BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001G05

Length=528
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009768837.1|  PREDICTED: chitinase-like protein 2                184   2e-53   Nicotiana sylvestris
ref|XP_006349881.1|  PREDICTED: chitinase-like protein 2-like           182   7e-53   Solanum tuberosum [potatoes]
ref|XP_009617372.1|  PREDICTED: chitinase-like protein 2                182   1e-52   Nicotiana tomentosiformis
ref|XP_004252963.1|  PREDICTED: chitinase-like protein 1                177   8e-51   Solanum lycopersicum
ref|XP_002269474.1|  PREDICTED: chitinase-like protein 2                175   4e-50   Vitis vinifera
ref|XP_006364661.1|  PREDICTED: chitinase-like protein 1-like           174   6e-50   Solanum tuberosum [potatoes]
ref|XP_008222679.1|  PREDICTED: chitinase-like protein 1                171   1e-48   Prunus mume [ume]
ref|XP_009623434.1|  PREDICTED: chitinase-like protein 1                171   1e-48   Nicotiana tomentosiformis
ref|XP_004247978.1|  PREDICTED: chitinase-like protein 1                171   2e-48   Solanum lycopersicum
ref|XP_007227478.1|  hypothetical protein PRUPE_ppa008743mg             170   3e-48   Prunus persica
ref|XP_008386854.1|  PREDICTED: LOW QUALITY PROTEIN: chitinase-li...    169   7e-48   
ref|XP_008353968.1|  PREDICTED: chitinase-like protein 1                169   7e-48   
ref|XP_008343357.1|  PREDICTED: chitinase-like protein 1                169   7e-48   
ref|XP_009775616.1|  PREDICTED: chitinase-like protein 1                169   9e-48   Nicotiana sylvestris
gb|KDP37888.1|  hypothetical protein JCGZ_05770                         169   1e-47   Jatropha curcas
ref|XP_008391633.1|  PREDICTED: chitinase-like protein 1                170   1e-47   Malus domestica [apple tree]
dbj|BAI63079.1|  putative chitinase                                     168   2e-47   Epipremnum aureum
ref|XP_009339898.1|  PREDICTED: chitinase-like protein 1                168   2e-47   Pyrus x bretschneideri [bai li]
ref|XP_007022927.1|  Chitinase family protein                           168   3e-47   
ref|XP_010270668.1|  PREDICTED: chitinase-like protein 1                167   4e-47   
ref|XP_010069371.1|  PREDICTED: chitinase-like protein 1                166   1e-46   Eucalyptus grandis [rose gum]
ref|XP_004296698.1|  PREDICTED: chitinase-like protein 1                166   1e-46   Fragaria vesca subsp. vesca
ref|XP_011073914.1|  PREDICTED: chitinase-like protein 1                166   1e-46   Sesamum indicum [beniseed]
gb|AFW90525.1|  chitinase-like protein 1-like isoform 1                 166   1e-46   Phaseolus vulgaris [French bean]
gb|AHA84180.1|  chitinase-like protein 1                                166   2e-46   Phaseolus vulgaris [French bean]
gb|AGV54496.1|  class-1 chitinase                                       166   2e-46   Phaseolus vulgaris [French bean]
gb|EYU36737.1|  hypothetical protein MIMGU_mgv1a010106mg                165   2e-46   Erythranthe guttata [common monkey flower]
gb|AFK38281.1|  unknown                                                 161   2e-46   Medicago truncatula
ref|XP_006298086.1|  hypothetical protein CARUB_v10014131mg             166   3e-46   Capsella rubella
ref|XP_007139304.1|  hypothetical protein PHAVU_008G018100g             165   3e-46   Phaseolus vulgaris [French bean]
ref|XP_002276563.1|  PREDICTED: chitinase-like protein 2                165   3e-46   Vitis vinifera
ref|XP_008438940.1|  PREDICTED: chitinase-like protein 2                165   3e-46   Cucumis melo [Oriental melon]
ref|XP_008453931.1|  PREDICTED: chitinase-like protein 1                164   4e-46   Cucumis melo [Oriental melon]
ref|XP_010913810.1|  PREDICTED: chitinase-like protein 1                164   4e-46   Elaeis guineensis
ref|XP_002515664.1|  chitinase, putative                                164   5e-46   Ricinus communis
gb|ACJ85217.1|  unknown                                                 160   5e-46   Medicago truncatula
gb|KHN13837.1|  Chitinase-like protein 1                                164   8e-46   Glycine soja [wild soybean]
gb|AFY08284.1|  class Ib chitinase                                      164   1e-45   Acacia koa
ref|XP_008337550.1|  PREDICTED: chitinase-like protein 1                163   1e-45   
gb|KFK39034.1|  hypothetical protein AALP_AA3G192100                    164   1e-45   Arabis alpina [alpine rockcress]
ref|XP_008781695.1|  PREDICTED: chitinase-like protein 1                163   1e-45   Phoenix dactylifera
ref|XP_010024779.1|  PREDICTED: chitinase-like protein 2                163   1e-45   Eucalyptus grandis [rose gum]
ref|XP_010487564.1|  PREDICTED: chitinase-like protein 2                163   2e-45   Camelina sativa [gold-of-pleasure]
gb|ABL86685.1|  CLT3                                                    162   3e-45   Gossypium barbadense [Egyptian cotton]
ref|XP_006660787.1|  PREDICTED: chitinase-like protein 1-like           162   3e-45   Oryza brachyantha
gb|KJB34691.1|  hypothetical protein B456_006G078900                    162   3e-45   Gossypium raimondii
ref|XP_010276208.1|  PREDICTED: chitinase-like protein 1                162   3e-45   Nelumbo nucifera [Indian lotus]
ref|XP_002885177.1|  AT3g16920/K14A17_4                                 162   3e-45   Arabidopsis lyrata subsp. lyrata
ref|XP_004152085.1|  PREDICTED: chitinase-like protein 1-like iso...    162   3e-45   Cucumis sativus [cucumbers]
gb|AHC69781.1|  chitinase                                               162   4e-45   Quercus suber [cork oak]
sp|Q9LSP9.1|CTL2_ARATH  RecName: Full=Chitinase-like protein 2; S...    162   4e-45   Arabidopsis thaliana [mouse-ear cress]
gb|AAQ56598.1|  chitinase-like protein                                  162   4e-45   Gossypium hirsutum [American cotton]
ref|XP_010465717.1|  PREDICTED: chitinase-like protein 2                162   4e-45   Camelina sativa [gold-of-pleasure]
ref|XP_004162209.1|  PREDICTED: chitinase-like protein 2-like           162   4e-45   
ref|XP_006406791.1|  hypothetical protein EUTSA_v10021094mg             162   4e-45   Eutrema salsugineum [saltwater cress]
ref|NP_188317.2|  chitinase-like protein 2                              162   5e-45   
ref|XP_010504812.1|  PREDICTED: chitinase-like protein 2                162   5e-45   Camelina sativa [gold-of-pleasure]
ref|XP_007035746.1|  Chitinase-like protein 2                           162   5e-45   Theobroma cacao [chocolate]
ref|XP_004152084.1|  PREDICTED: chitinase-like protein 1-like iso...    162   5e-45   
ref|XP_003531920.1|  PREDICTED: chitinase-like protein 1-like iso...    162   7e-45   Glycine max [soybeans]
ref|XP_003621680.1|  Endochitinase                                      161   8e-45   Medicago truncatula
dbj|BAC81645.1|  class1 chitinase                                       160   9e-45   Pisum sativum [garden pea]
gb|KHN14660.1|  Chitinase-like protein 2                                161   1e-44   Glycine soja [wild soybean]
gb|AHX74092.1|  chitodextrinase                                         161   1e-44   Eucommia ulmoides
ref|NP_001063549.1|  Os09g0494200                                       161   1e-44   
ref|XP_002321089.2|  hypothetical protein POPTR_0014s14370g             160   1e-44   Populus trichocarpa [western balsam poplar]
ref|NP_001242130.1|  uncharacterized protein LOC100811072 precursor     161   1e-44   
gb|KDP27890.1|  hypothetical protein JCGZ_18970                         160   3e-44   Jatropha curcas
ref|XP_002519197.1|  chitinase, putative                                160   3e-44   Ricinus communis
ref|XP_008796626.1|  PREDICTED: chitinase-like protein 1                159   5e-44   Phoenix dactylifera
ref|XP_011006099.1|  PREDICTED: chitinase-like protein 1                159   6e-44   Populus euphratica
gb|KDO35933.1|  hypothetical protein CISIN_1g029634mg                   155   6e-44   Citrus sinensis [apfelsine]
ref|XP_003533202.1|  PREDICTED: chitinase-like protein 2-like           159   7e-44   Glycine max [soybeans]
gb|AAQ56599.1|  chitinase-like protein                                  159   7e-44   Gossypium hirsutum [American cotton]
gb|KHG06992.1|  Chitinase-like protein 2                                159   7e-44   Gossypium arboreum [tree cotton]
gb|ACU18968.1|  unknown                                                 159   8e-44   Glycine max [soybeans]
ref|XP_010932192.1|  PREDICTED: chitinase-like protein 1                158   9e-44   Elaeis guineensis
gb|KEH43926.1|  class I chitinase                                       158   1e-43   Medicago truncatula
ref|NP_001142334.1|  uncharacterized protein LOC100274504               158   1e-43   Zea mays [maize]
gb|KJB72798.1|  hypothetical protein B456_011G198500                    158   1e-43   Gossypium raimondii
gb|ADC55619.2|  class I chitinase                                       157   1e-43   Elaeis guineensis
ref|XP_004957236.1|  PREDICTED: chitinase-like protein 1-like           158   1e-43   Setaria italica
ref|XP_002460464.1|  hypothetical protein SORBIDRAFT_02g028770          158   1e-43   Sorghum bicolor [broomcorn]
ref|NP_001242608.1|  uncharacterized protein LOC100805300 precursor     158   2e-43   Glycine max [soybeans]
gb|ABL86686.1|  CLT4                                                    158   2e-43   Gossypium barbadense [Egyptian cotton]
ref|XP_010927492.1|  PREDICTED: chitinase-like protein 1                157   2e-43   Elaeis guineensis
ref|XP_008796462.1|  PREDICTED: chitinase-like protein 1                159   2e-43   Phoenix dactylifera
gb|ACJ84650.1|  unknown                                                 152   2e-43   Medicago truncatula
ref|XP_008381556.1|  PREDICTED: chitinase-like protein 2                154   3e-43   
ref|XP_011009946.1|  PREDICTED: chitinase-like protein 2                157   3e-43   Populus euphratica
gb|ABV89661.1|  chitinase                                               155   3e-43   Brassica rapa
ref|XP_010678214.1|  PREDICTED: chitinase-like protein 1                157   3e-43   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003578351.1|  PREDICTED: chitinase-like protein 1                157   5e-43   Brachypodium distachyon [annual false brome]
gb|AAP80800.1|  class VII chitinase precursor                           157   5e-43   Gossypium hirsutum [American cotton]
dbj|BAH30273.1|  hypothetical protein                                   156   5e-43   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172076.1|  chitinase-like protein 1                              156   6e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008223307.1|  PREDICTED: chitinase-like protein 2                156   6e-43   Prunus mume [ume]
ref|XP_009414020.1|  PREDICTED: chitinase-like protein 1                156   6e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006417979.1|  hypothetical protein EUTSA_v10008219mg             156   6e-43   Eutrema salsugineum [saltwater cress]
gb|EPS65534.1|  hypothetical protein M569_09245                         156   7e-43   Genlisea aurea
gb|ACO25187.1|  chitinase                                               156   7e-43   Mikania micrantha [bittervine]
dbj|BAJ33659.1|  unnamed protein product                                155   7e-43   Eutrema halophilum
gb|KJB69093.1|  hypothetical protein B456_011G005100                    156   7e-43   Gossypium raimondii
gb|ACD93719.1|  chitinase                                               156   7e-43   Mikania micrantha [bittervine]
gb|AEZ67304.1|  chitinase 5                                             156   8e-43   Populus x canadensis [Canadian poplar]
ref|XP_010524573.1|  PREDICTED: LOW QUALITY PROTEIN: chitinase-li...    156   1e-42   Tarenaya hassleriana [spider flower]
gb|KHF97626.1|  Chitinase-like protein 1                                155   1e-42   Gossypium arboreum [tree cotton]
gb|KDO50537.1|  hypothetical protein CISIN_1g0252372mg                  152   2e-42   Citrus sinensis [apfelsine]
ref|XP_006305373.1|  hypothetical protein CARUB_v10009762mg             155   2e-42   Capsella rubella
ref|XP_009119113.1|  PREDICTED: chitinase-like protein 1                155   2e-42   Brassica rapa
ref|XP_009348883.1|  PREDICTED: chitinase-like protein 2                155   2e-42   Pyrus x bretschneideri [bai li]
ref|XP_009369953.1|  PREDICTED: chitinase-like protein 2                155   2e-42   Pyrus x bretschneideri [bai li]
gb|AFK34282.1|  unknown                                                 155   2e-42   Lotus japonicus
gb|ACM45714.1|  class II chitinase                                      155   2e-42   Pyrus x bretschneideri x Pyrus pyrifolia
ref|XP_008361932.1|  PREDICTED: LOW QUALITY PROTEIN: chitinase-li...    155   2e-42   
emb|CDY10156.1|  BnaC05g03990D                                          155   3e-42   Brassica napus [oilseed rape]
ref|XP_008340624.1|  PREDICTED: chitinase-like protein 2                155   3e-42   
ref|XP_002316022.1|  class1 chitinase family protein                    155   3e-42   
gb|EYU45212.1|  hypothetical protein MIMGU_mgv1a010053mg                154   4e-42   Erythranthe guttata [common monkey flower]
ref|XP_010094321.1|  Chitinase-like protein 2                           154   4e-42   Morus notabilis
ref|XP_006488866.1|  PREDICTED: chitinase-like protein 2-like           154   4e-42   Citrus sinensis [apfelsine]
ref|XP_006419422.1|  hypothetical protein CICLE_v10005421mg             154   4e-42   Citrus clementina [clementine]
ref|XP_010485424.1|  PREDICTED: chitinase-like protein 1                154   5e-42   Camelina sativa [gold-of-pleasure]
ref|XP_007222686.1|  hypothetical protein PRUPE_ppa008643mg             154   6e-42   Prunus persica
gb|ACE98503.1|  family 19 glycoside hydrolase                           147   6e-42   Populus tremula [European aspen]
ref|XP_009391282.1|  PREDICTED: chitinase-like protein 1 isoform X2     153   7e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002892310.1|  pom-pom1                                           153   8e-42   
gb|AFK41090.1|  unknown                                                 153   9e-42   Medicago truncatula
ref|XP_004295106.1|  PREDICTED: chitinase-like protein 2                153   9e-42   Fragaria vesca subsp. vesca
ref|XP_003594792.1|  Endochitinase                                      153   9e-42   Medicago truncatula
ref|XP_009391281.1|  PREDICTED: chitinase-like protein 1 isoform X1     153   9e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010475305.1|  PREDICTED: chitinase-like protein 1                153   9e-42   Camelina sativa [gold-of-pleasure]
ref|XP_009407212.1|  PREDICTED: chitinase-like protein 1 isoform X2     152   1e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001288894.1|  chitinase-like protein 1 precursor                 153   1e-41   Brassica rapa
ref|XP_009111023.1|  PREDICTED: chitinase-like protein 1                153   1e-41   Brassica rapa
ref|XP_009407211.1|  PREDICTED: chitinase-like protein 1 isoform X1     152   1e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004487788.1|  PREDICTED: chitinase-like protein 2-like           152   1e-41   Cicer arietinum [garbanzo]
ref|XP_004492044.1|  PREDICTED: chitinase-like protein 2-like           152   2e-41   Cicer arietinum [garbanzo]
ref|XP_009410357.1|  PREDICTED: chitinase-like protein 1                152   2e-41   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX86549.1|  BnaC08g01540D                                          152   2e-41   
gb|ACE98508.1|  family 19 glycoside hydrolase                           145   3e-41   Populus tremula [European aspen]
gb|ACE98500.1|  family 19 glycoside hydrolase                           145   4e-41   Populus tremula [European aspen]
gb|ACE98493.1|  family 19 glycoside hydrolase                           145   5e-41   Populus tremula [European aspen]
ref|XP_010522204.1|  PREDICTED: chitinase-like protein 1                151   5e-41   Tarenaya hassleriana [spider flower]
gb|ACE98498.1|  family 19 glycoside hydrolase                           143   2e-40   Populus tremula [European aspen]
gb|ACE98499.1|  family 19 glycoside hydrolase                           143   3e-40   Populus tremula [European aspen]
gb|ACE98502.1|  family 19 glycoside hydrolase                           142   3e-40   Populus tremula [European aspen]
gb|KDO38166.1|  hypothetical protein CISIN_1g036277mg                   147   5e-40   Citrus sinensis [apfelsine]
gb|ACN27372.1|  unknown                                                 144   6e-40   Zea mays [maize]
ref|XP_009386704.1|  PREDICTED: chitinase-like protein 1                148   7e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010557059.1|  PREDICTED: chitinase-like protein 1                147   1e-39   Tarenaya hassleriana [spider flower]
gb|ACE98494.1|  family 19 glycoside hydrolase                           140   2e-39   Populus tremula [European aspen]
ref|XP_006443148.1|  hypothetical protein CICLE_v10021187mg             147   2e-39   Citrus clementina [clementine]
ref|XP_007138976.1|  hypothetical protein PHAVU_009G254400g             145   7e-39   Phaseolus vulgaris [French bean]
ref|XP_010103925.1|  Chitinase-like protein 1                           145   8e-39   Morus notabilis
ref|XP_004134237.1|  PREDICTED: LOW QUALITY PROTEIN: chitinase-li...    145   1e-38   
ref|XP_006660298.1|  PREDICTED: chitinase-like protein 1-like           144   2e-38   
gb|EMT31181.1|  Endochitinase                                           144   5e-38   
gb|EMS57391.1|  Chitinase-like protein 1                                143   2e-37   Triticum urartu
gb|ACE79211.1|  chi2                                                    141   3e-37   Limonium bicolor
dbj|BAK00996.1|  predicted protein                                      141   3e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006849899.1|  hypothetical protein AMTR_s00022p00097040          142   5e-37   
gb|EMS53119.1|  Chitinase-like protein 1                                144   8e-37   Triticum urartu
gb|ABD92820.1|  class I chitinase                                       140   1e-36   Limonium bicolor
gb|EMT31096.1|  Putative L-ascorbate peroxidase 6                       144   1e-36   
gb|AAS15706.1|  putative class I chitinase                              133   4e-36   Picea abies
gb|ABL86684.1|  CLT2                                                    137   6e-36   Gossypium barbadense [Egyptian cotton]
ref|XP_002445877.1|  hypothetical protein SORBIDRAFT_07g027310          137   1e-35   Sorghum bicolor [broomcorn]
ref|NP_001062281.1|  Os08g0522500                                       137   1e-35   
gb|EAZ07679.1|  hypothetical protein OsI_29936                          137   2e-35   Oryza sativa Indica Group [Indian rice]
gb|AGY34712.1|  chitinase class VII                                     135   4e-35   Saccharum hybrid cultivar [sugarcane]
gb|AGY34713.1|  chitinase class VII                                     135   5e-35   Saccharum hybrid cultivar [sugarcane]
gb|ABK23415.1|  unknown                                                 132   7e-34   Picea sitchensis
gb|ACN39823.1|  unknown                                                 132   7e-34   Picea sitchensis
ref|XP_004973912.1|  PREDICTED: chitinase-like protein 1-like           130   3e-33   
emb|CAZ64529.1|  endochitinase                                          116   3e-30   Populus trichocarpa [western balsam poplar]
ref|XP_003572384.1|  PREDICTED: chitinase-like protein 1                120   2e-29   Brachypodium distachyon [annual false brome]
gb|EMS52807.1|  Chitinase-like protein 1                                112   2e-26   Triticum urartu
gb|KHG26643.1|  Chitinase-like protein 2                                105   5e-24   Gossypium arboreum [tree cotton]
gb|ABK23781.1|  unknown                                                 100   6e-22   Picea sitchensis
ref|XP_003615141.1|  Class1 chitinase                                 94.0    3e-21   
gb|AAQ84319.1|  fiber glycosyl hydrolase family 19 protein            90.1    1e-18   Gossypium barbadense [Egyptian cotton]
ref|XP_001771063.1|  predicted protein                                89.7    2e-18   
emb|CDX95895.1|  BnaC05g36460D                                        84.0    3e-16   
ref|XP_002970118.1|  hypothetical protein SELMODRAFT_227948           83.2    5e-16   
ref|XP_002985308.1|  hypothetical protein SELMODRAFT_229092           82.0    1e-15   
ref|XP_001781538.1|  predicted protein                                80.5    4e-15   
ref|XP_001781573.1|  predicted protein                                79.7    6e-15   
gb|EMT04393.1|  Endochitinase CH25                                    82.4    8e-15   
emb|CDX92107.1|  BnaA05g23000D                                        66.6    7e-11   
ref|XP_006379300.1|  hypothetical protein POPTR_0009s14410g           60.1    8e-08   
ref|XP_006379301.1|  hypothetical protein POPTR_0009s14430g           59.3    2e-07   Populus trichocarpa [western balsam poplar]
gb|EAZ07665.1|  hypothetical protein OsI_29921                        55.8    4e-07   Oryza sativa Indica Group [Indian rice]
gb|AAA62420.1|  class I acidic chitinase                              57.8    5e-07   Zea mays [maize]
ref|XP_011045248.1|  PREDICTED: acidic endochitinase WIN6-like        57.0    1e-06   Populus euphratica
ref|XP_008645097.1|  PREDICTED: LOW QUALITY PROTEIN: basic endoch...  57.0    1e-06   
gb|KHN15004.1|  Endochitinase                                         55.1    2e-06   Glycine soja [wild soybean]
ref|XP_002312922.1|  hypothetical protein POPTR_0009s14390g           56.2    2e-06   
ref|XP_011045270.1|  PREDICTED: acidic endochitinase WIN6             55.5    3e-06   Populus euphratica
emb|CBI22907.3|  unnamed protein product                              53.5    7e-06   Vitis vinifera
ref|XP_003547902.2|  PREDICTED: LOW QUALITY PROTEIN: endochitinas...  55.1    7e-06   
emb|CDP01819.1|  unnamed protein product                              54.3    8e-06   Coffea canephora [robusta coffee]
gb|AEW08791.1|  hypothetical protein CL1635Contig1_06                 50.8    9e-06   Pinus radiata
gb|AAF69774.1|AF135134_1  class I chitinase                           53.9    1e-05   Arabis blepharophylla [rose rockcress]
ref|XP_010672242.1|  PREDICTED: endochitinase-like                    53.9    1e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004163409.1|  PREDICTED: endochitinase-like                    53.5    1e-05   
ref|XP_006387601.1|  hypothetical protein POPTR_0790s00200g           53.5    2e-05   
ref|XP_006387600.1|  hypothetical protein POPTR_0790s00200g           53.1    2e-05   
ref|XP_002312916.2|  hypothetical protein POPTR_0009s14400g           53.1    2e-05   
pir||S18750  chitinase (EC 3.2.1.14) precursor - western balsam p...  53.1    2e-05
ref|XP_003629192.1|  Endochitinase                                    53.1    2e-05   Medicago truncatula
sp|P29031.2|CHIB_POPTR  RecName: Full=Acidic endochitinase WIN6.2...  53.1    2e-05   Populus trichocarpa [western balsam poplar]
gb|EEE53030.1|  hypothetical protein OsJ_35750                        50.1    3e-05   Oryza sativa Japonica Group [Japonica rice]
gb|AAF69781.1|AF135141_1  class I chitinase                           52.8    3e-05   Boechera gunnisoniana
gb|AAF04453.1|AF000964_1  chitinase                                   52.4    4e-05   Poa pratensis
gb|AAF69776.1|AF135136_1  class I chitinase                           52.0    5e-05   Boechera fecunda [Mt. Sapphire rockcress]
gb|AFW75728.1|  hypothetical protein ZEAMMB73_827760                  52.4    5e-05   
sp|P85084.1|CHIT_CARPA  RecName: Full=Endochitinase                   51.6    5e-05   Carica papaya [mamon]
ref|XP_004135003.1|  PREDICTED: endochitinase-like                    52.0    5e-05   
pdb|3CQL|A  Chain A, Crystal Structure Of Gh Family 19 Chitinase ...  51.6    5e-05   Carica papaya [mamon]
ref|XP_008440903.1|  PREDICTED: endochitinase-like                    51.6    7e-05   Cucumis melo [Oriental melon]
dbj|BAA82810.1|  basic endochitinase                                  51.6    7e-05   Arabidopsis thaliana [mouse-ear cress]
gb|AAF69769.1|AF135129_1  class I chitinase                           50.1    8e-05   Boechera stricta
gb|AHY24793.1|  endochitinase                                         51.6    8e-05   Triticum aestivum [Canadian hard winter wheat]
gb|AHY24794.1|  endochitinase                                         51.6    8e-05   Triticum aestivum [Canadian hard winter wheat]
gb|AAF69768.1|AF135128_1  class I chitinase                           50.8    8e-05   Arabis alpina [alpine rockcress]
gb|AAF69783.1|AF135143_1  class I chitinase                           51.2    8e-05   Boechera lemmonii
prf||1710349A  basic chitinase                                        51.6    8e-05
gb|AHY24795.1|  endochitinase                                         51.2    8e-05   Triticum aestivum [Canadian hard winter wheat]
emb|CAA53626.1|  endochitinase                                        51.2    9e-05   Triticum aestivum [Canadian hard winter wheat]
emb|CDJ26692.1|  unnamed protein product                              51.2    9e-05   Triticum aestivum [Canadian hard winter wheat]
gb|EMT27215.1|  Basic endochitinase A                                 51.2    9e-05   
gb|AAF69782.1|AF135142_1  class I chitinase                           51.2    9e-05   Halimolobos perplexus var. perplexus
ref|NP_566426.2|  basic chitinase B                                   51.2    9e-05   Arabidopsis thaliana [mouse-ear cress]
dbj|BAA82824.1|  basic endochitinase                                  51.2    9e-05   Arabidopsis thaliana [mouse-ear cress]
dbj|BAA82814.1|  basic endochitinase                                  51.2    9e-05   Arabidopsis thaliana [mouse-ear cress]
gb|AAK96819.1|  basic chitinase                                       51.2    1e-04   Arabidopsis thaliana [mouse-ear cress]
gb|KDO68260.1|  hypothetical protein CISIN_1g045378mg                 48.5    1e-04   Citrus sinensis [apfelsine]
gb|AAF69793.1|AF135153_1  class I chitinase                           50.8    1e-04   Boechera parishii [dwarf rockcress]
gb|AAF69786.1|AF135146_1  class I chitinase                           50.8    1e-04   Boechera lignifera [desert rockcress]
gb|AAF69791.1|AF135151_1  class I chitinase                           50.8    1e-04   Boechera microphylla
gb|AAF69787.1|AF135147_1  class I chitinase                           50.8    1e-04   Boechera lignifera [desert rockcress]
ref|XP_009344658.1|  PREDICTED: endochitinase-like                    50.8    1e-04   Pyrus x bretschneideri [bai li]
gb|AAF69792.1|AF135152_1  class I chitinase                           50.8    1e-04   Boechera parishii [dwarf rockcress]
gb|AAF69777.1|AF135137_1  class I chitinase                           50.8    1e-04   Boechera fecunda [Mt. Sapphire rockcress]
ref|XP_009786482.1|  PREDICTED: endochitinase 3-like                  50.8    1e-04   Nicotiana sylvestris
gb|AAF69784.1|AF135144_1  class I chitinase                           50.8    1e-04   Boechera lemmonii
gb|AAF69770.1|AF135130_1  class I chitinase                           50.8    1e-04   Boechera holboellii
gb|AAF69775.1|AF135135_1  class I chitinase                           50.8    1e-04   Boechera stricta
ref|XP_006422472.1|  hypothetical protein CICLE_v10028959mg           50.8    1e-04   Citrus clementina [clementine]
ref|XP_002447824.1|  hypothetical protein SORBIDRAFT_06g016510        50.4    1e-04   Sorghum bicolor [broomcorn]
dbj|BAJ33711.1|  unnamed protein product                              50.1    1e-04   Eutrema halophilum
gb|AHY24792.1|  endochitinase                                         50.8    1e-04   Triticum aestivum [Canadian hard winter wheat]
dbj|BAK08350.1|  predicted protein                                    50.4    1e-04   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003569604.1|  PREDICTED: basic endochitinase A-like            50.4    2e-04   Brachypodium distachyon [annual false brome]
gb|AEF56931.1|  chitinase                                             49.7    2e-04   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT27216.1|  Basic endochitinase A                                 50.4    2e-04   
ref|XP_002884907.1|  basic endochitinase                              50.4    2e-04   Arabidopsis lyrata subsp. lyrata
gb|AAF69780.1|AF135140_1  class I chitinase                           50.4    2e-04   Turritis glabra
gb|AAF69773.1|AF135133_1  class I chitinase                           50.1    2e-04   Arabis blepharophylla [rose rockcress]
gb|AAF69778.1|AF135138_1  class I chitinase                           50.1    2e-04   Turritis glabra
ref|NP_001149582.1|  LOC100283208 precursor                           50.1    2e-04   Zea mays [maize]
gb|AHY24796.1|  endochitinase                                         50.1    2e-04   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002488863.1|  hypothetical protein SORBIDRAFT_3219s002010      50.1    2e-04   
ref|XP_010555448.1|  PREDICTED: endochitinase CH25                    50.1    2e-04   
ref|XP_010242848.1|  PREDICTED: basic endochitinase-like              50.1    2e-04   Nelumbo nucifera [Indian lotus]
ref|XP_008441134.1|  PREDICTED: endochitinase-like                    50.1    2e-04   Cucumis melo [Oriental melon]
gb|AFW69575.1|  basic endochitinase 1                                 49.7    3e-04   
emb|CBI39460.3|  unnamed protein product                              49.3    3e-04   Vitis vinifera
dbj|BAG12896.1|  chitinase                                            49.7    3e-04   Bromus inermis [awnless brome grass]
dbj|BAJ89873.1|  predicted protein                                    49.7    3e-04   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009611126.1|  PREDICTED: endochitinase 3-like                  49.3    3e-04   Nicotiana tomentosiformis
ref|XP_010465019.1|  PREDICTED: basic endochitinase B-like            49.3    4e-04   Camelina sativa [gold-of-pleasure]
gb|ADO32899.1|  chitinase 134                                         49.3    4e-04   Vincetoxicum mongolicum
ref|XP_006298138.1|  hypothetical protein CARUB_v10014185mg           49.3    4e-04   Capsella rubella
gb|AAF69772.1|AF135132_1  class I chitinase                           49.3    4e-04   Boechera gunnisoniana
ref|XP_010465018.1|  PREDICTED: basic endochitinase B-like            49.3    4e-04   Camelina sativa [gold-of-pleasure]
gb|ACI23385.1|  basic chitinase                                       47.0    4e-04   Isatis tinctoria [woad]
dbj|BAO45893.1|  chitinase                                            49.3    4e-04   Acacia mangium
ref|XP_009146610.1|  PREDICTED: endochitinase CH25                    49.3    4e-04   
gb|AFY08283.1|  class Ia chitinase                                    49.3    4e-04   
ref|XP_006486645.1|  PREDICTED: endochitinase 1-like                  49.3    4e-04   
sp|Q09023.1|CHI2_BRANA  RecName: Full=Endochitinase CH25; Flags: ...  49.3    5e-04   
emb|CDY42151.1|  BnaC05g40680D                                        49.3    5e-04   
ref|XP_010029601.1|  PREDICTED: 26 kDa endochitinase 2-like           47.4    5e-04   
dbj|BAA82818.1|  basic endochitinase                                  48.9    5e-04   
ref|XP_010029605.1|  PREDICTED: 26 kDa endochitinase 2-like           47.4    5e-04   
gb|AAF64475.1|AF241267_1  chitinase 2                                 48.9    5e-04   
gb|ACN55075.1|  chitinase Ib                                          48.9    6e-04   
gb|AAT40732.1|  basic chitinase 1-1                                   48.9    6e-04   
gb|ACJ23248.1|  class I chitinase                                     48.9    6e-04   
ref|XP_010499059.1|  PREDICTED: basic endochitinase B                 48.9    6e-04   
emb|CDY50344.1|  BnaC01g38390D                                        48.9    6e-04   
gb|ACL81177.1|  chitinase                                             48.5    7e-04   
gb|ACE79210.1|  chi31                                                 48.5    8e-04   
emb|CDP07195.1|  unnamed protein product                              47.8    8e-04   
gb|ABD92819.1|  class Ib chitinase                                    48.5    9e-04   
gb|ABL86683.1|  CLT1                                                  47.8    9e-04   
ref|XP_004163401.1|  PREDICTED: endochitinase CH25-like               48.1    9e-04   
gb|ACJ62099.1|  chitinase                                             48.5    9e-04   
ref|XP_004134831.1|  PREDICTED: endochitinase CH25-like               48.1    0.001   
ref|XP_004135004.1|  PREDICTED: endochitinase B-like                  48.1    0.001   
gb|AAF69788.1|AF135148_1  class I chitinase                           48.1    0.001   
ref|XP_004163410.1|  PREDICTED: endochitinase B-like                  48.1    0.001   
gb|ACP43629.2|  chitinase                                             48.1    0.001   
dbj|BAA82826.1|  basic endochitinase                                  48.1    0.001   



>ref|XP_009768837.1| PREDICTED: chitinase-like protein 2 [Nicotiana sylvestris]
Length=323

 Score =   184 bits (466),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            MC K WECNKLS+FCCNLTI+D F+TYQFENLFAKRNSP+AHAVGFWDY+SFI ASA +Q
Sbjct  44   MCVKDWECNKLSRFCCNLTISDYFETYQFENLFAKRNSPVAHAVGFWDYKSFITASALYQ  103

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTGGK+MQM E+AAFLGHVGSKTSCGYGVATGG
Sbjct  104  PLGFGTTGGKQMQMKEIAAFLGHVGSKTSCGYGVATGG  141



>ref|XP_006349881.1| PREDICTED: chitinase-like protein 2-like [Solanum tuberosum]
Length=327

 Score =   182 bits (463),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            MC K WECN LS+FCCNLTI+D F+TYQFENLF+KRNSP+AHAVGFWDY+SFI+ASA FQ
Sbjct  47   MCVKDWECNVLSRFCCNLTISDFFETYQFENLFSKRNSPVAHAVGFWDYKSFIIASALFQ  106

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTGGK+MQM E+AAFLGHVGSKTSCGYGVATGG
Sbjct  107  PLGFGTTGGKQMQMKEIAAFLGHVGSKTSCGYGVATGG  144



>ref|XP_009617372.1| PREDICTED: chitinase-like protein 2 [Nicotiana tomentosiformis]
Length=323

 Score =   182 bits (461),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            MC K WECNKLS+FCCNLTI+D F+TYQFENLF KRNSP+AHAVGFWDY+SFI ASA +Q
Sbjct  44   MCVKDWECNKLSRFCCNLTISDYFETYQFENLFVKRNSPVAHAVGFWDYKSFITASALYQ  103

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTGGK+MQM E+AAFLGHVGSKTSCGYGVATGG
Sbjct  104  PLGFGTTGGKQMQMKEIAAFLGHVGSKTSCGYGVATGG  141



>ref|XP_004252963.1| PREDICTED: chitinase-like protein 1 [Solanum lycopersicum]
Length=328

 Score =   177 bits (449),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            MC K WECN LS+FCCNLTI+D F+TYQFENLF+KRNSP+AH+ GFWDY+SFI+ASA FQ
Sbjct  49   MCVKDWECNVLSRFCCNLTISDFFETYQFENLFSKRNSPVAHSAGFWDYKSFIIASALFQ  108

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTGGK MQM E+AAFLGHVGSKTSCGYGVATGG
Sbjct  109  PLGFGTTGGKFMQMKEIAAFLGHVGSKTSCGYGVATGG  146



>ref|XP_002269474.1| PREDICTED: chitinase-like protein 2 [Vitis vinifera]
Length=316

 Score =   175 bits (443),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC   S+FCCNLTI+D F TYQFENLF+KRNSP+AHAVGFWDYRSFILASA +Q
Sbjct  39   VCDKGWECKGWSEFCCNLTISDYFQTYQFENLFSKRNSPVAHAVGFWDYRSFILASAVYQ  98

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTGGK MQM ELAAFLGHVG KTSCGYGVATGG
Sbjct  99   PLGFGTTGGKVMQMKELAAFLGHVGCKTSCGYGVATGG  136



>ref|XP_006364661.1| PREDICTED: chitinase-like protein 1-like [Solanum tuberosum]
Length=323

 Score =   174 bits (442),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            MC K WECNKLSKFCCNLTITD  DT QFE LF KRNSP+AHAVGFWDY SFI A+A +Q
Sbjct  44   MCVKDWECNKLSKFCCNLTITDYLDTDQFELLFTKRNSPVAHAVGFWDYGSFIRATALYQ  103

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTGGKKMQM E+AAFLGHVGSKTSCGYGVATGG
Sbjct  104  PLGFGTTGGKKMQMKEIAAFLGHVGSKTSCGYGVATGG  141



>ref|XP_008222679.1| PREDICTED: chitinase-like protein 1 [Prunus mume]
Length=321

 Score =   171 bits (434),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C +GWEC   S++CCNLTI+D F TYQFENLF+KRN+P+AHAVGFWDY+SFI ASA FQ
Sbjct  41   VCDRGWECKGWSQYCCNLTISDFFQTYQFENLFSKRNTPVAHAVGFWDYQSFITASALFQ  100

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTGGK MQM E+AAFLGHVGSKTSCGYGVATGG
Sbjct  101  PLGFGTTGGKLMQMKEIAAFLGHVGSKTSCGYGVATGG  138



>ref|XP_009623434.1| PREDICTED: chitinase-like protein 1 [Nicotiana tomentosiformis]
Length=325

 Score =   171 bits (433),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            MC K WECNKLSKFCCNLTITD  D  QFE LFAKRN+P+AHAVGFWDY SFI A+A +Q
Sbjct  46   MCVKDWECNKLSKFCCNLTITDYLDVDQFELLFAKRNTPVAHAVGFWDYSSFINAAALYQ  105

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTGGK+MQM E+AAFLGHVGSKT+CGYGVATGG
Sbjct  106  PLGFGTTGGKRMQMKEIAAFLGHVGSKTTCGYGVATGG  143



>ref|XP_004247978.1| PREDICTED: chitinase-like protein 1 [Solanum lycopersicum]
Length=319

 Score =   171 bits (433),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            MC K WECNKLSKFCCNLTITD  D  QFE LF KRNSP+AHAVGFWDY SFI A+A +Q
Sbjct  42   MCVKDWECNKLSKFCCNLTITDYLDVDQFELLFTKRNSPVAHAVGFWDYGSFIRAAALYQ  101

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTGGKKMQM E+AAF GHVGSKTSCGYGVATGG
Sbjct  102  PLGFGTTGGKKMQMKEIAAFFGHVGSKTSCGYGVATGG  139



>ref|XP_007227478.1| hypothetical protein PRUPE_ppa008743mg [Prunus persica]
 gb|EMJ28677.1| hypothetical protein PRUPE_ppa008743mg [Prunus persica]
Length=321

 Score =   170 bits (431),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C +GWEC   S++CCNLTI+D F TYQFENLF+KRN+P+AHAVGFWDY+SFI ASA FQ
Sbjct  41   VCDRGWECKGWSQYCCNLTISDFFQTYQFENLFSKRNTPVAHAVGFWDYQSFITASALFQ  100

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTGGK MQM E+AAFLGHVGSKT+CGYGVATGG
Sbjct  101  PLGFGTTGGKLMQMKEIAAFLGHVGSKTTCGYGVATGG  138



>ref|XP_008386854.1| PREDICTED: LOW QUALITY PROTEIN: chitinase-like protein 1 [Malus 
domestica]
Length=321

 Score =   169 bits (429),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC   SK+CCNLTI+D F TYQFENLF+KRN+P+AHAVGFWDY++FI A+A F+
Sbjct  41   LCDKGWECKGWSKYCCNLTISDYFQTYQFENLFSKRNTPVAHAVGFWDYQAFITAAALFE  100

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTGGK MQM E+AAFLGHVGSKTSCGYGVATGG
Sbjct  101  PLGFGTTGGKLMQMKEIAAFLGHVGSKTSCGYGVATGG  138



>ref|XP_008353968.1| PREDICTED: chitinase-like protein 1 [Malus domestica]
Length=321

 Score =   169 bits (428),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC   SK+CCNLTI+D F TYQFENLF+KRN+P+AHAVGFWDY++FI A+A F+
Sbjct  41   LCDKGWECKGWSKYCCNLTISDYFQTYQFENLFSKRNTPVAHAVGFWDYQAFITAAALFE  100

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTGGK MQM E+AAFLGHVGSKTSCGYGVATGG
Sbjct  101  PLGFGTTGGKLMQMKEIAAFLGHVGSKTSCGYGVATGG  138



>ref|XP_008343357.1| PREDICTED: chitinase-like protein 1 [Malus domestica]
Length=321

 Score =   169 bits (428),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC   SK+CCNLTI+D F TYQFENLF+KRN+P+AHAVGFWDY++FI A+A F+
Sbjct  41   LCDKGWECKGWSKYCCNLTISDYFQTYQFENLFSKRNTPVAHAVGFWDYQAFITAAALFE  100

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTGGK MQM E+AAFLGHVGSKTSCGYGVATGG
Sbjct  101  PLGFGTTGGKLMQMKEIAAFLGHVGSKTSCGYGVATGG  138



>ref|XP_009775616.1| PREDICTED: chitinase-like protein 1 [Nicotiana sylvestris]
Length=325

 Score =   169 bits (428),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            MC K WECNKLSKFCCNLTITD  D  QFE LFAKRN+P+AHAVGFWDY SFI A+A +Q
Sbjct  46   MCVKDWECNKLSKFCCNLTITDYLDVDQFELLFAKRNTPVAHAVGFWDYSSFINAAALYQ  105

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTGGK+MQM E+AAF GHVGSKT+CGYGVATGG
Sbjct  106  PLGFGTTGGKRMQMKEIAAFFGHVGSKTTCGYGVATGG  143



>gb|KDP37888.1| hypothetical protein JCGZ_05770 [Jatropha curcas]
Length=318

 Score =   169 bits (427),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = +3

Query  237  CAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQP  416
            C +GWEC   S +CCN TI+DIF TYQFENLF+KRN+P+AHA+GFWDY+SFI AS  FQP
Sbjct  42   CTRGWECKDWSVYCCNQTISDIFQTYQFENLFSKRNAPVAHAIGFWDYQSFITASTTFQP  101

Query  417  LGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            LGF TTGGK MQM ELAAFLGHVGSKTSCGYGVATGG
Sbjct  102  LGFCTTGGKLMQMKELAAFLGHVGSKTSCGYGVATGG  138



>ref|XP_008391633.1| PREDICTED: chitinase-like protein 1 [Malus domestica]
Length=388

 Score =   170 bits (431),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC   SK+CCNLTI+D F TYQFENLF+KRN+P+AHAVGFWDY++FI A+A F+
Sbjct  108  LCDKGWECKGWSKYCCNLTISDFFQTYQFENLFSKRNTPVAHAVGFWDYQAFITAAALFE  167

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTGGK MQM E+AAFLGHVGSKTSCGYGVATGG
Sbjct  168  PLGFGTTGGKLMQMKEVAAFLGHVGSKTSCGYGVATGG  205



>dbj|BAI63079.1| putative chitinase [Epipremnum aureum]
Length=305

 Score =   168 bits (425),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC   SK+CCN TITD F  YQFENLF+KRN+P+AHAVGFWDY++FI A+A +Q
Sbjct  31   LCDKGWECKGPSKYCCNDTITDFFQVYQFENLFSKRNAPVAHAVGFWDYQAFITAAAVYQ  90

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTGGKKMQM E+AAFLGHVGSKTSCGYGVATGG
Sbjct  91   PLGFGTTGGKKMQMKEVAAFLGHVGSKTSCGYGVATGG  128



>ref|XP_009339898.1| PREDICTED: chitinase-like protein 1 [Pyrus x bretschneideri]
Length=321

 Score =   168 bits (426),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC   SK+CCNLTI+D F TYQFENLF+KRN+P+AHAVGFWDY++FI A+A F+
Sbjct  41   LCDKGWECKGWSKYCCNLTISDYFQTYQFENLFSKRNTPVAHAVGFWDYQAFINAAALFE  100

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTGGK MQM E+AAFLGHVGSKTSCGYGVATGG
Sbjct  101  PLGFGTTGGKLMQMKEIAAFLGHVGSKTSCGYGVATGG  138



>ref|XP_007022927.1| Chitinase family protein [Theobroma cacao]
 gb|EOY25549.1| Chitinase family protein [Theobroma cacao]
Length=322

 Score =   168 bits (425),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C +GWECN  S +CCN TI+DIF  YQFENLF+KRNSP+AHAVGFWDY+SFILA+AD++
Sbjct  42   VCLQGWECNVWSVYCCNQTISDIFQVYQFENLFSKRNSPVAHAVGFWDYQSFILAAADYE  101

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
             LGF TTGGK MQM E+AAFLGHVG+KTSCGYGVATGG
Sbjct  102  HLGFGTTGGKLMQMKEIAAFLGHVGAKTSCGYGVATGG  139



>ref|XP_010270668.1| PREDICTED: chitinase-like protein 1 [Nelumbo nucifera]
 ref|XP_010270669.1| PREDICTED: chitinase-like protein 1 [Nelumbo nucifera]
Length=308

 Score =   167 bits (423),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 86/98 (88%), Gaps = 1/98 (1%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC   SK+CCNLTI+D F  YQFENLF+KRNSPI+HAVGFWDY+SFILAS  FQ
Sbjct  32   VCTKGWECQG-SKYCCNLTISDYFQVYQFENLFSKRNSPISHAVGFWDYQSFILASTLFQ  90

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTGGK MQM E+AAFLGHVGS+TSCGYGVATGG
Sbjct  91   PLGFGTTGGKLMQMKEIAAFLGHVGSQTSCGYGVATGG  128



>ref|XP_010069371.1| PREDICTED: chitinase-like protein 1 [Eucalyptus grandis]
 gb|KCW57693.1| hypothetical protein EUGRSUZ_H00455 [Eucalyptus grandis]
 gb|KCW57694.1| hypothetical protein EUGRSUZ_H00455 [Eucalyptus grandis]
Length=322

 Score =   166 bits (420),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC+  SK+CCN TI+DIF TYQFENLF+KRNSP+AHAVGFWDY+SFIL++A ++
Sbjct  42   VCIKGWECSTWSKYCCNETISDIFQTYQFENLFSKRNSPVAHAVGFWDYQSFILSAALYE  101

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTG   MQM E+AAFLGHVG+KTSCGYGVATGG
Sbjct  102  PLGFGTTGNTTMQMMEVAAFLGHVGAKTSCGYGVATGG  139



>ref|XP_004296698.1| PREDICTED: chitinase-like protein 1 [Fragaria vesca subsp. vesca]
Length=323

 Score =   166 bits (420),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = +3

Query  237  CAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQP  416
            C KGWEC   S++CCNLTITD F TYQFE LF+ RN+P+AHAVGFWDY+SFILA++ FQP
Sbjct  47   CDKGWECKGWSQYCCNLTITDFFQTYQFEELFSNRNAPVAHAVGFWDYKSFILAASLFQP  106

Query  417  LGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
             GF TTGGK MQM ELAAFLGHVGSKTSCGYGVATGG
Sbjct  107  QGFCTTGGKLMQMKELAAFLGHVGSKTSCGYGVATGG  143



>ref|XP_011073914.1| PREDICTED: chitinase-like protein 1 [Sesamum indicum]
 ref|XP_011073915.1| PREDICTED: chitinase-like protein 1 [Sesamum indicum]
Length=320

 Score =   166 bits (420),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C +GWEC   SKFCCN TI+D F TYQFENLFAKRN+P+AHAVGFWDY+SFI A+A +Q
Sbjct  43   VCDQGWECKGFSKFCCNQTISDFFQTYQFENLFAKRNTPVAHAVGFWDYKSFITAAAKYQ  102

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTGGK  QM E+AAF GHVG+KTSCGYGVATGG
Sbjct  103  PLGFGTTGGKLTQMKEIAAFFGHVGAKTSCGYGVATGG  140



>gb|AFW90525.1| chitinase-like protein 1-like isoform 1 [Phaseolus vulgaris]
Length=323

 Score =   166 bits (420),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 83/97 (86%), Gaps = 0/97 (0%)
 Frame = +3

Query  237  CAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQP  416
            C KGWEC   S +CCNLTITD F TYQFENLF+KRNSP+AHAVGFWDYRSFI A+A F+P
Sbjct  45   CDKGWECKGWSIYCCNLTITDYFQTYQFENLFSKRNSPVAHAVGFWDYRSFIAAAALFEP  104

Query  417  LGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            LGF TTG K  QM E+AAFLGHVGSKTSCGYGVATGG
Sbjct  105  LGFGTTGNKTTQMMEVAAFLGHVGSKTSCGYGVATGG  141



>gb|AHA84180.1| chitinase-like protein 1 [Phaseolus vulgaris]
Length=323

 Score =   166 bits (419),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 83/97 (86%), Gaps = 0/97 (0%)
 Frame = +3

Query  237  CAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQP  416
            C KGWEC   S +CCNLTITD F TYQFENLF+KRNSP+AHAVGFWDYRSFI A+A F+P
Sbjct  45   CDKGWECKGWSIYCCNLTITDYFQTYQFENLFSKRNSPVAHAVGFWDYRSFIAAAALFEP  104

Query  417  LGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            LGF TTG K  QM E+AAFLGHVGSKTSCGYGVATGG
Sbjct  105  LGFGTTGNKTTQMMEVAAFLGHVGSKTSCGYGVATGG  141



>gb|AGV54496.1| class-1 chitinase [Phaseolus vulgaris]
Length=322

 Score =   166 bits (419),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 83/97 (86%), Gaps = 0/97 (0%)
 Frame = +3

Query  237  CAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQP  416
            C KGWEC   S +CCNLTITD F TYQFENLF+KRNSP+AHAVGFWDYRSFI A+A F+P
Sbjct  45   CDKGWECKGWSIYCCNLTITDYFQTYQFENLFSKRNSPVAHAVGFWDYRSFIAAAALFEP  104

Query  417  LGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            LGF TTG K  QM E+AAFLGHVGSKTSCGYGVATGG
Sbjct  105  LGFGTTGNKTTQMMEVAAFLGHVGSKTSCGYGVATGG  141



>gb|EYU36737.1| hypothetical protein MIMGU_mgv1a010106mg [Erythranthe guttata]
 gb|EYU36738.1| hypothetical protein MIMGU_mgv1a010106mg [Erythranthe guttata]
Length=322

 Score =   165 bits (418),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C +GWEC  LSK+CCN TI+D F TYQFE LF  RNSP++HAVGFWDYRSFI A+A +Q
Sbjct  45   LCDQGWECKGLSKYCCNQTISDFFQTYQFETLFENRNSPVSHAVGFWDYRSFITAAATYQ  104

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTGGK +QM E+AAFLGHVG+KTSCGYGVATGG
Sbjct  105  PLGFGTTGGKTLQMKEVAAFLGHVGAKTSCGYGVATGG  142



>gb|AFK38281.1| unknown [Medicago truncatula]
Length=171

 Score =   161 bits (407),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +3

Query  237  CAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQP  416
            C KGWEC   S +CCNLTITD F TYQFENLF+KRN+PIAHAVGFWDY SFI A++ F+P
Sbjct  42   CDKGWECKGWSIYCCNLTITDYFQTYQFENLFSKRNTPIAHAVGFWDYHSFINAASLFEP  101

Query  417  LGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            LGF TTG K  QM E+AAFLGHVGSKTSCGYGVATGG
Sbjct  102  LGFGTTGNKTTQMMEIAAFLGHVGSKTSCGYGVATGG  138



>ref|XP_006298086.1| hypothetical protein CARUB_v10014131mg [Capsella rubella]
 gb|EOA30984.1| hypothetical protein CARUB_v10014131mg [Capsella rubella]
Length=336

 Score =   166 bits (419),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC   S++CCN TI+D F+TYQFENLF+KRNSP+AHAVGFWDYRSFI A+A++Q
Sbjct  51   LCDKGWECKGWSQYCCNHTISDFFETYQFENLFSKRNSPVAHAVGFWDYRSFITAAAEYQ  110

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTG K  +M E+AAFLGHVGSKTSCGYGVATGG
Sbjct  111  PLGFGTTGEKLQRMKEVAAFLGHVGSKTSCGYGVATGG  148



>ref|XP_007139304.1| hypothetical protein PHAVU_008G018100g [Phaseolus vulgaris]
 gb|ESW11298.1| hypothetical protein PHAVU_008G018100g [Phaseolus vulgaris]
Length=323

 Score =   165 bits (418),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 83/97 (86%), Gaps = 0/97 (0%)
 Frame = +3

Query  237  CAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQP  416
            C KGWEC   S +CCNLTITD F TYQFENLF+KRNSP+AHAVGFWDYRSFI A+A F+P
Sbjct  45   CDKGWECKGWSIYCCNLTITDYFQTYQFENLFSKRNSPVAHAVGFWDYRSFIAAAALFEP  104

Query  417  LGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            LGF TTG K  QM E+AAFLGHVGSKTSCGYGVATGG
Sbjct  105  LGFGTTGNKTTQMMEVAAFLGHVGSKTSCGYGVATGG  141



>ref|XP_002276563.1| PREDICTED: chitinase-like protein 2 [Vitis vinifera]
 emb|CAN78546.1| hypothetical protein VITISV_034797 [Vitis vinifera]
Length=321

 Score =   165 bits (418),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC   SK+CCN T++D F TYQFENLFAKRN+P+AHAVGFWDYRSFI A+A +Q
Sbjct  40   VCDKGWECKGWSKYCCNQTVSDFFQTYQFENLFAKRNTPVAHAVGFWDYRSFITAAAVYQ  99

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            P GF T GGK MQM E+AAFLGHVGSKT+CGYGVATGG
Sbjct  100  PHGFGTAGGKLMQMKEVAAFLGHVGSKTTCGYGVATGG  137



>ref|XP_008438940.1| PREDICTED: chitinase-like protein 2 [Cucumis melo]
Length=322

 Score =   165 bits (417),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC   S++CCN TI+D F TYQFENLF+KRNSP+AHAVGFWDYRSFI A+A FQ
Sbjct  42   LCDKGWECKGWSEYCCNHTISDYFQTYQFENLFSKRNSPVAHAVGFWDYRSFITAAALFQ  101

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            P GF TTGGK M M E+AAFLGHVGSKTSCGYGVATGG
Sbjct  102  PHGFGTTGGKLMGMKEIAAFLGHVGSKTSCGYGVATGG  139



>ref|XP_008453931.1| PREDICTED: chitinase-like protein 1 [Cucumis melo]
Length=318

 Score =   164 bits (416),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 86/98 (88%), Gaps = 1/98 (1%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C +GWEC+  S +CCNLTITD F+TYQFENLFAKRNSP+AHAVGFWD+ SFILA+A F+
Sbjct  39   LCDRGWECS-WSTYCCNLTITDYFETYQFENLFAKRNSPVAHAVGFWDFHSFILAAAQFE  97

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTG KKMQM ELAAFLGHVGSKTSCG GV TGG
Sbjct  98   PLGFGTTGDKKMQMKELAAFLGHVGSKTSCGDGVVTGG  135



>ref|XP_010913810.1| PREDICTED: chitinase-like protein 1 [Elaeis guineensis]
 ref|XP_010910752.1| PREDICTED: chitinase-like protein 1 [Elaeis guineensis]
 gb|AFV30204.1| chitinase-like protein [Elaeis guineensis]
Length=309

 Score =   164 bits (415),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 85/98 (87%), Gaps = 1/98 (1%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC K S +CCN TI+D+F  YQFENLF+KRN+P+AHAVGFWDY+SFI AS  +Q
Sbjct  35   LCTKGWEC-KASVYCCNQTISDLFQVYQFENLFSKRNTPVAHAVGFWDYQSFITASTAYQ  93

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            P GF TTGGK+MQM E+AAFLGHVGSKTSCGYGVATGG
Sbjct  94   PQGFGTTGGKQMQMKEVAAFLGHVGSKTSCGYGVATGG  131



>ref|XP_002515664.1| chitinase, putative [Ricinus communis]
 gb|EEF46716.1| chitinase, putative [Ricinus communis]
Length=321

 Score =   164 bits (416),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C +GWEC   S++CCN TI+D F TYQFENLF+KRN+P+AHA+GFWDY+SFI ASA FQ
Sbjct  41   VCTRGWECASWSEYCCNQTISDFFQTYQFENLFSKRNAPVAHAIGFWDYQSFITASALFQ  100

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTGGK MQM ELAAF  HVGSKTSCGYGVATGG
Sbjct  101  PLGFCTTGGKLMQMKELAAFFSHVGSKTSCGYGVATGG  138



>gb|ACJ85217.1| unknown [Medicago truncatula]
 gb|ACJ85223.1| unknown [Medicago truncatula]
 gb|AFK49011.1| unknown [Medicago truncatula]
Length=189

 Score =   160 bits (406),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +3

Query  237  CAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQP  416
            C KGWEC   S +CCNLTITD F TYQFENLF+KRN+PIAHAVGFWDY SFI A++ F+P
Sbjct  42   CDKGWECKGWSIYCCNLTITDYFQTYQFENLFSKRNTPIAHAVGFWDYHSFINAASLFEP  101

Query  417  LGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            LGF TTG K  QM E+AAFLGHVGSKTSCGYGVATGG
Sbjct  102  LGFGTTGNKTTQMMEIAAFLGHVGSKTSCGYGVATGG  138



>gb|KHN13837.1| Chitinase-like protein 1 [Glycine soja]
Length=329

 Score =   164 bits (415),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +3

Query  237  CAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQP  416
            C KGWEC   S +CCNLTITD F TYQFENLF+KRNSP+AHAVGFWDY SFI A+A F+P
Sbjct  51   CDKGWECKGWSIYCCNLTITDYFQTYQFENLFSKRNSPVAHAVGFWDYHSFIAAAALFEP  110

Query  417  LGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
             GF TTG K MQM E+AAFLGHVGSKTSCGYGVATGG
Sbjct  111  QGFGTTGNKTMQMMEIAAFLGHVGSKTSCGYGVATGG  147



>gb|AFY08284.1| class Ib chitinase [Acacia koa]
Length=319

 Score =   164 bits (414),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC   S +CCNLTITD F  YQFENLF+KRNSP+AHAVGFWDY SFI A+A ++
Sbjct  39   LCDKGWECKGWSIYCCNLTITDYFQPYQFENLFSKRNSPVAHAVGFWDYHSFITAAAVYE  98

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTG K MQM E+AAFL HVGSKTSCGYGVATGG
Sbjct  99   PLGFGTTGNKTMQMKEIAAFLAHVGSKTSCGYGVATGG  136



>ref|XP_008337550.1| PREDICTED: chitinase-like protein 1 [Malus domestica]
Length=321

 Score =   163 bits (413),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGW+C   SK+ CNLTI+D F TYQFENLF+KRN+P+AHAVGFWDY++FI A+A F+
Sbjct  41   LCDKGWKCKGWSKYFCNLTISDYFQTYQFENLFSKRNTPVAHAVGFWDYQAFITAAALFE  100

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTGGK MQM E+AAFLGHVGSKTSCGYGVATGG
Sbjct  101  PLGFGTTGGKLMQMKEIAAFLGHVGSKTSCGYGVATGG  138



>gb|KFK39034.1| hypothetical protein AALP_AA3G192100 [Arabis alpina]
Length=326

 Score =   164 bits (414),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC   S++CCN TI+D F+TYQFENLF+KRNSP+AHA GFWDYRSFI A+A++Q
Sbjct  49   LCDKGWECKGWSEYCCNHTISDFFETYQFENLFSKRNSPVAHAAGFWDYRSFINAAAEYQ  108

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTG K+  M E+AAFLGHVGSKTSCGYGVATGG
Sbjct  109  PLGFGTTGEKRQGMKEVAAFLGHVGSKTSCGYGVATGG  146



>ref|XP_008781695.1| PREDICTED: chitinase-like protein 1 [Phoenix dactylifera]
Length=307

 Score =   163 bits (412),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 85/98 (87%), Gaps = 1/98 (1%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC K S +CCN TI+D+F  YQFENLF+KRN+P+A AVGFWDY SFI ASA +Q
Sbjct  33   LCNKGWEC-KASVYCCNETISDLFQVYQFENLFSKRNTPVAQAVGFWDYHSFITASAVYQ  91

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTGGK+MQM E+AAFLGHVGSKTSCGYGVATGG
Sbjct  92   PLGFGTTGGKQMQMKEVAAFLGHVGSKTSCGYGVATGG  129



>ref|XP_010024779.1| PREDICTED: chitinase-like protein 2 [Eucalyptus grandis]
 gb|KCW61274.1| hypothetical protein EUGRSUZ_H04034 [Eucalyptus grandis]
Length=329

 Score =   163 bits (413),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC KLS++CCN TI+D F  YQFENLF+KRNSP+AHA GFWDY SFI A+A++Q
Sbjct  46   LCTKGWECKKLSQYCCNQTISDYFQAYQFENLFSKRNSPVAHAAGFWDYHSFITAAAEYQ  105

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            P GF T+GGK   M E+AAFLGHVGSKTSCGYGVATGG
Sbjct  106  PHGFGTSGGKVTAMKEVAAFLGHVGSKTSCGYGVATGG  143



>ref|XP_010487564.1| PREDICTED: chitinase-like protein 2 [Camelina sativa]
Length=335

 Score =   163 bits (413),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC   S +CCN TI+D FDTYQFE LF+KRNSP+AHAVGFWDYRSFI A+A++Q
Sbjct  52   LCDKGWECKGWSAYCCNHTISDFFDTYQFEELFSKRNSPVAHAVGFWDYRSFITAAAEYQ  111

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTG K   M E+AAFLGHVGSKTSCGYGVATGG
Sbjct  112  PLGFGTTGEKLQGMKEVAAFLGHVGSKTSCGYGVATGG  149



>gb|ABL86685.1| CLT3 [Gossypium barbadense]
Length=316

 Score =   162 bits (411),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC   S+FCCN TI+D F TYQFENLFAKRN+P+AHAVGFWDY SFI A+A +Q
Sbjct  36   LCDKGWECKGWSQFCCNQTISDYFQTYQFENLFAKRNTPVAHAVGFWDYHSFITAAAQYQ  95

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            P GF TTGGK   M E+AAFLGHVGSKTSCGYGVATGG
Sbjct  96   PHGFGTTGGKLQSMKEVAAFLGHVGSKTSCGYGVATGG  133



>ref|XP_006660787.1| PREDICTED: chitinase-like protein 1-like [Oryza brachyantha]
Length=326

 Score =   162 bits (411),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 86/98 (88%), Gaps = 1/98 (1%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC+  SK+CCN TITD F  YQFENLFAKRNSP+AHAVGFWDY++FI A+A F+
Sbjct  47   VCDKGWECSG-SKYCCNDTITDFFKVYQFENLFAKRNSPVAHAVGFWDYQAFITAAALFE  105

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTGGK+MQM EL AFLGHVGSKTSCGYGVATGG
Sbjct  106  PLGFCTTGGKQMQMMELCAFLGHVGSKTSCGYGVATGG  143



>gb|KJB34691.1| hypothetical protein B456_006G078900 [Gossypium raimondii]
Length=317

 Score =   162 bits (410),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC   S+FCCN TI+D F TYQFENLFAKRN+P+AHAVGFWDY SFI A+A +Q
Sbjct  36   LCDKGWECKGWSQFCCNQTISDYFQTYQFENLFAKRNTPVAHAVGFWDYHSFITAAAQYQ  95

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            P GF TTGGK   M E+AAFLGHVGSKTSCGYGVATGG
Sbjct  96   PHGFGTTGGKLQSMKEVAAFLGHVGSKTSCGYGVATGG  133



>ref|XP_010276208.1| PREDICTED: chitinase-like protein 1 [Nelumbo nucifera]
Length=319

 Score =   162 bits (410),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 84/98 (86%), Gaps = 1/98 (1%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC K S +CCN TI+D F TYQFE+LFAKRNSP+AHAVGFWDY SFI ASA +Q
Sbjct  42   VCTKGWEC-KNSVYCCNQTISDFFQTYQFEDLFAKRNSPVAHAVGFWDYHSFITASALYQ  100

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            P GF TTGGK MQM E+AAFLGHVGSKTSCGYGVATGG
Sbjct  101  PHGFGTTGGKLMQMKEVAAFLGHVGSKTSCGYGVATGG  138



>ref|XP_002885177.1| AT3g16920/K14A17_4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61436.1| AT3g16920/K14A17_4 [Arabidopsis lyrata subsp. lyrata]
Length=333

 Score =   162 bits (411),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC   S++CCN TI+D F+TYQFENLF+KRNSP+AHAVGFWDYRSFI A+A++Q
Sbjct  49   LCDKGWECKGWSEYCCNHTISDFFETYQFENLFSKRNSPVAHAVGFWDYRSFITAAAEYQ  108

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF T G K   M E+AAFLGHVGSKTSCGYGVATGG
Sbjct  109  PLGFGTAGEKLQGMKEVAAFLGHVGSKTSCGYGVATGG  146



>ref|XP_004152085.1| PREDICTED: chitinase-like protein 1-like isoform 2 [Cucumis sativus]
 ref|XP_004161592.1| PREDICTED: chitinase-like protein 1-like [Cucumis sativus]
 gb|KGN53123.1| hypothetical protein Csa_4G017110 [Cucumis sativus]
Length=318

 Score =   162 bits (410),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 84/98 (86%), Gaps = 1/98 (1%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C +GWEC   S +CCNLTITD F+TYQFENLFAKRNSP+AHAVGFWD+ SFILA+A F+
Sbjct  39   LCDRGWECT-WSTYCCNLTITDYFETYQFENLFAKRNSPVAHAVGFWDFHSFILAAAQFE  97

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTG KKMQM E+AAF GHVGSKTSCG GV TGG
Sbjct  98   PLGFGTTGDKKMQMKEIAAFFGHVGSKTSCGDGVVTGG  135



>gb|AHC69781.1| chitinase [Quercus suber]
Length=316

 Score =   162 bits (410),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +3

Query  237  CAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQP  416
            C KGWEC + SKFCC  TI++ F TYQFENLFAKRN+P+AHAVGFWDY SFI A+A+ QP
Sbjct  39   CQKGWECKRFSKFCCKETISEYFQTYQFENLFAKRNTPVAHAVGFWDYHSFITAAAEHQP  98

Query  417  LGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
             GF TTGGKK  M E+AAFLGHVGSKTSCGYGVATGG
Sbjct  99   DGFGTTGGKKTGMKEVAAFLGHVGSKTSCGYGVATGG  135



>sp|Q9LSP9.1|CTL2_ARATH RecName: Full=Chitinase-like protein 2; Short=AtCTL2; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAL06524.1|AF412071_1 AT3g16920/K14A17_4 [Arabidopsis thaliana]
 dbj|BAA94976.1| basic chitinase [Arabidopsis thaliana]
 gb|AAL90922.1| AT3g16920/K14A17_4 [Arabidopsis thaliana]
 dbj|BAE98469.1| putative basic chitinase [Arabidopsis thaliana]
Length=333

 Score =   162 bits (411),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC   S++CCN TI+D F+TYQFENLF+KRNSP+AHAVGFWDYRSFI A+A++Q
Sbjct  49   LCDKGWECKGWSEYCCNHTISDFFETYQFENLFSKRNSPVAHAVGFWDYRSFITAAAEYQ  108

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF T G K   M E+AAFLGHVGSKTSCGYGVATGG
Sbjct  109  PLGFGTAGEKLQGMKEVAAFLGHVGSKTSCGYGVATGG  146



>gb|AAQ56598.1| chitinase-like protein [Gossypium hirsutum]
Length=318

 Score =   162 bits (410),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC   S+FCCN TI+D F TYQFENLFAKRN+P+AHAVGFWDY SFI A+A +Q
Sbjct  36   LCDKGWECKGWSQFCCNQTISDYFRTYQFENLFAKRNTPVAHAVGFWDYHSFITAAAQYQ  95

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            P GF TTGGK   M E+AAFLGHVGSKTSCGYGVATGG
Sbjct  96   PHGFGTTGGKLQSMKEVAAFLGHVGSKTSCGYGVATGG  133



>ref|XP_010465717.1| PREDICTED: chitinase-like protein 2 [Camelina sativa]
Length=337

 Score =   162 bits (411),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC   S +CCN TI+D FDTYQFE LF+KRNSP+AHAVGFWDYRSFI A+A++Q
Sbjct  52   LCDKGWECKGWSAYCCNHTISDFFDTYQFEELFSKRNSPVAHAVGFWDYRSFITAAAEYQ  111

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTG K   M E+AAFLGHVGSKTSCGYGVATGG
Sbjct  112  PLGFGTTGEKLQGMKEVAAFLGHVGSKTSCGYGVATGG  149



>ref|XP_004162209.1| PREDICTED: chitinase-like protein 2-like [Cucumis sativus]
 gb|KGN57156.1| hypothetical protein Csa_3G166220 [Cucumis sativus]
Length=322

 Score =   162 bits (410),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC   S++CCN TI+D F TYQFENLF+KRNSP+AHA GFWDYRSFI A+A FQ
Sbjct  42   LCDKGWECKGWSEYCCNHTISDYFQTYQFENLFSKRNSPVAHAAGFWDYRSFITAAALFQ  101

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            P GF TTGGK M M E+AAFLGHVGSKT+CGYGVATGG
Sbjct  102  PHGFGTTGGKLMGMKEIAAFLGHVGSKTTCGYGVATGG  139



>ref|XP_006406791.1| hypothetical protein EUTSA_v10021094mg [Eutrema salsugineum]
 gb|ESQ48244.1| hypothetical protein EUTSA_v10021094mg [Eutrema salsugineum]
Length=335

 Score =   162 bits (411),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC   S++CCN TI+D F+TYQFENLF+KRNSP+AHAVGFWDYRSFI A+A++Q
Sbjct  49   LCDKGWECKGWSEYCCNHTISDFFETYQFENLFSKRNSPVAHAVGFWDYRSFITAAAEYQ  108

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF T G K   M E+AAFLGHVGSKTSCGYGVATGG
Sbjct  109  PLGFGTAGEKLQGMKEVAAFLGHVGSKTSCGYGVATGG  146



>ref|NP_188317.2| chitinase-like protein 2 [Arabidopsis thaliana]
 gb|AEE75884.1| chitinase-like protein 2 [Arabidopsis thaliana]
Length=348

 Score =   162 bits (411),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC   S++CCN TI+D F+TYQFENLF+KRNSP+AHAVGFWDYRSFI A+A++Q
Sbjct  64   LCDKGWECKGWSEYCCNHTISDFFETYQFENLFSKRNSPVAHAVGFWDYRSFITAAAEYQ  123

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF T G K   M E+AAFLGHVGSKTSCGYGVATGG
Sbjct  124  PLGFGTAGEKLQGMKEVAAFLGHVGSKTSCGYGVATGG  161



>ref|XP_010504812.1| PREDICTED: chitinase-like protein 2 [Camelina sativa]
Length=335

 Score =   162 bits (410),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC   S +CCN TI+D FDTYQFE LF+KRNSP+AHAVGFWDYRSFI A+A++Q
Sbjct  52   LCNKGWECKGWSAYCCNHTISDFFDTYQFEELFSKRNSPVAHAVGFWDYRSFITAAAEYQ  111

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTG K   M E+AAFLGHVGSKTSCGYGVATGG
Sbjct  112  PLGFGTTGEKLQGMKEVAAFLGHVGSKTSCGYGVATGG  149



>ref|XP_007035746.1| Chitinase-like protein 2 [Theobroma cacao]
 gb|EOY06672.1| Chitinase-like protein 2 [Theobroma cacao]
Length=315

 Score =   162 bits (409),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +3

Query  237  CAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQP  416
            C +GWEC   S++CCN TI+D F TYQFENLFAKRN+P+AHAVGFWDYRSFI A+A +QP
Sbjct  37   CDRGWECKGWSQYCCNQTISDYFQTYQFENLFAKRNTPVAHAVGFWDYRSFITAAARYQP  96

Query  417  LGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
             GF TTGGK   M E+AAFLGHVGSKTSCGYGVATGG
Sbjct  97   HGFGTTGGKLQSMKEVAAFLGHVGSKTSCGYGVATGG  133



>ref|XP_004152084.1| PREDICTED: chitinase-like protein 1-like isoform 1 [Cucumis sativus]
Length=332

 Score =   162 bits (410),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 84/98 (86%), Gaps = 1/98 (1%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C +GWEC   S +CCNLTITD F+TYQFENLFAKRNSP+AHAVGFWD+ SFILA+A F+
Sbjct  53   LCDRGWECT-WSTYCCNLTITDYFETYQFENLFAKRNSPVAHAVGFWDFHSFILAAAQFE  111

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTG KKMQM E+AAF GHVGSKTSCG GV TGG
Sbjct  112  PLGFGTTGDKKMQMKEIAAFFGHVGSKTSCGDGVVTGG  149



>ref|XP_003531920.1| PREDICTED: chitinase-like protein 1-like isoform 1 [Glycine max]
 gb|KHN15575.1| Chitinase-like protein 1 [Glycine soja]
Length=326

 Score =   162 bits (409),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +3

Query  237  CAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQP  416
            C KGWEC   S +CCNLTITD F TYQFENLF+KRNSP+AHAVGFWDY SFI A+A F+P
Sbjct  48   CDKGWECKGWSIYCCNLTITDYFQTYQFENLFSKRNSPVAHAVGFWDYHSFIAAAALFEP  107

Query  417  LGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
             GF TTG K MQM E+AAF GHVGSKTSCGYGVATGG
Sbjct  108  EGFGTTGNKTMQMMEIAAFFGHVGSKTSCGYGVATGG  144



>ref|XP_003621680.1| Endochitinase [Medicago truncatula]
 gb|ABN08775.1| Glycoside hydrolase, family 19 [Medicago truncatula]
 gb|ACJ84914.1| unknown [Medicago truncatula]
 gb|AES77898.1| Nodule Cysteine-Rich (NCR) secreted peptide [Medicago truncatula]
Length=319

 Score =   161 bits (408),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +3

Query  237  CAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQP  416
            C KGWEC   S +CCNLTITD F TYQFENLF+KRN+PIAHAVGFWDY SFI A++ F+P
Sbjct  42   CDKGWECKGWSIYCCNLTITDYFQTYQFENLFSKRNTPIAHAVGFWDYHSFINAASLFEP  101

Query  417  LGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            LGF TTG K  QM E+AAFLGHVGSKTSCGYGVATGG
Sbjct  102  LGFGTTGNKTTQMMEIAAFLGHVGSKTSCGYGVATGG  138



>dbj|BAC81645.1| class1 chitinase [Pisum sativum]
Length=296

 Score =   160 bits (406),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +3

Query  237  CAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQP  416
            C +GWECN  S +CCNLTI+D F TY FENLF+KRN+P+AHAVGFWDY SFI A+A F+P
Sbjct  19   CTQGWECNNWSIYCCNLTISDYFQTYHFENLFSKRNTPVAHAVGFWDYHSFINAAALFEP  78

Query  417  LGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
             GF TTG K MQM E+AAFLGHVGSKTSCGYGVATGG
Sbjct  79   QGFGTTGNKTMQMMEIAAFLGHVGSKTSCGYGVATGG  115



>gb|KHN14660.1| Chitinase-like protein 2 [Glycine soja]
Length=318

 Score =   161 bits (407),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC   S +CCN TI+D F TYQFENLFAKRNSP+AHAVGFWDYRSFI A+A +Q
Sbjct  37   VCDKGWECKGWSAYCCNETISDYFQTYQFENLFAKRNSPVAHAVGFWDYRSFITAAALYQ  96

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTGGK     ELAAF GHVGSKTSCGYGVATGG
Sbjct  97   PLGFGTTGGKTSGQKELAAFFGHVGSKTSCGYGVATGG  134



>gb|AHX74092.1| chitodextrinase [Eucommia ulmoides]
Length=322

 Score =   161 bits (407),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +3

Query  237  CAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQP  416
            C KGWEC   S +CCN TI+D F TYQFE+LF+KRN+P+AHAVGFWDY SFI ASA +QP
Sbjct  42   CDKGWECKGWSIYCCNSTISDYFQTYQFEDLFSKRNTPVAHAVGFWDYHSFITASALYQP  101

Query  417  LGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            LGF T GGK MQM E+AAFLGHVGSKT+CGYGVATGG
Sbjct  102  LGFGTAGGKLMQMKEVAAFLGHVGSKTTCGYGVATGG  138



>ref|NP_001063549.1| Os09g0494200 [Oryza sativa Japonica Group]
 dbj|BAF25463.1| Os09g0494200 [Oryza sativa Japonica Group]
 gb|EAZ09601.1| hypothetical protein OsI_31885 [Oryza sativa Indica Group]
 gb|EAZ45226.1| hypothetical protein OsJ_29870 [Oryza sativa Japonica Group]
Length=326

 Score =   161 bits (407),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 86/98 (88%), Gaps = 1/98 (1%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC+  SK+CCN TITD F  YQFENLF+KRNSP+AHAVGFWDY+SFI A+A F+
Sbjct  47   ICDKGWECSG-SKYCCNDTITDFFKVYQFENLFSKRNSPVAHAVGFWDYQSFITAAALFE  105

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTGGK+MQM EL AFLGHVGSKTSCG+GVATGG
Sbjct  106  PLGFCTTGGKQMQMMELCAFLGHVGSKTSCGFGVATGG  143



>ref|XP_002321089.2| hypothetical protein POPTR_0014s14370g [Populus trichocarpa]
 gb|ABK95866.1| unknown [Populus trichocarpa]
 gb|EEE99404.2| hypothetical protein POPTR_0014s14370g [Populus trichocarpa]
Length=319

 Score =   160 bits (406),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C +GWEC   S++CCN TI+DIF  YQFENLF+ RNSP+AHAVGFWDYRSFILAS  FQ
Sbjct  39   LCKRGWECLDWSEYCCNETISDIFQPYQFENLFSNRNSPVAHAVGFWDYRSFILASTSFQ  98

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
             LGF TTGGK  QM ELAAFL HVG KTSCGYGVATGG
Sbjct  99   HLGFCTTGGKATQMKELAAFLAHVGCKTSCGYGVATGG  136



>ref|NP_001242130.1| uncharacterized protein LOC100811072 precursor [Glycine max]
 gb|ACU19724.1| unknown [Glycine max]
Length=329

 Score =   161 bits (407),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +3

Query  237  CAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQP  416
            C KGWEC   S +CCNLTITD F TYQFENLF+KRNSP+AHAVGFW Y SFI A+A F+P
Sbjct  51   CDKGWECKGWSIYCCNLTITDYFQTYQFENLFSKRNSPVAHAVGFWGYHSFIAAAALFEP  110

Query  417  LGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
             GF TTG K MQM E+AAFLGHVGSKTSCGYGVATGG
Sbjct  111  QGFGTTGNKTMQMMEIAAFLGHVGSKTSCGYGVATGG  147



>gb|KDP27890.1| hypothetical protein JCGZ_18970 [Jatropha curcas]
Length=320

 Score =   160 bits (404),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC  LS +CCN TI+D F TYQFENLF+KRN+P+AHAVGFWDY SFI A+A +Q
Sbjct  41   LCDKGWECKGLSVYCCNQTISDYFQTYQFENLFSKRNTPVAHAVGFWDYHSFITAAAIYQ  100

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            P GF TTGGK M   E+AAFLGHVGSKTSCGYGVATGG
Sbjct  101  PHGFGTTGGKLMGQKEVAAFLGHVGSKTSCGYGVATGG  138



>ref|XP_002519197.1| chitinase, putative [Ricinus communis]
 gb|EEF43061.1| chitinase, putative [Ricinus communis]
Length=324

 Score =   160 bits (404),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC  LS +CCN TI+D F TYQFENLFAKRN+PIAHAVGFWDY SFI A+A +Q
Sbjct  45   VCDKGWECKGLSIYCCNQTISDYFQTYQFENLFAKRNTPIAHAVGFWDYHSFITAAAIYQ  104

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            P GF T+GGK M   E+AAFLGHVGSKTSCGYGVATGG
Sbjct  105  PHGFGTSGGKLMGQKEVAAFLGHVGSKTSCGYGVATGG  142



>ref|XP_008796626.1| PREDICTED: chitinase-like protein 1 [Phoenix dactylifera]
Length=299

 Score =   159 bits (401),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 85/98 (87%), Gaps = 1/98 (1%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC+  SK+CCN TITD F  YQFENLF+KRN+P+AHAVGFWDY SFI A+A ++
Sbjct  26   VCDKGWECSG-SKYCCNETITDYFQVYQFENLFSKRNAPVAHAVGFWDYHSFITAAAVYE  84

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTGGK+M M E+AAFLGHVGSKTSCGYGVA+GG
Sbjct  85   PLGFGTTGGKQMGMKEVAAFLGHVGSKTSCGYGVASGG  122



>ref|XP_011006099.1| PREDICTED: chitinase-like protein 1 [Populus euphratica]
Length=319

 Score =   159 bits (402),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C +GWEC   S++CCN TI+D F  YQFENLF+ RNSP+AHAVGFWDYRSFILAS  FQ
Sbjct  39   LCKRGWECLDWSEYCCNQTISDFFQPYQFENLFSNRNSPVAHAVGFWDYRSFILASTSFQ  98

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
             LGF TTGGK  QM ELAAFL HVG KTSCGYGVATGG
Sbjct  99   HLGFCTTGGKATQMKELAAFLAHVGCKTSCGYGVATGG  136



>gb|KDO35933.1| hypothetical protein CISIN_1g029634mg [Citrus sinensis]
Length=190

 Score =   155 bits (392),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC   S++CCN TI+D F TYQFENLFAKRN+P+AHAVGFWDY SFI A+A +Q
Sbjct  40   LCDKGWECKGWSEYCCNQTISDYFQTYQFENLFAKRNTPVAHAVGFWDYHSFITAAALYQ  99

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            P GF T+ GK M   E+AAFLGHVGSKTSCGYGVATGG
Sbjct  100  PHGFGTSAGKLMGQKEVAAFLGHVGSKTSCGYGVATGG  137



>ref|XP_003533202.1| PREDICTED: chitinase-like protein 2-like [Glycine max]
 gb|KHN12899.1| Chitinase-like protein 2 [Glycine soja]
Length=317

 Score =   159 bits (401),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC   S +CCN TI+D F TYQFENLFAKRNSP+AHAVGFWDYRSFI A+A +Q
Sbjct  36   VCDKGWECKGWSAYCCNETISDYFQTYQFENLFAKRNSPVAHAVGFWDYRSFITAAALYQ  95

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            P GF TTGGK     ELAAF GHVGSKTSCGYGVATGG
Sbjct  96   PHGFGTTGGKTSGQKELAAFFGHVGSKTSCGYGVATGG  133



>gb|AAQ56599.1| chitinase-like protein [Gossypium hirsutum]
Length=316

 Score =   159 bits (401),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC   SK+CCN TI+D F TYQFE+LFAKRN+P+AHAVGFWDY SFI A+A +Q
Sbjct  37   LCDKGWECKGWSKYCCNHTISDYFQTYQFEDLFAKRNTPVAHAVGFWDYHSFITAAAQYQ  96

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            P GF TTG K   M E+AAFLGHVGSKTSCGYGVATGG
Sbjct  97   PHGFGTTGEKLQNMKEVAAFLGHVGSKTSCGYGVATGG  134



>gb|KHG06992.1| Chitinase-like protein 2 [Gossypium arboreum]
Length=316

 Score =   159 bits (401),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC   SK+CCN TI+D F TYQFE+LFAKRN+P+AHAVGFWDY SFI A+A +Q
Sbjct  37   LCDKGWECKGWSKYCCNHTISDYFQTYQFEDLFAKRNTPVAHAVGFWDYHSFITAAAQYQ  96

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            P GF TTG K   M E+AAFLGHVGSKTSCGYGVATGG
Sbjct  97   PHGFGTTGEKLQNMKEVAAFLGHVGSKTSCGYGVATGG  134



>gb|ACU18968.1| unknown [Glycine max]
Length=317

 Score =   159 bits (401),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC   S +CCN TI+D F TYQFENLFAKRNSP+AHAVGFWDYRSFI A+A +Q
Sbjct  36   VCDKGWECKGWSAYCCNETISDYFQTYQFENLFAKRNSPVAHAVGFWDYRSFITAAALYQ  95

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            P GF TTGGK     ELAAF GHVGSKTSCGYGVATGG
Sbjct  96   PHGFGTTGGKTSGQKELAAFFGHVGSKTSCGYGVATGG  133



>ref|XP_010932192.1| PREDICTED: chitinase-like protein 1 [Elaeis guineensis]
Length=304

 Score =   158 bits (400),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 85/98 (87%), Gaps = 1/98 (1%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC+  SK+CCN TITD F  YQFENLF+KRN+P+AHAVGFWDY+SFI A+A ++
Sbjct  31   VCDKGWECSG-SKYCCNETITDYFQVYQFENLFSKRNAPVAHAVGFWDYQSFITAAAVYE  89

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTGGK+M M E+AAF GHVGSKTSCGYGVATGG
Sbjct  90   PLGFGTTGGKQMGMKEVAAFFGHVGSKTSCGYGVATGG  127



>gb|KEH43926.1| class I chitinase [Medicago truncatula]
Length=321

 Score =   158 bits (400),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +3

Query  237  CAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQP  416
            C KGWEC   S +CCNLTITD   TYQFENLF+KRNSPIAHAVGFWDY SFI A+A F+P
Sbjct  45   CDKGWECKGWSIYCCNLTITDYLQTYQFENLFSKRNSPIAHAVGFWDYHSFITAAAVFEP  104

Query  417  LGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            LGF TTG K ++M E+AAFLGHVGSKTSCGYG A GG
Sbjct  105  LGFGTTGNKTLKMMEIAAFLGHVGSKTSCGYGAADGG  141



>ref|NP_001142334.1| uncharacterized protein LOC100274504 [Zea mays]
 gb|ACF88216.1| unknown [Zea mays]
 gb|ACG31694.1| endochitinase A2 precursor [Zea mays]
 tpg|DAA62094.1| TPA: endochitinase A2 [Zea mays]
Length=328

 Score =   158 bits (400),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 85/98 (87%), Gaps = 1/98 (1%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC+  SK+CCN TITD F  YQFENLFAKRN+P+AHAVGFWDY++FI A+A F+
Sbjct  47   ICNKGWECSG-SKYCCNDTITDFFKVYQFENLFAKRNTPVAHAVGFWDYQAFITAAALFE  105

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            P GF TTGGK+MQM EL AFLGHVG+KTSCGYGVATGG
Sbjct  106  PQGFCTTGGKQMQMMELCAFLGHVGAKTSCGYGVATGG  143



>gb|KJB72798.1| hypothetical protein B456_011G198500 [Gossypium raimondii]
Length=316

 Score =   158 bits (399),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC   SK+CCN TI+D F TYQFE+LFAKRN+P+AHAVGFWDY SFI A+A +Q
Sbjct  37   LCDKGWECKGWSKYCCNHTISDYFQTYQFEDLFAKRNTPVAHAVGFWDYHSFISAAAQYQ  96

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            P GF TTG K   M E+AAFLGHVGSKTSCGYGVATGG
Sbjct  97   PHGFGTTGEKLQNMKEVAAFLGHVGSKTSCGYGVATGG  134



>gb|ADC55619.2| class I chitinase [Elaeis guineensis]
Length=280

 Score =   157 bits (397),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 85/98 (87%), Gaps = 1/98 (1%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC+  S +CCN TITD F  YQFENLF+KRN+P+AHAVGFWDY+SFI A+A ++
Sbjct  7    VCNKGWECSG-SIYCCNETITDYFQVYQFENLFSKRNAPVAHAVGFWDYQSFITAAAVYE  65

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTGGK+M M E+AAFLGHVGSKTSCGYGVATGG
Sbjct  66   PLGFGTTGGKQMGMKEVAAFLGHVGSKTSCGYGVATGG  103



>ref|XP_004957236.1| PREDICTED: chitinase-like protein 1-like [Setaria italica]
Length=329

 Score =   158 bits (400),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 85/98 (87%), Gaps = 1/98 (1%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC+  SK+CCN TITD F  YQFENLFAKRN+P+AHAVGFWDY++FI A+A F+
Sbjct  47   ICNKGWECSG-SKYCCNDTITDFFKVYQFENLFAKRNTPVAHAVGFWDYQAFITAAALFE  105

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            P GF TTGGK+MQM EL AFLGHVG+KTSCGYGVATGG
Sbjct  106  PQGFCTTGGKQMQMMELCAFLGHVGAKTSCGYGVATGG  143



>ref|XP_002460464.1| hypothetical protein SORBIDRAFT_02g028770 [Sorghum bicolor]
 gb|EER96985.1| hypothetical protein SORBIDRAFT_02g028770 [Sorghum bicolor]
Length=328

 Score =   158 bits (400),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 85/98 (87%), Gaps = 1/98 (1%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC+  SK+CCN TITD F  YQFENLFAKRN+P+AHAVGFWDY++FI A+A F+
Sbjct  47   ICNKGWECSG-SKYCCNDTITDFFKVYQFENLFAKRNTPVAHAVGFWDYQAFITAAALFE  105

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            P GF TTGGK+MQM EL AFLGHVG+KTSCGYGVATGG
Sbjct  106  PQGFCTTGGKQMQMMELCAFLGHVGAKTSCGYGVATGG  143



>ref|NP_001242608.1| uncharacterized protein LOC100805300 precursor [Glycine max]
 gb|ACU22808.1| unknown [Glycine max]
Length=318

 Score =   158 bits (399),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGW C   S +CCN TI+D F TYQFENLFAKRNSP+AHAVGFWDYRSFI A+A +Q
Sbjct  37   VCDKGWGCKGWSAYCCNETISDYFQTYQFENLFAKRNSPVAHAVGFWDYRSFITAAALYQ  96

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTGGK     ELAAF GHVGSKTSCGYGVATGG
Sbjct  97   PLGFGTTGGKTSGQKELAAFFGHVGSKTSCGYGVATGG  134



>gb|ABL86686.1| CLT4 [Gossypium barbadense]
Length=316

 Score =   158 bits (399),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC   SK+CCN TI+D F TYQFE+LFAKRN+P+AHAVGFWDY SFI A+A +Q
Sbjct  37   LCDKGWECKGWSKYCCNHTISDYFQTYQFEDLFAKRNTPVAHAVGFWDYHSFITAAAQYQ  96

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            P GF TTG K   M E+AAFLGHVGSKTSCGYGVATGG
Sbjct  97   PHGFCTTGEKLQNMKEVAAFLGHVGSKTSCGYGVATGG  134



>ref|XP_010927492.1| PREDICTED: chitinase-like protein 1 [Elaeis guineensis]
Length=300

 Score =   157 bits (397),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 85/98 (87%), Gaps = 1/98 (1%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC+  S +CCN TITD F  YQFENLF+KRN+P+AHAVGFWDY+SFI A+A ++
Sbjct  27   VCNKGWECSG-SIYCCNETITDYFQVYQFENLFSKRNAPVAHAVGFWDYQSFITAAAVYE  85

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTGGK+M M E+AAFLGHVGSKTSCGYGVATGG
Sbjct  86   PLGFGTTGGKQMGMKEVAAFLGHVGSKTSCGYGVATGG  123



>ref|XP_008796462.1| PREDICTED: chitinase-like protein 1 [Phoenix dactylifera]
Length=377

 Score =   159 bits (402),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 85/98 (87%), Gaps = 1/98 (1%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC+  SK+CCN TITD F  YQFENLF+KRN+P+AHAVGFWDY SFI A++ ++
Sbjct  104  VCNKGWECSG-SKYCCNETITDYFQVYQFENLFSKRNAPVAHAVGFWDYHSFITAASVYE  162

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTGGK+M M E+AAFLGHVGSKTSCGYGVATGG
Sbjct  163  PLGFGTTGGKQMGMKEVAAFLGHVGSKTSCGYGVATGG  200



>gb|ACJ84650.1| unknown [Medicago truncatula]
Length=148

 Score =   152 bits (385),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC   S +CCN TI+D F TYQFENLF+KRN P AHA GFWDYRSFI A+A +Q
Sbjct  37   LCDKGWECKGWSVYCCNETISDYFQTYQFENLFSKRNDPTAHASGFWDYRSFITAAALYQ  96

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF T+GGK     E+AAFLGHVGSKTSCGYGVATGG
Sbjct  97   PLGFGTSGGKHGGQKEVAAFLGHVGSKTSCGYGVATGG  134



>ref|XP_008381556.1| PREDICTED: chitinase-like protein 2 [Malus domestica]
Length=217

 Score =   154 bits (390),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 79/90 (88%), Gaps = 0/90 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC   SK+CCNLTI+D F TYQFENLF+KRN+P+AHAVGFWDY++FI A+A F+
Sbjct  108  LCDKGWECKGWSKYCCNLTISDFFQTYQFENLFSKRNTPVAHAVGFWDYQAFITAAALFE  167

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSC  503
            PLGF TTGGK MQM E+AAFLGHVGSKTSC
Sbjct  168  PLGFGTTGGKLMQMKEVAAFLGHVGSKTSC  197



>ref|XP_011009946.1| PREDICTED: chitinase-like protein 2 [Populus euphratica]
Length=317

 Score =   157 bits (397),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC  LS +CCN TI+D F TYQFENLF+KRN+P+AHA GFWDY SFI A+A++Q
Sbjct  38   LCDKGWECKGLSAYCCNQTISDFFQTYQFENLFSKRNTPVAHASGFWDYHSFITATAEYQ  97

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            P GF TTGGK     E+AAFLGHVGSKTSCGYGVATGG
Sbjct  98   PHGFGTTGGKLTGQKEVAAFLGHVGSKTSCGYGVATGG  135



>gb|ABV89661.1| chitinase [Brassica rapa]
Length=257

 Score =   155 bits (393),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +3

Query  237  CAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQP  416
            C +GWEC   S++CCN TI+D F  YQFE LFAKRN+PIAHAVGFWDY+SFI A+A F+P
Sbjct  42   CTQGWECVWWSEYCCNQTISDYFQVYQFEQLFAKRNTPIAHAVGFWDYQSFITAAALFEP  101

Query  417  LGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            LGF TTGGK M   E+AAFLGHV SKTSCGYGVATGG
Sbjct  102  LGFGTTGGKLMGQKEMAAFLGHVASKTSCGYGVATGG  138



>ref|XP_010678214.1| PREDICTED: chitinase-like protein 1 [Beta vulgaris subsp. vulgaris]
Length=322

 Score =   157 bits (397),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +3

Query  237  CAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQP  416
            C +GWECN  S +CCN TITD F TYQFENLFAKRN P AHAVGFWDY+SFI A+A F+ 
Sbjct  44   CTRGWECNPWSIYCCNETITDFFQTYQFENLFAKRNVPQAHAVGFWDYQSFIQAAALFEH  103

Query  417  LGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            LGF T G K M+M ELAAFLGHVGSKTSCGYGVATGG
Sbjct  104  LGFCTYGNKTMKMKELAAFLGHVGSKTSCGYGVATGG  140



>ref|XP_003578351.1| PREDICTED: chitinase-like protein 1 [Brachypodium distachyon]
Length=326

 Score =   157 bits (396),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 83/98 (85%), Gaps = 1/98 (1%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C+KGWEC+  SK+CCN TI+D F  YQFENLFAKRN+PIA AVGFWDY+SFI AS  FQ
Sbjct  47   VCSKGWECSN-SKYCCNQTISDFFKVYQFENLFAKRNTPIAKAVGFWDYQSFITASIPFQ  105

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            P GF TTGGK MQM EL AFLGHVG+KTSCG+GVATGG
Sbjct  106  PQGFCTTGGKDMQMMELCAFLGHVGAKTSCGFGVATGG  143



>gb|AAP80800.1| class VII chitinase precursor [Gossypium hirsutum]
 gb|AAP80801.1| class VII chitinase precursor [Gossypium hirsutum]
Length=325

 Score =   157 bits (396),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 83/97 (86%), Gaps = 0/97 (0%)
 Frame = +3

Query  237  CAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQP  416
            C +GWEC+  SK+CCN T++D+F  YQFE+LFAKRNSP+AHAVGFWDY SFILA++ ++P
Sbjct  45   CIQGWECSYWSKYCCNKTVSDVFQVYQFEDLFAKRNSPVAHAVGFWDYHSFILAASIYEP  104

Query  417  LGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            LGF TTGGK+MQM E+AAFL HVG+KTSCG GV  GG
Sbjct  105  LGFGTTGGKRMQMKEVAAFLAHVGAKTSCGDGVIDGG  141



>dbj|BAH30273.1| hypothetical protein [Arabidopsis thaliana]
Length=321

 Score =   156 bits (395),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C +GWEC+  SK+CCN TI+D F  YQFE LF+KRN+PIAHAVGFWDY+SFI A+A F+
Sbjct  41   VCTQGWECSWWSKYCCNQTISDYFQVYQFEQLFSKRNTPIAHAVGFWDYQSFITAAALFE  100

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTGGK M   E+AAFLGHV SKTSCGYGVATGG
Sbjct  101  PLGFGTTGGKLMGQKEMAAFLGHVASKTSCGYGVATGG  138



>ref|NP_172076.1| chitinase-like protein 1 [Arabidopsis thaliana]
 sp|Q9MA41.1|CTL1_ARATH RecName: Full=Chitinase-like protein 1; Short=AtCTL1; AltName: 
Full=Protein ANION ALTERED ROOT MORPHOLOGY; AltName: Full=Protein 
ECTOPIC DEPOSITION OF LIGNIN IN PITH 1; AltName: Full=Protein 
ECTOPIC ROOT HAIR 2; AltName: Full=Protein POM-POM1; 
AltName: Full=Protein SENSITIVE TO HOT TEMPERATURES 2; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAF29391.1|AC009999_11 Contains similarity to a basic endochitinase from Arabidopis 
thaliana gb|AB023448, and contains a Chitinases class I PF|00182 
domain. ESTs gb|AI995747, gb|AA728545, gb|Z26222, gb|Z25683, 
gb|T88386, gb|T14122, gb|T04241, gb|N38122 come from this 
gene [Arabidopsis thaliana]
 gb|AAG48821.1|AF332458_1 putative class I chitinase [Arabidopsis thaliana]
 gb|AAL37736.1|AF422178_1 chitinase-like protein 1 [Arabidopsis thaliana]
 gb|AAL37737.1|AF422179_1 chitinase-like protein 1 [Arabidopsis thaliana]
 gb|AAK59442.1| putative class I chitinase [Arabidopsis thaliana]
 gb|AAM44973.1| putative class I chitinase [Arabidopsis thaliana]
 gb|AEE27904.1| chitinase-like protein 1 [Arabidopsis thaliana]
Length=321

 Score =   156 bits (395),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C +GWEC+  SK+CCN TI+D F  YQFE LF+KRN+PIAHAVGFWDY+SFI A+A F+
Sbjct  41   VCTQGWECSWWSKYCCNQTISDYFQVYQFEQLFSKRNTPIAHAVGFWDYQSFITAAALFE  100

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTGGK M   E+AAFLGHV SKTSCGYGVATGG
Sbjct  101  PLGFGTTGGKLMGQKEMAAFLGHVASKTSCGYGVATGG  138



>ref|XP_008223307.1| PREDICTED: chitinase-like protein 2 [Prunus mume]
Length=325

 Score =   156 bits (395),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC   S +CCN TI+D F  YQFE LF+KRN+P+AHAVGFWDY SFI A+AD+Q
Sbjct  41   LCDKGWECKGWSLYCCNQTISDYFQAYQFETLFSKRNAPVAHAVGFWDYHSFITAAADYQ  100

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            P GF TTGGK   M E+AAFLGHVGSKTSCGYGVATGG
Sbjct  101  PQGFGTTGGKLQGMKEVAAFLGHVGSKTSCGYGVATGG  138



>ref|XP_009414020.1| PREDICTED: chitinase-like protein 1 [Musa acuminata subsp. malaccensis]
Length=308

 Score =   156 bits (394),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 83/98 (85%), Gaps = 1/98 (1%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC K S +CCN TI+D F  YQFENLF+KRN+P+A AVGFWDY SFI A+A +Q
Sbjct  34   VCDKGWEC-KNSVYCCNETISDFFQVYQFENLFSKRNTPVAQAVGFWDYHSFITAAAVYQ  92

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTGGK+ QM E+AAFLGHVGSKTSCGYGVATGG
Sbjct  93   PLGFGTTGGKQTQMGEVAAFLGHVGSKTSCGYGVATGG  130



>ref|XP_006417979.1| hypothetical protein EUTSA_v10008219mg [Eutrema salsugineum]
 ref|XP_006417980.1| hypothetical protein EUTSA_v10008219mg [Eutrema salsugineum]
 gb|ESQ36332.1| hypothetical protein EUTSA_v10008219mg [Eutrema salsugineum]
 gb|ESQ36333.1| hypothetical protein EUTSA_v10008219mg [Eutrema salsugineum]
Length=321

 Score =   156 bits (395),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            MC +GWEC+  S++CCN TI+D F  YQFE LFAKRN+P+AHAVGFWDY+SFI A+A ++
Sbjct  41   MCTQGWECSWWSEYCCNQTISDYFQVYQFEQLFAKRNTPVAHAVGFWDYQSFITAAALYE  100

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTGGK M   E+AAFLGHV SKTSCGYGVATGG
Sbjct  101  PLGFGTTGGKLMGQKEIAAFLGHVASKTSCGYGVATGG  138



>gb|EPS65534.1| hypothetical protein M569_09245, partial [Genlisea aurea]
Length=314

 Score =   156 bits (394),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +3

Query  237  CAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQP  416
            C +GWEC  LS+FCCN TI+D F TY FE LF KRNSP+AHAV FWDY SFI ASA +QP
Sbjct  38   CTRGWECATLSRFCCNQTISDFFQTYNFEELFPKRNSPVAHAVDFWDYNSFITASAVYQP  97

Query  417  LGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
             GF TTGGK  QM E+AAFL HVG+KTSCGYGVATGG
Sbjct  98   QGFGTTGGKLSQMKEIAAFLAHVGAKTSCGYGVATGG  134



>gb|ACO25187.1| chitinase [Mikania micrantha]
Length=318

 Score =   156 bits (394),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C +GWEC   S++CCNLTI+  FD YQFENLF+KRN+P+AHAVGFWD++SFI ASA +Q
Sbjct  38   VCDQGWECKGWSEYCCNLTISQYFDYYQFENLFSKRNTPVAHAVGFWDFKSFITASAIYQ  97

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTG K  QM E+AAFL HVGS+TSCGYGVATGG
Sbjct  98   PLGFGTTGNKTTQMLEVAAFLAHVGSQTSCGYGVATGG  135



>dbj|BAJ33659.1| unnamed protein product [Thellungiella halophila]
Length=303

 Score =   155 bits (393),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            MC +GWEC+  S++CCN TI+D F  YQFE LFAKRN+P+AHAVGFWDY+SFI A+A ++
Sbjct  23   MCTQGWECSWWSEYCCNQTISDYFQVYQFEQLFAKRNTPVAHAVGFWDYQSFITAAALYE  82

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTGGK M   E+AAFLGHV SKTSCGYGVATGG
Sbjct  83   PLGFGTTGGKLMGQKEIAAFLGHVASKTSCGYGVATGG  120



>gb|KJB69093.1| hypothetical protein B456_011G005100 [Gossypium raimondii]
Length=325

 Score =   156 bits (395),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +3

Query  237  CAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQP  416
            C +GWEC+  SK+CCN TI+D+F  YQFE+LFAKRNSP+AHAVGFWDY SFILA++ ++P
Sbjct  45   CIQGWECSYWSKYCCNQTISDVFQVYQFEDLFAKRNSPVAHAVGFWDYHSFILAASIYEP  104

Query  417  LGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            LGF TTGGK MQM E+AAFL HVG+KTSCG GV  GG
Sbjct  105  LGFGTTGGKHMQMKEVAAFLAHVGAKTSCGDGVIDGG  141



>gb|ACD93719.1| chitinase [Mikania micrantha]
Length=318

 Score =   156 bits (394),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C +GWEC   S++CCNLTI+  FD YQFENLF+KRN+P+AHAVGFWD++SFI ASA +Q
Sbjct  38   VCDQGWECKGWSEYCCNLTISQYFDYYQFENLFSKRNTPVAHAVGFWDFKSFITASAIYQ  97

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTG K  QM E+AAFL HVGS+TSCGYGVATGG
Sbjct  98   PLGFGTTGNKTTQMLEVAAFLAHVGSQTSCGYGVATGG  135



>gb|AEZ67304.1| chitinase 5 [Populus x canadensis]
Length=319

 Score =   156 bits (394),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +3

Query  237  CAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQP  416
            C KGWEC  LS +CCN TI+D F TYQFENLF+KRN+P+AHA GFWDY SFI A+A++QP
Sbjct  42   CDKGWECKGLSAYCCNQTISDFFQTYQFENLFSKRNTPVAHASGFWDYHSFITAAAEYQP  101

Query  417  LGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
             GF TTGGK     E+AAFLGHVGSKTSCGYGVATGG
Sbjct  102  HGFGTTGGKLTGQKEVAAFLGHVGSKTSCGYGVATGG  138



>ref|XP_010524573.1| PREDICTED: LOW QUALITY PROTEIN: chitinase-like protein 2 [Tarenaya 
hassleriana]
Length=335

 Score =   156 bits (394),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 83/104 (80%), Gaps = 6/104 (6%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASA---  404
            +C KGWEC   S++CCN TI+D F+TYQFENLF+KRN+P+AHAVGFWDY+SFI A A   
Sbjct  46   LCDKGWECKGWSEYCCNQTISDYFETYQFENLFSKRNTPVAHAVGFWDYKSFITAGAXXX  105

Query  405  ---DFQPLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
                FQPLGF T GGK   M E+AAFLGHVGSKTSCGYGVATGG
Sbjct  106  XXXXFQPLGFGTAGGKHQGMKEVAAFLGHVGSKTSCGYGVATGG  149



>gb|KHF97626.1| Chitinase-like protein 1 [Gossypium arboreum]
Length=325

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
             C +GWEC+  SK+CCN T++D+F  YQFE+LFAKRNSP+AHAVGFWDY SFILA++ ++
Sbjct  44   QCIQGWECSYWSKYCCNQTVSDVFQVYQFEDLFAKRNSPVAHAVGFWDYHSFILAASIYE  103

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTGGK MQM E+AAFL HVG+KTSCG GV  GG
Sbjct  104  PLGFGTTGGKHMQMKEVAAFLAHVGAKTSCGDGVIDGG  141



>gb|KDO50537.1| hypothetical protein CISIN_1g0252372mg, partial [Citrus sinensis]
Length=200

 Score =   152 bits (383),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC   SKFCCN TI+D F  YQFEN F+KRN+P+AHAVGFWDY+SFI A+  +Q
Sbjct  43   VCIKGWECPTWSKFCCNETISDYFQVYQFENFFSKRNTPVAHAVGFWDYQSFITATVKYQ  102

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTG K  +M E+ AFL HVG KTSCGYGVATGG
Sbjct  103  PLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGG  140



>ref|XP_006305373.1| hypothetical protein CARUB_v10009762mg [Capsella rubella]
 ref|XP_010457695.1| PREDICTED: chitinase-like protein 1 [Camelina sativa]
 gb|EOA38271.1| hypothetical protein CARUB_v10009762mg [Capsella rubella]
Length=321

 Score =   155 bits (392),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C +GWEC+  SK+CCN TI+D F  YQFE LF+KRN+P+AHAVGFWDY+SFI A+A ++
Sbjct  41   VCTQGWECSWWSKYCCNQTISDYFQVYQFEQLFSKRNTPVAHAVGFWDYQSFITAAALYE  100

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTGGK M   E+AAFLGHV SKTSCGYGVATGG
Sbjct  101  PLGFGTTGGKLMGQKEMAAFLGHVASKTSCGYGVATGG  138



>ref|XP_009119113.1| PREDICTED: chitinase-like protein 1 [Brassica rapa]
 emb|CDY47699.1| BnaA10g03880D [Brassica napus]
Length=321

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +3

Query  237  CAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQP  416
            C +GWEC   S++CCN TI+D F  YQFE LFAKRN+PIAHAVGFWDY+SFI A+A F+P
Sbjct  42   CTQGWECVWWSEYCCNQTISDYFQVYQFEQLFAKRNTPIAHAVGFWDYQSFITAAALFEP  101

Query  417  LGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            LGF TTGGK M   E+AAFLGHV SKTSCGYGVATGG
Sbjct  102  LGFGTTGGKLMGQKEMAAFLGHVASKTSCGYGVATGG  138



>ref|XP_009348883.1| PREDICTED: chitinase-like protein 2 [Pyrus x bretschneideri]
Length=320

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC   S +CCN TI+D F  YQFE+LF+KRNSP+AHAVGFWDY SFI A+A++Q
Sbjct  42   VCDKGWECKGWSVYCCNQTISDYFQAYQFEDLFSKRNSPVAHAVGFWDYHSFITAAAEYQ  101

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            P GF TTGGK   M E+ AFLGHVGSKTSCGYGVATGG
Sbjct  102  PHGFGTTGGKLQGMKEVTAFLGHVGSKTSCGYGVATGG  139



>ref|XP_009369953.1| PREDICTED: chitinase-like protein 2 [Pyrus x bretschneideri]
Length=320

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC   S +CCN TI+D F  YQFE+LF+KRNSP+AHAVGFWDY SFI A+A++Q
Sbjct  42   VCDKGWECKGWSVYCCNQTISDYFQAYQFEDLFSKRNSPVAHAVGFWDYHSFITAAAEYQ  101

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            P GF TTGGK   M E+ AFLGHVGSKTSCGYGVATGG
Sbjct  102  PHGFGTTGGKLQGMKEVTAFLGHVGSKTSCGYGVATGG  139



>gb|AFK34282.1| unknown [Lotus japonicus]
Length=321

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +3

Query  237  CAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQP  416
            C KGWEC   S +CCNLTI+D F  YQFENLF+KRN+P+A+AVGFWDY SFI A+A F+P
Sbjct  44   CDKGWECKGWSIYCCNLTISDYFQVYQFENLFSKRNTPVANAVGFWDYHSFITAAALFEP  103

Query  417  LGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
             GF TTG K +QM E+AAFLGHVG+KTSCGYGVATGG
Sbjct  104  QGFGTTGNKTLQMMEIAAFLGHVGAKTSCGYGVATGG  140



>gb|ACM45714.1| class II chitinase [Pyrus pyrifolia]
Length=322

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC   S +CCN TI+D F  YQFE+LF+KRNSP+AHAVGFWDY SFI A+A++Q
Sbjct  42   VCDKGWECKGWSVYCCNQTISDYFQAYQFEDLFSKRNSPVAHAVGFWDYHSFITAAAEYQ  101

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            P GF TTGGK   M E+ AFLGHVGSKTSCGYGVATGG
Sbjct  102  PHGFGTTGGKLQGMKEVTAFLGHVGSKTSCGYGVATGG  139



>ref|XP_008361932.1| PREDICTED: LOW QUALITY PROTEIN: chitinase-like protein 2 [Malus 
domestica]
Length=327

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC   S +CCN TI+D F  Y FE+LF+KRNSP+AHAVGFWDY SFI A+AD+Q
Sbjct  42   VCDKGWECKGWSVYCCNQTISDYFQAYHFEDLFSKRNSPVAHAVGFWDYHSFITAAADYQ  101

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            P GF TTGGK   M E+AAFLGHVGSKT+CGYGVATGG
Sbjct  102  PHGFGTTGGKLQGMKEVAAFLGHVGSKTTCGYGVATGG  139



>emb|CDY10156.1| BnaC05g03990D [Brassica napus]
Length=321

 Score =   155 bits (391),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +3

Query  237  CAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQP  416
            C +GWEC   S++CCN TI+D F  YQFE LFAKRN+PIAHAVGFWDY+SFI A+A F+P
Sbjct  42   CTQGWECVWWSEYCCNQTISDYFQVYQFEQLFAKRNTPIAHAVGFWDYQSFITAAALFEP  101

Query  417  LGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            LGF TTGGK M   E+AAFLGHV SKTSCGYGVATGG
Sbjct  102  LGFGTTGGKLMGQKEMAAFLGHVASKTSCGYGVATGG  138



>ref|XP_008340624.1| PREDICTED: chitinase-like protein 2 [Malus domestica]
Length=328

 Score =   155 bits (391),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC   S +CCN TI+D F  Y FE+LF+KRNSP+AHAVGFWDY SFI A+AD+Q
Sbjct  42   VCDKGWECKGWSVYCCNQTISDYFQAYHFEDLFSKRNSPVAHAVGFWDYHSFITAAADYQ  101

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            P GF TTGGK   M E+AAFLGHVGSKT+CGYGVATGG
Sbjct  102  PHGFGTTGGKLQGMKEVAAFLGHVGSKTTCGYGVATGG  139



>ref|XP_002316022.1| class1 chitinase family protein [Populus trichocarpa]
 gb|ABK92465.1| unknown [Populus trichocarpa]
 gb|EEF02193.1| class1 chitinase family protein [Populus trichocarpa]
Length=320

 Score =   155 bits (391),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +3

Query  237  CAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQP  416
            C KGWEC  LS +CCN TI+D F TYQFENLF+KRN+P+AHA GFWDY SFI A+A++QP
Sbjct  42   CDKGWECKGLSAYCCNQTISDFFQTYQFENLFSKRNTPVAHASGFWDYHSFITAAAEYQP  101

Query  417  LGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
             GF T+GGK     E+AAFLGHVGSKTSCGYGVATGG
Sbjct  102  HGFGTSGGKLTGQKEVAAFLGHVGSKTSCGYGVATGG  138



>gb|EYU45212.1| hypothetical protein MIMGU_mgv1a010053mg [Erythranthe guttata]
 gb|EYU45213.1| hypothetical protein MIMGU_mgv1a010053mg [Erythranthe guttata]
 gb|EYU45214.1| hypothetical protein MIMGU_mgv1a010053mg [Erythranthe guttata]
Length=324

 Score =   154 bits (390),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C +GWEC   S++CCN TI+D+F TY FENLF  RNSP+AHAV FW YRSFI A++ ++
Sbjct  46   VCDQGWECKGFSEYCCNQTISDLFQTYNFENLFPNRNSPVAHAVDFWTYRSFITAASIYE  105

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTGG  MQM E+AAFLGHVG KTSCGYGVATGG
Sbjct  106  PLGFGTTGGPDMQMKEVAAFLGHVGCKTSCGYGVATGG  143



>ref|XP_010094321.1| Chitinase-like protein 2 [Morus notabilis]
 gb|EXB55741.1| Chitinase-like protein 2 [Morus notabilis]
Length=319

 Score =   154 bits (389),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC   S +CCN TI++ F  YQFENLF+KRNSP+AHAVGFWDY SFI A+A +Q
Sbjct  38   LCTKGWECKVWSVYCCNQTISEYFQAYQFENLFSKRNSPVAHAVGFWDYHSFITAAAQYQ  97

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
             LGF TTGGK   M E+AAFLGHVGSKTSCGYGVATGG
Sbjct  98   HLGFGTTGGKFAGMKEVAAFLGHVGSKTSCGYGVATGG  135



>ref|XP_006488866.1| PREDICTED: chitinase-like protein 2-like [Citrus sinensis]
Length=325

 Score =   154 bits (390),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC   S++CCN TI+D F TYQFENLF KRN+P+AHAVGFWDY SFI A+A +Q
Sbjct  40   LCDKGWECKGWSEYCCNQTISDYFQTYQFENLFTKRNTPVAHAVGFWDYHSFITAAALYQ  99

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            P GF T+ GK M   E+AAFLGHVGSKTSCGYGVATGG
Sbjct  100  PHGFGTSAGKLMGQKEVAAFLGHVGSKTSCGYGVATGG  137



>ref|XP_006419422.1| hypothetical protein CICLE_v10005421mg [Citrus clementina]
 gb|ESR32662.1| hypothetical protein CICLE_v10005421mg [Citrus clementina]
Length=325

 Score =   154 bits (390),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC   S++CCN TI+D F TYQFENLF KRN+P+AHAVGFWDY SFI A+A +Q
Sbjct  40   LCDKGWECKGWSEYCCNQTISDYFQTYQFENLFTKRNTPVAHAVGFWDYHSFITAAALYQ  99

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            P GF T+ GK M   E+AAFLGHVGSKTSCGYGVATGG
Sbjct  100  PHGFGTSAGKLMGQKEVAAFLGHVGSKTSCGYGVATGG  137



>ref|XP_010485424.1| PREDICTED: chitinase-like protein 1 [Camelina sativa]
Length=321

 Score =   154 bits (389),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C +GWEC   SK+CCN TI+D F  YQFE LF+KRN+P+AHAVGFWDY+SFI A+A ++
Sbjct  41   VCTQGWECAWWSKYCCNQTISDYFQVYQFEQLFSKRNTPVAHAVGFWDYQSFITAAALYE  100

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTGGK M   E+AAFLGHV SKTSCGYGVATGG
Sbjct  101  PLGFGTTGGKLMGQKEMAAFLGHVASKTSCGYGVATGG  138



>ref|XP_007222686.1| hypothetical protein PRUPE_ppa008643mg [Prunus persica]
 gb|EMJ23885.1| hypothetical protein PRUPE_ppa008643mg [Prunus persica]
Length=324

 Score =   154 bits (388),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC   S +CCN TI+D F +YQFE LF+KRN+P+AHAVGFWDY SFI A+A+ Q
Sbjct  41   LCDKGWECKGWSVYCCNQTISDYFQSYQFETLFSKRNAPVAHAVGFWDYHSFITAAAEHQ  100

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            P GF TTGGK   M E+AAFLGHVGSKTSCGYGVATGG
Sbjct  101  PHGFGTTGGKLQGMKEVAAFLGHVGSKTSCGYGVATGG  138



>gb|ACE98503.1| family 19 glycoside hydrolase, partial [Populus tremula]
 gb|ACE98504.1| family 19 glycoside hydrolase, partial [Populus tremula]
Length=96

 Score =   147 bits (371),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C +GWEC   S++CCNLTI+DIF++YQFENLF+ RNSP+AHAVGFWDYRSFILA+  FQ
Sbjct  8    LCKRGWECLDWSEYCCNLTISDIFESYQFENLFSNRNSPVAHAVGFWDYRSFILATTSFQ  67

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTS  500
             LGF TTGGK  QM ELAAFL HVG+KTS
Sbjct  68   HLGFCTTGGKATQMKELAAFLAHVGTKTS  96



>ref|XP_009391282.1| PREDICTED: chitinase-like protein 1 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=311

 Score =   153 bits (387),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 83/98 (85%), Gaps = 1/98 (1%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC K S +CCN TI++ F  YQFE+LF+KRN+P+A AVGFWDY SFI A+A ++
Sbjct  31   VCDKGWEC-KASVYCCNETISEFFQVYQFEDLFSKRNAPVAQAVGFWDYHSFITAAAVYE  89

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTGGK MQM E+AAFLGHVGSKTSCGYGVATGG
Sbjct  90   PLGFGTTGGKLMQMKEVAAFLGHVGSKTSCGYGVATGG  127



>ref|XP_002892310.1| pom-pom1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68569.1| pom-pom1 [Arabidopsis lyrata subsp. lyrata]
Length=321

 Score =   153 bits (387),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C +GWEC+  SK+CCN TI+D F  YQFE LF+KRN+PIAHAVGFWDY+SFI A+A ++
Sbjct  41   VCTQGWECSWWSKYCCNQTISDYFQVYQFEQLFSKRNTPIAHAVGFWDYQSFITAAALYE  100

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTGGK     E+AAFLGHV SKTSCGYGVATGG
Sbjct  101  PLGFGTTGGKLQGQKEMAAFLGHVASKTSCGYGVATGG  138



>gb|AFK41090.1| unknown [Medicago truncatula]
Length=318

 Score =   153 bits (387),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC   S +CCN TI+D F TYQFENLF+KRN P AHA GFWDYRSFI A+A +Q
Sbjct  37   LCDKGWECKGWSVYCCNETISDYFQTYQFENLFSKRNDPTAHASGFWDYRSFITAAALYQ  96

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF T+GGK     E+AAFLGHVGSKTSCGYGVATGG
Sbjct  97   PLGFGTSGGKHGGQKEVAAFLGHVGSKTSCGYGVATGG  134



>ref|XP_004295106.1| PREDICTED: chitinase-like protein 2 [Fragaria vesca subsp. vesca]
Length=323

 Score =   153 bits (387),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC   S +CCN TI+D F +YQFE+LF+KRNSP+AHAV FWDY SFI A+A +Q
Sbjct  42   LCDKGWECKGWSAYCCNHTISDYFQSYQFEDLFSKRNSPVAHAVDFWDYHSFITAAAGYQ  101

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            P GF TTGGK   M E+AAFLGHVGSKTSCGYGVATGG
Sbjct  102  PHGFGTTGGKLQGMKEVAAFLGHVGSKTSCGYGVATGG  139



>ref|XP_003594792.1| Endochitinase [Medicago truncatula]
 gb|AES65043.1| Chitinase [Medicago truncatula]
 gb|AFK46708.1| unknown [Medicago truncatula]
Length=318

 Score =   153 bits (387),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC   S +CCN TI+D F TYQFENLF+KRN P AHA GFWDYRSFI A+A +Q
Sbjct  37   LCDKGWECKGWSVYCCNETISDYFQTYQFENLFSKRNDPTAHASGFWDYRSFITAAALYQ  96

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF T+GGK     E+AAFLGHVGSKTSCGYGVATGG
Sbjct  97   PLGFGTSGGKHGGQKEVAAFLGHVGSKTSCGYGVATGG  134



>ref|XP_009391281.1| PREDICTED: chitinase-like protein 1 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=326

 Score =   153 bits (387),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 83/98 (85%), Gaps = 1/98 (1%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC K S +CCN TI++ F  YQFE+LF+KRN+P+A AVGFWDY SFI A+A ++
Sbjct  46   VCDKGWEC-KASVYCCNETISEFFQVYQFEDLFSKRNAPVAQAVGFWDYHSFITAAAVYE  104

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTGGK MQM E+AAFLGHVGSKTSCGYGVATGG
Sbjct  105  PLGFGTTGGKLMQMKEVAAFLGHVGSKTSCGYGVATGG  142



>ref|XP_010475305.1| PREDICTED: chitinase-like protein 1 [Camelina sativa]
Length=321

 Score =   153 bits (387),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C +GWEC   S++CCN TI+D F  YQFE LF+KRN+P+AHAVGFWDY+SFI A+A F+
Sbjct  41   VCTQGWECVWWSEYCCNQTISDYFQVYQFEQLFSKRNTPVAHAVGFWDYQSFITAAALFE  100

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTGGK M   E+AAFLGHV SKTSCGYGVATGG
Sbjct  101  PLGFGTTGGKLMGQKEMAAFLGHVASKTSCGYGVATGG  138



>ref|XP_009407212.1| PREDICTED: chitinase-like protein 1 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=301

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 83/97 (86%), Gaps = 1/97 (1%)
 Frame = +3

Query  237  CAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQP  416
            C KGWEC+  S +CCN TITD F  YQFENLF+KRN+P+AHAVGFWD++SFI A+A F+P
Sbjct  29   CDKGWECSG-SVYCCNETITDYFQVYQFENLFSKRNAPVAHAVGFWDFQSFITAAALFEP  87

Query  417  LGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            LGF TTG K+ +M E+AAFLGHVGSKTSCGYGVATGG
Sbjct  88   LGFGTTGDKQTKMKEVAAFLGHVGSKTSCGYGVATGG  124



>ref|NP_001288894.1| chitinase-like protein 1 precursor [Brassica rapa]
 gb|ABV89660.1| chitinase [Brassica rapa]
Length=321

 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +3

Query  237  CAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQP  416
            C +GWEC   S++CCN TI+D F  YQFE LFAKRN+P+AHAVGFWDY+SFI A+A ++P
Sbjct  42   CTQGWECVWWSEYCCNETISDYFQVYQFEQLFAKRNTPVAHAVGFWDYQSFITAAALYEP  101

Query  417  LGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            LGF TTGGK M   E+AAFLGHV SKTSCGYGVATGG
Sbjct  102  LGFGTTGGKLMGQKEMAAFLGHVASKTSCGYGVATGG  138



>ref|XP_009111023.1| PREDICTED: chitinase-like protein 1 [Brassica rapa]
 emb|CDY63794.1| BnaA08g31740D [Brassica napus]
Length=321

 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +3

Query  237  CAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQP  416
            C +GWEC   S++CCN TI+D F  YQFE LFAKRN+P+AHAVGFWDY+SFI A+A ++P
Sbjct  42   CTQGWECVWWSEYCCNETISDYFQVYQFEQLFAKRNTPVAHAVGFWDYQSFITAAALYEP  101

Query  417  LGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            LGF TTGGK M   E+AAFLGHV SKTSCGYGVATGG
Sbjct  102  LGFGTTGGKLMGQKEMAAFLGHVASKTSCGYGVATGG  138



>ref|XP_009407211.1| PREDICTED: chitinase-like protein 1 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=304

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 83/97 (86%), Gaps = 1/97 (1%)
 Frame = +3

Query  237  CAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQP  416
            C KGWEC+  S +CCN TITD F  YQFENLF+KRN+P+AHAVGFWD++SFI A+A F+P
Sbjct  32   CDKGWECSG-SVYCCNETITDYFQVYQFENLFSKRNAPVAHAVGFWDFQSFITAAALFEP  90

Query  417  LGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            LGF TTG K+ +M E+AAFLGHVGSKTSCGYGVATGG
Sbjct  91   LGFGTTGDKQTKMKEVAAFLGHVGSKTSCGYGVATGG  127



>ref|XP_004487788.1| PREDICTED: chitinase-like protein 2-like [Cicer arietinum]
Length=318

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC   S +CCN TI+D   TYQFENLF+KRN P+AHA GFWDYRSFI A+A +Q
Sbjct  37   VCDKGWECKGWSVYCCNETISDYLQTYQFENLFSKRNDPVAHAAGFWDYRSFITAAALYQ  96

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF T+GGK     E+AAFLGHVGSKTSCGYGVATGG
Sbjct  97   PLGFGTSGGKHGGQKEVAAFLGHVGSKTSCGYGVATGG  134



>ref|XP_004492044.1| PREDICTED: chitinase-like protein 2-like [Cicer arietinum]
Length=321

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 80/98 (82%), Gaps = 1/98 (1%)
 Frame = +3

Query  237  CAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQP  416
            C +GWEC   S +CCNLTITD F TYQFENLF+ RNSP+AHAVGFWDY SFI A++ F+P
Sbjct  43   CDQGWECQGWSIYCCNLTITDYFQTYQFENLFSMRNSPVAHAVGFWDYHSFIAAASIFEP  102

Query  417  LGFATTG-GKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
             GF TTG  K  QM E+AAFLGHVGSKTSCGYGVATGG
Sbjct  103  QGFGTTGKNKTFQMMEIAAFLGHVGSKTSCGYGVATGG  140



>ref|XP_009410357.1| PREDICTED: chitinase-like protein 1 [Musa acuminata subsp. malaccensis]
Length=302

 Score =   152 bits (383),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 84/98 (86%), Gaps = 1/98 (1%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC+  S +CCN TI+D F  YQFENLF+KRNSP+AHAVGFWDY+SFILA++ ++
Sbjct  28   VCNKGWECSG-SIYCCNETISDYFKVYQFENLFSKRNSPVAHAVGFWDYQSFILAASVYE  86

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTG K  +M E++AFLGHVGSKTSCGYGVATGG
Sbjct  87   PLGFGTTGDKVTKMQEVSAFLGHVGSKTSCGYGVATGG  124



>emb|CDX86549.1| BnaC08g01540D [Brassica napus]
Length=321

 Score =   152 bits (384),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +3

Query  237  CAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQP  416
            C +GWEC   S++CCN TI+D F  YQFE LFAKRN+P+AHAVGFWDY+SFI A++ ++P
Sbjct  42   CTQGWECVWWSEYCCNQTISDYFQVYQFEQLFAKRNTPVAHAVGFWDYQSFITAASLYEP  101

Query  417  LGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            LGF TTGGK M   E+AAFLGHV SKTSCGYGVATGG
Sbjct  102  LGFGTTGGKLMGQKEMAAFLGHVASKTSCGYGVATGG  138



>gb|ACE98508.1| family 19 glycoside hydrolase, partial [Populus tremula]
 gb|ACE98514.1| family 19 glycoside hydrolase, partial [Populus tremula]
Length=96

 Score =   145 bits (366),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C +GWEC   S++CCNLTI+DIF++YQFENLF+ RNSP+AHAVGFWDY+SFILA+  FQ
Sbjct  8    LCKRGWECLDWSEYCCNLTISDIFESYQFENLFSNRNSPVAHAVGFWDYQSFILATTSFQ  67

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTS  500
             LGF TTGGK  QM ELAAFL HVG+KTS
Sbjct  68   HLGFCTTGGKATQMKELAAFLAHVGTKTS  96



>gb|ACE98500.1| family 19 glycoside hydrolase, partial [Populus tremula]
Length=96

 Score =   145 bits (365),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C +GWEC   S++CCNLTI+D F++YQFENLF+ RNSP+AHAVGFWDYRSFILA+  FQ
Sbjct  8    LCKRGWECLDWSEYCCNLTISDFFESYQFENLFSNRNSPVAHAVGFWDYRSFILATTSFQ  67

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTS  500
             LGF TTGGK  QM ELAAFL HVG+KTS
Sbjct  68   HLGFCTTGGKATQMKELAAFLAHVGTKTS  96



>gb|ACE98493.1| family 19 glycoside hydrolase, partial [Populus tremula]
 gb|ACE98495.1| family 19 glycoside hydrolase, partial [Populus tremula]
 gb|ACE98496.1| family 19 glycoside hydrolase, partial [Populus tremula]
 gb|ACE98507.1| family 19 glycoside hydrolase, partial [Populus tremula]
Length=96

 Score =   145 bits (365),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C +GWEC   S++CCN TI+DIF++YQFENLF+ RNSP+AHAVGFWDYRSFILA+  FQ
Sbjct  8    LCKRGWECLDWSEYCCNQTISDIFESYQFENLFSNRNSPVAHAVGFWDYRSFILATTSFQ  67

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTS  500
             LGF TTGGK  QM ELAAFL HVG+KTS
Sbjct  68   HLGFCTTGGKATQMKELAAFLAHVGTKTS  96



>ref|XP_010522204.1| PREDICTED: chitinase-like protein 1 [Tarenaya hassleriana]
Length=321

 Score =   151 bits (382),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            MC +GWEC+  S +CCN TI+D F  YQFE LFAKRN+P+AHAVGFWDY+SFI A+A ++
Sbjct  41   MCVQGWECSYWSIYCCNQTISDYFQVYQFEQLFAKRNTPVAHAVGFWDYQSFITAAAIYE  100

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTGGK     E+AAFLGHV +KTSCGYGVATGG
Sbjct  101  PLGFGTTGGKLKGQMEIAAFLGHVAAKTSCGYGVATGG  138



>gb|ACE98498.1| family 19 glycoside hydrolase, partial [Populus tremula]
Length=96

 Score =   143 bits (361),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C +GWEC   S++CCNLTI+D F++YQFENLF+ RNSP+AHAVGFWDY+SFILA+  FQ
Sbjct  8    LCKRGWECLDWSEYCCNLTISDFFESYQFENLFSNRNSPVAHAVGFWDYQSFILATTSFQ  67

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTS  500
             LGF TTGGK  QM ELAAFL HVG+KTS
Sbjct  68   HLGFCTTGGKATQMKELAAFLAHVGTKTS  96



>gb|ACE98499.1| family 19 glycoside hydrolase, partial [Populus tremula]
 gb|ACE98501.1| family 19 glycoside hydrolase, partial [Populus tremula]
Length=96

 Score =   143 bits (360),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C +GWEC   S++CCN TI+DIF++YQFENLF+ RNSP+AHAVGFWDY+SFILA+  FQ
Sbjct  8    LCKRGWECLDWSEYCCNQTISDIFESYQFENLFSNRNSPVAHAVGFWDYQSFILATTSFQ  67

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTS  500
             LGF TTGGK  QM ELAAFL HVG+KTS
Sbjct  68   HLGFCTTGGKATQMKELAAFLAHVGTKTS  96



>gb|ACE98502.1| family 19 glycoside hydrolase, partial [Populus tremula]
 gb|ACE98513.1| family 19 glycoside hydrolase, partial [Populus tremula]
Length=96

 Score =   142 bits (359),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C +GWEC   S++CCN TI+D F++YQFENLF+ RNSP+AHAVGFWDYRSFILA+  FQ
Sbjct  8    LCKRGWECLDWSEYCCNQTISDFFESYQFENLFSNRNSPVAHAVGFWDYRSFILATTSFQ  67

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTS  500
             LGF TTGGK  QM ELAAFL HVG+KTS
Sbjct  68   HLGFCTTGGKATQMKELAAFLAHVGTKTS  96



>gb|KDO38166.1| hypothetical protein CISIN_1g036277mg, partial [Citrus sinensis]
Length=246

 Score =   147 bits (370),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +3

Query  246  GWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGF  425
            GWEC   SKFCCN TI+D F  YQFEN F+KRN+P+AHAVGFWDY+SFI A+  +QPLGF
Sbjct  79   GWECPTWSKFCCNETISDYFQVYQFENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGF  138

Query  426  ATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
             TTG K  +M E+ AFL HVG KTSCGYGVATGG
Sbjct  139  GTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGG  172



>gb|ACN27372.1| unknown [Zea mays]
 tpg|DAA62095.1| TPA: hypothetical protein ZEAMMB73_941092 [Zea mays]
Length=152

 Score =   144 bits (362),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 77/90 (86%), Gaps = 1/90 (1%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC+  SK+CCN TITD F  YQFENLFAKRN+P+AHAVGFWDY++FI A+A F+
Sbjct  47   ICNKGWECSG-SKYCCNDTITDFFKVYQFENLFAKRNTPVAHAVGFWDYQAFITAAALFE  105

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSC  503
            P GF TTGGK+MQM EL AFLGHVG+KTSC
Sbjct  106  PQGFCTTGGKQMQMMELCAFLGHVGAKTSC  135



>ref|XP_009386704.1| PREDICTED: chitinase-like protein 1 [Musa acuminata subsp. malaccensis]
Length=303

 Score =   148 bits (373),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 83/97 (86%), Gaps = 1/97 (1%)
 Frame = +3

Query  237  CAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQP  416
            C KGWEC+  S +CCN TI++ F  YQFENLF+KRN+P+AHAVGFWDY+SFI+A++ ++P
Sbjct  31   CDKGWECSG-SIYCCNETISEYFVVYQFENLFSKRNAPVAHAVGFWDYQSFIIAASVYEP  89

Query  417  LGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            LGF T G K+ +M E+AAFLGHVGSKTSCGYGVATGG
Sbjct  90   LGFGTAGDKQTKMKEVAAFLGHVGSKTSCGYGVATGG  126



>ref|XP_010557059.1| PREDICTED: chitinase-like protein 1 [Tarenaya hassleriana]
Length=321

 Score =   147 bits (372),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            MC +GWEC+  S +CCN TI+D F   QFE LF+KRNSP AHAVGFWDYRSFI A+A ++
Sbjct  41   MCMQGWECSYWSIYCCNETISDYFQVTQFEQLFSKRNSPAAHAVGFWDYRSFITAAAIYE  100

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTGG  M   E+AAFLGHV SKTSCG+GVATGG
Sbjct  101  PLGFGTTGGYLMGQKEIAAFLGHVASKTSCGFGVATGG  138



>gb|ACE98494.1| family 19 glycoside hydrolase, partial [Populus tremula]
 gb|ACE98497.1| family 19 glycoside hydrolase, partial [Populus tremula]
 gb|ACE98505.1| family 19 glycoside hydrolase, partial [Populus tremula]
 gb|ACE98506.1| family 19 glycoside hydrolase, partial [Populus tremula]
 gb|ACE98509.1| family 19 glycoside hydrolase, partial [Populus tremula]
 gb|ACE98510.1| family 19 glycoside hydrolase, partial [Populus tremula]
 gb|ACE98511.1| family 19 glycoside hydrolase, partial [Populus tremula]
 gb|ACE98512.1| family 19 glycoside hydrolase, partial [Populus tremula]
Length=96

 Score =   140 bits (354),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C +GWEC   S++CCN TI+D F++YQFENLF+ RNSP+AHAVGFWDY+SFILA+  FQ
Sbjct  8    LCKRGWECLDWSEYCCNQTISDFFESYQFENLFSNRNSPVAHAVGFWDYQSFILATTSFQ  67

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTS  500
             LGF TTGGK  QM ELAAFL HVG+KTS
Sbjct  68   HLGFCTTGGKATQMKELAAFLAHVGTKTS  96



>ref|XP_006443148.1| hypothetical protein CICLE_v10021187mg [Citrus clementina]
 ref|XP_006478886.1| PREDICTED: chitinase-like protein 1-like [Citrus sinensis]
 gb|ESR56388.1| hypothetical protein CICLE_v10021187mg [Citrus clementina]
Length=321

 Score =   147 bits (371),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +3

Query  246  GWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGF  425
            GWEC   SKFCCN TI+D F  YQFEN F+KRN+P+AHAVGFWDY+SFI A+  +QPLGF
Sbjct  45   GWECPTWSKFCCNETISDYFQVYQFENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGF  104

Query  426  ATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
             TTG K  +M E+ AFL HVG KTSCGYGVATGG
Sbjct  105  GTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGG  138



>ref|XP_007138976.1| hypothetical protein PHAVU_009G254400g [Phaseolus vulgaris]
 gb|ESW10970.1| hypothetical protein PHAVU_009G254400g [Phaseolus vulgaris]
Length=317

 Score =   145 bits (367),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +3

Query  237  CAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQP  416
            C KGWEC   S +CCN TI+D F TYQFENLFAKRNSP+AHAVGFWDYRSFI A+A +QP
Sbjct  37   CDKGWECKGWSAYCCNETISDYFQTYQFENLFAKRNSPVAHAVGFWDYRSFITAAALYQP  96

Query  417  LGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            LGF TTGG      E+AAFLGHVGSKTSCGYGVATGG
Sbjct  97   LGFGTTGGTTNGQKEVAAFLGHVGSKTSCGYGVATGG  133



>ref|XP_010103925.1| Chitinase-like protein 1 [Morus notabilis]
 gb|EXB97442.1| Chitinase-like protein 1 [Morus notabilis]
Length=318

 Score =   145 bits (367),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 80/98 (82%), Gaps = 1/98 (1%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C +G EC K S FCCN TITDIF  YQFE+LF+KRNSP+A AVGFWD+ SFI A+ ++Q
Sbjct  40   ICTQGLEC-KESVFCCNHTITDIFQYYQFEDLFSKRNSPVAKAVGFWDFESFITATYNYQ  98

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            P GF TTGGK  QM E+AAFL HVG+KTSCGYGVATGG
Sbjct  99   PRGFGTTGGKTNQMKEIAAFLAHVGAKTSCGYGVATGG  136



>ref|XP_004134237.1| PREDICTED: LOW QUALITY PROTEIN: chitinase-like protein 2-like 
[Cucumis sativus]
Length=317

 Score =   145 bits (365),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 77/98 (79%), Gaps = 5/98 (5%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC          TI+D F TYQFENLF+KRNSP+AHA GFWDYRSFI A+A FQ
Sbjct  42   LCDKGWECKGWXH-----TISDYFQTYQFENLFSKRNSPVAHAAGFWDYRSFITAAALFQ  96

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            P GF TTGGK M M E+AAFLGHVGSKT+CGYGVATGG
Sbjct  97   PHGFGTTGGKLMGMKEIAAFLGHVGSKTTCGYGVATGG  134



>ref|XP_006660298.1| PREDICTED: chitinase-like protein 1-like [Oryza brachyantha]
Length=313

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 81/101 (80%), Gaps = 5/101 (5%)
 Frame = +3

Query  237  CAKGWE----CNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASA  404
            C KGWE    C+  S+FCCN TITD F  YQFE+LFAKRN P AHA GFWDY++FI A+A
Sbjct  36   CDKGWEGGGECSG-SRFCCNDTITDYFKVYQFEDLFAKRNDPTAHAAGFWDYKAFITAAA  94

Query  405  DFQPLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
             F+P GF TTGGK++ M E+AAFLGHVG+KTSCGYGVATGG
Sbjct  95   LFEPRGFGTTGGKEVGMREVAAFLGHVGAKTSCGYGVATGG  135



>gb|EMT31181.1| Endochitinase [Aegilops tauschii]
Length=332

 Score =   144 bits (362),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 80/98 (82%), Gaps = 1/98 (1%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC+  +K+CCN TITD F  YQFENLFAKRN P+A AVGFWDY++FI A++ F+
Sbjct  47   VCNKGWECSG-TKYCCNQTITDFFKVYQFENLFAKRNFPVAKAVGFWDYQAFITAASLFE  105

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
              GF TTGG  MQM EL AFLGHVG+KTSCGYGVATGG
Sbjct  106  NQGFCTTGGIDMQMMELCAFLGHVGAKTSCGYGVATGG  143



>gb|EMS57391.1| Chitinase-like protein 1 [Triticum urartu]
Length=398

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 80/98 (82%), Gaps = 1/98 (1%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC+  +K+CCN TITD F  YQFENLFAKRN P+A AVGFWDY++FI A++ F+
Sbjct  47   VCNKGWECSG-TKYCCNQTITDFFKVYQFENLFAKRNFPMAKAVGFWDYQAFITAASLFE  105

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
              GF TTGG  MQM EL AFLGHVG+KTSCGYGVATGG
Sbjct  106  NQGFCTTGGIDMQMMELCAFLGHVGAKTSCGYGVATGG  143



>gb|ACE79211.1| chi2 [Limonium bicolor]
Length=319

 Score =   141 bits (356),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 75/98 (77%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C +GW C + SKFCCN TI +  D  QF+ LF   N+P AHAVGFWDY+SF+LA+  + 
Sbjct  42   VCKRGWACPEFSKFCCNQTIPEFLDVDQFQQLFPNINAPTAHAVGFWDYQSFVLATIKYA  101

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTGGK M   ELAAFLGHVGS+TSCGYGVATGG
Sbjct  102  PLGFGTTGGKLMGQLELAAFLGHVGSQTSCGYGVATGG  139



>dbj|BAK00996.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=304

 Score =   141 bits (355),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 80/97 (82%), Gaps = 1/97 (1%)
 Frame = +3

Query  237  CAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQP  416
            C KGWEC+  S+FCCN TITD F  YQFE LFA+RN+ +AHA GFW+Y++FI A++ F+P
Sbjct  31   CDKGWECSG-SRFCCNETITDYFKAYQFEELFAQRNNSLAHAAGFWNYQAFITAASLFEP  89

Query  417  LGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
             GF TTGG++M M E+AAFLGHVG+KTSCGY +ATGG
Sbjct  90   RGFGTTGGREMSMKEVAAFLGHVGAKTSCGYSLATGG  126



>ref|XP_006849899.1| hypothetical protein AMTR_s00022p00097040 [Amborella trichopoda]
 gb|ERN11480.1| hypothetical protein AMTR_s00022p00097040 [Amborella trichopoda]
Length=362

 Score =   142 bits (357),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 75/88 (85%), Gaps = 1/88 (1%)
 Frame = +3

Query  237  CAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQP  416
            C KGWEC K S +CCN TI+D F  YQFENLF+KRN+P+AHAVGFWDY+SFILAS  +QP
Sbjct  27   CDKGWEC-KGSIYCCNDTISDFFQAYQFENLFSKRNAPVAHAVGFWDYKSFILASTQYQP  85

Query  417  LGFATTGGKKMQMNELAAFLGHVGSKTS  500
            LGF T+GGKKMQM E++AFL HVGSKTS
Sbjct  86   LGFGTSGGKKMQMKEVSAFLSHVGSKTS  113



>gb|EMS53119.1| Chitinase-like protein 1 [Triticum urartu]
Length=640

 Score =   144 bits (363),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 79/97 (81%), Gaps = 1/97 (1%)
 Frame = +3

Query  237  CAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQP  416
            C KGWEC+  S+FCCN TITD F  YQFE LFAKRN+ +AHA GFWDY++FI A+A ++P
Sbjct  31   CDKGWECSG-SRFCCNETITDYFKAYQFEELFAKRNNSLAHAAGFWDYKAFITAAALYEP  89

Query  417  LGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
             GF TTGG++M M E+AAFLGHVG+KTSCGY +A GG
Sbjct  90   RGFGTTGGREMSMKEVAAFLGHVGAKTSCGYSLADGG  126



>gb|ABD92820.1| class I chitinase [Limonium bicolor]
Length=319

 Score =   140 bits (352),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C  GW C + SKFCCN TI +  D  QF+ LF   N+P AHAVGFWDY+SF+LA+  + 
Sbjct  42   VCKMGWACPEFSKFCCNQTIPEFLDVDQFQQLFPNINAPTAHAVGFWDYQSFVLATIKYA  101

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            PLGF TTGGK M   ELAAFLGHVGS+TSCGYGVATGG
Sbjct  102  PLGFGTTGGKLMGQLELAAFLGHVGSQTSCGYGVATGG  139



>gb|EMT31096.1| Putative L-ascorbate peroxidase 6 [Aegilops tauschii]
Length=710

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 79/97 (81%), Gaps = 1/97 (1%)
 Frame = +3

Query  237  CAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQP  416
            C KGWEC+  S+FCCN TITD F  YQFE LFAKR+S +AHA GFWDY++FI A+A F+P
Sbjct  31   CDKGWECSG-SRFCCNETITDYFKAYQFEELFAKRHSSLAHATGFWDYQAFITAAALFEP  89

Query  417  LGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
             GF TTGG++M M E+AAFLGHVG+KTSCGY +A GG
Sbjct  90   RGFGTTGGREMSMKEVAAFLGHVGAKTSCGYSLADGG  126



>gb|AAS15706.1| putative class I chitinase [Picea abies]
Length=123

 Score =   133 bits (334),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 74/98 (76%), Gaps = 2/98 (2%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC  +  +CCN TI+ IF    FE LF+KRNSP+AHAVGFWDY SFI A+A F+
Sbjct  27   ICDKGWECKGV--YCCNQTISQIFTVDNFEELFSKRNSPVAHAVGFWDYYSFINAAAQFE  84

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
             +GF TTGG+ MQ  ELAAF GHV ++TSCGY VA GG
Sbjct  85   GIGFGTTGGQLMQQKELAAFFGHVAAETSCGYSVAVGG  122



>gb|ABL86684.1| CLT2 [Gossypium barbadense]
Length=264

 Score =   137 bits (344),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  288  TITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELA  467
            TI+D F TYQFENLFAKRN+P+AHAVGFWDY SFI A+A +QP GF TTGGK   M ELA
Sbjct  1    TISDYFQTYQFENLFAKRNTPVAHAVGFWDYHSFITAAAQYQPHGFGTTGGKLQSMKELA  60

Query  468  AFLGHVGSKTSCGYGVATGG  527
            AFLGHVGSKTSCGYGVATGG
Sbjct  61   AFLGHVGSKTSCGYGVATGG  80



>ref|XP_002445877.1| hypothetical protein SORBIDRAFT_07g027310 [Sorghum bicolor]
 gb|EES15372.1| hypothetical protein SORBIDRAFT_07g027310 [Sorghum bicolor]
Length=302

 Score =   137 bits (344),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 76/98 (78%), Gaps = 1/98 (1%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC+  S+FCCN TI D F  YQFE LF KRNS +AHA GFWDY++FI A+A F+
Sbjct  28   VCDKGWECSG-SRFCCNETIGDFFKAYQFEELFPKRNSDLAHAAGFWDYKAFITAAALFE  86

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            P GF TTGGK+M M E+AAFLGHVG+KTSCGY  A  G
Sbjct  87   PRGFGTTGGKEMGMMEVAAFLGHVGAKTSCGYNEAPDG  124



>ref|NP_001062281.1| Os08g0522500 [Oryza sativa Japonica Group]
 dbj|BAC55635.1| putative chitinase precursor [Oryza sativa Japonica Group]
 dbj|BAD08871.1| putative chitinase precursor [Oryza sativa Japonica Group]
 dbj|BAF24195.1| Os08g0522500 [Oryza sativa Japonica Group]
 gb|EAZ43378.1| hypothetical protein OsJ_27982 [Oryza sativa Japonica Group]
 dbj|BAG95730.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96901.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97629.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87308.1| unnamed protein product [Oryza sativa Japonica Group]
Length=316

 Score =   137 bits (344),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 77/98 (79%), Gaps = 2/98 (2%)
 Frame = +3

Query  237  CAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNS-PIAHAVGFWDYRSFILASADFQ  413
            C KGWEC+  S+FCCN TITD F  YQFE LFA RN   +AHA GFWDY +FI A+A F+
Sbjct  42   CDKGWECSG-SRFCCNDTITDYFKAYQFEELFAHRNDRSLAHAAGFWDYHAFITAAALFE  100

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            P GF TTGGK++ M E+AAFLGHVG+KTSCGY VATGG
Sbjct  101  PRGFGTTGGKEVGMKEVAAFLGHVGAKTSCGYSVATGG  138



>gb|EAZ07679.1| hypothetical protein OsI_29936 [Oryza sativa Indica Group]
Length=316

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 77/98 (79%), Gaps = 2/98 (2%)
 Frame = +3

Query  237  CAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNS-PIAHAVGFWDYRSFILASADFQ  413
            C KGWEC+  S+FCCN TITD F  YQFE LFA RN   +AHA GFWDY +FI A+A F+
Sbjct  42   CDKGWECSG-SRFCCNDTITDYFKAYQFEELFAHRNDRSLAHAAGFWDYHAFITAAALFE  100

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            P GF TTGGK++ M E+AAFLGHVG+KTSCGY VATGG
Sbjct  101  PRGFGTTGGKEVGMKEVAAFLGHVGAKTSCGYSVATGG  138



>gb|AGY34712.1| chitinase class VII [Saccharum hybrid cultivar]
Length=299

 Score =   135 bits (340),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 75/98 (77%), Gaps = 1/98 (1%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC+  S+FCCN TI D F  YQFE LF KRNS +AHA GFWDY++FI A+A F 
Sbjct  25   VCDKGWECSG-SRFCCNETIGDFFKAYQFEELFPKRNSDLAHAAGFWDYKAFITAAALFV  83

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            P GF TTGGK+M M E+AAFLGHVG+KTSCGY  A  G
Sbjct  84   PRGFGTTGGKEMGMREVAAFLGHVGAKTSCGYKEAPDG  121



>gb|AGY34713.1| chitinase class VII [Saccharum hybrid cultivar]
Length=299

 Score =   135 bits (340),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 75/98 (77%), Gaps = 1/98 (1%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC+  S+FCCN TI D F  YQFE LF KRNS +AHA GFWDY++FI A+A F 
Sbjct  25   VCDKGWECSG-SRFCCNETIGDFFKAYQFEELFPKRNSDLAHAAGFWDYKAFITAAALFV  83

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            P GF TTGGK+M M E+AAFLGHVG+KTSCGY  A  G
Sbjct  84   PRGFGTTGGKEMGMREVAAFLGHVGAKTSCGYKEAPDG  121



>gb|ABK23415.1| unknown [Picea sitchensis]
Length=300

 Score =   132 bits (332),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 74/98 (76%), Gaps = 2/98 (2%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC  +  +CCN TI+ IF    FE LF+KRNSP+AHAVGFWDY SFI A+A F+
Sbjct  27   ICDKGWECKGV--YCCNQTISQIFTVDNFEELFSKRNSPVAHAVGFWDYYSFINAAAQFE  84

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
             +GF TTGG+ MQ  ELAAF GHV ++TSCGY VA GG
Sbjct  85   GIGFGTTGGQLMQQKELAAFFGHVAAETSCGYSVAVGG  122



>gb|ACN39823.1| unknown [Picea sitchensis]
 gb|ACN39949.1| unknown [Picea sitchensis]
 gb|ACN40505.1| unknown [Picea sitchensis]
 gb|ACN40651.1| unknown [Picea sitchensis]
Length=300

 Score =   132 bits (332),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 74/98 (76%), Gaps = 2/98 (2%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC  +  +CCN TI+ IF    FE LF+KRNSP+AHAVGFWDY SFI A+A F+
Sbjct  27   ICDKGWECKGV--YCCNQTISQIFTVDNFEELFSKRNSPVAHAVGFWDYYSFINAAAQFE  84

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
             +GF TTGG+ MQ  ELAAF GHV ++TSCGY VA GG
Sbjct  85   GIGFGTTGGQLMQQKELAAFFGHVAAETSCGYSVAVGG  122



>ref|XP_004973912.1| PREDICTED: chitinase-like protein 1-like [Setaria italica]
Length=307

 Score =   130 bits (328),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 74/98 (76%), Gaps = 1/98 (1%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC+  S+FCCN  I+D F  YQFE LFA RN   AHA  FW+Y++FI A+A F+
Sbjct  33   VCDKGWECSG-SRFCCNEAISDYFKAYQFEELFAHRNDAQAHAADFWNYQAFITAAALFE  91

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            P GF TTGGK+M M E+AAFLGHVG+KTSCGY  A GG
Sbjct  92   PRGFGTTGGKEMGMREVAAFLGHVGAKTSCGYREAPGG  129



>emb|CAZ64529.1| endochitinase [Populus trichocarpa]
Length=73

 Score =   116 bits (291),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +3

Query  252  ECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFAT  431
            EC   S++CCN TI+DIF  YQFENLF+ RNSP+AHAVGFWDYRSFILAS  FQ LGF T
Sbjct  1    ECLDWSEYCCNETISDIFQPYQFENLFSNRNSPVAHAVGFWDYRSFILASTSFQHLGFCT  60

Query  432  TGGKKMQMNELAA  470
            TGGK  QM ELAA
Sbjct  61   TGGKATQMKELAA  73



>ref|XP_003572384.1| PREDICTED: chitinase-like protein 1 [Brachypodium distachyon]
Length=310

 Score =   120 bits (302),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 70/92 (76%), Gaps = 1/92 (1%)
 Frame = +3

Query  237  CAKGWECN-KLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            C +GW+C+ +  + CCN TI+D F    FE LF KRN  +AHA GFWDYR+FI A+A F+
Sbjct  35   CGEGWDCSGRGGRLCCNGTISDYFKAEHFEELFPKRNDSLAHAAGFWDYRAFITAAALFE  94

Query  414  PLGFATTGGKKMQMNELAAFLGHVGSKTSCGY  509
            P GF TTGG++M + E+AAFLGH+G+KTSCG+
Sbjct  95   PRGFGTTGGREMGVKEVAAFLGHIGAKTSCGH  126



>gb|EMS52807.1| Chitinase-like protein 1 [Triticum urartu]
Length=312

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 62/90 (69%), Gaps = 1/90 (1%)
 Frame = +3

Query  237  CAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQP  416
            C KGWE    S+ CC   ITD F    FE LF +RN  IAHA GFWDY +FI A+A F+P
Sbjct  27   CDKGWE-RSGSRLCCKRNITDFFKARHFEELFPRRNDTIAHAAGFWDYPAFIAAAALFEP  85

Query  417  LGFATTGGKKMQMNELAAFLGHVGSKTSCG  506
             GF TTGGK+M + E+AAFL HVG+ TSCG
Sbjct  86   RGFGTTGGKEMGVREVAAFLAHVGASTSCG  115



>gb|KHG26643.1| Chitinase-like protein 2 [Gossypium arboreum]
Length=288

 Score =   105 bits (262),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +3

Query  234  MCAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQ  413
            +C KGWEC   S+FCCN TI+D F TYQFENLFAKRN+P+AHAVGFWDY SFI A+A +Q
Sbjct  26   LCDKGWECKGWSQFCCNQTISDYFQTYQFENLFAKRNTPVAHAVGFWDYHSFITAAAQYQ  85

Query  414  P  416
            P
Sbjct  86   P  86



>gb|ABK23781.1| unknown [Picea sitchensis]
Length=320

 Score =   100 bits (248),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 60/89 (67%), Gaps = 7/89 (8%)
 Frame = +3

Query  237  CAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQP  416
            C KG EC        N TI+++F   QFE+LF+ RN+P+AHA GFWDY SFI A+A F+P
Sbjct  49   CIKGAECK-------NKTISELFTVDQFESLFSHRNAPMAHAQGFWDYHSFITAAAHFEP  101

Query  417  LGFATTGGKKMQMNELAAFLGHVGSKTSC  503
             GF  TGG  +Q  ELAAF  HV ++TSC
Sbjct  102  KGFGATGGDLVQKKELAAFFAHVATETSC  130



>ref|XP_003615141.1| Class1 chitinase [Medicago truncatula]
 gb|AES98099.1| class I chitinase [Medicago truncatula]
Length=104

 Score = 94.0 bits (232),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 56/81 (69%), Gaps = 6/81 (7%)
 Frame = +3

Query  243  KGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLG  422
            KGW     S +  NLTITD F TYQFENLF+K+NS IAH VGF DY S I  ++ F PLG
Sbjct  16   KGW-----SIYYLNLTITDYFQTYQFENLFSKQNSLIAH-VGFLDYHSIITTTSLFDPLG  69

Query  423  FATTGGKKMQMNELAAFLGHV  485
            F TTG   +QM E+AAF GH+
Sbjct  70   FGTTGNNSLQMTEIAAFHGHI  90



>gb|AAQ84319.1| fiber glycosyl hydrolase family 19 protein [Gossypium barbadense]
Length=238

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +3

Query  360  AVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            AVGFWDY SFI A+A +QP GF TTG K   M E+AAFLGHVGSKTSCGYGVATGG
Sbjct  1    AVGFWDYHSFITAAAQYQPHGFCTTGEKLQNMKEVAAFLGHVGSKTSCGYGVATGG  56



>ref|XP_001771063.1| predicted protein [Physcomitrella patens]
 gb|EDQ64064.1| predicted protein [Physcomitrella patens]
Length=292

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 58/96 (60%), Gaps = 1/96 (1%)
 Frame = +3

Query  243  KGWECNK-LSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPL  419
            KG  C K L +  CN TI+D+F    FE++F  RN   AHA GFW Y  F+ A+  F+  
Sbjct  23   KGLVCTKELKEDGCNKTISDLFTVQTFEDMFKHRNDRAAHAAGFWTYDGFMAAAQMFEKD  82

Query  420  GFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            GFA+ GG  MQ  ELAAF  HV  +TSCG+ +A  G
Sbjct  83   GFASVGGDDMQKRELAAFFAHVAHETSCGWSMAKDG  118



>emb|CDX95895.1| BnaC05g36460D [Brassica napus]
Length=319

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +3

Query  354  AHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            AHAVGFWDYRSFI A+A++QPLG  T G K   M E+AAFLGH+     CGYGVATGG
Sbjct  104  AHAVGFWDYRSFINAAAEYQPLGLDTAGDKLQGMKEVAAFLGHLNRFIKCGYGVATGG  161



>ref|XP_002970118.1| hypothetical protein SELMODRAFT_227948 [Selaginella moellendorffii]
 gb|EFJ29242.1| hypothetical protein SELMODRAFT_227948 [Selaginella moellendorffii]
Length=293

 Score = 83.2 bits (204),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 58/96 (60%), Gaps = 0/96 (0%)
 Frame = +3

Query  240  AKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPL  419
            AKG +   L+    N T+ +IF +  F+ +F  RN P  HA GF+D+ SFI A+   +  
Sbjct  24   AKGGDNVALAAKPKNKTVAEIFTSDLFDLMFNHRNEPQTHAQGFYDHYSFITAAKTMEKE  83

Query  420  GFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            GF  TGG+ +Q  E+AAFL HV  +T+CGY  A GG
Sbjct  84   GFGVTGGETVQKREIAAFLAHVAHETTCGYSAAKGG  119



>ref|XP_002985308.1| hypothetical protein SELMODRAFT_229092 [Selaginella moellendorffii]
 gb|EFJ13802.1| hypothetical protein SELMODRAFT_229092 [Selaginella moellendorffii]
Length=293

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +3

Query  282  NLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNE  461
            N T+ +IF +  F+ +F  RN P  HA GF+D+ SFI A+   +  GF  TGG+ +Q  E
Sbjct  38   NKTVAEIFTSDLFDLMFNHRNEPQTHAQGFYDHYSFITAAKTMEKEGFGVTGGETVQKRE  97

Query  462  LAAFLGHVGSKTSCGYGVATGG  527
            +AAFL HV  +T+CGY  A GG
Sbjct  98   IAAFLAHVAHETTCGYSAAKGG  119



>ref|XP_001781538.1| predicted protein [Physcomitrella patens]
 gb|EDQ53657.1| predicted protein [Physcomitrella patens]
Length=274

 Score = 80.5 bits (197),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = +3

Query  279  CNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMN  458
            CN TI+D+F    FE +F  RN  +AHA GFW Y  F+ A+  FQ  GF + GG   Q  
Sbjct  18   CNKTISDLFTEGMFEGMFMHRNGRMAHAQGFWSYGGFMTAAKMFQSAGFGSVGGDDTQKK  77

Query  459  ELAAFLGHVGSKTSCGY  509
            ELAAF  HV  +TSCG+
Sbjct  78   ELAAFFAHVAHETSCGW  94



>ref|XP_001781573.1| predicted protein [Physcomitrella patens]
 gb|EDQ53624.1| predicted protein [Physcomitrella patens]
Length=280

 Score = 79.7 bits (195),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 50/83 (60%), Gaps = 0/83 (0%)
 Frame = +3

Query  279  CNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMN  458
            CN T++++F+   FE +F  RN   AHA GFW Y  FI A+  F+  GF   GG+ +Q  
Sbjct  24   CNKTVSELFNAEMFEAMFKHRNDKAAHAQGFWSYDGFIAAAKMFEKDGFGMVGGEDVQKR  83

Query  459  ELAAFLGHVGSKTSCGYGVATGG  527
            EL+AF  HV  +TSCG+  A  G
Sbjct  84   ELSAFFAHVAHETSCGWSGAKDG  106



>gb|EMT04393.1| Endochitinase CH25 [Aegilops tauschii]
Length=677

 Score = 82.4 bits (202),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 38/65 (58%), Positives = 47/65 (72%), Gaps = 2/65 (3%)
 Frame = +3

Query  315  QFENLFAKRNSPIAHAVGFWDYR--SFILASADFQPLGFATTGGKKMQMNELAAFLGHVG  488
             FE LF +RN  IAHA GFWD+   +FI A+A F+P GF TTGGK+M +  +AAFL HVG
Sbjct  62   HFEELFPRRNDFIAHAAGFWDWDHPAFIAAAALFEPRGFGTTGGKEMGVRVVAAFLAHVG  121

Query  489  SKTSC  503
            + TSC
Sbjct  122  ASTSC  126



>emb|CDX92107.1| BnaA05g23000D [Brassica napus]
Length=139

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 41/59 (69%), Gaps = 1/59 (2%)
 Frame = +3

Query  351  IAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAAFLGHVGSKTSCGYGVATGG  527
            +AHAVGFWD R FI A+ ++QPL F T G K   + E++AFLGHV    S GYGV TGG
Sbjct  76   VAHAVGFWDCRLFINAATEYQPLDFGTAGDKFQGIKEVSAFLGHV-QAWSRGYGVVTGG  133



>ref|XP_006379300.1| hypothetical protein POPTR_0009s14410g, partial [Populus trichocarpa]
 gb|ERP57097.1| hypothetical protein POPTR_0009s14410g, partial [Populus trichocarpa]
Length=304

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 44/79 (56%), Gaps = 2/79 (3%)
 Frame = +3

Query  291  ITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAA  470
            ++DI     FE     RN P  HAVGF+ Y +FI A+ +F   G+  TG   ++  E+AA
Sbjct  52   LSDIIPESTFEAFLKYRNDPQCHAVGFYTYDAFISAAKEFPDFGY--TGDDLIRKREIAA  109

Query  471  FLGHVGSKTSCGYGVATGG  527
            FLG    +T+ G+  A GG
Sbjct  110  FLGQTSHETTGGWPTAPGG  128



>ref|XP_006379301.1| hypothetical protein POPTR_0009s14430g [Populus trichocarpa]
 gb|ERP57098.1| hypothetical protein POPTR_0009s14430g [Populus trichocarpa]
Length=330

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 44/79 (56%), Gaps = 2/79 (3%)
 Frame = +3

Query  291  ITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAA  470
            ++DI     F+++   RN P  HAVGF+ Y +FI A+ +F    F  TG   M+  E+AA
Sbjct  79   LSDIIPESMFDDMLKYRNDPQCHAVGFYTYDAFISAAKEFP--DFGNTGDDLMRKREIAA  136

Query  471  FLGHVGSKTSCGYGVATGG  527
            FLG    +T+ G+  A  G
Sbjct  137  FLGQTSHETTGGWPTAPDG  155



>gb|EAZ07665.1| hypothetical protein OsI_29921 [Oryza sativa Indica Group]
Length=118

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 32/46 (70%), Gaps = 2/46 (4%)
 Frame = +3

Query  237  CAKGWECNKLSKFCCNLTITDIFDTYQFENLFAKRNS-PIAHAVGF  371
            C KGWEC+  S+FCCN TITD F  YQ+E LFA RN   + HA G+
Sbjct  42   CDKGWECSG-SRFCCNDTITDYFKAYQYEELFAHRNDRSLDHADGW  86



>gb|AAA62420.1| class I acidic chitinase, partial [Zea mays]
Length=275

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 43/79 (54%), Gaps = 2/79 (3%)
 Frame = +3

Query  291  ITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAA  470
            +  I     FE +   RN P   A GF+ Y +FI A+  F+  GF TTG  ++Q  ELAA
Sbjct  19   VASIITEDLFERMLKHRNEPDCKARGFYTYDAFITAADAFR--GFGTTGSTEVQKRELAA  76

Query  471  FLGHVGSKTSCGYGVATGG  527
            FLG  G +T+ G+  A  G
Sbjct  77   FLGQTGHETTGGWPNAPDG  95



>ref|XP_011045248.1| PREDICTED: acidic endochitinase WIN6-like [Populus euphratica]
Length=328

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 43/79 (54%), Gaps = 2/79 (3%)
 Frame = +3

Query  291  ITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAA  470
            ++DI     F+ L   RN P  HAVGF+ Y +FI A+ +F    F  TG   ++  E+AA
Sbjct  77   LSDIIPESTFDALLKYRNDPQCHAVGFYTYDAFISAAKEFP--DFGNTGDDLIRKREIAA  134

Query  471  FLGHVGSKTSCGYGVATGG  527
            FLG    +T+ G+  A  G
Sbjct  135  FLGQTSHETTGGWAEAPDG  153



>ref|XP_008645097.1| PREDICTED: LOW QUALITY PROTEIN: basic endochitinase A [Zea mays]
Length=352

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 42/79 (53%), Gaps = 2/79 (3%)
 Frame = +3

Query  291  ITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAA  470
            +  I     FE +   RN P   A GF+ Y +FI A+  F   GF TTG  ++Q  ELAA
Sbjct  97   VASIITEDLFERMLKHRNEPDCKARGFYTYDAFITAADAFX--GFGTTGSTEVQKRELAA  154

Query  471  FLGHVGSKTSCGYGVATGG  527
            FLG  G +T+ G+  A  G
Sbjct  155  FLGQTGHETTGGWPNAPDG  173



>gb|KHN15004.1| Endochitinase [Glycine soja]
Length=196

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 41/79 (52%), Gaps = 2/79 (3%)
 Frame = +3

Query  291  ITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAA  470
            I++I    QFE +   RN P     GF+ Y +FI A++ F   GF TTG    +  E+AA
Sbjct  78   ISNIMTRSQFEEMLKHRNDPACPGHGFYTYDAFIAAASSFN--GFGTTGDITTRKREIAA  135

Query  471  FLGHVGSKTSCGYGVATGG  527
            FL     +TS G+  A  G
Sbjct  136  FLAQTSHETSGGWPTAPDG  154



>ref|XP_002312922.1| hypothetical protein POPTR_0009s14390g [Populus trichocarpa]
 gb|EEE86877.1| hypothetical protein POPTR_0009s14390g [Populus trichocarpa]
Length=334

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 43/79 (54%), Gaps = 2/79 (3%)
 Frame = +3

Query  291  ITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAA  470
            ++DI     F+ L   RN P  HAVGF+ Y +FI A+ +F    F  TG   M+  E+AA
Sbjct  82   LSDIIPKSTFDALLKFRNDPRCHAVGFYTYDAFISAAKEFP--DFGNTGDDLMRKREIAA  139

Query  471  FLGHVGSKTSCGYGVATGG  527
            FLG    +T+ G+  A  G
Sbjct  140  FLGQTSHETTEGWPDAPCG  158



>ref|XP_011045270.1| PREDICTED: acidic endochitinase WIN6 [Populus euphratica]
Length=330

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 42/79 (53%), Gaps = 2/79 (3%)
 Frame = +3

Query  291  ITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAA  470
            ++DI     F+ L   RN P  HAVGF+ Y +FI A+ +F    F  TG    +  E+AA
Sbjct  79   LSDIIPESTFDALLKYRNDPRCHAVGFYTYDAFISAAKEFP--DFGNTGDNLTRRREIAA  136

Query  471  FLGHVGSKTSCGYGVATGG  527
            FLG    +T+ G+  A  G
Sbjct  137  FLGQTSHETTGGWPEAPDG  155



>emb|CBI22907.3| unnamed protein product [Vitis vinifera]
Length=211

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +3

Query  447  MQMNELAAFLGHVGSKTSCGYGVATGG  527
            MQM E+AAFLGHVGSKT+CGYGVATGG
Sbjct  1    MQMKEVAAFLGHVGSKTTCGYGVATGG  27



>ref|XP_003547902.2| PREDICTED: LOW QUALITY PROTEIN: endochitinase A-like [Glycine 
max]
Length=634

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 41/79 (52%), Gaps = 2/79 (3%)
 Frame = +3

Query  291  ITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAA  470
            I++I    QFE +   RN P     GF+ Y +FI A++ F   GF TTG    +  E+AA
Sbjct  395  ISNIITRSQFEEMLKHRNDPACPGHGFYTYDAFIAAASSFN--GFGTTGDITTRKREIAA  452

Query  471  FLGHVGSKTSCGYGVATGG  527
            FL     +TS G+  A  G
Sbjct  453  FLAQTSHETSGGWPTAPDG  471



>emb|CDP01819.1| unnamed protein product [Coffea canephora]
Length=324

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 42/79 (53%), Gaps = 2/79 (3%)
 Frame = +3

Query  291  ITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAA  470
            I+ +     F+ +   RN P   + GF+ Y +FI A+  F   GFATTG  + Q  E+AA
Sbjct  84   ISSLISQALFDQMLKYRNDPRCPSNGFYSYNAFITAAQSFP--GFATTGNDETQKREIAA  141

Query  471  FLGHVGSKTSCGYGVATGG  527
            FLG    +T+ G+  A  G
Sbjct  142  FLGQTSHETTGGWPSAPDG  160



>gb|AEW08791.1| hypothetical protein CL1635Contig1_06, partial [Pinus radiata]
 gb|AFG45012.1| hypothetical protein CL1635Contig1_06, partial [Pinus taeda]
 gb|AFG45013.1| hypothetical protein CL1635Contig1_06, partial [Pinus taeda]
 gb|AFG45014.1| hypothetical protein CL1635Contig1_06, partial [Pinus taeda]
 gb|AFG45015.1| hypothetical protein CL1635Contig1_06, partial [Pinus taeda]
 gb|AFG45016.1| hypothetical protein CL1635Contig1_06, partial [Pinus taeda]
 gb|AFG45017.1| hypothetical protein CL1635Contig1_06, partial [Pinus taeda]
 gb|AFG45018.1| hypothetical protein CL1635Contig1_06, partial [Pinus taeda]
 gb|AFG45019.1| hypothetical protein CL1635Contig1_06, partial [Pinus taeda]
 gb|AFG45020.1| hypothetical protein CL1635Contig1_06, partial [Pinus taeda]
 gb|AFG45021.1| hypothetical protein CL1635Contig1_06, partial [Pinus taeda]
 gb|AFG45022.1| hypothetical protein CL1635Contig1_06, partial [Pinus taeda]
 gb|AFG45023.1| hypothetical protein CL1635Contig1_06, partial [Pinus taeda]
 gb|AFG45024.1| hypothetical protein CL1635Contig1_06, partial [Pinus taeda]
 gb|AFG45025.1| hypothetical protein CL1635Contig1_06, partial [Pinus taeda]
 gb|AFG45026.1| hypothetical protein CL1635Contig1_06, partial [Pinus taeda]
 gb|AFG45027.1| hypothetical protein CL1635Contig1_06, partial [Pinus taeda]
 gb|AFG45028.1| hypothetical protein CL1635Contig1_06, partial [Pinus taeda]
 gb|AFG45029.1| hypothetical protein CL1635Contig1_06, partial [Pinus taeda]
Length=66

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  381  RSFILASADFQPLGFATTGGKKMQMNELAAFLGHVGSKTSC  503
             SFI A+A ++P GF TTGG  +Q  ELAAF  H+ ++TSC
Sbjct  1    HSFITAAAHYEPKGFGTTGGDIVQKRELAAFFAHIATETSC  41



>gb|AAF69774.1|AF135134_1 class I chitinase [Arabis blepharophylla]
Length=289

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 44/84 (52%), Gaps = 2/84 (2%)
 Frame = +3

Query  276  CCNLTITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQM  455
            C    ++DI  + QF+++   RN+    A GF+ Y +FI A+  F   GF TTG    + 
Sbjct  36   CTPGDLSDIISSSQFDDMLKNRNAASCPARGFYTYNAFITAAKSFP--GFGTTGDTATRK  93

Query  456  NELAAFLGHVGSKTSCGYGVATGG  527
             E+AAF G    +T+ G+  A  G
Sbjct  94   KEVAAFFGQTSHETTGGWASAPDG  117



>ref|XP_010672242.1| PREDICTED: endochitinase-like [Beta vulgaris subsp. vulgaris]
Length=339

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 40/79 (51%), Gaps = 2/79 (3%)
 Frame = +3

Query  291  ITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAA  470
            ITDIF    FE +   RN+    A GF+ Y  FI A+A F    FA  G  + +  ELAA
Sbjct  87   ITDIFSEATFEEMLLHRNNDACPAKGFYTYYDFITAAASFP--EFANIGDVETRKRELAA  144

Query  471  FLGHVGSKTSCGYGVATGG  527
            F G    +T+ G+  A  G
Sbjct  145  FFGQTSQETTGGWPTAPDG  163



>ref|XP_004163409.1| PREDICTED: endochitinase-like [Cucumis sativus]
Length=324

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 39/70 (56%), Gaps = 2/70 (3%)
 Frame = +3

Query  318  FENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAAFLGHVGSKT  497
            F  +F  RN P     G ++YR+F+ A+  F   GFATTG +  +  ELAAFLG    +T
Sbjct  93   FNQMFKHRNEPDCQNNGIYNYRAFLNAAQSFN--GFATTGDESTRKRELAAFLGQTSKET  150

Query  498  SCGYGVATGG  527
            + G+  A  G
Sbjct  151  TGGWETAPDG  160



>ref|XP_006387601.1| hypothetical protein POPTR_0790s00200g [Populus trichocarpa]
 gb|ERP46515.1| hypothetical protein POPTR_0790s00200g [Populus trichocarpa]
Length=325

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 42/78 (54%), Gaps = 2/78 (3%)
 Frame = +3

Query  291  ITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAA  470
            ++DI     F+++   RN P   AVGF+ Y +FI A+ +F    F  TG   M+  E+AA
Sbjct  74   LSDIIPESMFDDMLKYRNDPQCPAVGFYTYNAFISAAKEFP--DFGNTGDDLMRKREIAA  131

Query  471  FLGHVGSKTSCGYGVATG  524
            FLG    +T+  +  A G
Sbjct  132  FLGQTSHETNGWWPAAQG  149



>ref|XP_006387600.1| hypothetical protein POPTR_0790s00200g [Populus trichocarpa]
 gb|ERP46514.1| hypothetical protein POPTR_0790s00200g [Populus trichocarpa]
Length=319

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 42/78 (54%), Gaps = 2/78 (3%)
 Frame = +3

Query  291  ITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAA  470
            ++DI     F+++   RN P   AVGF+ Y +FI A+ +F    F  TG   M+  E+AA
Sbjct  68   LSDIIPESMFDDMLKYRNDPQCPAVGFYTYNAFISAAKEFP--DFGNTGDDLMRKREIAA  125

Query  471  FLGHVGSKTSCGYGVATG  524
            FLG    +T+  +  A G
Sbjct  126  FLGQTSHETNGWWPAAQG  143



>ref|XP_002312916.2| hypothetical protein POPTR_0009s14400g [Populus trichocarpa]
 gb|EEE86871.2| hypothetical protein POPTR_0009s14400g [Populus trichocarpa]
Length=336

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 42/78 (54%), Gaps = 2/78 (3%)
 Frame = +3

Query  291  ITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAA  470
            ++DI     F+++   RN P   AVGF+ Y +FI A+ +F    F  TG   M+  E+AA
Sbjct  85   LSDIIPESMFDDMLKYRNDPQCPAVGFYTYNAFISAAKEFP--DFGNTGDDLMRKREIAA  142

Query  471  FLGHVGSKTSCGYGVATG  524
            FLG    +T+  +  A G
Sbjct  143  FLGQTSHETNGWWPAAQG  160



>pir||S18750 chitinase (EC 3.2.1.14) precursor - western balsam poplar x cottonwood
Length=336

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 42/78 (54%), Gaps = 2/78 (3%)
 Frame = +3

Query  291  ITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAA  470
            ++DI     F+++   RN P   AVGF+ Y +FI A+ +F    F  TG   M+  E+AA
Sbjct  85   LSDIIPESMFDDMLKYRNDPQCPAVGFYTYNAFISAAKEFP--DFGNTGDDLMRKREIAA  142

Query  471  FLGHVGSKTSCGYGVATG  524
            FLG    +T+  +  A G
Sbjct  143  FLGQTSHETNGWWPAAQG  160



>ref|XP_003629192.1| Endochitinase [Medicago truncatula]
 gb|AET03668.1| Chitinase (Class Ib) / Hevein [Medicago truncatula]
Length=320

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 41/79 (52%), Gaps = 2/79 (3%)
 Frame = +3

Query  291  ITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAA  470
            +  +  +  F+ +   RN P   A GF+ Y SFI A+  F   GF TTG +  +  E+AA
Sbjct  80   VGSLISSSMFDEMLKYRNDPRCAARGFYSYDSFITAARSFN--GFGTTGDENTRKREVAA  137

Query  471  FLGHVGSKTSCGYGVATGG  527
            FLG    +T+ G+  A  G
Sbjct  138  FLGQTSHETTGGWPTAPDG  156



>sp|P29031.2|CHIB_POPTR RecName: Full=Acidic endochitinase WIN6.2B; Flags: Precursor 
[Populus trichocarpa]
 emb|CAA42612.1| gwin6.2b [Populus trichocarpa]
Length=303

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 42/78 (54%), Gaps = 2/78 (3%)
 Frame = +3

Query  291  ITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAA  470
            ++DI     F+++   RN P   AVGF+ Y +FI A+ +F    F  TG   M+  E+AA
Sbjct  85   LSDIIPESMFDDMLKYRNDPQCPAVGFYTYNAFISAAKEFP--DFGNTGDDLMRKREIAA  142

Query  471  FLGHVGSKTSCGYGVATG  524
            FLG    +T+  +  A G
Sbjct  143  FLGQTSHETNGWWPAAQG  160



>gb|EEE53030.1| hypothetical protein OsJ_35750 [Oryza sativa Japonica Group]
Length=99

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 31/44 (70%), Gaps = 3/44 (7%)
 Frame = +3

Query  375  DYRSFILASADFQ---PLGFATTGGKKMQMNELAAFLGHVGSKT  497
            + R+FI A+A      PLGF TT GKKMQM EL AFLGHVGS +
Sbjct  17   NRRAFITATAPPPSSIPLGFCTTRGKKMQMMELYAFLGHVGSTS  60



>gb|AAF69781.1|AF135141_1 class I chitinase [Boechera gunnisoniana]
Length=295

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 42/79 (53%), Gaps = 2/79 (3%)
 Frame = +3

Query  291  ITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAA  470
            ++ I  + QF+++   RN     A GF+ Y +FI A+  F  LGF TTG    +  E+AA
Sbjct  47   LSGIISSSQFDDMLKHRNDAACPARGFYTYNAFITAAKSF--LGFGTTGDTATRKKEIAA  104

Query  471  FLGHVGSKTSCGYGVATGG  527
            F G    +T+ G+  A  G
Sbjct  105  FFGQTSHETTGGWASAPDG  123



>gb|AAF04453.1|AF000964_1 chitinase [Poa pratensis]
Length=340

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 41/79 (52%), Gaps = 2/79 (3%)
 Frame = +3

Query  291  ITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAA  470
            ++ +     FE +   RN P   A GF+ Y++FI A+  F   GF TTG   ++  E+AA
Sbjct  78   VSSLVSQSLFEQMLLHRNDPSCQANGFYTYKAFIAAANSF--AGFGTTGSTDVRKREVAA  135

Query  471  FLGHVGSKTSCGYGVATGG  527
            FL     +T+ G+  A  G
Sbjct  136  FLAQTSHETTGGWPTAPDG  154



>gb|AAF69776.1|AF135136_1 class I chitinase [Boechera fecunda]
Length=300

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 41/79 (52%), Gaps = 2/79 (3%)
 Frame = +3

Query  291  ITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAA  470
            ++DI  + QF+ +   RN     A GF+ Y +FI A+  F   GF TTG    +  E+AA
Sbjct  51   LSDIISSSQFDYMLMHRNDAACPARGFYTYNAFITAAKSFP--GFGTTGDTATRKKEIAA  108

Query  471  FLGHVGSKTSCGYGVATGG  527
            F G    +T+ G+  A  G
Sbjct  109  FFGQTSHETTGGWASAPDG  127



>gb|AFW75728.1| hypothetical protein ZEAMMB73_827760 [Zea mays]
Length=379

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 40/79 (51%), Gaps = 2/79 (3%)
 Frame = +3

Query  291  ITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAA  470
            +++I     F  +   RN     A+GF+ Y +FI A+  F   GF TTGG   Q  ELAA
Sbjct  119  VSEIISESLFNEMLLHRNDVACPAIGFYTYDAFIAAANAFP--GFGTTGGADTQKRELAA  176

Query  471  FLGHVGSKTSCGYGVATGG  527
            FL     +T+ G+  A  G
Sbjct  177  FLAQTSHETTGGWDTAPDG  195



>sp|P85084.1|CHIT_CARPA RecName: Full=Endochitinase [Carica papaya]
Length=243

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 40/79 (51%), Gaps = 2/79 (3%)
 Frame = +3

Query  291  ITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAA  470
            I  I     F+ +   RN+P   A GF+ Y +F+ A+  F    F TTG   ++  ELAA
Sbjct  2    IEKIISRSMFDQMLKHRNNPACPAKGFYTYDAFLAAAKSFP--SFGTTGSTDVRKRELAA  59

Query  471  FLGHVGSKTSCGYGVATGG  527
            FLG    +T+ G+  A  G
Sbjct  60   FLGQTSHETTGGWPSAPDG  78



>ref|XP_004135003.1| PREDICTED: endochitinase-like [Cucumis sativus]
 gb|KGN48984.1| hypothetical protein Csa_6G509040 [Cucumis sativus]
Length=324

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 38/70 (54%), Gaps = 2/70 (3%)
 Frame = +3

Query  318  FENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAAFLGHVGSKT  497
            F  +F  RN P     G ++YR+F+ A+  F   GFATTG +  +  ELAAF G    +T
Sbjct  93   FNQMFKHRNEPDCQNNGIYNYRAFLNAAQSFN--GFATTGDESTRKRELAAFFGQTSKET  150

Query  498  SCGYGVATGG  527
            + G+  A  G
Sbjct  151  TGGWETAPDG  160



>pdb|3CQL|A Chain A, Crystal Structure Of Gh Family 19 Chitinase From Carica 
Papaya
 pdb|3CQL|B Chain B, Crystal Structure Of Gh Family 19 Chitinase From Carica 
Papaya
Length=243

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 40/79 (51%), Gaps = 2/79 (3%)
 Frame = +3

Query  291  ITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAA  470
            I  I     F+ +   RN+P   A GF+ Y +FI A+  F    F TTG   ++  E+AA
Sbjct  2    IEKIISRSMFDQMLKHRNNPACPAKGFYTYDAFIAAAKSFP--SFGTTGSTDVRKREIAA  59

Query  471  FLGHVGSKTSCGYGVATGG  527
            FLG    +T+ G+  A  G
Sbjct  60   FLGQTSHETTGGWPSAPDG  78



>ref|XP_008440903.1| PREDICTED: endochitinase-like [Cucumis melo]
Length=325

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 38/70 (54%), Gaps = 2/70 (3%)
 Frame = +3

Query  318  FENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAAFLGHVGSKT  497
            F  +F   N P   + GF+ YR+F+ A+  F   GFATTG +  +  ELAAF G    +T
Sbjct  94   FNQMFKYSNDPRCPSNGFYSYRAFLTAAQSFN--GFATTGDEATRKRELAAFFGQTSQET  151

Query  498  SCGYGVATGG  527
            + G+  A  G
Sbjct  152  TGGWATAPDG  161



>dbj|BAA82810.1| basic endochitinase [Arabidopsis thaliana]
Length=335

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 41/79 (52%), Gaps = 2/79 (3%)
 Frame = +3

Query  291  ITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAA  470
            ++ I  + QF+++   RN     A GF+ Y +FI A+  F   GF TTG    +  E+AA
Sbjct  86   LSGIISSSQFDDMLKHRNDATCPARGFYTYNAFITAAKSFP--GFGTTGDTATRKKEVAA  143

Query  471  FLGHVGSKTSCGYGVATGG  527
            F G    +T+ G+  A  G
Sbjct  144  FFGQTSHETTGGWATAPDG  162



>gb|AAF69769.1|AF135129_1 class I chitinase, partial [Boechera stricta]
 gb|AAF69771.1|AF135131_1 class I chitinase, partial [Boechera holboellii]
Length=170

 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 41/79 (52%), Gaps = 2/79 (3%)
 Frame = +3

Query  291  ITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAA  470
            ++ I  + QF+++   RN     A GF+ Y +FI A+  F   GF T+G    +  E+AA
Sbjct  60   LSGIISSSQFDDMLKHRNDAACPARGFYTYNAFITAAKSFP--GFGTSGDTATRKKEIAA  117

Query  471  FLGHVGSKTSCGYGVATGG  527
            F G    +T+ G+  A  G
Sbjct  118  FFGQTSHETTGGWASAPDG  136



>gb|AHY24793.1| endochitinase [Triticum aestivum]
Length=318

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 42/79 (53%), Gaps = 2/79 (3%)
 Frame = +3

Query  291  ITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAA  470
            ++ I     F+ +   RN     A GF++Y +F+ A+  F   GFATTGG  ++  E+AA
Sbjct  77   VSSIISQSLFDQMLLHRNDAACQAKGFYNYGAFVAAANSFS--GFATTGGTDVRKREVAA  134

Query  471  FLGHVGSKTSCGYGVATGG  527
            FL     +T+ G+  A  G
Sbjct  135  FLAQTSHETTGGWPTAPDG  153



>gb|AHY24794.1| endochitinase [Triticum aestivum]
Length=318

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 42/79 (53%), Gaps = 2/79 (3%)
 Frame = +3

Query  291  ITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAA  470
            ++ I     F+ +   RN     A GF++Y +F+ A+  F   GFATTGG  ++  E+AA
Sbjct  77   VSSIISQSLFDQMLLHRNDAACQAKGFYNYGAFVAAANSFS--GFATTGGTDVRKREVAA  134

Query  471  FLGHVGSKTSCGYGVATGG  527
            FL     +T+ G+  A  G
Sbjct  135  FLAQTSHETTGGWPTAPDG  153



>gb|AAF69768.1|AF135128_1 class I chitinase, partial [Arabis alpina]
Length=212

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 41/79 (52%), Gaps = 2/79 (3%)
 Frame = +3

Query  291  ITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAA  470
            ++ I  + QF+++   RN     A GF+ Y +FI A+  F   GF TTG    +  E+AA
Sbjct  49   LSGIISSSQFDDMLKHRNDAACPARGFYTYNAFITAAKSFP--GFGTTGDTATRKKEVAA  106

Query  471  FLGHVGSKTSCGYGVATGG  527
            F G    +T+ G+  A  G
Sbjct  107  FFGQTSHETTGGWASAPDG  125



>gb|AAF69783.1|AF135143_1 class I chitinase [Boechera lemmonii]
Length=302

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 41/79 (52%), Gaps = 2/79 (3%)
 Frame = +3

Query  291  ITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAA  470
            ++DI  + QF+++   RN     A GF+ Y +FI A+  F    F TTG    +  E+AA
Sbjct  53   LSDIISSSQFDDMLMHRNDAACPARGFYTYNAFITAAKSFP--NFGTTGDTTTRKKEIAA  110

Query  471  FLGHVGSKTSCGYGVATGG  527
            F G    +T+ G+  A  G
Sbjct  111  FFGQTSHETTGGWASAPDG  129



>prf||1710349A basic chitinase
Length=334

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 41/79 (52%), Gaps = 2/79 (3%)
 Frame = +3

Query  291  ITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAA  470
            ++ I  + QF+++   RN     A GF+ Y +FI A+  F   GF TTG    +  E+AA
Sbjct  86   LSGIISSSQFDDMLKHRNDAACPARGFYTYNAFITAAKSFP--GFGTTGDTATRKKEVAA  143

Query  471  FLGHVGSKTSCGYGVATGG  527
            F G    +T+ G+  A  G
Sbjct  144  FFGQTSHETTGGWATAPDG  162



>gb|AHY24795.1| endochitinase [Triticum aestivum]
Length=320

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 42/79 (53%), Gaps = 2/79 (3%)
 Frame = +3

Query  291  ITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAA  470
            ++ I     F+ +   RN     A GF++Y +F+ A+  F   GFATTGG  ++  E+AA
Sbjct  79   VSSIISQSLFDQMLLHRNDAACQAKGFYNYGAFVAAANSFS--GFATTGGADVRKREVAA  136

Query  471  FLGHVGSKTSCGYGVATGG  527
            FL     +T+ G+  A  G
Sbjct  137  FLAQTSHETTGGWPTAPDG  155



>emb|CAA53626.1| endochitinase [Triticum aestivum]
Length=320

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 42/79 (53%), Gaps = 2/79 (3%)
 Frame = +3

Query  291  ITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAA  470
            ++ I     F+ +   RN     A GF++Y +F+ A+  F   GFATTGG  ++  E+AA
Sbjct  79   VSSIISQSLFDQMLLHRNDAACQAKGFYNYGAFVAAANSFS--GFATTGGADVRKREVAA  136

Query  471  FLGHVGSKTSCGYGVATGG  527
            FL     +T+ G+  A  G
Sbjct  137  FLAQTSHETTGGWPTAPDG  155



>emb|CDJ26692.1| unnamed protein product [Triticum aestivum]
Length=320

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 42/79 (53%), Gaps = 2/79 (3%)
 Frame = +3

Query  291  ITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAA  470
            ++ I     F+ +   RN     A GF++Y +F+ A+  F   GFATTGG  ++  E+AA
Sbjct  79   VSSIISQSLFDQMLLHRNDAACQAKGFYNYGAFVAAANSFS--GFATTGGADVRKREVAA  136

Query  471  FLGHVGSKTSCGYGVATGG  527
            FL     +T+ G+  A  G
Sbjct  137  FLAQTSHETTGGWPTAPDG  155



>gb|EMT27215.1| Basic endochitinase A [Aegilops tauschii]
Length=310

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 40/79 (51%), Gaps = 2/79 (3%)
 Frame = +3

Query  291  ITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAA  470
            ++ I     F  +   RN P  HA GF+ Y +F+ A+A F   GF TTG  + +  E+AA
Sbjct  69   VSSIISRSLFNQMLLHRNDPGCHARGFYTYDAFVTAAAAFP--GFGTTGRHRPRKREVAA  126

Query  471  FLGHVGSKTSCGYGVATGG  527
            FL     +T+  +  A  G
Sbjct  127  FLAQTSHETTGEWATAPNG  145



>gb|AAF69782.1|AF135142_1 class I chitinase [Halimolobos perplexus var. perplexus]
Length=311

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 41/79 (52%), Gaps = 2/79 (3%)
 Frame = +3

Query  291  ITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAA  470
            ++ I  + QF+++   RN+    A GF+ Y  FI A+  F   GF TTG    +  E+AA
Sbjct  63   LSGIISSSQFDDMLKHRNAAACPARGFYTYNDFITAAKSFP--GFGTTGDTATRKKEIAA  120

Query  471  FLGHVGSKTSCGYGVATGG  527
            F G    +T+ G+  A  G
Sbjct  121  FFGQTSHETTGGWATAPDG  139



>ref|NP_566426.2| basic chitinase B [Arabidopsis thaliana]
 sp|P19171.3|CHIB_ARATH RecName: Full=Basic endochitinase B; AltName: Full=Pathogenesis-related 
protein 3; Short=AtChiB; Short=PR-3; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG51023.1|AC069474_22 basic chitinase; 63810-65293 [Arabidopsis thaliana]
 gb|AAA32769.1| basic chitinase [Arabidopsis thaliana]
 dbj|BAA82811.1| basic endochitinase [Arabidopsis thaliana]
 dbj|BAA82812.1| basic endochitinase [Arabidopsis thaliana]
 dbj|BAA82813.1| basic endochitinase [Arabidopsis thaliana]
 dbj|BAA82815.1| basic endochitinase [Arabidopsis thaliana]
 dbj|BAA82816.1| basic endochitinase [Arabidopsis thaliana]
 dbj|BAA82819.1| basic endochitinase [Arabidopsis thaliana]
 dbj|BAA82820.1| basic endochitinase [Arabidopsis thaliana]
 dbj|BAA82821.1| basic endochitinase [Arabidopsis thaliana]
 dbj|BAA82822.1| basic endochitinase [Arabidopsis thaliana]
 dbj|BAA82823.1| basic endochitinase [Arabidopsis thaliana]
 dbj|BAA82825.1| basic endochitinase [Arabidopsis thaliana]
 gb|AEE75203.1| basic chitinase B [Arabidopsis thaliana]
Length=335

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 41/79 (52%), Gaps = 2/79 (3%)
 Frame = +3

Query  291  ITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAA  470
            ++ I  + QF+++   RN     A GF+ Y +FI A+  F   GF TTG    +  E+AA
Sbjct  86   LSGIISSSQFDDMLKHRNDAACPARGFYTYNAFITAAKSFP--GFGTTGDTATRKKEVAA  143

Query  471  FLGHVGSKTSCGYGVATGG  527
            F G    +T+ G+  A  G
Sbjct  144  FFGQTSHETTGGWATAPDG  162



>dbj|BAA82824.1| basic endochitinase [Arabidopsis thaliana]
Length=335

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 41/79 (52%), Gaps = 2/79 (3%)
 Frame = +3

Query  291  ITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAA  470
            ++ I  + QF+++   RN     A GF+ Y +FI A+  F   GF TTG    +  E+AA
Sbjct  86   LSGIISSSQFDDMLKHRNDAACPARGFYTYNAFITAAKSFP--GFGTTGDTATRKKEVAA  143

Query  471  FLGHVGSKTSCGYGVATGG  527
            F G    +T+ G+  A  G
Sbjct  144  FFGQTSHETTGGWATAPDG  162



>dbj|BAA82814.1| basic endochitinase [Arabidopsis thaliana]
 dbj|BAA82817.1| basic endochitinase [Arabidopsis thaliana]
Length=335

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 41/79 (52%), Gaps = 2/79 (3%)
 Frame = +3

Query  291  ITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAA  470
            ++ I  + QF+++   RN     A GF+ Y +FI A+  F   GF TTG    +  E+AA
Sbjct  86   LSGIISSSQFDDMLKHRNDAACPARGFYTYNAFITAAKSFP--GFGTTGDTATRKKEVAA  143

Query  471  FLGHVGSKTSCGYGVATGG  527
            F G    +T+ G+  A  G
Sbjct  144  FFGQTSHETTGGWATAPDG  162



>gb|AAK96819.1| basic chitinase [Arabidopsis thaliana]
 dbj|BAB03157.1| chitinase [Arabidopsis thaliana]
 gb|AAM10081.1| basic chitinase [Arabidopsis thaliana]
Length=322

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 41/79 (52%), Gaps = 2/79 (3%)
 Frame = +3

Query  291  ITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAA  470
            ++ I  + QF+++   RN     A GF+ Y +FI A+  F   GF TTG    +  E+AA
Sbjct  73   LSGIISSSQFDDMLKHRNDAACPARGFYTYNAFITAAKSFP--GFGTTGDTATRKKEVAA  130

Query  471  FLGHVGSKTSCGYGVATGG  527
            F G    +T+ G+  A  G
Sbjct  131  FFGQTSHETTGGWATAPDG  149



>gb|KDO68260.1| hypothetical protein CISIN_1g045378mg, partial [Citrus sinensis]
Length=99

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 39/76 (51%), Gaps = 2/76 (3%)
 Frame = +3

Query  300  IFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAAFLG  479
            I     FE+L   RN     A GF+ Y +FI A+  F   GF  +G + M+  E+AAF  
Sbjct  1    IISREMFEDLLPYRNDARCPARGFYTYDAFIEAAQAFP--GFGNSGNETMRKREIAAFFA  58

Query  480  HVGSKTSCGYGVATGG  527
              G +T+ G+  A GG
Sbjct  59   QTGHETTGGWTDAPGG  74



>gb|AAF69793.1|AF135153_1 class I chitinase [Boechera parishii]
Length=312

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 41/79 (52%), Gaps = 2/79 (3%)
 Frame = +3

Query  291  ITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAA  470
            ++ I  + QF+++   RN     A GF+ Y +FI A+  F   GF TTG    +  E+AA
Sbjct  64   LSGIISSSQFDDMLKHRNDAACPARGFYTYNAFITAAKSFP--GFGTTGDTATRKKEIAA  121

Query  471  FLGHVGSKTSCGYGVATGG  527
            F G    +T+ G+  A  G
Sbjct  122  FFGQTSHETTGGWASAPDG  140



>gb|AAF69786.1|AF135146_1 class I chitinase [Boechera lignifera]
Length=300

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 41/79 (52%), Gaps = 2/79 (3%)
 Frame = +3

Query  291  ITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAA  470
            ++ I  + QF+++   RN     A GF+ Y +FI A+  F   GF TTG    +  E+AA
Sbjct  52   LSGIISSSQFDDMLKHRNDAACPARGFYTYNAFITAAKSFP--GFGTTGDTATRKKEIAA  109

Query  471  FLGHVGSKTSCGYGVATGG  527
            F G    +T+ G+  A  G
Sbjct  110  FFGQTSHETTGGWASAPDG  128



>gb|AAF69791.1|AF135151_1 class I chitinase [Boechera microphylla]
Length=294

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 41/79 (52%), Gaps = 2/79 (3%)
 Frame = +3

Query  291  ITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAA  470
            ++ I  + QF+++   RN     A GF+ Y +FI A+  F   GF TTG    +  E+AA
Sbjct  46   LSGIISSSQFDDMLKHRNDAACPARGFYTYNAFITAAKSFP--GFGTTGDTATRKKEIAA  103

Query  471  FLGHVGSKTSCGYGVATGG  527
            F G    +T+ G+  A  G
Sbjct  104  FFGQTSHETTGGWASAPDG  122



>gb|AAF69787.1|AF135147_1 class I chitinase [Boechera lignifera]
 gb|AAF69790.1|AF135150_1 class I chitinase [Boechera microphylla]
Length=295

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 41/79 (52%), Gaps = 2/79 (3%)
 Frame = +3

Query  291  ITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAA  470
            ++ I  + QF+++   RN     A GF+ Y +FI A+  F   GF TTG    +  E+AA
Sbjct  47   LSGIISSSQFDDMLKHRNDAACPARGFYTYNAFITAAKSFP--GFGTTGDTATRKKEIAA  104

Query  471  FLGHVGSKTSCGYGVATGG  527
            F G    +T+ G+  A  G
Sbjct  105  FFGQTSHETTGGWASAPDG  123



>ref|XP_009344658.1| PREDICTED: endochitinase-like [Pyrus x bretschneideri]
Length=323

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 41/79 (52%), Gaps = 2/79 (3%)
 Frame = +3

Query  291  ITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAA  470
            I+ +  +  F+ +   RN P   + GF+ Y +F+ A+  F   GF TTG    +  ELAA
Sbjct  84   ISSLISSSVFDQMLKYRNDPRCQSNGFYTYDAFVAAARSFN--GFGTTGDDATRKRELAA  141

Query  471  FLGHVGSKTSCGYGVATGG  527
            FLG    +T+ G+  A  G
Sbjct  142  FLGQTSHETTGGWESAPDG  160



>gb|AAF69792.1|AF135152_1 class I chitinase [Boechera parishii]
Length=312

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 41/79 (52%), Gaps = 2/79 (3%)
 Frame = +3

Query  291  ITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAA  470
            ++ I  + QF+++   RN     A GF+ Y +FI A+  F   GF TTG    +  E+AA
Sbjct  64   LSGIISSSQFDDMLKHRNDAACPARGFYTYNAFITAAKSFP--GFGTTGDTATRKKEIAA  121

Query  471  FLGHVGSKTSCGYGVATGG  527
            F G    +T+ G+  A  G
Sbjct  122  FFGQTSHETTGGWASAPDG  140



>gb|AAF69777.1|AF135137_1 class I chitinase [Boechera fecunda]
Length=326

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 41/79 (52%), Gaps = 2/79 (3%)
 Frame = +3

Query  291  ITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAA  470
            ++ I  + QF+++   RN     A GF+ Y +FI A+  F   GF TTG    +  E+AA
Sbjct  77   LSGIISSSQFDDMLKHRNDAACPARGFYTYNAFITAAKSFP--GFGTTGDTATRKKEIAA  134

Query  471  FLGHVGSKTSCGYGVATGG  527
            F G    +T+ G+  A  G
Sbjct  135  FFGQTSHETTGGWASAPDG  153



>ref|XP_009786482.1| PREDICTED: endochitinase 3-like [Nicotiana sylvestris]
Length=341

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 43/79 (54%), Gaps = 2/79 (3%)
 Frame = +3

Query  291  ITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAA  470
            IT+I  +  F+ L   RN+    A GF+ Y +F+ A+ +F  +GF TTG    +  E+AA
Sbjct  89   ITEIISSNLFDELLLHRNNVACPARGFYTYDAFVQAARNF--IGFGTTGNTTDRKREVAA  146

Query  471  FLGHVGSKTSCGYGVATGG  527
            FL     +T+ G+  A  G
Sbjct  147  FLAQTSHETTGGWDTAPDG  165



>gb|AAF69784.1|AF135144_1 class I chitinase [Boechera lemmonii]
Length=301

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 41/79 (52%), Gaps = 2/79 (3%)
 Frame = +3

Query  291  ITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAA  470
            ++ I  + QF+++   RN     A GF+ Y +FI A+  F   GF TTG    +  E+AA
Sbjct  52   LSGIISSSQFDDMLKHRNDAACPARGFYTYNAFITAAKSFP--GFGTTGDTATRKKEIAA  109

Query  471  FLGHVGSKTSCGYGVATGG  527
            F G    +T+ G+  A  G
Sbjct  110  FFGQTSHETTGGWASAPDG  128



>gb|AAF69770.1|AF135130_1 class I chitinase, partial [Boechera holboellii]
Length=299

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 41/79 (52%), Gaps = 2/79 (3%)
 Frame = +3

Query  291  ITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAA  470
            ++ I  + QF+++   RN     A GF+ Y +FI A+  F   GF TTG    +  E+AA
Sbjct  51   LSGIISSSQFDDMLKHRNDAACPARGFYTYNAFITAAKSFP--GFGTTGDTATRKKEIAA  108

Query  471  FLGHVGSKTSCGYGVATGG  527
            F G    +T+ G+  A  G
Sbjct  109  FFGQTSHETTGGWASAPDG  127



>gb|AAF69775.1|AF135135_1 class I chitinase [Boechera stricta]
Length=305

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 41/79 (52%), Gaps = 2/79 (3%)
 Frame = +3

Query  291  ITDIFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAA  470
            ++ I  + QF+++   RN     A GF+ Y +FI A+  F   GF TTG    +  E+AA
Sbjct  57   LSGIISSSQFDDMLKHRNDAACPARGFYTYNAFITAAKSFP--GFGTTGDTATRKKEIAA  114

Query  471  FLGHVGSKTSCGYGVATGG  527
            F G    +T+ G+  A  G
Sbjct  115  FFGQTSHETTGGWASAPDG  133



>ref|XP_006422472.1| hypothetical protein CICLE_v10028959mg [Citrus clementina]
 gb|ESR35712.1| hypothetical protein CICLE_v10028959mg [Citrus clementina]
Length=292

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 39/76 (51%), Gaps = 2/76 (3%)
 Frame = +3

Query  300  IFDTYQFENLFAKRNSPIAHAVGFWDYRSFILASADFQPLGFATTGGKKMQMNELAAFLG  479
            I     FE+L   RN    HA GF+ Y +FI A+  F    F  +G + M+  E+AAF  
Sbjct  48   IISREMFEDLLPYRNDERCHARGFYTYDAFIEAAKAFP--AFGNSGNETMRKREIAAFFA  105

Query  480  HVGSKTSCGYGVATGG  527
              G +T+ G+  A GG
Sbjct  106  QTGHETTGGWPDAPGG  121



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559039970400