKEEIHRLGQQQPDGSYKVKFGVLFNDDRCANIFEALVGTLRAAKKRKILT  60

Query  236  YDGELLLQGVHDNVEITLKPTPA  304
            Y+GELLLQGVHDNVEITL P PA
Sbjct  61   YEGELLLQGVHDNVEITLLPPPA  83



>ref|XP_009792409.1| PREDICTED: costars family protein [Nicotiana sylvestris]
Length=93

 Score =   125 bits (313),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 70/80 (88%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVEEEVERL+EEIKRLG  QDDGSYK+TFGVLF+DD+CANIFEALVGTLRAAKKRK++ 
Sbjct  1    MNVEEEVERLKEEIKRLGIAQDDGSYKITFGVLFHDDRCANIFEALVGTLRAAKKRKILT  60

Query  236  YDGELLLQGVHDNVEITLKP  295
            YDGELLLQGVHDNVEI LKP
Sbjct  61   YDGELLLQGVHDNVEIILKP  80



>ref|XP_010923309.1| PREDICTED: costars family protein [Elaeis guineensis]
Length=86

 Score =   124 bits (312),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVEEEV RL+EEI+RLG++Q DGS KV FGVLFNDD+CANIFEALVGTLRAAKKRKVV 
Sbjct  1    MNVEEEVGRLKEEIRRLGQQQQDGSCKVKFGVLFNDDRCANIFEALVGTLRAAKKRKVVT  60

Query  236  YDGELLLQGVHDNVEITLKPTPAA  307
            YDGELLLQGVHDNVEITL P+ AA
Sbjct  61   YDGELLLQGVHDNVEITLLPSAAA  84



>ref|XP_006359368.1| PREDICTED: costars family protein-like [Solanum tuberosum]
 ref|XP_010313068.1| PREDICTED: costars family protein [Solanum lycopersicum]
Length=86

 Score =   124 bits (312),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 60/67 (90%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +2

Query  95   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVAYDGELLLQGVHDN  274
            IKRLG  QDDGSYKVTFGVLFNDD+CANIFEALVGTLRAAKKRK + YDGELLLQGVHDN
Sbjct  14   IKRLGIAQDDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKKRKFLTYDGELLLQGVHDN  73

Query  275  VEITLKP  295
            VEI LKP
Sbjct  74   VEIILKP  80



>gb|EMS63642.1| hypothetical protein TRIUR3_05750 [Triticum urartu]
 gb|EMT26083.1| hypothetical protein F775_28756 [Aegilops tauschii]
Length=90

 Score =   124 bits (311),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +2

Query  95   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVAYDGELLLQGVHDN  274
            I+RLG++Q DGSYKV FGV+FNDD+CANIFEALVGTLRAAKKRKVV YDGE+LLQGVHDN
Sbjct  17   IQRLGQQQPDGSYKVKFGVIFNDDRCANIFEALVGTLRAAKKRKVVTYDGEMLLQGVHDN  76

Query  275  VEITLKPTP  301
            VEITL P P
Sbjct  77   VEITLFPPP  85



>ref|XP_010277586.1| PREDICTED: costars family protein [Nelumbo nucifera]
Length=80

 Score =   124 bits (310),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 60/66 (91%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = +2

Query  95   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVAYDGELLLQGVHDN  274
            IKRLG+ Q DGSYKVTFGVLFNDD+CANIFEALVGTLRAAKKRKVV+Y+GELLLQGVHDN
Sbjct  14   IKRLGQLQPDGSYKVTFGVLFNDDKCANIFEALVGTLRAAKKRKVVSYNGELLLQGVHDN  73

Query  275  VEITLK  292
            VEITLK
Sbjct  74   VEITLK  79



>ref|XP_006284841.1| hypothetical protein CARUB_v10006123mg [Capsella rubella]
 gb|EOA17739.1| hypothetical protein CARUB_v10006123mg [Capsella rubella]
Length=94

 Score =   124 bits (311),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVEEE+++L EEI RLG  Q DGSYKVTFGVLFNDD+CANIFEALVGTLRAAKKRK+VA
Sbjct  1    MNVEEEIQKLEEEIHRLGSRQPDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKKRKIVA  60

Query  236  YDGELLLQGVHDNVEITLKPT  298
            +DGELLLQGVHD VEITL+PT
Sbjct  61   FDGELLLQGVHDKVEITLRPT  81



>ref|XP_009412481.1| PREDICTED: costars family protein [Musa acuminata subsp. malaccensis]
Length=87

 Score =   124 bits (310),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVEEEV RL+EE++RLG+ Q DGSYKV FGVLFNDD+CANIFEALVGTLRAAKKRKVV 
Sbjct  1    MNVEEEVGRLKEEMQRLGQLQPDGSYKVKFGVLFNDDRCANIFEALVGTLRAAKKRKVVK  60

Query  236  YDGELLLQGVHDNVEITLKPTPA  304
            Y+GELLLQGVHDNVEITL P PA
Sbjct  61   YEGELLLQGVHDNVEITLLPLPA  83



>emb|CDX68993.1| BnaC01g04600D [Brassica napus]
Length=95

 Score =   124 bits (311),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVEEE+++L EEI RLG  Q DGSYKVTFGVLFNDD+CANIFEALVGTLRAAKKRK+V+
Sbjct  1    MNVEEEIQKLEEEIHRLGSLQPDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKKRKIVS  60

Query  236  YDGELLLQGVHDNVEITLKPTP  301
            + GELLLQGVHD VEITL+P+P
Sbjct  61   FPGELLLQGVHDKVEITLRPSP  82



>ref|XP_008358397.1| PREDICTED: costars family protein-like [Malus domestica]
Length=97

 Score =   124 bits (311),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/67 (88%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +2

Query  95   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVAYDGELLLQGVHDN  274
            I+RLGK QDDGSYKVTFGVLFNDD+CANIFEALVGTLRAAK+RK + YDGELLLQGVHDN
Sbjct  14   IQRLGKLQDDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKRRKFLTYDGELLLQGVHDN  73

Query  275  VEITLKP  295
            VEI LKP
Sbjct  74   VEIILKP  80



>ref|XP_009620459.1| PREDICTED: costars family protein [Nicotiana tomentosiformis]
Length=93

 Score =   124 bits (310),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/80 (88%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVEEEVERL+EEIKRLG  QDDGSYKVTFGVLF+DD+CANIFEALVGTLRAAKKRK++ 
Sbjct  1    MNVEEEVERLKEEIKRLGIAQDDGSYKVTFGVLFHDDRCANIFEALVGTLRAAKKRKILT  60

Query  236  YDGELLLQGVHDNVEITLKP  295
            YDGELLLQGVH+NVEI LKP
Sbjct  61   YDGELLLQGVHENVEIILKP  80



>ref|XP_002309860.1| hypothetical protein POPTR_0007s03140g [Populus trichocarpa]
 gb|EEE90310.1| hypothetical protein POPTR_0007s03140g [Populus trichocarpa]
Length=96

 Score =   123 bits (309),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/86 (84%), Positives = 77/86 (90%), Gaps = 2/86 (2%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVEEEV RL+EEI+RLGK Q DGSYKVTFGVLFNDD+CANIFEALVGTLRAAKKRK + 
Sbjct  1    MNVEEEVGRLKEEIQRLGKVQPDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKKRKFLT  60

Query  236  YDGELLLQGVHDNVEITLK--PTPAA  307
            YDGELLLQGVHDNVEI LK  P PA+
Sbjct  61   YDGELLLQGVHDNVEIILKAAPLPAS  86



>ref|XP_010645168.1| PREDICTED: LOW QUALITY PROTEIN: costars family protein [Vitis 
vinifera]
Length=93

 Score =   123 bits (308),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/79 (90%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVEEEV RL+EEI RLGK QDDGSYKVTFGVLF+DD+CANIFEALVGTLRAAKKRKVVA
Sbjct  1    MNVEEEVGRLKEEITRLGKIQDDGSYKVTFGVLFHDDRCANIFEALVGTLRAAKKRKVVA  60

Query  236  YDGELLLQGVHDNVEITLK  292
            Y+GELLLQGVHDNVEI LK
Sbjct  61   YEGELLLQGVHDNVEIVLK  79



>ref|XP_011023072.1| PREDICTED: costars family protein [Populus euphratica]
Length=96

 Score =   123 bits (308),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 73/86 (85%), Positives = 78/86 (91%), Gaps = 2/86 (2%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVEEEVERL+EEI+RLGK Q DGSYKVTFGVLFNDD+CANIFEALVGTLRAAKKRK + 
Sbjct  1    MNVEEEVERLKEEIQRLGKVQPDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKKRKFLT  60

Query  236  YDGELLLQGVHDNVEITLK--PTPAA  307
            YDGELLLQGVHDNVEI LK  P PA+
Sbjct  61   YDGELLLQGVHDNVEIILKAAPLPAS  86



>ref|XP_010231394.1| PREDICTED: costars family protein [Brachypodium distachyon]
Length=86

 Score =   122 bits (307),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVEEEV +L+EEI+RLG++Q DGSYKV FGVLFNDD+CANIFEALVGTLRAAKKRK V 
Sbjct  1    MNVEEEVGKLKEEIQRLGQQQPDGSYKVKFGVLFNDDRCANIFEALVGTLRAAKKRKFVT  60

Query  236  YDGELLLQGVHDNVEITLKPTPAA  307
            YDGELLLQGVHDNVEITL P   A
Sbjct  61   YDGELLLQGVHDNVEITLLPPVVA  84



>ref|XP_003529267.1| PREDICTED: costars family protein-like [Glycine max]
Length=90

 Score =   121 bits (304),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 68/78 (87%), Positives = 73/78 (94%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVEEEV+RL +EIKRLGK Q DGSYKVTFG LFNDD+CANIFEALVGTLRAAKKRKV+ 
Sbjct  1    MNVEEEVQRLSQEIKRLGKVQADGSYKVTFGTLFNDDECANIFEALVGTLRAAKKRKVLT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y+GELLLQGVHDNVEITL
Sbjct  61   YEGELLLQGVHDNVEITL  78



>ref|XP_003531014.1| PREDICTED: costars family protein At4g33640-like [Glycine max]
 gb|KHN46252.1| Costars family protein [Glycine soja]
Length=91

 Score =   121 bits (304),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 68/78 (87%), Positives = 73/78 (94%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVEEEV+RL +EIKRLGK Q DGSYKVTFG LFNDD+CANIFEALVGTLRAAKKRKV+ 
Sbjct  1    MNVEEEVQRLSQEIKRLGKVQADGSYKVTFGTLFNDDECANIFEALVGTLRAAKKRKVLT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y+GELLLQGVHDNVEITL
Sbjct  61   YEGELLLQGVHDNVEITL  78



>gb|EYU18406.1| hypothetical protein MIMGU_mgv1a017197mg [Erythranthe guttata]
Length=88

 Score =   119 bits (298),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 67/79 (85%), Positives = 74/79 (94%), Gaps = 0/79 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVEEEV RL+EEI+RLG+ Q DGSYKVTFGVLF+DD+CANIFEALVGTLRAAKKRK++ 
Sbjct  1    MNVEEEVGRLKEEIQRLGQSQPDGSYKVTFGVLFHDDRCANIFEALVGTLRAAKKRKILT  60

Query  236  YDGELLLQGVHDNVEITLK  292
            YDGELLLQGVHDNVEI LK
Sbjct  61   YDGELLLQGVHDNVEIILK  79



>ref|NP_567930.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q8LBN7.1|COSA_ARATH RecName: Full=Costars family protein At4g33640 [Arabidopsis thaliana]
 gb|AAM64660.1| unknown [Arabidopsis thaliana]
 gb|ABF58990.1| At4g33640 [Arabidopsis thaliana]
 dbj|BAF01162.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE86259.1| uncharacterized protein AT4G33640 [Arabidopsis thaliana]
Length=95

 Score =   119 bits (298),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV+EE+++L EEI RLG  Q DGSYKVTFGVLFNDD+CANIFEALVGTLRAAKKRK+VA
Sbjct  1    MNVDEEIQKLEEEIHRLGSRQTDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKKRKIVA  60

Query  236  YDGELLLQGVHDNVEITLK  292
            ++GELLLQGVHD VEITL+
Sbjct  61   FEGELLLQGVHDKVEITLR  79



>ref|XP_008237249.1| PREDICTED: costars family protein [Prunus mume]
Length=96

 Score =   119 bits (297),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/78 (88%), Positives = 74/78 (95%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVEEEVERL+EEI+RLGK QDDGSYKVTFGVLFNDD+CANIFEALVGTLRAAKKRK + 
Sbjct  1    MNVEEEVERLKEEIQRLGKVQDDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKKRKFLT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y+GELLLQGVHDNVEI L
Sbjct  61   YEGELLLQGVHDNVEIIL  78



>ref|XP_010432532.1| PREDICTED: costars family protein At4g33640 [Camelina sativa]
Length=91

 Score =   118 bits (296),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVEEE+++L EEI RLG  Q DGSYKVTFGVLFNDD+CANIFEALVGTLRAAKKRK+VA
Sbjct  1    MNVEEEIQKLEEEIHRLGSRQTDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKKRKIVA  60

Query  236  YDGELLLQGVHDNVEITLK  292
            ++GELLLQGVHD VEITL+
Sbjct  61   FEGELLLQGVHDKVEITLR  79



>ref|XP_010437738.1| PREDICTED: costars family protein At4g33640-like [Camelina sativa]
Length=92

 Score =   118 bits (296),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVEEE+++L EEI RLG  Q DGSYKVTFGVLFNDD+CANIFEALVGTLRAAKKRK+VA
Sbjct  1    MNVEEEIQKLEEEIHRLGSRQTDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKKRKIVA  60

Query  236  YDGELLLQGVHDNVEITLK  292
            ++GELLLQGVHD VEITL+
Sbjct  61   FEGELLLQGVHDKVEITLR  79



>ref|XP_010447216.1| PREDICTED: costars family protein At4g33640-like [Camelina sativa]
Length=93

 Score =   118 bits (296),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVEEE+++L EEI RLG  Q DGSYKVTFGVLFNDD+CANIFEALVGTLRAAKKRK+VA
Sbjct  1    MNVEEEIQKLEEEIHRLGSRQTDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKKRKIVA  60

Query  236  YDGELLLQGVHDNVEITLK  292
            ++GELLLQGVHD VEITL+
Sbjct  61   FEGELLLQGVHDKVEITLR  79



>gb|KFK29986.1| hypothetical protein AALP_AA7G203000 [Arabis alpina]
Length=94

 Score =   118 bits (296),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/79 (84%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVEEE+++L EEI RLG  Q DGSYKVTFGVLFNDD+CANIFEALVGTLRAAKKRK+VA
Sbjct  1    MNVEEEIQKLEEEIHRLGSVQPDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKKRKIVA  60

Query  236  YDGELLLQGVHDNVEITLK  292
            + GELLLQGVHDNVEITL+
Sbjct  61   FPGELLLQGVHDNVEITLR  79



>emb|CAA20577.1| putative protein [Arabidopsis thaliana]
 emb|CAB80081.1| putative protein [Arabidopsis thaliana]
Length=161

 Score =   120 bits (301),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV+EE+++L EEI RLG  Q DGSYKVTFGVLFNDD+CANIFEALVGTLRAAKKRK+VA
Sbjct  67   MNVDEEIQKLEEEIHRLGSRQTDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKKRKIVA  126

Query  236  YDGELLLQGVHDNVEITLK  292
            ++GELLLQGVHD VEITL+
Sbjct  127  FEGELLLQGVHDKVEITLR  145



>ref|XP_002867166.1| hypothetical protein ARALYDRAFT_491316 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43425.1| hypothetical protein ARALYDRAFT_491316 [Arabidopsis lyrata subsp. 
lyrata]
Length=93

 Score =   117 bits (294),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVEEE+++L EEI RLG  Q DGSYKVTFGVLFNDD+CANIFEALVGTLRAAKKRK+VA
Sbjct  1    MNVEEEIQKLEEEIHRLGSLQTDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKKRKIVA  60

Query  236  YDGELLLQGVHDNVEITLK  292
            + GELLLQGVHD VEITL+
Sbjct  61   FQGELLLQGVHDKVEITLR  79



>ref|XP_006412331.1| hypothetical protein EUTSA_v10026671mg [Eutrema salsugineum]
 sp|B4YYA9.1|COSA_THEHA RecName: Full=Costars family protein ST45-2 [Eutrema halophilum]
 gb|ACF23026.1| ST45-2 [Eutrema halophilum]
 gb|ESQ53784.1| hypothetical protein EUTSA_v10026671mg [Eutrema salsugineum]
Length=92

 Score =   117 bits (294),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVEEE+++L EEI RLG  Q DGSYKVTFGVLFNDD+CANIFEALVGTLRAAKKRK+VA
Sbjct  1    MNVEEEIQKLEEEIHRLGSLQSDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKKRKIVA  60

Query  236  YDGELLLQGVHDNVEITLK  292
            + GELLLQGVHD VEITL+
Sbjct  61   FPGELLLQGVHDKVEITLR  79



>ref|XP_010547923.1| PREDICTED: costars family protein ST45-2 [Tarenaya hassleriana]
Length=95

 Score =   117 bits (294),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVEEE+ RL EEI+RLG  Q DGSYKVTFGVLFNDD+CANIFEALVGTLRAAKKRK+VA
Sbjct  1    MNVEEEIHRLEEEIQRLGSLQPDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKKRKIVA  60

Query  236  YDGELLLQGVHDNVEITLK  292
            Y+GELLLQGVHD VEI ++
Sbjct  61   YEGELLLQGVHDKVEIIMR  79



>ref|XP_003608396.1| hypothetical protein MTR_4g093660 [Medicago truncatula]
 gb|AES90593.1| costars family protein abracl protein [Medicago truncatula]
Length=87

 Score =   116 bits (291),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 70/78 (90%), Positives = 73/78 (94%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVEEEVE+LREEIKRLG  Q DGS KVTFG LF+DD+CANIFEALVGTLRAAKKRKVVA
Sbjct  1    MNVEEEVEKLREEIKRLGNVQTDGSCKVTFGTLFHDDRCANIFEALVGTLRAAKKRKVVA  60

Query  236  YDGELLLQGVHDNVEITL  289
            YDGELLLQGVHDNVEITL
Sbjct  61   YDGELLLQGVHDNVEITL  78



>ref|XP_009120730.1| PREDICTED: costars family protein ST45-2 [Brassica rapa]
 gb|AID60087.1| At4g33640-like protein [Brassica napus]
 emb|CDX75369.1| BnaA01g03330D [Brassica napus]
Length=95

 Score =   116 bits (291),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVEEE+++L EEI RLG  Q DGSYKVTFGVLFNDD+CANIFEALVGTLRAAKKRK+VA
Sbjct  1    MNVEEEIQKLEEEIHRLGSLQPDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKKRKIVA  60

Query  236  YDGELLLQGVHDNVEITLK  292
            + GELLLQGVHD VEITL+
Sbjct  61   FPGELLLQGVHDKVEITLR  79



>gb|ACG47970.1| hypothetical protein [Zea mays]
Length=108

 Score =   116 bits (291),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +2

Query  95   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVAYDGELLLQGVHDN  274
            I RLG++Q DGSYKV FGVLFNDD+CANIFEALVGTLRAAKKRK++ Y+GELLLQGVHDN
Sbjct  14   IHRLGQQQPDGSYKVKFGVLFNDDRCANIFEALVGTLRAAKKRKILTYEGELLLQGVHDN  73

Query  275  VEIT  286
            VEIT
Sbjct  74   VEIT  77



>ref|XP_004147507.1| PREDICTED: costars family protein-like [Cucumis sativus]
 ref|XP_004163936.1| PREDICTED: costars family protein-like [Cucumis sativus]
Length=120

 Score =   117 bits (292),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 78/107 (73%), Gaps = 25/107 (23%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYK-------------------------VTFGVLFN  160
            MNVEEEVERL+EEIKRLGK QDDGSYK                         VTFGVLFN
Sbjct  1    MNVEEEVERLKEEIKRLGKLQDDGSYKITFLIAQNQICLPMPITCLMFCHYWVTFGVLFN  60

Query  161  DDQCANIFEALVGTLRAAKKRKVVAYDGELLLQGVHDNVEITLKPTP  301
            DD+CANIFEALVGTLRAAKKRK+V+YDGELLLQGVHDNVEI LK  P
Sbjct  61   DDRCANIFEALVGTLRAAKKRKIVSYDGELLLQGVHDNVEIILKAIP  107



>ref|XP_006852895.1| hypothetical protein AMTR_s00033p00221650 [Amborella trichopoda]
 gb|ERN14362.1| hypothetical protein AMTR_s00033p00221650 [Amborella trichopoda]
Length=95

 Score =   115 bits (289),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  95   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVAYDGELLLQGVHDN  274
            IKRLG+ Q+DGSYKV FGVLFNDD+CANIFEALVGTLRAAK+RK++ Y+GELLLQGVHDN
Sbjct  16   IKRLGQPQNDGSYKVKFGVLFNDDRCANIFEALVGTLRAAKRRKILTYEGELLLQGVHDN  75

Query  275  VEITL  289
            VEI L
Sbjct  76   VEILL  80



>sp|A9NK39.1|COSA_PICSI RecName: Full=Costars family protein WS02710_H03 [Picea sitchensis]
 gb|ABK21000.1| unknown [Picea sitchensis]
Length=95

 Score =   114 bits (285),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +2

Query  53   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVV  232
            T+NV+EEVERL+EEIKRL + + DGSY V FGVLF+DD+CANIFEALVGTLRAAKKRKVV
Sbjct  2    TLNVDEEVERLKEEIKRLAQPRPDGSYVVKFGVLFSDDRCANIFEALVGTLRAAKKRKVV  61

Query  233  AYDGELLLQGVHDNVEITLKPTP  301
             YDGELLLQGVHDNVEI L   P
Sbjct  62   TYDGELLLQGVHDNVEIVLLKPP  84



>ref|XP_009062533.1| hypothetical protein LOTGIDRAFT_207050 [Lottia gigantea]
 gb|ESO86839.1| hypothetical protein LOTGIDRAFT_207050 [Lottia gigantea]
Length=82

 Score =   108 bits (270),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVE EV  L EEIKRLG +  +G Y+VTFGVLFNDD+CANIFEALVGTLRAAK++K+V 
Sbjct  1    MNVEHEVNLLVEEIKRLGTQNGNGQYEVTFGVLFNDDRCANIFEALVGTLRAAKRKKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y+GELLLQGVHDNV+I L
Sbjct  61   YEGELLLQGVHDNVKIVL  78



>ref|XP_002131888.1| PREDICTED: costars family protein ABRACL-like [Ciona intestinalis]
Length=82

 Score =   107 bits (266),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV+ EV+ L EEIKRLGK+  DG + VTFGVLF+DD+CANIFEALVGTLRAAK++K+V 
Sbjct  1    MNVDHEVKLLVEEIKRLGKQNADGQFVVTFGVLFSDDRCANIFEALVGTLRAAKRKKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHDNVE+ L
Sbjct  61   YTGELLLQGVHDNVEVIL  78



>gb|KGN53893.1| hypothetical protein Csa_4G182240 [Cucumis sativus]
Length=91

 Score =   105 bits (263),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +2

Query  137  VTFGVLFNDDQCANIFEALVGTLRAAKKRKVVAYDGELLLQGVHDNVEITLKPTP  301
            VTFGVLFNDD+CANIFEALVGTLRAAKKRK+V+YDGELLLQGVHDNVEI LK  P
Sbjct  24   VTFGVLFNDDRCANIFEALVGTLRAAKKRKIVSYDGELLLQGVHDNVEIILKAIP  78



>ref|XP_002963364.1| hypothetical protein SELMODRAFT_8583, partial [Selaginella moellendorffii]
 gb|EFJ35235.1| hypothetical protein SELMODRAFT_8583, partial [Selaginella moellendorffii]
Length=80

 Score =   105 bits (261),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +2

Query  95   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVAYDGELLLQGVHDN  274
            I+RLG  Q DGS  V FG+LFNDD+CAN+FEALVGTLRAAKKRK++ YDGELLLQGVHDN
Sbjct  14   IERLGTVQPDGSTVVKFGILFNDDRCANLFEALVGTLRAAKKRKLLTYDGELLLQGVHDN  73

Query  275  VEITL  289
            V+I L
Sbjct  74   VDIVL  78



>ref|XP_003971945.1| PREDICTED: costars family protein ABRACL-like [Takifugu rubripes]
Length=81

 Score =   104 bits (260),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV  E+E L EEIKRLG +  DG   V FGVLFNDD+CANIFEALVGTL+AAKKRK+++
Sbjct  1    MNVSHEIELLMEEIKRLGSKNADGQTCVKFGVLFNDDRCANIFEALVGTLKAAKKRKLIS  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHDNV+ITL
Sbjct  61   YQGELLLQGVHDNVDITL  78



>ref|XP_005102609.1| PREDICTED: costars family protein ABRACL-like isoform X1 [Aplysia 
californica]
 ref|XP_005102610.1| PREDICTED: costars family protein ABRACL-like isoform X2 [Aplysia 
californica]
Length=79

 Score =   103 bits (257),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +2

Query  95   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVAYDGELLLQGVHDN  274
            IKRLGKE  DG  +VTFG LFNDD+CAN+FEALVGTLRAAK++K++ YDGELLLQGVHD+
Sbjct  14   IKRLGKEGSDGKCEVTFGALFNDDKCANLFEALVGTLRAAKRKKIIKYDGELLLQGVHDS  73

Query  275  VEITL  289
              I+L
Sbjct  74   TVISL  78



>ref|XP_011423954.1| PREDICTED: costars family protein ABRACL-like [Crassostrea gigas]
 ref|XP_011423955.1| PREDICTED: costars family protein ABRACL-like [Crassostrea gigas]
Length=83

 Score =   103 bits (257),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV+ EVE L EEIKRLG    DG   VTFG LF+DD+CANIFEALVGTLRAAK++KVV 
Sbjct  1    MNVQHEVELLIEEIKRLGSPDADGKVSVTFGTLFSDDRCANIFEALVGTLRAAKRKKVVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y+GELLLQGVHDNV I L
Sbjct  61   YEGELLLQGVHDNVPIQL  78



>ref|NP_001154032.1| CF115 protein [Oncorhynchus mykiss]
 sp|B5X8A5.1|ABRAL_SALSA RecName: Full=Costars family protein ABRACL; AltName: Full=ABRA 
C-terminal-like protein [Salmo salar]
 gb|ACI67075.1| C6orf115 [Salmo salar]
 gb|ACM08715.1| C6orf115 [Salmo salar]
 gb|ACM09336.1| C6orf115 [Salmo salar]
 gb|ACO07598.1| C6orf115 [Oncorhynchus mykiss]
 gb|ADM16247.1| C6orf115 [Salmo salar]
 emb|CDQ64641.1| unnamed protein product [Oncorhynchus mykiss]
Length=81

 Score =   103 bits (256),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV+ EV  L  EI+RLG +  DG   V FGVLFNDD+CANIFEALVGTLRAAK++K++A
Sbjct  1    MNVQHEVSLLVGEIQRLGSKNADGQTCVKFGVLFNDDRCANIFEALVGTLRAAKRKKIIA  60

Query  236  YDGELLLQGVHDNVEITL  289
            ++GELLLQGVHDNV+ITL
Sbjct  61   FEGELLLQGVHDNVDITL  78



>ref|XP_002974652.1| hypothetical protein SELMODRAFT_8582, partial [Selaginella moellendorffii]
 gb|EFJ24172.1| hypothetical protein SELMODRAFT_8582, partial [Selaginella moellendorffii]
Length=80

 Score =   102 bits (254),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +2

Query  95   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVAYDGELLLQGVHDN  274
            I+RLG    DGS  V FG+LFNDD+CAN+FEALVGTLRAAKKRK++ YDGELLLQGVHDN
Sbjct  14   IERLGTVLPDGSTVVKFGILFNDDRCANLFEALVGTLRAAKKRKLLTYDGELLLQGVHDN  73

Query  275  VEITL  289
            V+I L
Sbjct  74   VDIVL  78



>ref|XP_008112706.1| PREDICTED: costars family protein ABRACL isoform X1 [Anolis carolinensis]
Length=96

 Score =   102 bits (255),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +2

Query  44   QTGTMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKR  223
            +  TMNVE E+  L EEI+RLG +  DG+  V FGVLF D++CAN+FEALVGTL+AAK+R
Sbjct  12   ERATMNVEHEISLLVEEIQRLGTKNPDGTLSVKFGVLFADEKCANLFEALVGTLKAAKRR  71

Query  224  KVVAYDGELLLQGVHDNVEITL  289
            K+V+Y GELLLQGVHDNV+I L
Sbjct  72   KIVSYPGELLLQGVHDNVDILL  93



>ref|NP_998807.1| costars family protein ABRACL [Danio rerio]
 sp|Q6TGV7.1|ABRAL_DANRE RecName: Full=Costars family protein ABRACL; AltName: Full=ABRA 
C-terminal-like protein [Danio rerio]
 gb|AAQ97832.1| hypothetical protein PRO2013 [Danio rerio]
 gb|AAH97017.1| C6orf115 homolog (H. sapiens) [Danio rerio]
Length=81

 Score =   101 bits (252),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVE EV  L +EI+RLG +  DG   V FGVLFNDDQCAN+FEALVGTL+AAK++KV+ 
Sbjct  1    MNVEHEVSLLIDEIRRLGSKNADGKTSVKFGVLFNDDQCANLFEALVGTLKAAKRKKVIT  60

Query  236  YDGELLLQGVHDNVEITL  289
            +DGELLLQGVHDNV++ L
Sbjct  61   FDGELLLQGVHDNVDVVL  78



>ref|XP_010880879.1| PREDICTED: costars family protein ABRACL [Esox lucius]
 gb|ACO13801.1| C6orf115 [Esox lucius]
Length=81

 Score =   101 bits (252),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV+ EV  L +EI+RLG +  DG   V FGVLFNDD+CANIFEALVGTLRAAK++K++ 
Sbjct  1    MNVQHEVSLLVDEIQRLGSKNADGKMCVKFGVLFNDDRCANIFEALVGTLRAAKRKKIIT  60

Query  236  YDGELLLQGVHDNVEITL  289
            ++GELLLQGVHDNV+ITL
Sbjct  61   FEGELLLQGVHDNVDITL  78



>ref|XP_003387508.1| PREDICTED: costars family protein ABRACL-like [Amphimedon queenslandica]
Length=81

 Score =   101 bits (252),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVE EVE L  EIKRLG +  DG Y VTFG LF DD+CAN+FEALVGTL+AAK++K+V 
Sbjct  1    MNVEHEVELLVGEIKRLGTQNADGQYVVTFGTLFADDKCANLFEALVGTLKAAKRKKIVK  60

Query  236  YDGELLLQGVHDNVEITL  289
            YD E+LLQGVHD VEITL
Sbjct  61   YDAEILLQGVHDGVEITL  78



>ref|NP_001165090.1| costars family protein ABRACL [Xenopus laevis]
 sp|Q498C5.1|ABRAL_XENLA RecName: Full=Costars family protein ABRACL; AltName: Full=ABRA 
C-terminal-like protein [Xenopus laevis]
 gb|AAI00274.1| MGC116503 protein [Xenopus laevis]
Length=81

 Score =   101 bits (252),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +2

Query  95   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVAYDGELLLQGVHDN  274
            I+RLG + +DG + V FGVLF+DD+CAN+FEALVGTL+AAKKRK++ Y GELLLQGVHDN
Sbjct  14   IRRLGSKGNDGKFSVKFGVLFSDDKCANLFEALVGTLKAAKKRKIITYQGELLLQGVHDN  73

Query  275  VEITL  289
            V+I L
Sbjct  74   VDIVL  78



>gb|ETO27738.1| hypothetical protein RFI_09392 [Reticulomyxa filosa]
Length=100

 Score =   101 bits (252),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +2

Query  95   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVAYDGELLLQGVHDN  274
            IKRLGK   +G Y VTF  +FND+QCANIFEALVGTL+AAKKRKV+ Y G++LLQGV DN
Sbjct  18   IKRLGKPNSNGKYSVTFKTIFNDEQCANIFEALVGTLKAAKKRKVIDYQGQILLQGVSDN  77

Query  275  VEITL  289
            VEI L
Sbjct  78   VEIVL  82



>gb|KFP31952.1| Costars family protein ABRACL, partial [Colius striatus]
Length=82

 Score =   100 bits (250),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +2

Query  53   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVV  232
            TMNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AAK+RK++
Sbjct  1    TMNVEHEISLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKII  60

Query  233  AYDGELLLQGVHDNVEITL  289
             Y GELLLQGVHDNV+ITL
Sbjct  61   TYQGELLLQGVHDNVDITL  79



>gb|KFQ69396.1| Costars family protein ABRACL, partial [Phaethon lepturus]
Length=82

 Score =   100 bits (250),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +2

Query  53   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVV  232
            TMNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AAK+RK+V
Sbjct  1    TMNVEHEISLLVEEIQRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIV  60

Query  233  AYDGELLLQGVHDNVEITL  289
            AY GELLLQGVHDNV+I L
Sbjct  61   AYQGELLLQGVHDNVDIML  79



>ref|NP_001134634.1| costars family protein ABRACL [Salmo salar]
 gb|ACI68284.1| C6orf115 [Salmo salar]
Length=81

 Score =   100 bits (250),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV+ EV  L  EI+RLG +  DG   V FGVLFNDD+CANIFEALVGTLRAAK++K++A
Sbjct  1    MNVQHEVSLLVGEIQRLGSKNADGQTCVKFGVLFNDDRCANIFEALVGTLRAAKRKKIIA  60

Query  236  YDGELLLQGVHDNVEITL  289
            ++GEL LQGVHDNV+ITL
Sbjct  61   FEGELPLQGVHDNVDITL  78



>gb|KFR07389.1| Costars family protein ABRACL, partial [Opisthocomus hoazin]
Length=82

 Score =   100 bits (250),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +2

Query  53   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVV  232
            TMNVE E+  L EEI+RLG    DG   V FGVLF D++CAN+FEALVGTL+AAK+RK+V
Sbjct  1    TMNVEHEISLLVEEIRRLGTRNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIV  60

Query  233  AYDGELLLQGVHDNVEITL  289
            AY GELLLQGVHDNV+I L
Sbjct  61   AYQGELLLQGVHDNVDIML  79



>ref|NP_001165089.1| costars family protein ABRACL [Xenopus (Silurana) tropicalis]
 sp|A4IHJ3.1|ABRAL_XENTR RecName: Full=Costars family protein ABRACL; AltName: Full=ABRA 
C-terminal-like protein [Xenopus (Silurana) tropicalis]
 gb|AAI35555.1| LOC100124856 protein [Xenopus (Silurana) tropicalis]
Length=81

 Score =   100 bits (249),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +2

Query  95   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVAYDGELLLQGVHDN  274
            I+RLG + +DG   V FGVLF+DD+CAN+FEALVGTL+AAKKRK+V Y GELLLQGVHDN
Sbjct  14   IRRLGSKGNDGKLSVKFGVLFSDDKCANLFEALVGTLKAAKKRKIVTYQGELLLQGVHDN  73

Query  275  VEITL  289
            V+I L
Sbjct  74   VDIVL  78



>gb|AAQ55814.1| hypothetical protein [Coturnix coturnix]
Length=108

 Score =   101 bits (251),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = +2

Query  38   RHQTGTMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAK  217
            R +  TMNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AAK
Sbjct  22   RWERTTMNVEHEISLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAK  81

Query  218  KRKVVAYDGELLLQGVHDNVEITL  289
            +RK+V Y GELLLQGVHDNV+I L
Sbjct  82   RRKIVTYQGELLLQGVHDNVDIVL  105



>gb|KFO13502.1| Costars family protein ABRACL, partial [Balearica regulorum gibbericeps]
Length=82

 Score =   100 bits (249),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +2

Query  53   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVV  232
            TMNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AAK+RK+V
Sbjct  1    TMNVEHEINLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIV  60

Query  233  AYDGELLLQGVHDNVEITL  289
             Y GELLLQGVHDNVEI L
Sbjct  61   TYQGELLLQGVHDNVEIML  79



>ref|XP_003446311.1| PREDICTED: costars family protein ABRACL-like isoform X1 [Oreochromis 
niloticus]
 ref|XP_005475126.1| PREDICTED: costars family protein ABRACL-like isoform X2 [Oreochromis 
niloticus]
Length=81

 Score =   100 bits (249),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV  E++ L +EI+RLG +  DG + V FGVLFNDD+CANIFEALVGTL+AAKK+KV+ 
Sbjct  1    MNVSHEIDLLVQEIQRLGSKNADGKFSVKFGVLFNDDRCANIFEALVGTLKAAKKKKVID  60

Query  236  YDGELLLQGVHDNVEITL  289
            + GELLLQGVHDNV++ L
Sbjct  61   FQGELLLQGVHDNVDVIL  78



>gb|KFZ52453.1| Costars family protein ABRACL, partial [Caprimulgus carolinensis]
Length=82

 Score =   100 bits (249),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +2

Query  53   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVV  232
            TMNVE E+  L EEI+RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK+V
Sbjct  1    TMNVEHEINLLVEEIRRLGTKNADGQVSVKFGVLFADDKCANLFEALVGTLKAAKRRKIV  60

Query  233  AYDGELLLQGVHDNVEITL  289
             Y GELLLQGVHDNV+I L
Sbjct  61   TYQGELLLQGVHDNVDIML  79



>gb|KGL81992.1| Costars family protein ABRACL, partial [Tinamus guttatus]
Length=82

 Score =   100 bits (248),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +2

Query  53   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVV  232
            TMNVE EV  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AAK+RKVV
Sbjct  1    TMNVEHEVNLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKVV  60

Query  233  AYDGELLLQGVHDNVEITL  289
            +Y GELLLQGVHDNV+I L
Sbjct  61   SYQGELLLQGVHDNVDIVL  79



>ref|XP_008311631.1| PREDICTED: costars family protein ABRACL [Cynoglossus semilaevis]
Length=81

 Score =   100 bits (248),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV  EV  L EEI+RLG E  DG+  V FGVLFNDD+CANIFEALVGTLRAAKK+K+V 
Sbjct  1    MNVAHEVNMLVEEIQRLGTENADGNISVKFGVLFNDDRCANIFEALVGTLRAAKKKKIVD  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQ VHD+V+I L
Sbjct  61   YKGELLLQNVHDDVDIVL  78



>gb|KFQ08843.1| Costars family protein ABRACL, partial [Leptosomus discolor]
Length=82

 Score =   100 bits (248),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +2

Query  53   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVV  232
            TMNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AAK+RK+V
Sbjct  1    TMNVEHEISLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIV  60

Query  233  AYDGELLLQGVHDNVEITL  289
            +Y GELLLQGVHDNV+I L
Sbjct  61   SYQGELLLQGVHDNVDIML  79



>ref|XP_002158724.1| PREDICTED: costars family protein ABRACL-like [Hydra vulgaris]
Length=84

 Score =   100 bits (248),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV  EVE L +EIKRLG +  DG Y+V FG +FND +CANIFEALVGTLRAAK++KVV 
Sbjct  1    MNVAHEVELLVQEIKRLGTKNKDGQYEVLFGKIFNDTRCANIFEALVGTLRAAKRKKVVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            ++GELLLQGVHDNV I L
Sbjct  61   FEGELLLQGVHDNVPIKL  78



>ref|XP_009687213.1| PREDICTED: costars family protein ABRACL isoform X1 [Struthio 
camelus australis]
Length=105

 Score =   100 bits (249),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 67/85 (79%), Gaps = 1/85 (1%)
 Frame = +2

Query  38   RHQT-GTMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAA  214
            RH +  TMNVE E+  L EEI+RLG    DG   V FGVLF D++CAN+FEALVGTL+AA
Sbjct  18   RHSSKNTMNVEHEINLLVEEIQRLGTRNADGQVSVKFGVLFADEKCANLFEALVGTLKAA  77

Query  215  KKRKVVAYDGELLLQGVHDNVEITL  289
            K+RK+V+Y GELLLQGVHDNV+I L
Sbjct  78   KRRKIVSYQGELLLQGVHDNVDIML  102



>ref|XP_010200782.1| PREDICTED: costars family protein ABRACL [Colius striatus]
Length=89

 Score = 99.8 bits (247),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AAK+RK++ 
Sbjct  1    MNVEHEISLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIIT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHDNV+ITL
Sbjct  61   YQGELLLQGVHDNVDITL  78



>gb|EMC83349.1| UPF0727 protein C6orf115 like protein, partial [Columba livia]
Length=83

 Score = 99.8 bits (247),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +2

Query  53   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVV  232
            TMNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AAK+RK+V
Sbjct  2    TMNVEHEISLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIV  61

Query  233  AYDGELLLQGVHDNVEITL  289
             Y GELLLQGVHDNV+I L
Sbjct  62   TYPGELLLQGVHDNVDIML  80



>ref|XP_003223326.1| PREDICTED: costars family protein ABRACL isoform X2 [Anolis carolinensis]
 ref|XP_008112707.1| PREDICTED: costars family protein ABRACL isoform X2 [Anolis carolinensis]
 ref|XP_008112708.1| PREDICTED: costars family protein ABRACL isoform X2 [Anolis carolinensis]
 ref|XP_008112709.1| PREDICTED: costars family protein ABRACL isoform X2 [Anolis carolinensis]
 ref|XP_008112710.1| PREDICTED: costars family protein ABRACL isoform X2 [Anolis carolinensis]
Length=81

 Score = 99.8 bits (247),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVE E+  L EEI+RLG +  DG+  V FGVLF D++CAN+FEALVGTL+AAK+RK+V+
Sbjct  1    MNVEHEISLLVEEIQRLGTKNPDGTLSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVS  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHDNV+I L
Sbjct  61   YPGELLLQGVHDNVDILL  78



>ref|XP_010737667.1| PREDICTED: costars family protein ABRACL [Larimichthys crocea]
Length=81

 Score = 99.4 bits (246),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVE EV+ L EEI+RLG +  DG   V FGVLF+DD+CANIFEALVGTL+AAKKRKVV+
Sbjct  1    MNVEHEVKLLVEEIQRLGTKNADGQTTVKFGVLFSDDRCANIFEALVGTLKAAKKRKVVS  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y  ELLLQGVHD+VE+ L
Sbjct  61   YQAELLLQGVHDDVEVVL  78



>ref|XP_783554.1| PREDICTED: costars family protein ABRACL-like [Strongylocentrotus 
purpuratus]
Length=79

 Score = 99.4 bits (246),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVE EV+ L EE+KRLG+   DG   V FGVLF DD+CAN+FEALVGTLRAAK++K+V 
Sbjct  1    MNVEHEVQLLVEEMKRLGEPNADGKVAVKFGVLFADDRCANLFEALVGTLRAAKRKKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y+GELLLQGVHDNV+I L
Sbjct  61   YEGELLLQGVHDNVDIVL  78



>dbj|GAM18052.1| hypothetical protein SAMD00019534_012270 [Acytostelium subglobosum 
LB1]
Length=83

 Score = 99.4 bits (246),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV+ EV  L  EIKRLG  Q +G+  V FGVLFNDDQ ANIFEALVGTL+AAKKRK++ 
Sbjct  1    MNVDHEVTLLIREIKRLGTAQPNGTTVVKFGVLFNDDQVANIFEALVGTLKAAKKRKIIN  60

Query  236  YDGELLLQGVHDNVEITL  289
            YDGE+LLQ VHDNV++ L
Sbjct  61   YDGEILLQRVHDNVDVIL  78



>gb|KFO73634.1| Costars family protein ABRACL, partial [Cuculus canorus]
 gb|KFP40603.1| Costars family protein ABRACL, partial [Chlamydotis macqueenii]
 gb|KGL91071.1| Costars family protein ABRACL, partial [Charadrius vociferus]
Length=82

 Score = 99.4 bits (246),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +2

Query  53   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVV  232
            TMNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AAK+RK+V
Sbjct  1    TMNVEHEISLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIV  60

Query  233  AYDGELLLQGVHDNVEITL  289
             Y GELLLQGVHDNV+I L
Sbjct  61   TYQGELLLQGVHDNVDIVL  79



>ref|XP_003770544.1| PREDICTED: costars family protein ABRACL-like [Sarcophilus harrisii]
Length=81

 Score = 99.4 bits (246),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVE E+  L EE++RLG    DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVEHEISLLVEEMQRLGTRGADGKLSVKFGVLFQDDRCANLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y+GELLLQGVHDNVEI L
Sbjct  61   YEGELLLQGVHDNVEIVL  78



>gb|ACO09013.1| C6orf115 [Osmerus mordax]
Length=81

 Score = 99.4 bits (246),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV+ EV  L EEI+RLG +  DG   V FGVLF+DD+CANIFEALVGTLRAAK++K+V 
Sbjct  1    MNVQHEVSLLVEEIQRLGSKNADGKTSVKFGVLFSDDRCANIFEALVGTLRAAKRKKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            ++GELLLQGVHDNV++ L
Sbjct  61   FEGELLLQGVHDNVDVIL  78



>gb|KFZ55568.1| Costars family protein ABRACL, partial [Podiceps cristatus]
Length=82

 Score = 99.4 bits (246),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +2

Query  53   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVV  232
            TMNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AAK+RKVV
Sbjct  1    TMNVEHEINLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKVV  60

Query  233  AYDGELLLQGVHDNVEITL  289
             Y GELLLQGVHDNV+I L
Sbjct  61   TYQGELLLQGVHDNVDIVL  79



>gb|KFV63720.1| Costars family protein ABRACL, partial [Picoides pubescens]
Length=82

 Score = 99.4 bits (246),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +2

Query  53   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVV  232
            TMNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AAK+RK+V
Sbjct  1    TMNVEHEISLLVEEIRRLGTKNADGRVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIV  60

Query  233  AYDGELLLQGVHDNVEITL  289
             Y+GELLLQGVHDNV+I L
Sbjct  61   TYNGELLLQGVHDNVDILL  79



>gb|KFM09004.1| Costars family protein ABRACL, partial [Aptenodytes forsteri]
 gb|KFO60897.1| Costars family protein ABRACL, partial [Corvus brachyrhynchos]
 gb|KFO83467.1| Costars family protein ABRACL, partial [Buceros rhinoceros silvestris]
 gb|KFP20518.1| Costars family protein ABRACL, partial [Egretta garzetta]
 gb|KFP46725.1| Costars family protein ABRACL, partial [Cathartes aura]
 gb|KFP57947.1| Costars family protein ABRACL, partial [Cariama cristata]
 gb|KFP76783.1| Costars family protein ABRACL, partial [Acanthisitta chloris]
 gb|KFQ93630.1| Costars family protein ABRACL, partial [Nipponia nippon]
 gb|KFV02017.1| Costars family protein ABRACL, partial [Pterocles gutturalis]
 gb|KFV42367.1| Costars family protein ABRACL, partial [Gavia stellata]
 gb|KFW04301.1| Costars family protein ABRACL, partial [Fulmarus glacialis]
 gb|KFW63685.1| Costars family protein ABRACL, partial [Pygoscelis adeliae]
 gb|KFW88410.1| Costars family protein ABRACL, partial [Manacus vitellinus]
Length=82

 Score = 99.4 bits (246),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +2

Query  53   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVV  232
            TMNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AAK+RK+V
Sbjct  1    TMNVEHEISLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIV  60

Query  233  AYDGELLLQGVHDNVEITL  289
             Y GELLLQGVHDNV+I L
Sbjct  61   TYQGELLLQGVHDNVDIML  79



>ref|XP_007423586.1| PREDICTED: costars family protein ABRACL isoform X1 [Python bivittatus]
 ref|XP_007423587.1| PREDICTED: costars family protein ABRACL isoform X2 [Python bivittatus]
 gb|ETE71276.1| hypothetical protein L345_02896 [Ophiophagus hannah]
Length=81

 Score = 99.0 bits (245),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVE E+  L EEI+RLG +  DG+  V FGVLF D++CAN+FEALVGTL+AAK+RK+V+
Sbjct  1    MNVEHEINLLVEEIRRLGTKNPDGTLSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVS  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHDNV+I L
Sbjct  61   YPGELLLQGVHDNVDILL  78



>gb|KFV46510.1| Costars family protein ABRACL, partial [Tyto alba]
Length=82

 Score = 99.0 bits (245),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +2

Query  53   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVV  232
            TMNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AAK+RK+V
Sbjct  1    TMNVEHEISLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIV  60

Query  233  AYDGELLLQGVHDNVEITL  289
             Y GELLLQGVHDN++I L
Sbjct  61   TYQGELLLQGVHDNIDIVL  79



>gb|KFQ52259.1| Costars family protein ABRACL, partial [Pelecanus crispus]
Length=82

 Score = 99.0 bits (245),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = +2

Query  53   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVV  232
            TMNVE E+  L EEI+RLG    DG   V FGVLF D++CAN+FEALVGTL+AAK+RK+V
Sbjct  1    TMNVEHEISLLVEEIRRLGTRNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIV  60

Query  233  AYDGELLLQGVHDNVEITL  289
             Y GELLLQGVHDNV+I L
Sbjct  61   TYQGELLLQGVHDNVDIVL  79



>ref|XP_002714893.1| PREDICTED: costars family protein ABRACL [Oryctolagus cuniculus]
 ref|XP_008261798.1| PREDICTED: costars family protein ABRACL [Oryctolagus cuniculus]
Length=81

 Score = 99.0 bits (245),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVE EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+RKVV 
Sbjct  1    MNVEHEVNLLVEEIHRLGSKNADGKISVKFGVLFQDDKCANLFEALVGTLKAAKRRKVVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHD+V+ITL
Sbjct  61   YPGELLLQGVHDDVDITL  78



>ref|XP_002505679.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66937.1| predicted protein [Micromonas sp. RCC299]
Length=82

 Score = 99.0 bits (245),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +2

Query  95   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVAYDGELLLQGVHDN  274
            I+RLG E  DG   V FGVLF DD+CANIFEALVGTLRAAKKRKV+ ++GE+LLQGVHD+
Sbjct  16   IRRLGSEGPDGKIAVKFGVLFADDRCANIFEALVGTLRAAKKRKVIHFEGEMLLQGVHDD  75

Query  275  VEITL  289
            V++ L
Sbjct  76   VDVVL  80



>gb|KFP80599.1| Costars family protein ABRACL, partial [Apaloderma vittatum]
Length=82

 Score = 99.0 bits (245),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +2

Query  53   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVV  232
            TMNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AAK+RK++
Sbjct  1    TMNVEHEISLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKII  60

Query  233  AYDGELLLQGVHDNVEITL  289
             Y GELLLQGVHDNV+I L
Sbjct  61   TYQGELLLQGVHDNVDIIL  79



>ref|XP_010284041.1| PREDICTED: costars family protein ABRACL [Phaethon lepturus]
Length=81

 Score = 99.0 bits (245),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AAK+RK+VA
Sbjct  1    MNVEHEISLLVEEIQRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVA  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHDNV+I L
Sbjct  61   YQGELLLQGVHDNVDIML  78



>ref|XP_009930257.1| PREDICTED: costars family protein ABRACL [Opisthocomus hoazin]
Length=81

 Score = 99.0 bits (245),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVE E+  L EEI+RLG    DG   V FGVLF D++CAN+FEALVGTL+AAK+RK+VA
Sbjct  1    MNVEHEISLLVEEIRRLGTRNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVA  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHDNV+I L
Sbjct  61   YQGELLLQGVHDNVDIML  78



>gb|KFV88505.1| Costars family protein ABRACL, partial [Struthio camelus australis]
Length=82

 Score = 99.0 bits (245),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +2

Query  53   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVV  232
            TMNVE E+  L EEI+RLG    DG   V FGVLF D++CAN+FEALVGTL+AAK+RK+V
Sbjct  1    TMNVEHEINLLVEEIQRLGTRNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIV  60

Query  233  AYDGELLLQGVHDNVEITL  289
            +Y GELLLQGVHDNV+I L
Sbjct  61   SYQGELLLQGVHDNVDIML  79



>ref|XP_010306042.1| PREDICTED: costars family protein ABRACL [Balearica regulorum 
gibbericeps]
Length=81

 Score = 98.6 bits (244),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVEHEINLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHDNVEI L
Sbjct  61   YQGELLLQGVHDNVEIML  78



>ref|XP_008304863.1| PREDICTED: costars family protein ABRACL-like [Stegastes partitus]
 ref|XP_008304865.1| PREDICTED: costars family protein ABRACL-like [Stegastes partitus]
 ref|XP_008304867.1| PREDICTED: costars family protein ABRACL-like [Stegastes partitus]
 ref|XP_008304868.1| PREDICTED: costars family protein ABRACL-like [Stegastes partitus]
Length=81

 Score = 98.6 bits (244),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +2

Query  95   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVAYDGELLLQGVHDN  274
            I+RLG +  DG   V FGVLF+DD+CANIFEALVGTL+AAKKRKV+ + GELLLQGVHDN
Sbjct  14   IQRLGSKNADGQTSVKFGVLFSDDRCANIFEALVGTLKAAKKRKVINFQGELLLQGVHDN  73

Query  275  VEITL  289
            V+I L
Sbjct  74   VDIIL  78



>ref|XP_005043771.1| PREDICTED: costars family protein ABRACL [Ficedula albicollis]
Length=81

 Score = 98.6 bits (244),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVE E+  L EEI+RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK++ 
Sbjct  1    MNVEHEISLLVEEIRRLGTKNADGQVSVKFGVLFADDKCANLFEALVGTLKAAKRRKIIT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHDNV+I L
Sbjct  61   YQGELLLQGVHDNVDIML  78



>gb|KFP01035.1| Costars family protein ABRACL, partial [Calypte anna]
Length=82

 Score = 98.6 bits (244),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +2

Query  53   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVV  232
            TMNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AAK+RK+V
Sbjct  1    TMNVEHEIGLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIV  60

Query  233  AYDGELLLQGVHDNVEITL  289
             Y GELLLQGVHDNV+I L
Sbjct  61   TYQGELLLQGVHDNVDIML  79



>ref|XP_005361042.1| PREDICTED: costars family protein ABRACL isoform X1 [Microtus 
ochrogaster]
 ref|XP_005361043.1| PREDICTED: costars family protein ABRACL isoform X2 [Microtus 
ochrogaster]
Length=81

 Score = 98.6 bits (244),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV+ EV  L EEI+RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVDHEVNLLVEEIRRLGSKNADGKLSVKFGVLFQDDRCANLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHDNV+I L
Sbjct  61   YTGELLLQGVHDNVDIVL  78



>gb|KFU90284.1| Costars family protein ABRACL, partial [Chaetura pelagica]
Length=82

 Score = 98.6 bits (244),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +2

Query  53   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVV  232
            TMNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AAK+RK+V
Sbjct  1    TMNVEHEISLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIV  60

Query  233  AYDGELLLQGVHDNVEITL  289
             Y GELLLQGVHDNV+I L
Sbjct  61   NYQGELLLQGVHDNVDIML  79



>ref|XP_003204212.1| PREDICTED: costars family protein ABRACL [Meleagris gallopavo]
Length=81

 Score = 98.2 bits (243),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVE E+  L EEI+RLG +  DG   V FGVLF+D++CAN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVEHEISLLVEEIRRLGTKNADGQVSVKFGVLFSDEKCANLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHDNV+I L
Sbjct  61   YQGELLLQGVHDNVDIML  78



>ref|XP_006642989.1| PREDICTED: costars family protein ABRACL-like [Lepisosteus oculatus]
Length=81

 Score = 98.2 bits (243),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVE EV  L +EI+RLG    DG   V FGVLFNDD+CAN+FEALVGTL+AAK++K+V 
Sbjct  1    MNVEHEVSLLADEIRRLGSPNADGKISVKFGVLFNDDKCANLFEALVGTLKAAKRKKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            + GELLLQGVHDNV++ L
Sbjct  61   FQGELLLQGVHDNVDVVL  78



>ref|XP_010176388.1| PREDICTED: costars family protein ABRACL [Caprimulgus carolinensis]
Length=81

 Score = 98.2 bits (243),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVE E+  L EEI+RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVEHEINLLVEEIRRLGTKNADGQVSVKFGVLFADDKCANLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHDNV+I L
Sbjct  61   YQGELLLQGVHDNVDIML  78



>gb|KFQ22819.1| Costars family protein ABRACL, partial [Mesitornis unicolor]
Length=82

 Score = 98.2 bits (243),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +2

Query  53   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVV  232
            TMNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AAK+RK+V
Sbjct  1    TMNVEHEIGLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIV  60

Query  233  AYDGELLLQGVHDNVEITL  289
             Y GELLLQGVHDN++I L
Sbjct  61   TYQGELLLQGVHDNIDIML  79



>ref|XP_010219792.1| PREDICTED: costars family protein ABRACL [Tinamus guttatus]
Length=81

 Score = 98.2 bits (243),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVE EV  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AAK+RKVV+
Sbjct  1    MNVEHEVNLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKVVS  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHDNV+I L
Sbjct  61   YQGELLLQGVHDNVDIVL  78



>gb|KFQ35820.1| Costars family protein ABRACL, partial [Merops nubicus]
Length=82

 Score = 98.2 bits (243),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +2

Query  53   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVV  232
            TMNVE E+  L EEI+RLG    DG   V FGVLF D++CAN+FEALVGTL+AAK+RK+V
Sbjct  1    TMNVEHEISLLVEEIQRLGTRNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIV  60

Query  233  AYDGELLLQGVHDNVEITL  289
            +Y+GELLLQGVHD+V+I L
Sbjct  61   SYEGELLLQGVHDSVDIRL  79



>ref|XP_004587333.1| PREDICTED: costars family protein ABRACL [Ochotona princeps]
Length=81

 Score = 97.8 bits (242),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKISVKFGVLFQDDKCANLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHD+V+ITL
Sbjct  61   YPGELLLQGVHDDVDITL  78



>ref|XP_009946947.1| PREDICTED: costars family protein ABRACL [Leptosomus discolor]
Length=81

 Score = 97.8 bits (242),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AAK+RK+V+
Sbjct  1    MNVEHEISLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVS  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHDNV+I L
Sbjct  61   YQGELLLQGVHDNVDIML  78



>ref|XP_005280433.1| PREDICTED: costars family protein ABRACL isoform X1 [Chrysemys 
picta bellii]
Length=127

 Score = 99.4 bits (246),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +2

Query  53   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVV  232
            TMNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AAK+RK+V
Sbjct  46   TMNVEHEINLLVEEIRRLGTKNADGKLSVKFGVLFADEKCANLFEALVGTLKAAKRRKIV  105

Query  233  AYDGELLLQGVHDNVEITL  289
             Y GELLLQGVHDNV+I L
Sbjct  106  TYPGELLLQGVHDNVDILL  124



>ref|XP_004550622.1| PREDICTED: costars family protein ABRACL-like [Maylandia zebra]
 ref|XP_005737337.1| PREDICTED: costars family protein ABRACL-like isoform X1 [Pundamilia 
nyererei]
 ref|XP_005931598.1| PREDICTED: costars family protein ABRACL-like [Haplochromis burtoni]
 ref|XP_006792768.1| PREDICTED: costars family protein ABRACL-like [Neolamprologus 
brichardi]
Length=81

 Score = 97.8 bits (242),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV  E++ L +EI+RLG +  DG   V FGVLFNDD+CANIFEALVGTL+AAKK+KV+ 
Sbjct  1    MNVSHEIDLLVQEIQRLGSKNADGKCSVKFGVLFNDDRCANIFEALVGTLKAAKKKKVID  60

Query  236  YDGELLLQGVHDNVEITL  289
            + GELLLQGVHDNV++ L
Sbjct  61   FQGELLLQGVHDNVDVIL  78



>ref|XP_007245508.1| PREDICTED: costars family protein ABRACL [Astyanax mexicanus]
Length=113

 Score = 98.6 bits (244),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVE EV  L EEI+RLG +  DG   V FGVLF+DD+CAN+FEALVGTL+AAK++KV+ 
Sbjct  33   MNVEHEVTLLVEEIRRLGSKNSDGKTSVKFGVLFSDDKCANLFEALVGTLKAAKRKKVIM  92

Query  236  YDGELLLQGVHDNVEITL  289
            ++GELLLQGVHDNV++ L
Sbjct  93   FEGELLLQGVHDNVDVIL  110



>gb|EDL03471.1| mCG7517, isoform CRA_a [Mus musculus]
 gb|EDL93764.1| rCG57402, isoform CRA_a [Rattus norvegicus]
Length=90

 Score = 97.8 bits (242),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = +2

Query  44   QTGTMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKR  223
            Q   MNVE EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+R
Sbjct  6    QRSAMNVEHEVNLLVEEIHRLGSKNADGKLSVKFGVLFQDDRCANLFEALVGTLKAAKRR  65

Query  224  KVVAYDGELLLQGVHDNVEITL  289
            K+V Y GELLLQGVHD+V+I L
Sbjct  66   KIVTYAGELLLQGVHDDVDIVL  87



>ref|XP_005509479.1| PREDICTED: costars family protein ABRACL [Columba livia]
Length=81

 Score = 97.8 bits (242),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVEHEISLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHDNV+I L
Sbjct  61   YPGELLLQGVHDNVDIML  78



>ref|XP_007649289.1| PREDICTED: costars family protein ABRACL isoform X1 [Cricetulus 
griseus]
 ref|XP_007631501.1| PREDICTED: costars family protein ABRACL isoform X1 [Cricetulus 
griseus]
Length=90

 Score = 97.8 bits (242),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = +2

Query  44   QTGTMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKR  223
            Q   MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+R
Sbjct  6    QCSAMNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFQDDRCANLFEALVGTLKAAKRR  65

Query  224  KVVAYDGELLLQGVHDNVEITL  289
            K+V Y GELLLQGVHD+V+I L
Sbjct  66   KIVTYTGELLLQGVHDDVDIVL  87



>gb|KFW11356.1| Costars family protein ABRACL, partial [Eurypyga helias]
Length=82

 Score = 97.8 bits (242),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +2

Query  53   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVV  232
            TMNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AAK+RK+V
Sbjct  1    TMNVEHEISLLVEEIRRLGTKNADGQMSVKFGVLFADEKCANLFEALVGTLKAAKRRKIV  60

Query  233  AYDGELLLQGVHDNVEITL  289
             Y GELLLQGVHD+V+I L
Sbjct  61   TYQGELLLQGVHDDVDIVL  79



>ref|XP_004628595.1| PREDICTED: costars family protein ABRACL [Octodon degus]
Length=81

 Score = 97.4 bits (241),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV+ EV  L EEI RLG +  DG + V FGVLF DD+CAN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKFSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHD+V+I L
Sbjct  61   YPGELLLQGVHDDVDIIL  78



>ref|XP_005230222.1| PREDICTED: costars family protein ABRACL [Falco peregrinus]
 ref|XP_005435855.1| PREDICTED: costars family protein ABRACL [Falco cherrug]
 ref|XP_009555782.1| PREDICTED: costars family protein ABRACL [Cuculus canorus]
 ref|XP_009880604.1| PREDICTED: costars family protein ABRACL [Charadrius vociferus]
 ref|XP_010115907.1| PREDICTED: costars family protein ABRACL [Chlamydotis macqueenii]
 sp|Q6V289.2|ABRAL_COTCO RecName: Full=Costars family protein ABRACL; AltName: Full=ABRA 
C-terminal-like protein [Coturnix coturnix]
Length=81

 Score = 97.4 bits (241),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVEHEISLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHDNV+I L
Sbjct  61   YQGELLLQGVHDNVDIVL  78



>ref|XP_004636782.1| PREDICTED: costars family protein ABRACL-like [Octodon degus]
Length=81

 Score = 97.4 bits (241),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV+ EV  L EEI RLG +  DG + V FGVLF DD+CAN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKFSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHD+V+I L
Sbjct  61   YSGELLLQGVHDDVDIIL  78



>ref|NP_001289105.1| costars family protein ABRACL [Gallus gallus]
 ref|XP_004935739.1| PREDICTED: costars family protein ABRACL isoform X2 [Gallus gallus]
 ref|XP_008634205.1| PREDICTED: costars family protein ABRACL [Corvus brachyrhynchos]
 ref|XP_008930603.1| PREDICTED: costars family protein ABRACL [Manacus vitellinus]
 ref|XP_009069395.1| PREDICTED: costars family protein ABRACL [Acanthisitta chloris]
 ref|XP_009091056.1| PREDICTED: costars family protein ABRACL [Serinus canaria]
 ref|XP_009279736.1| PREDICTED: costars family protein ABRACL [Aptenodytes forsteri]
 ref|XP_009317376.1| PREDICTED: costars family protein ABRACL [Pygoscelis adeliae]
 ref|XP_009458986.1| PREDICTED: costars family protein ABRACL [Nipponia nippon]
 ref|XP_009575376.1| PREDICTED: costars family protein ABRACL [Fulmarus glacialis]
 ref|XP_009642612.1| PREDICTED: costars family protein ABRACL [Egretta garzetta]
 ref|XP_009809147.1| PREDICTED: costars family protein ABRACL [Gavia stellata]
 ref|XP_009697257.1| PREDICTED: costars family protein ABRACL [Cariama cristata]
 ref|XP_009914680.1| PREDICTED: costars family protein ABRACL [Haliaeetus albicilla]
 ref|XP_010133216.1| PREDICTED: costars family protein ABRACL [Buceros rhinoceros 
silvestris]
 ref|XP_010082823.1| PREDICTED: costars family protein ABRACL [Pterocles gutturalis]
 ref|XP_010398175.1| PREDICTED: costars family protein ABRACL [Corvus cornix cornix]
 ref|XP_010398184.1| PREDICTED: costars family protein ABRACL [Corvus cornix cornix]
 ref|XP_010398192.1| PREDICTED: costars family protein ABRACL [Corvus cornix cornix]
 ref|XP_010572920.1| PREDICTED: costars family protein ABRACL [Haliaeetus leucocephalus]
 ref|XP_010572921.1| PREDICTED: costars family protein ABRACL [Haliaeetus leucocephalus]
Length=81

 Score = 97.4 bits (241),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVEHEISLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHDNV+I L
Sbjct  61   YQGELLLQGVHDNVDIML  78



>ref|XP_002197784.1| PREDICTED: costars family protein ABRACL [Taeniopygia guttata]
Length=81

 Score = 97.4 bits (241),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVEHEISLLVEEIRRLGAKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHDNV+I L
Sbjct  61   YQGELLLQGVHDNVDIML  78



>ref|XP_003340441.1| PREDICTED: costars family protein ABRACL [Monodelphis domestica]
Length=81

 Score = 97.4 bits (241),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVE E+  L EE++RLG    DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVEHEISLLVEEMQRLGTRGPDGKLSVKFGVLFQDDKCANLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHD+VEI L
Sbjct  61   YQGELLLQGVHDDVEIVL  78



>ref|XP_009909861.1| PREDICTED: costars family protein ABRACL [Picoides pubescens]
Length=81

 Score = 97.1 bits (240),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVEHEISLLVEEIRRLGTKNADGRVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y+GELLLQGVHDNV+I L
Sbjct  61   YNGELLLQGVHDNVDILL  78



>gb|KFQ49984.1| Costars family protein ABRACL, partial [Nestor notabilis]
Length=82

 Score = 97.1 bits (240),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +2

Query  53   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVV  232
            TMNVE EV  L EEI+RLG    DG   V FGVLF D++CAN+FEALVGTL+AAK+RK++
Sbjct  1    TMNVEHEVSLLVEEIRRLGTRNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKII  60

Query  233  AYDGELLLQGVHDNVEITL  289
            +Y GELLLQGVHD+V+I L
Sbjct  61   SYQGELLLQGVHDDVDIML  79



>ref|XP_009482515.1| PREDICTED: costars family protein ABRACL [Pelecanus crispus]
Length=81

 Score = 97.1 bits (240),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVE E+  L EEI+RLG    DG   V FGVLF D++CAN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVEHEISLLVEEIRRLGTRNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHDNV+I L
Sbjct  61   YQGELLLQGVHDNVDIVL  78



>ref|XP_005518508.1| PREDICTED: costars family protein ABRACL [Pseudopodoces humilis]
Length=81

 Score = 97.1 bits (240),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVE E+  L EEI+RLG    DG   V FGVLF D++CAN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVEHEISLLVEEIRRLGTRNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHDNV+I L
Sbjct  61   YQGELLLQGVHDNVDIML  78



>ref|XP_005017805.1| PREDICTED: costars family protein ABRACL [Anas platyrhynchos]
Length=81

 Score = 97.1 bits (240),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVE E+  L EEI+RLG    DG   V FGVLF D++CAN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVEHEITLLVEEIRRLGTRNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHDNV+I L
Sbjct  61   YQGELLLQGVHDNVDIVL  78



>ref|XP_009961435.1| PREDICTED: costars family protein ABRACL [Tyto alba]
Length=81

 Score = 97.1 bits (240),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVEHEISLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHDN++I L
Sbjct  61   YQGELLLQGVHDNIDIVL  78



>ref|XP_008820248.1| PREDICTED: costars family protein ABRACL [Nannospalax galili]
Length=81

 Score = 97.1 bits (240),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV+ EV  L EEI+RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVDHEVNLLVEEIQRLGSKNTDGKLSVKFGVLFQDDRCANLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHD+V+I L
Sbjct  61   YPGELLLQGVHDDVDIVL  78



>ref|XP_006112767.1| PREDICTED: costars family protein ABRACL [Pelodiscus sinensis]
Length=81

 Score = 97.1 bits (240),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVEHEINLLVEEIRRLGTKNADGKLSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHDNV+I L
Sbjct  61   YSGELLLQGVHDNVDILL  78



>ref|XP_005420151.1| PREDICTED: costars family protein ABRACL [Geospiza fortis]
Length=81

 Score = 97.1 bits (240),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AAK+RK++ 
Sbjct  1    MNVEHEISLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIIT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHDNV+I L
Sbjct  61   YQGELLLQGVHDNVDIML  78



>gb|KFQ75069.1| Costars family protein ABRACL, partial [Phoenicopterus ruber 
ruber]
Length=82

 Score = 97.1 bits (240),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = +2

Query  53   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVV  232
            TMNVE E+  L EEI+RLG +   G   V FGVLF D++CAN+FEALVGTL+AAK+RK+V
Sbjct  1    TMNVEHEISLLVEEIRRLGTKNAHGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIV  60

Query  233  AYDGELLLQGVHDNVEITL  289
             Y GELLLQGVHDNV+I L
Sbjct  61   TYQGELLLQGVHDNVDIML  79



>ref|XP_006885004.1| PREDICTED: costars family protein ABRACL [Elephantulus edwardii]
Length=81

 Score = 97.1 bits (240),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK+V+
Sbjct  1    MNVDHEVSLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVS  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHD+V+I L
Sbjct  61   YQGELLLQGVHDDVDIVL  78



>ref|XP_009876408.1| PREDICTED: costars family protein ABRACL [Apaloderma vittatum]
Length=81

 Score = 97.1 bits (240),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AAK+RK++ 
Sbjct  1    MNVEHEISLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIIT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHDNV+I L
Sbjct  61   YQGELLLQGVHDNVDIIL  78



>ref|XP_006020731.1| PREDICTED: costars family protein ABRACL isoform X1 [Alligator 
sinensis]
 ref|XP_006020732.1| PREDICTED: costars family protein ABRACL isoform X2 [Alligator 
sinensis]
 ref|XP_006020733.1| PREDICTED: costars family protein ABRACL isoform X3 [Alligator 
sinensis]
 ref|XP_006020734.1| PREDICTED: costars family protein ABRACL isoform X4 [Alligator 
sinensis]
 ref|XP_006267511.1| PREDICTED: costars family protein ABRACL isoform X1 [Alligator 
mississippiensis]
 ref|XP_006267512.1| PREDICTED: costars family protein ABRACL isoform X2 [Alligator 
mississippiensis]
 ref|XP_006267513.1| PREDICTED: costars family protein ABRACL isoform X3 [Alligator 
mississippiensis]
Length=81

 Score = 97.1 bits (240),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVEHEINLLIEEIRRLGTKNADGKMSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHDNV+I L
Sbjct  61   YPGELLLQGVHDNVDILL  78



>ref|XP_009687214.1| PREDICTED: costars family protein ABRACL isoform X2 [Struthio 
camelus australis]
 ref|XP_009687215.1| PREDICTED: costars family protein ABRACL isoform X2 [Struthio 
camelus australis]
Length=81

 Score = 97.1 bits (240),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVE E+  L EEI+RLG    DG   V FGVLF D++CAN+FEALVGTL+AAK+RK+V+
Sbjct  1    MNVEHEINLLVEEIQRLGTRNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVS  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHDNV+I L
Sbjct  61   YQGELLLQGVHDNVDIML  78



>ref|XP_004368930.1| PREDICTED: costars family protein ABRACL [Trichechus manatus 
latirostris]
Length=81

 Score = 96.7 bits (239),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK+V+
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVS  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHD+V+I L
Sbjct  61   YPGELLLQGVHDDVDIVL  78



>ref|XP_001640937.1| predicted protein [Nematostella vectensis]
 sp|A7RHL5.1|COSA_NEMVE RecName: Full=Costars family protein v1g158749 [Nematostella 
vectensis]
 gb|EDO48874.1| predicted protein [Nematostella vectensis]
Length=82

 Score = 96.7 bits (239),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVE EV+ L EE+KRLG+   D    V FGVLFNDD+CANIFEALVGTL+AAK++K+V 
Sbjct  1    MNVEHEVKLLVEELKRLGQPNSDDKIVVKFGVLFNDDRCANIFEALVGTLKAAKRKKIVH  60

Query  236  YDGELLLQGVHDNVEITL  289
            YD ELLLQGVHD+V+I L
Sbjct  61   YDSELLLQGVHDHVDIVL  78



>ref|XP_005280434.1| PREDICTED: costars family protein ABRACL isoform X2 [Chrysemys 
picta bellii]
 ref|XP_005280435.1| PREDICTED: costars family protein ABRACL isoform X2 [Chrysemys 
picta bellii]
Length=81

 Score = 96.7 bits (239),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVEHEINLLVEEIRRLGTKNADGKLSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHDNV+I L
Sbjct  61   YPGELLLQGVHDNVDILL  78



>ref|XP_004609058.1| PREDICTED: costars family protein ABRACL [Sorex araneus]
Length=81

 Score = 96.7 bits (239),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAKKRK+V 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKKRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHD+V+I L
Sbjct  61   YTGELLLQGVHDDVDIVL  78



>ref|XP_003986651.1| PREDICTED: costars family protein ABRACL [Felis catus]
 ref|XP_006932115.1| PREDICTED: costars family protein ABRACL [Felis catus]
 ref|XP_007096440.1| PREDICTED: costars family protein ABRACL isoform X1 [Panthera 
tigris altaica]
 ref|XP_007096441.1| PREDICTED: costars family protein ABRACL isoform X2 [Panthera 
tigris altaica]
Length=81

 Score = 96.7 bits (239),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+RKVV 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFQDDKCANLFEALVGTLKAAKRRKVVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHD+V+I L
Sbjct  61   YPGELLLQGVHDDVDIVL  78



>gb|EPQ03269.1| hypothetical protein D623_10035727 [Myotis brandtii]
Length=90

 Score = 97.1 bits (240),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 62/81 (77%), Gaps = 0/81 (0%)
 Frame = +2

Query  47   TGTMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRK  226
               MNVE EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK
Sbjct  7    VAAMNVEHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRK  66

Query  227  VVAYDGELLLQGVHDNVEITL  289
            +V Y GELLLQGVHD+V+I L
Sbjct  67   IVTYPGELLLQGVHDDVDIIL  87



>ref|XP_002817467.1| PREDICTED: costars family protein ABRACL [Pongo abelii]
Length=81

 Score = 96.7 bits (239),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV+ EV  L EEI RLG +  DG   V FGVLF+DD+CAN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFHDDKCANLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHD+V+I L
Sbjct  61   YPGELLLQGVHDDVDIIL  78



>ref|XP_001513946.1| PREDICTED: costars family protein ABRACL [Ornithorhynchus anatinus]
Length=81

 Score = 96.7 bits (239),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVE E++ L EEI+RLGK   DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVEHEIDLLVEEIRRLGKRGADGKLSVKFGVLFLDDRCANLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHDN +I L
Sbjct  61   YQGELLLQGVHDNTDIVL  78



>ref|XP_005329869.1| PREDICTED: costars family protein ABRACL [Ictidomys tridecemlineatus]
Length=81

 Score = 96.7 bits (239),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+RKVV 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFQDDKCANLFEALVGTLKAAKRRKVVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHD+V+I L
Sbjct  61   YPGELLLQGVHDDVDIIL  78



>ref|XP_005065907.1| PREDICTED: costars family protein ABRACL [Mesocricetus auratus]
Length=81

 Score = 96.7 bits (239),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVDHEVSLLVEEIHRLGSKNADGKLSVKFGVLFRDDRCANLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHD+V+I L
Sbjct  61   YSGELLLQGVHDDVDIVL  78



>ref|XP_009996826.1| PREDICTED: costars family protein ABRACL [Chaetura pelagica]
Length=81

 Score = 96.7 bits (239),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVEHEISLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVN  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHDNV+I L
Sbjct  61   YQGELLLQGVHDNVDIML  78



>ref|XP_008492282.1| PREDICTED: costars family protein ABRACL [Calypte anna]
Length=81

 Score = 96.7 bits (239),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +2

Query  95   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVAYDGELLLQGVHDN  274
            I+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AAK+RK+V Y GELLLQGVHDN
Sbjct  14   IRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVTYQGELLLQGVHDN  73

Query  275  VEITL  289
            V+I L
Sbjct  74   VDIML  78



>ref|XP_004083943.1| PREDICTED: costars family protein ABRACL [Oryzias latipes]
Length=81

 Score = 96.3 bits (238),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +2

Query  95   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVAYDGELLLQGVHDN  274
            I+RLG +   G   V FGVLFNDD+CANIFEALVGTL+AAKKRKV+++  ELLLQGVHD+
Sbjct  14   IQRLGSKNASGQTSVKFGVLFNDDRCANIFEALVGTLKAAKKRKVISFQSELLLQGVHDD  73

Query  275  VEITL  289
            V+I L
Sbjct  74   VDIVL  78



>ref|XP_005489295.1| PREDICTED: costars family protein ABRACL isoform X1 [Zonotrichia 
albicollis]
 ref|XP_005489296.1| PREDICTED: costars family protein ABRACL isoform X2 [Zonotrichia 
albicollis]
 ref|XP_005489297.1| PREDICTED: costars family protein ABRACL isoform X3 [Zonotrichia 
albicollis]
Length=81

 Score = 96.3 bits (238),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AAK+RK++ 
Sbjct  1    MNVEHEINLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIIT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHDNV+I L
Sbjct  61   YQGELLLQGVHDNVDIML  78



>ref|XP_008005040.1| PREDICTED: costars family protein ABRACL isoform X2 [Chlorocebus 
sabaeus]
Length=109

 Score = 97.1 bits (240),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = +2

Query  44   QTGTMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKR  223
            +   MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+R
Sbjct  25   RMAAMNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRR  84

Query  224  KVVAYDGELLLQGVHDNVEITL  289
            K+V Y GELLLQGVHD+V+I L
Sbjct  85   KIVTYSGELLLQGVHDDVDIVL  106



>ref|XP_008689265.1| PREDICTED: costars family protein ABRACL [Ursus maritimus]
Length=203

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  32   RNRHQTGTMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRA  211
            R +  +  MNV+ E+  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+A
Sbjct  115  RKKGGSAAMNVDHEINLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKA  174

Query  212  AKKRKVVAYDGELLLQGVHDNVEITL  289
            AK+RK+V Y GELLLQGVHD+V+I L
Sbjct  175  AKRRKIVTYPGELLLQGVHDDVDIIL  200



>ref|XP_006834682.1| PREDICTED: costars family protein ABRACL [Chrysochloris asiatica]
Length=81

 Score = 96.3 bits (238),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFQDDKCANLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHD+V+I L
Sbjct  61   YPGELLLQGVHDDVDIVL  78



>ref|XP_008516613.1| PREDICTED: costars family protein ABRACL [Equus przewalskii]
Length=95

 Score = 96.7 bits (239),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +2

Query  50   GTMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKV  229
              MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK+
Sbjct  13   AAMNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKI  72

Query  230  VAYDGELLLQGVHDNVEITL  289
            V Y GELLLQGVHD+V+I L
Sbjct  73   VTYPGELLLQGVHDDVDIIL  92



>ref|XP_004702032.1| PREDICTED: costars family protein ABRACL [Echinops telfairi]
Length=81

 Score = 96.3 bits (238),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKISVKFGVLFQDDKCANLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHD+V+I L
Sbjct  61   YSGELLLQGVHDDVDIVL  78



>ref|XP_005859127.1| PREDICTED: costars family protein ABRACL [Myotis brandtii]
 ref|XP_006084472.1| PREDICTED: costars family protein ABRACL [Myotis lucifugus]
 ref|XP_008160128.1| PREDICTED: costars family protein ABRACL [Eptesicus fuscus]
Length=81

 Score = 96.3 bits (238),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVE EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVEHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHD+V+I L
Sbjct  61   YPGELLLQGVHDDVDIIL  78



>ref|XP_002912685.1| PREDICTED: costars family protein ABRACL [Ailuropoda melanoleuca]
Length=81

 Score = 96.3 bits (238),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVE E+  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVEHEINLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHD+V+I L
Sbjct  61   YPGELLLQGVHDDVDIIL  78



>ref|NP_001180288.1| uncharacterized protein LOC708266 [Macaca mulatta]
 ref|XP_003898153.1| PREDICTED: costars family protein ABRACL [Papio anubis]
 ref|XP_005552041.1| PREDICTED: costars family protein ABRACL [Macaca fascicularis]
 ref|XP_008005042.1| PREDICTED: costars family protein ABRACL isoform X3 [Chlorocebus 
sabaeus]
 ref|XP_010377821.1| PREDICTED: costars family protein ABRACL [Rhinopithecus roxellana]
 gb|EHH18651.1| hypothetical protein EGK_15299 [Macaca mulatta]
 gb|EHH53346.1| hypothetical protein EGM_13967 [Macaca fascicularis]
Length=81

 Score = 96.3 bits (238),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHD+V+I L
Sbjct  61   YSGELLLQGVHDDVDIVL  78



>ref|XP_007058144.1| PREDICTED: costars family protein ABRACL [Chelonia mydas]
 gb|EMP37425.1| hypothetical protein UY3_05406 [Chelonia mydas]
Length=81

 Score = 96.3 bits (238),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVEHEINLLVEEIRRLGTKNADGKLSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHDNV++ L
Sbjct  61   YPGELLLQGVHDNVDVLL  78



>ref|XP_004442153.1| PREDICTED: costars family protein ABRACL [Ceratotherium simum 
simum]
 ref|XP_005389320.1| PREDICTED: costars family protein ABRACL isoform X2 [Chinchilla 
lanigera]
 ref|XP_005389321.1| PREDICTED: costars family protein ABRACL isoform X3 [Chinchilla 
lanigera]
Length=81

 Score = 96.3 bits (238),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFQDDKCANLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHD+V+I L
Sbjct  61   YPGELLLQGVHDDVDIIL  78



>ref|XP_010182672.1| PREDICTED: costars family protein ABRACL [Mesitornis unicolor]
Length=81

 Score = 96.3 bits (238),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVEHEIGLLVEEIRRLGTKNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHDN++I L
Sbjct  61   YQGELLLQGVHDNIDIML  78



>ref|XP_008945039.1| PREDICTED: costars family protein ABRACL [Merops nubicus]
Length=81

 Score = 96.3 bits (238),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVE E+  L EEI+RLG    DG   V FGVLF D++CAN+FEALVGTL+AAK+RK+V+
Sbjct  1    MNVEHEISLLVEEIQRLGTRNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVS  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y+GELLLQGVHD+V+I L
Sbjct  61   YEGELLLQGVHDSVDIRL  78



>ref|XP_003404025.1| PREDICTED: costars family protein ABRACL [Loxodonta africana]
 ref|XP_003732795.1| PREDICTED: costars family protein ABRACL [Callithrix jacchus]
 ref|XP_008993414.1| PREDICTED: costars family protein ABRACL [Callithrix jacchus]
 ref|XP_010335859.1| PREDICTED: costars family protein ABRACL [Saimiri boliviensis 
boliviensis]
Length=81

 Score = 95.9 bits (237),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHD+V+I L
Sbjct  61   YPGELLLQGVHDDVDIVL  78



>ref|XP_006986145.1| PREDICTED: costars family protein ABRACL isoform X1 [Peromyscus 
maniculatus bairdii]
 ref|XP_006986146.1| PREDICTED: costars family protein ABRACL isoform X2 [Peromyscus 
maniculatus bairdii]
 ref|XP_006986147.1| PREDICTED: costars family protein ABRACL isoform X3 [Peromyscus 
maniculatus bairdii]
Length=81

 Score = 95.9 bits (237),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV+ EV  L EEI+RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVDHEVNLLVEEIQRLGSKNADGKLSVKFGVLFRDDRCANLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHD+V+I L
Sbjct  61   YTGELLLQGVHDDVDIVL  78



>ref|NP_001160033.1| costars family protein ABRACL [Bos taurus]
 ref|XP_004011429.1| PREDICTED: costars family protein ABRACL [Ovis aries]
 ref|XP_005211043.1| PREDICTED: costars family protein ABRACL isoform X1 [Bos taurus]
 ref|XP_005684871.1| PREDICTED: costars family protein ABRACL [Capra hircus]
 ref|XP_005892019.1| PREDICTED: costars family protein ABRACL [Bos mutus]
 ref|XP_006074720.1| PREDICTED: costars family protein ABRACL isoform X1 [Bubalus 
bubalis]
 ref|XP_006074721.1| PREDICTED: costars family protein ABRACL isoform X2 [Bubalus 
bubalis]
 ref|XP_010842515.1| PREDICTED: costars family protein ABRACL [Bison bison bison]
 sp|Q3ZBN0.1|ABRAL_BOVIN RecName: Full=Costars family protein ABRACL; AltName: Full=ABRA 
C-terminal-like protein [Bos taurus]
 gb|AAI03207.1| C9H6ORF115 protein [Bos taurus]
 tpg|DAA26078.1| TPA: hypothetical protein LOC505914 [Bos taurus]
 gb|ELR59097.1| hypothetical protein M91_20305 [Bos mutus]
Length=81

 Score = 95.9 bits (237),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV+ EV+ L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK++ 
Sbjct  1    MNVDHEVKLLVEEIHRLGSKNADGKLSVKFGVLFQDDKCANLFEALVGTLKAAKRRKIIT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHD+V+I L
Sbjct  61   YSGELLLQGVHDDVDIIL  78



>ref|XP_005973408.1| PREDICTED: costars family protein ABRACL [Pantholops hodgsonii]
Length=81

 Score = 95.9 bits (237),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV+ EV+ L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK++ 
Sbjct  1    MNVDHEVKLLVEEIHRLGSKNADGKLSVKFGVLFQDDKCANLFEALVGTLKAAKRRKIIT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHD+V+I L
Sbjct  61   YSGELLLQGVHDDVDIIL  78



>ref|XP_006915428.1| PREDICTED: costars family protein ABRACL [Pteropus alecto]
 ref|XP_011354447.1| PREDICTED: costars family protein ABRACL [Pteropus vampyrus]
 gb|ELK09672.1| hypothetical protein PAL_GLEAN10014030 [Pteropus alecto]
Length=81

 Score = 95.9 bits (237),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHD+V+I L
Sbjct  61   YSGELLLQGVHDDVDIIL  78



>ref|XP_004410330.1| PREDICTED: costars family protein ABRACL [Odobenus rosmarus divergens]
 ref|XP_004740371.1| PREDICTED: costars family protein ABRACL [Mustela putorius furo]
 ref|XP_004789047.1| PREDICTED: costars family protein ABRACL [Mustela putorius furo]
 ref|XP_006731712.1| PREDICTED: costars family protein ABRACL [Leptonychotes weddellii]
Length=81

 Score = 95.9 bits (237),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV+ E+  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVDHEINLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHD+V+I L
Sbjct  61   YPGELLLQGVHDDVDIIL  78



>ref|NP_001093117.1| costars family protein ABRACL [Rattus norvegicus]
 sp|Q4KML4.1|ABRAL_MOUSE RecName: Full=Costars family protein ABRACL; AltName: Full=ABRA 
C-terminal-like protein [Mus musculus]
 gb|AAH98509.1| 3110003A17Rik protein [Mus musculus]
 dbj|BAE42271.1| unnamed protein product [Mus musculus]
 gb|EDL03474.1| mCG7517, isoform CRA_d [Mus musculus]
 gb|EDL93765.1| rCG57402, isoform CRA_b [Rattus norvegicus]
 gb|ACD47057.1| ASL1/3110003A17Rik fusion protein [Mus musculus]
Length=81

 Score = 95.9 bits (237),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVE EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVEHEVNLLVEEIHRLGSKNADGKLSVKFGVLFQDDRCANLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHD+V+I L
Sbjct  61   YAGELLLQGVHDDVDIVL  78



>ref|NP_067066.1| costars family protein ABRACL [Homo sapiens]
 ref|XP_003255842.1| PREDICTED: costars family protein ABRACL isoform 1 [Nomascus 
leucogenys]
 ref|XP_001159255.2| PREDICTED: costars family protein ABRACL [Pan troglodytes]
 ref|XP_003365779.1| PREDICTED: costars family protein ABRACL [Equus caballus]
 ref|XP_003790329.1| PREDICTED: costars family protein ABRACL [Otolemur garnettii]
 ref|XP_003827759.1| PREDICTED: costars family protein ABRACL [Pan paniscus]
 ref|XP_004044801.1| PREDICTED: costars family protein ABRACL isoform 1 [Gorilla gorilla 
gorilla]
 ref|XP_004044802.1| PREDICTED: costars family protein ABRACL isoform 2 [Gorilla gorilla 
gorilla]
 ref|XP_004880934.1| PREDICTED: costars family protein ABRACL isoform X1 [Heterocephalus 
glaber]
 ref|XP_004880935.1| PREDICTED: costars family protein ABRACL isoform X2 [Heterocephalus 
glaber]
 ref|XP_004846113.1| PREDICTED: costars family protein ABRACL isoform X1 [Heterocephalus 
glaber]
 ref|XP_004846114.1| PREDICTED: costars family protein ABRACL isoform X2 [Heterocephalus 
glaber]
 ref|XP_008563765.1| PREDICTED: costars family protein ABRACL [Galeopterus variegatus]
 ref|XP_009450382.1| PREDICTED: costars family protein ABRACL [Pan troglodytes]
 sp|Q9P1F3.1|ABRAL_HUMAN RecName: Full=Costars family protein ABRACL; AltName: Full=ABRA 
C-terminal-like protein [Homo sapiens]
 gb|AAF71102.1|AF116721_82 PRO2013 [Homo sapiens]
 gb|AAH14953.1| C6orf115 protein [Homo sapiens]
 gb|EAW47902.1| hCG1640751 [Homo sapiens]
 gb|EHB00646.1| hypothetical protein GW7_00275 [Heterocephalus glaber]
Length=81

 Score = 95.9 bits (237),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHD+V+I L
Sbjct  61   YPGELLLQGVHDDVDIIL  78



>gb|EDL03473.1| mCG7517, isoform CRA_c [Mus musculus]
Length=132

 Score = 97.4 bits (241),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = +2

Query  53   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVV  232
             MNVE EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK+V
Sbjct  51   AMNVEHEVNLLVEEIHRLGSKNADGKLSVKFGVLFQDDRCANLFEALVGTLKAAKRRKIV  110

Query  233  AYDGELLLQGVHDNVEITL  289
             Y GELLLQGVHD+V+I L
Sbjct  111  TYAGELLLQGVHDDVDIVL  129



>ref|XP_003465701.1| PREDICTED: costars family protein ABRACL isoform X1 [Cavia porcellus]
 ref|XP_005001887.1| PREDICTED: costars family protein ABRACL isoform X2 [Cavia porcellus]
Length=81

 Score = 95.9 bits (237),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGRLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHD+V+I L
Sbjct  61   YPGELLLQGVHDDVDIVL  78



>ref|XP_010156542.1| PREDICTED: costars family protein ABRACL [Eurypyga helias]
Length=81

 Score = 95.9 bits (237),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVE E+  L EEI+RLG +  DG   V FGVLF D++CAN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVEHEISLLVEEIRRLGTKNADGQMSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHD+V+I L
Sbjct  61   YQGELLLQGVHDDVDIVL  78



>ref|XP_004673954.1| PREDICTED: costars family protein ABRACL [Condylura cristata]
 ref|XP_004683317.1| PREDICTED: costars family protein ABRACL-like [Condylura cristata]
Length=81

 Score = 95.9 bits (237),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHD+V+I L
Sbjct  61   YQGELLLQGVHDDVDIVL  78



>ref|XP_010624898.1| PREDICTED: costars family protein ABRACL [Fukomys damarensis]
Length=81

 Score = 95.9 bits (237),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHD+V+I L
Sbjct  61   YPGELLLQGVHDDVDIIL  78



>gb|AAH39801.1| 3110003A17Rik protein, partial [Mus musculus]
Length=104

 Score = 96.3 bits (238),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +2

Query  50   GTMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKV  229
              MNVE EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK+
Sbjct  22   SAMNVEHEVNLLVEEIHRLGSKNADGKLSVKFGVLFQDDRCANLFEALVGTLKAAKRRKI  81

Query  230  VAYDGELLLQGVHDNVEITL  289
            V Y GELLLQGVHD+V+I L
Sbjct  82   VTYAGELLLQGVHDDVDIVL  101



>ref|XP_008005039.1| PREDICTED: costars family protein ABRACL isoform X1 [Chlorocebus 
sabaeus]
Length=157

 Score = 97.8 bits (242),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 68/93 (73%), Gaps = 3/93 (3%)
 Frame = +2

Query  11   DNLQFCVRNRHQTGTMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEA  190
            DNL F   ++     MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEA
Sbjct  65   DNLDFFFLSQ---AAMNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEA  121

Query  191  LVGTLRAAKKRKVVAYDGELLLQGVHDNVEITL  289
            LVGTL+AAK+RK+V Y GELLLQGVHD+V+I L
Sbjct  122  LVGTLKAAKRRKIVTYSGELLLQGVHDDVDIVL  154



>ref|XP_003121220.1| PREDICTED: costars family protein ABRACL isoformX2 [Sus scrofa]
Length=86

 Score = 95.9 bits (237),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +2

Query  50   GTMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKV  229
              MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK+
Sbjct  4    AAMNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKI  63

Query  230  VAYDGELLLQGVHDNVEITL  289
            + Y GELLLQGVHD+V+I L
Sbjct  64   ITYPGELLLQGVHDDVDIIL  83



>gb|AAF28958.1|AF161398_1 HSPC280 [Homo sapiens]
Length=141

 Score = 97.4 bits (241),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +2

Query  50   GTMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKV  229
              MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK+
Sbjct  59   AAMNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKI  118

Query  230  VAYDGELLLQGVHDNVEITL  289
            V Y GELLLQGVHD+V+I L
Sbjct  119  VTYPGELLLQGVHDDVDIIL  138



>ref|XP_004459985.1| PREDICTED: costars family protein ABRACL isoform 2 [Dasypus novemcinctus]
Length=84

 Score = 95.9 bits (237),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +2

Query  50   GTMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKV  229
              MNV+ EV  L EE+ RLG    DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK+
Sbjct  2    AAMNVDHEVSLLVEEMHRLGSRNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKI  61

Query  230  VAYDGELLLQGVHDNVEITL  289
            V Y GELLLQGVHD+V+I L
Sbjct  62   VTYPGELLLQGVHDDVDIVL  81



>ref|XP_007944483.1| PREDICTED: costars family protein ABRACL [Orycteropus afer afer]
Length=81

 Score = 95.5 bits (236),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV+ EV  L EEI RLG +  DG   V FG+LF DD+CAN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGILFRDDKCANLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHD+V+I L
Sbjct  61   YPGELLLQGVHDDVDIVL  78



>ref|XP_006188561.1| PREDICTED: costars family protein ABRACL [Camelus ferus]
 ref|XP_010963945.1| PREDICTED: costars family protein ABRACL [Camelus bactrianus]
 ref|XP_010963946.1| PREDICTED: costars family protein ABRACL [Camelus bactrianus]
 ref|XP_010981993.1| PREDICTED: costars family protein ABRACL [Camelus dromedarius]
 ref|XP_010981994.1| PREDICTED: costars family protein ABRACL [Camelus dromedarius]
 gb|EQB78760.1| costars family protein [Camelus ferus]
Length=81

 Score = 95.5 bits (236),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK++ 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFQDDKCANLFEALVGTLKAAKRRKIIM  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHD+V+I L
Sbjct  61   YPGELLLQGVHDDVDIVL  78



>ref|XP_003496586.1| PREDICTED: costars family protein ABRACL isoform X2 [Cricetulus 
griseus]
 ref|XP_007649294.1| PREDICTED: costars family protein ABRACL isoform X2 [Cricetulus 
griseus]
 ref|XP_007631502.1| PREDICTED: costars family protein ABRACL isoform X2 [Cricetulus 
griseus]
 ref|XP_007631503.1| PREDICTED: costars family protein ABRACL isoform X2 [Cricetulus 
griseus]
Length=81

 Score = 95.5 bits (236),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFQDDRCANLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHD+V+I L
Sbjct  61   YTGELLLQGVHDDVDIVL  78



>gb|KFW92191.1| Costars family protein ABRACL, partial [Phalacrocorax carbo]
Length=82

 Score = 95.5 bits (236),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +2

Query  53   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVV  232
            TMNVE E+  L EEI+RLG +  +G   V FGVLF D++CAN+FEALVGTL+AAK+RK+V
Sbjct  1    TMNVEHEISLLVEEIRRLGTKNANGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIV  60

Query  233  AYDGELLLQGVHDNVEITL  289
             Y GELLLQGVHD+V+I L
Sbjct  61   TYQGELLLQGVHDDVDIML  79



>ref|XP_003353243.1| PREDICTED: costars family protein ABRACL isoform X3 [Sus scrofa]
 ref|XP_003353244.1| PREDICTED: costars family protein ABRACL isoform X4 [Sus scrofa]
Length=81

 Score = 95.5 bits (236),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK++ 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIIT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHD+V+I L
Sbjct  61   YPGELLLQGVHDDVDIIL  78



>gb|KFO32243.1| hypothetical protein H920_06346 [Fukomys damarensis]
Length=100

 Score = 95.9 bits (237),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +2

Query  95   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVAYDGELLLQGVHDN  274
            I RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK+V Y GELLLQGVHD+
Sbjct  33   IHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVTYPGELLLQGVHDD  92

Query  275  VEITL  289
            V+I L
Sbjct  93   VDIIL  97



>ref|XP_005389319.1| PREDICTED: costars family protein ABRACL isoform X1 [Chinchilla 
lanigera]
Length=99

 Score = 95.9 bits (237),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = +2

Query  53   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVV  232
             MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK+V
Sbjct  18   IMNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFQDDKCANLFEALVGTLKAAKRRKIV  77

Query  233  AYDGELLLQGVHDNVEITL  289
             Y GELLLQGVHD+V+I L
Sbjct  78   TYPGELLLQGVHDDVDIIL  96



>ref|XP_533427.3| PREDICTED: costars family protein ABRACL [Canis lupus familiaris]
Length=81

 Score = 95.5 bits (236),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHD+V+I L
Sbjct  61   YTGELLLQGVHDDVDIIL  78



>ref|NP_082716.1| costars family protein ABRACL [Mus musculus]
 ref|XP_011241512.1| PREDICTED: costars family protein ABRACL isoform X1 [Mus musculus]
Length=81

 Score = 95.5 bits (236),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVE EV  L EEI RLG    DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVEHEVNLLVEEIHRLGSRNADGKLSVKFGVLFQDDRCANLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHD+V+I L
Sbjct  61   YAGELLLQGVHDDVDIVL  78



>ref|XP_005805218.1| PREDICTED: costars family protein ABRACL-like [Xiphophorus maculatus]
Length=81

 Score = 95.5 bits (236),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV  E+  L EEI+RLG + D G   V FGVLF+DD+CANIFEALVGTL+AAKK+K++ 
Sbjct  1    MNVSHEISLLVEEIQRLGCKNDKGQTSVKFGVLFSDDRCANIFEALVGTLKAAKKQKIID  60

Query  236  YDGELLLQGVHDNVEITL  289
            + GELLLQGVHDNV++ L
Sbjct  61   FQGELLLQGVHDNVDVVL  78



>ref|XP_010013288.1| PREDICTED: costars family protein ABRACL [Nestor notabilis]
Length=81

 Score = 95.5 bits (236),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVE EV  L EEI+RLG    DG   V FGVLF D++CAN+FEALVGTL+AAK+RK+++
Sbjct  1    MNVEHEVSLLVEEIRRLGTRNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIIS  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHD+V+I L
Sbjct  61   YQGELLLQGVHDDVDIML  78



>ref|XP_006151148.1| PREDICTED: costars family protein ABRACL [Tupaia chinensis]
 gb|ELW64180.1| hypothetical protein TREES_T100019446 [Tupaia chinensis]
Length=81

 Score = 95.5 bits (236),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDRCANLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHD+V+I L
Sbjct  61   YTGELLLQGVHDDVDIIL  78



>ref|XP_007191007.1| PREDICTED: costars family protein ABRACL isoform X1 [Balaenoptera 
acutorostrata scammoni]
Length=84

 Score = 95.5 bits (236),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +2

Query  50   GTMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKV  229
              MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK+
Sbjct  2    AAMNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKM  61

Query  230  VAYDGELLLQGVHDNVEITL  289
            + Y GELLLQGVHD+V+I L
Sbjct  62   ITYPGELLLQGVHDDVDIIL  81



>ref|XP_001764433.1| predicted protein [Physcomitrella patens]
 gb|EDQ70700.1| predicted protein, partial [Physcomitrella patens]
Length=79

 Score = 95.1 bits (235),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +2

Query  95   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVAYDGELLLQGVHDN  274
            I RLG +  DGS  V FG LFND++CANIFEALVGTLRAAKKRK+V ++ E+L QGVH+N
Sbjct  14   IVRLGTKNADGSITVKFGTLFNDERCANIFEALVGTLRAAKKRKIVTFNSEMLFQGVHNN  73

Query  275  VEITL  289
            V+I L
Sbjct  74   VDIVL  78



>ref|XP_006197837.1| PREDICTED: costars family protein ABRACL [Vicugna pacos]
Length=81

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK++ 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFQDDKCANLFEALVGTLKAAKRRKIIT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHD+V+I L
Sbjct  61   YAGELLLQGVHDDVDIVL  78



>ref|XP_007531554.1| PREDICTED: costars family protein ABRACL [Erinaceus europaeus]
Length=81

 Score = 94.7 bits (234),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +2

Query  95   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVAYDGELLLQGVHDN  274
            I RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK+V Y GELLLQGVHD+
Sbjct  14   IHRLGSKNADGKLSVKFGVLFGDDRCANLFEALVGTLKAAKRRKIVMYKGELLLQGVHDD  73

Query  275  VEITL  289
            V+I L
Sbjct  74   VDIIL  78



>ref|XP_004459984.1| PREDICTED: costars family protein ABRACL isoform 1 [Dasypus novemcinctus]
Length=99

 Score = 95.5 bits (236),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +2

Query  50   GTMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKV  229
              MNV+ EV  L EE+ RLG    DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK+
Sbjct  17   AAMNVDHEVSLLVEEMHRLGSRNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKI  76

Query  230  VAYDGELLLQGVHDNVEITL  289
            V Y GELLLQGVHD+V+I L
Sbjct  77   VTYPGELLLQGVHDDVDIVL  96



>ref|XP_006776246.1| PREDICTED: uncharacterized protein LOC102758438 [Myotis davidii]
Length=265

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +2

Query  95   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVAYDGELLLQGVHDN  274
            I RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK+V Y GELLLQGVHD+
Sbjct  198  IHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVTYPGELLLQGVHDD  257

Query  275  VEITL  289
            V+I L
Sbjct  258  VDIIL  262



>ref|XP_007191008.1| PREDICTED: costars family protein ABRACL isoform X2 [Balaenoptera 
acutorostrata scammoni]
 ref|XP_007191009.1| PREDICTED: costars family protein ABRACL isoform X3 [Balaenoptera 
acutorostrata scammoni]
Length=81

 Score = 94.7 bits (234),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK++ 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKMIT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHD+V+I L
Sbjct  61   YPGELLLQGVHDDVDIIL  78



>ref|XP_007101089.1| PREDICTED: costars family protein ABRACL [Physeter catodon]
Length=81

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +2

Query  95   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVAYDGELLLQGVHDN  274
            I RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK++ Y GELLLQGVHD+
Sbjct  14   IHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKMITYPGELLLQGVHDD  73

Query  275  VEITL  289
            V+I L
Sbjct  74   VDIIL  78



>ref|XP_007467653.1| PREDICTED: costars family protein ABRACL [Lipotes vexillifer]
Length=81

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV+ EV+ L EEI RLG    DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK++ 
Sbjct  1    MNVDHEVKLLVEEIHRLGSRNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKMIT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHD+V+I L
Sbjct  61   YPGELLLQGVHDDVDIIL  78



>gb|ERE84208.1| putative costars family protein [Cricetulus griseus]
Length=154

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +2

Query  95   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVAYDGELLLQGVHDN  274
            I RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK+V Y GELLLQGVHD+
Sbjct  87   IHRLGSKNADGKLSVKFGVLFQDDRCANLFEALVGTLKAAKRRKIVTYTGELLLQGVHDD  146

Query  275  VEITL  289
            V+I L
Sbjct  147  VDIVL  151



>gb|EHB16825.1| hypothetical protein GW7_19800 [Heterocephalus glaber]
Length=81

 Score = 94.4 bits (233),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV  EV  L EEI RLG +  DG   V FGVLF DD+C N+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVNHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCTNLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHD+V+I L
Sbjct  61   YPGELLLQGVHDDVDIML  78



>ref|XP_004263816.1| PREDICTED: costars family protein ABRACL [Orcinus orca]
 ref|XP_004328615.1| PREDICTED: costars family protein ABRACL-like [Tursiops truncatus]
Length=81

 Score = 94.4 bits (233),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV+ EV  L EEI RLG    DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK++ 
Sbjct  1    MNVDHEVNLLVEEIHRLGSRNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKMIT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHD+V+I L
Sbjct  61   YPGELLLQGVHDDVDIIL  78



>ref|XP_005154833.1| PREDICTED: costars family protein ABRACL [Melopsittacus undulatus]
Length=81

 Score = 94.0 bits (232),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVE EV  L EEI+RLG    DG   V FGVLF D++CAN+FEALVGTL+AAK+RK++ 
Sbjct  1    MNVEHEVNLLVEEIRRLGTRNADGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIIT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHD+V+I L
Sbjct  61   YQGELLLQGVHDDVDIML  78



>ref|XP_007909195.1| PREDICTED: costars family protein ABRACL [Callorhinchus milii]
 ref|XP_007909196.1| PREDICTED: costars family protein ABRACL [Callorhinchus milii]
 ref|XP_007909197.1| PREDICTED: costars family protein ABRACL [Callorhinchus milii]
 gb|AFK11444.1| hypothetical protein [Callorhinchus milii]
Length=81

 Score = 94.0 bits (232),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVE EV  L EEI+RLG    DG   V FGVLF DD+CAN+FEALVGTLRAAK++K++ 
Sbjct  1    MNVENEVNLLVEEIRRLGAPGVDGKITVKFGVLFADDKCANLFEALVGTLRAAKRKKIIM  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y+GE+LLQG HDNV+I L
Sbjct  61   YEGEMLLQGSHDNVDIVL  78



>ref|XP_008067195.1| PREDICTED: costars family protein ABRACL [Tarsius syrichta]
Length=81

 Score = 94.0 bits (232),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV+ EV  L EEI RLG +  +G   V FGVLF DD+CAN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNANGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHD+V+I L
Sbjct  61   YPGELLLQGVHDDVDIIL  78



>ref|XP_009505112.1| PREDICTED: costars family protein ABRACL [Phalacrocorax carbo]
Length=81

 Score = 93.6 bits (231),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVE E+  L EEI+RLG +  +G   V FGVLF D++CAN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVEHEISLLVEEIRRLGTKNANGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHD+V+I L
Sbjct  61   YQGELLLQGVHDDVDIML  78



>ref|XP_004651218.1| PREDICTED: costars family protein ABRACL [Jaculus jaculus]
Length=81

 Score = 92.8 bits (229),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV+ EV  L EEI RLG +  +G   V FGVLF DD+CAN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNAEGKLSVKFGVLFRDDRCANLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQG HD+V+I L
Sbjct  61   YPGELLLQGAHDDVDIIL  78



>pdb|2L2O|A Chain A, Solution Structure Of Human Hspc280 Protein
Length=89

 Score = 92.8 bits (229),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+ AN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKSANLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHD+V+I L
Sbjct  61   YPGELLLQGVHDDVDIIL  78



>gb|ACO51940.1| C6orf115 [Rana catesbeiana]
Length=81

 Score = 92.4 bits (228),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNVE EV  L E+I RLG    DG  KV FGVLF+DDQCAN+FEA+VGTL+AAK++K++ 
Sbjct  1    MNVEHEVSLLVEQIHRLGTRDLDGKLKVKFGVLFHDDQCANLFEAMVGTLKAAKRKKILT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y  ELLLQGVHD+++I L
Sbjct  61   YGTELLLQGVHDDIDIVL  78



>ref|XP_006013904.1| PREDICTED: costars family protein ABRACL-like [Latimeria chalumnae]
Length=80

 Score = 92.0 bits (227),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +2

Query  95   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVAYDGELLLQGVHDN  274
            I RLG    DG   V FGVLF D++CAN+FEALVGTLRAAKKRK++ Y+G+LLLQG HD+
Sbjct  14   ICRLGTRNADGKISVKFGVLFADEKCANLFEALVGTLRAAKKRKIITYEGQLLLQGTHDD  73

Query  275  VEITL  289
            V+I L
Sbjct  74   VDIVL  78



>gb|KGL85702.1| Costars family protein ABRACL, partial [Tinamus guttatus]
Length=61

 Score = 91.3 bits (225),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +2

Query  122  DGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVAYDGELLLQGVHDNVEITL  289
            DG   V FGVLF DD+CAN+FEALVGTL+AAK+RKVV+Y GELLLQGVHDNV+I L
Sbjct  3    DGQVSVKFGVLFADDKCANLFEALVGTLKAAKRRKVVSYQGELLLQGVHDNVDIVL  58



>ref|XP_006373008.1| hypothetical protein POPTR_0017s06990g, partial [Populus trichocarpa]
 gb|ERP50805.1| hypothetical protein POPTR_0017s06990g, partial [Populus trichocarpa]
Length=71

 Score = 91.7 bits (226),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +2

Query  149  VLFNDDQCANIFEALVGTLRAAKKRKVVAYDGELLLQGVHDNVEITLKPTP  301
            VLFN D+CA+IFEALVGTLRAAKKRKV++Y+GELLLQGVHDNV+I LKP P
Sbjct  4    VLFNVDRCAHIFEALVGTLRAAKKRKVLSYEGELLLQGVHDNVKIILKPAP  54



>gb|KDQ20442.1| hypothetical protein BOTBODRAFT_26447 [Botryobasidium botryosum 
FD-172 SS1]
Length=85

 Score = 91.7 bits (226),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 52/68 (76%), Gaps = 3/68 (4%)
 Frame = +2

Query  95   IKRLGKEQDDGSY---KVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVAYDGELLLQGV  265
            IKRLGK  +DG      V FGVL  DD+CANIFEALVGTLRAAKKR VVAYD  LLLQG 
Sbjct  15   IKRLGKPVEDGKAGIASVKFGVLVRDDRCANIFEALVGTLRAAKKRGVVAYDSPLLLQGA  74

Query  266  HDNVEITL  289
            HD+V++ L
Sbjct  75   HDDVDVVL  82



>ref|XP_003059997.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55949.1| predicted protein [Micromonas pusilla CCMP1545]
Length=82

 Score = 91.3 bits (225),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 53/65 (82%), Gaps = 1/65 (2%)
 Frame = +2

Query  95   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVAYDGELLLQGVHDN  274
            IKRLG   D G   V FGVLF DD+CANIFEALVGTLRAAKKRKV+ +DGE+LLQG HD+
Sbjct  16   IKRLGGNVD-GKTTVKFGVLFADDRCANIFEALVGTLRAAKKRKVIHFDGEMLLQGAHDH  74

Query  275  VEITL  289
            V++ L
Sbjct  75   VDVVL  79



>gb|AIC62228.1| ABRACL, partial [synthetic construct]
Length=80

 Score = 90.9 bits (224),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 61/78 (78%), Gaps = 1/78 (1%)
 Frame = +2

Query  56   MNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVA  235
            MNV+ EV  L EEI RLG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK+V 
Sbjct  1    MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVT  60

Query  236  YDGELLLQGVHDNVEITL  289
            Y GELLLQGVHD V+I L
Sbjct  61   YPGELLLQGVHD-VDIIL  77



>ref|XP_004347370.1| hypothetical protein CAOG_04623 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE93906.1| hypothetical protein CAOG_004623 [Capsaspora owczarzaki ATCC 
30864]
Length=81

 Score = 89.7 bits (221),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +2

Query  95   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVAYDGELLLQGVHDN  274
            IKRLG +   G Y V +GVLF DD+ ANIFEAL+GTL++AKKRK+V + GE+LLQGVHD+
Sbjct  14   IKRLGAKNASGQYSVKYGVLFKDDRVANIFEALLGTLKSAKKRKIVDFKGEMLLQGVHDD  73

Query  275  VEITL  289
            V++ L
Sbjct  74   VDVIL  78



>gb|EFB26624.1| hypothetical protein PANDA_000424 [Ailuropoda melanoleuca]
Length=61

 Score = 89.0 bits (219),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +2

Query  122  DGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVAYDGELLLQGVHDNVEITL  289
            DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK+V Y GELLLQGVHD+V+I L
Sbjct  3    DGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVTYPGELLLQGVHDDVDIIL  58



>gb|EDL03472.1| mCG7517, isoform CRA_b [Mus musculus]
Length=85

 Score = 89.7 bits (221),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +2

Query  113  EQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVAYDGELLLQGVHDNVEITL  289
            E  DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK+V Y GELLLQGVHD+V+I L
Sbjct  24   EDADGKLSVKFGVLFQDDRCANLFEALVGTLKAAKRRKIVTYAGELLLQGVHDDVDIVL  82



>gb|EFA82987.1| hypothetical protein PPL_03765 [Polysphondylium pallidum PN500]
Length=81

 Score = 89.4 bits (220),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +2

Query  53   TMNveeeverlreeIKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVV  232
            TMNV+EEV RL EEI RLG ++ DG   V +GVLFNDD  AN FEAL+GTL+AAK++K++
Sbjct  2    TMNVDEEVSRLIEEITRLGTKRPDGKIVVKYGVLFNDDIVANTFEALLGTLKAAKRKKLI  61

Query  233  AYDGELLLQGVHDNVEITL  289
             YDGE+LLQ VHDNV+I +
Sbjct  62   TYDGEILLQRVHDNVDIII  80



>gb|EOB02642.1| Uncharacterized protein C6orf115, partial [Anas platyrhynchos]
Length=61

 Score = 89.0 bits (219),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +2

Query  122  DGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVAYDGELLLQGVHDNVEITL  289
            DG   V FGVLF D++CAN+FEALVGTL+AAK+RK+V Y GELLLQGVHDNV+I L
Sbjct  3    DGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIVTYQGELLLQGVHDNVDIVL  58



>ref|XP_004350571.1| hypothetical protein DFA_11624 [Dictyostelium fasciculatum]
 gb|EGG13863.1| hypothetical protein DFA_11624 [Dictyostelium fasciculatum]
Length=79

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +2

Query  95   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVAYDGELLLQGVHDN  274
            I RLG +  +G   V +GVLFNDD+ AN FEALVGTL+AAKKRK++ YDGE+LLQ VHDN
Sbjct  14   INRLGTKGANGKVSVKYGVLFNDDEVANTFEALVGTLKAAKKRKILTYDGEILLQRVHDN  73

Query  275  VEITL  289
            V++ L
Sbjct  74   VDVIL  78



>ref|XP_010793085.1| PREDICTED: costars family protein ABRACL [Notothenia coriiceps]
 ref|XP_010793086.1| PREDICTED: costars family protein ABRACL [Notothenia coriiceps]
Length=81

 Score = 88.2 bits (217),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +2

Query  95   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVAYDGELLLQGVHDN  274
            I+RLG +  DG   VTFGVLFND+QCANIFEALVGTL+AAKKRKVV YD ELLLQGVHD+
Sbjct  14   IQRLGSKNADGQTSVTFGVLFNDEQCANIFEALVGTLKAAKKRKVVKYDSELLLQGVHDS  73

Query  275  VEITL  289
            V ITL
Sbjct  74   VSITL  78



>ref|XP_009985907.1| PREDICTED: costars family protein ABRACL, partial [Tauraco erythrolophus]
Length=60

 Score = 87.8 bits (216),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +2

Query  122  DGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVAYDGELLLQGVHDNVEITL  289
            DG   V FGVLF D++CAN+FEALVGTL+AAK+RK++ Y GELLLQGVHD+VE+ L
Sbjct  2    DGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIITYQGELLLQGVHDDVEVVL  57



>gb|KFV18849.1| Costars family protein ABRACL, partial [Tauraco erythrolophus]
Length=61

 Score = 87.8 bits (216),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +2

Query  122  DGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVAYDGELLLQGVHDNVEITL  289
            DG   V FGVLF D++CAN+FEALVGTL+AAK+RK++ Y GELLLQGVHD+VE+ L
Sbjct  3    DGQVSVKFGVLFADEKCANLFEALVGTLKAAKRRKIITYQGELLLQGVHDDVEVVL  58



>ref|XP_006898818.1| PREDICTED: costars family protein ABRACL-like [Elephantulus edwardii]
Length=78

 Score = 88.2 bits (217),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 51/63 (81%), Gaps = 1/63 (2%)
 Frame = +2

Query  101  RLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVAYDGELLLQGVHDNVE  280
             LG +  DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK+V+Y GELLLQGVHD V+
Sbjct  14   HLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVSYQGELLLQGVHD-VD  72

Query  281  ITL  289
            I L
Sbjct  73   IVL  75



>ref|XP_644929.1| hypothetical protein DDB_G0272861 [Dictyostelium discoideum AX4]
 sp|Q558Y7.1|COSA_DICDI RecName: Full=Protein costars [Dictyostelium discoideum]
 gb|EAL71068.1| hypothetical protein DDB_G0272861 [Dictyostelium discoideum AX4]
Length=82

 Score = 87.8 bits (216),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +2

Query  95   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVAYDGELLLQGVHDN  274
            IK+LG +  DG Y V +GVLFNDD  AN FEALVGTL+AAKKR ++ + GE+LLQ VHDN
Sbjct  14   IKKLGTKGADGKYSVKYGVLFNDDDVANFFEALVGTLKAAKKRGIITFQGEILLQRVHDN  73

Query  275  VEITL  289
            V++ L
Sbjct  74   VDVIL  78



>gb|KII85529.1| hypothetical protein PLICRDRAFT_166123 [Plicaturopsis crispa 
FD-325 SS-3]
Length=86

 Score = 88.2 bits (217),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 51/68 (75%), Gaps = 3/68 (4%)
 Frame = +2

Query  95   IKRLGKEQD---DGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVAYDGELLLQGV  265
            IKRLG       +G   V FG+L  DD+CANIFEALVGTLRAAKKRKV+ Y GE+LLQG 
Sbjct  16   IKRLGGPPPAGVEGVASVKFGILVKDDRCANIFEALVGTLRAAKKRKVITYAGEMLLQGA  75

Query  266  HDNVEITL  289
            HD+V++ L
Sbjct  76   HDDVDVVL  83



>ref|XP_003294793.1| hypothetical protein DICPUDRAFT_43951 [Dictyostelium purpureum]
 ref|XP_003294794.1| hypothetical protein DICPUDRAFT_96120 [Dictyostelium purpureum]
 gb|EGC28682.1| hypothetical protein DICPUDRAFT_43951 [Dictyostelium purpureum]
 gb|EGC28683.1| hypothetical protein DICPUDRAFT_96120 [Dictyostelium purpureum]
Length=85

 Score = 85.5 bits (210),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +2

Query  95   IKRLGKEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVAYDGELLLQGVHDN  274
            IKRLG +  +  Y V +GVLFNDD   N+FEAL+GTL++AK++K++ ++GELLLQ VHDN
Sbjct  18   IKRLGTKNANNQYVVKYGVLFNDDTVGNVFEALMGTLKSAKRKKIITFEGELLLQRVHDN  77

Query  275  VEITL  289
            V+I L
Sbjct  78   VDIIL  82



>gb|AAH89921.1| LOC685045 protein [Rattus norvegicus]
Length=133

 Score = 86.7 bits (213),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +2

Query  110  KEQDDGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVAYDGELLLQGVHDNVEITL  289
            K   DG   V FGVLF DD+CAN+FEALVGT +AAK+RK+V Y GELLLQGVHD+V+I L
Sbjct  71   KLDADGKLSVKFGVLFQDDRCANLFEALVGTPKAAKRRKIVTYAGELLLQGVHDDVDIVL  130



>gb|EGV96086.1| Epithelial cell transforming sequence 2 oncogene-like [Cricetulus 
griseus]
Length=939

 Score = 92.0 bits (227),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 41/56 (73%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +2

Query  122  DGSYKVTFGVLFNDDQCANIFEALVGTLRAAKKRKVVAYDGELLLQGVHDNVEITL  289
            DG   V FGVLF DD+CAN+FEALVGTL+AAK+RK+V Y GELLLQGVHD+V+I L
Sbjct  881  DGKLSVKFGVLFQDDRCANLFEALVGTLKAAKRRKIVTYTGELLLQGVHDDVDIVL  936



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 696633491985