BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001G02

Length=530
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO41054.1|  hypothetical protein CISIN_1g002238mg                   196   5e-56   Citrus sinensis [apfelsine]
ref|XP_006350960.1|  PREDICTED: probable receptor protein kinase ...    198   1e-55   Solanum tuberosum [potatoes]
ref|XP_009594248.1|  PREDICTED: probable receptor protein kinase ...    197   2e-55   Nicotiana tomentosiformis
ref|XP_004249911.1|  PREDICTED: probable receptor protein kinase ...    197   3e-55   Solanum lycopersicum
ref|XP_011043912.1|  PREDICTED: probable receptor protein kinase ...    196   6e-55   Populus euphratica
ref|XP_011038249.1|  PREDICTED: probable receptor protein kinase ...    196   7e-55   Populus euphratica
ref|XP_006372526.1|  receptor protein kinase TMK1 precursor             196   7e-55   Populus trichocarpa [western balsam poplar]
ref|XP_008463160.1|  PREDICTED: probable receptor protein kinase ...    196   8e-55   Cucumis melo [Oriental melon]
ref|XP_007032166.1|  Transmembrane kinase 1 isoform 2                   195   8e-55   
ref|XP_004140293.1|  PREDICTED: probable receptor protein kinase ...    196   1e-54   
gb|KDO41053.1|  hypothetical protein CISIN_1g002238mg                   194   1e-54   Citrus sinensis [apfelsine]
ref|XP_006494665.1|  PREDICTED: probable receptor protein kinase ...    194   1e-54   Citrus sinensis [apfelsine]
ref|XP_002305223.1|  hypothetical protein POPTR_0004s08230g             195   2e-54   Populus trichocarpa [western balsam poplar]
ref|XP_006421082.1|  hypothetical protein CICLE_v10004322mg             194   2e-54   
ref|XP_007032165.1|  Transmembrane kinase 1 isoform 1                   195   2e-54   
ref|XP_008343073.1|  PREDICTED: LOW QUALITY PROTEIN: probable rec...    195   2e-54   
ref|XP_009775667.1|  PREDICTED: probable receptor protein kinase ...    195   3e-54   Nicotiana sylvestris
gb|KDO41052.1|  hypothetical protein CISIN_1g002238mg                   194   4e-54   Citrus sinensis [apfelsine]
ref|XP_006494664.1|  PREDICTED: probable receptor protein kinase ...    194   4e-54   Citrus sinensis [apfelsine]
ref|XP_009378958.1|  PREDICTED: probable receptor protein kinase ...    194   4e-54   Pyrus x bretschneideri [bai li]
ref|XP_009587166.1|  PREDICTED: probable receptor protein kinase ...    194   4e-54   Nicotiana tomentosiformis
ref|XP_009769564.1|  PREDICTED: probable receptor protein kinase ...    193   9e-54   Nicotiana sylvestris
ref|XP_010690479.1|  PREDICTED: probable receptor protein kinase ...    193   9e-54   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004289581.2|  PREDICTED: probable receptor protein kinase ...    193   1e-53   Fragaria vesca subsp. vesca
gb|KJB43187.1|  hypothetical protein B456_007G187900                    193   1e-53   Gossypium raimondii
gb|KDP25825.1|  hypothetical protein JCGZ_22547                         193   1e-53   Jatropha curcas
ref|XP_010551437.1|  PREDICTED: probable receptor protein kinase ...    193   1e-53   Tarenaya hassleriana [spider flower]
gb|KHG20581.1|  putative receptor protein kinase TMK1                   193   1e-53   Gossypium arboreum [tree cotton]
ref|XP_010528574.1|  PREDICTED: probable receptor protein kinase ...    192   2e-53   Tarenaya hassleriana [spider flower]
gb|EYU30867.1|  hypothetical protein MIMGU_mgv1a001044mg                192   3e-53   Erythranthe guttata [common monkey flower]
gb|KHN41049.1|  Putative receptor protein kinase TMK1                   191   3e-53   Glycine soja [wild soybean]
ref|XP_009370081.1|  PREDICTED: probable receptor protein kinase ...    192   4e-53   Pyrus x bretschneideri [bai li]
ref|XP_011099938.1|  PREDICTED: probable receptor protein kinase ...    191   4e-53   Sesamum indicum [beniseed]
ref|XP_010110337.1|  putative receptor protein kinase TMK1              190   7e-53   
gb|KHN08792.1|  Putative receptor protein kinase TMK1                   181   1e-52   Glycine soja [wild soybean]
ref|XP_010648936.1|  PREDICTED: probable receptor protein kinase ...    190   1e-52   Vitis vinifera
emb|CAN77178.1|  hypothetical protein VITISV_021790                     181   1e-52   Vitis vinifera
ref|XP_008244390.1|  PREDICTED: probable receptor protein kinase ...    190   1e-52   Prunus mume [ume]
gb|KCW52194.1|  hypothetical protein EUGRSUZ_J01624                     189   2e-52   Eucalyptus grandis [rose gum]
emb|CBI26796.3|  unnamed protein product                                189   2e-52   Vitis vinifera
ref|XP_007214949.1|  hypothetical protein PRUPE_ppa000942mg             190   2e-52   Prunus persica
ref|XP_010553548.1|  PREDICTED: probable receptor protein kinase ...    190   2e-52   Tarenaya hassleriana [spider flower]
ref|XP_007141936.1|  hypothetical protein PHAVU_008G238600g             189   2e-52   Phaseolus vulgaris [French bean]
ref|XP_002281552.2|  PREDICTED: probable receptor protein kinase ...    189   4e-52   Vitis vinifera
ref|XP_002533475.1|  receptor protein kinase, putative                  189   4e-52   Ricinus communis
ref|XP_010032738.1|  PREDICTED: probable receptor protein kinase ...    189   5e-52   Eucalyptus grandis [rose gum]
ref|XP_009351579.1|  PREDICTED: probable receptor protein kinase ...    187   7e-52   Pyrus x bretschneideri [bai li]
ref|XP_003552883.2|  PREDICTED: probable receptor protein kinase ...    188   9e-52   Glycine max [soybeans]
ref|XP_010553540.1|  PREDICTED: probable receptor protein kinase ...    187   1e-51   Tarenaya hassleriana [spider flower]
ref|XP_010527815.1|  PREDICTED: probable receptor protein kinase ...    187   1e-51   Tarenaya hassleriana [spider flower]
gb|KHN39482.1|  Putative receptor protein kinase TMK1                   187   1e-51   Glycine soja [wild soybean]
ref|NP_001238698.1|  NAK-type protein kinase precursor                  187   2e-51   Glycine max [soybeans]
ref|XP_010271200.1|  PREDICTED: probable receptor protein kinase ...    187   2e-51   Nelumbo nucifera [Indian lotus]
ref|XP_002887010.1|  hypothetical protein ARALYDRAFT_475717             186   4e-51   
ref|XP_010043988.1|  PREDICTED: probable receptor protein kinase ...    186   4e-51   Eucalyptus grandis [rose gum]
ref|XP_006300693.1|  hypothetical protein CARUB_v10019739mg             186   4e-51   Capsella rubella
gb|AAP04161.1|  putative receptor protein kinase (TMK1)                 186   5e-51   Arabidopsis thaliana [mouse-ear cress]
gb|ACN59264.1|  leucine-rich repeat receptor-like protein kinase        186   5e-51   Arabidopsis thaliana [mouse-ear cress]
ref|NP_176789.1|  transmembrane kinase 1                                186   5e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009105191.1|  PREDICTED: probable receptor protein kinase ...    186   6e-51   Brassica rapa
emb|CDY07484.1|  BnaA07g25630D                                          186   6e-51   Brassica napus [oilseed rape]
ref|XP_010415157.1|  PREDICTED: probable receptor protein kinase ...    186   6e-51   Camelina sativa [gold-of-pleasure]
emb|CDP01661.1|  unnamed protein product                                186   6e-51   Coffea canephora [robusta coffee]
ref|XP_010105561.1|  putative receptor protein kinase TMK1              186   7e-51   Morus notabilis
emb|CDY39246.1|  BnaC06g27450D                                          186   7e-51   Brassica napus [oilseed rape]
ref|XP_011021737.1|  PREDICTED: probable receptor protein kinase ...    185   7e-51   Populus euphratica
ref|XP_006391349.1|  hypothetical protein EUTSA_v10018085mg             185   7e-51   Eutrema salsugineum [saltwater cress]
ref|XP_008220934.1|  PREDICTED: probable receptor protein kinase ...    185   7e-51   Prunus mume [ume]
ref|XP_010556225.1|  PREDICTED: probable receptor protein kinase ...    185   8e-51   Tarenaya hassleriana [spider flower]
ref|XP_010470484.1|  PREDICTED: probable receptor protein kinase ...    185   8e-51   Camelina sativa [gold-of-pleasure]
ref|XP_002893435.1|  leucine-rich repeat family protein                 184   9e-51   Arabidopsis lyrata subsp. lyrata
ref|XP_002314766.1|  hypothetical protein POPTR_0010s11360g             185   9e-51   
ref|XP_007225345.1|  hypothetical protein PRUPE_ppa000982mg             185   1e-50   Prunus persica
ref|XP_002527538.1|  receptor protein kinase, putative                  185   1e-50   Ricinus communis
ref|XP_004490803.1|  PREDICTED: probable receptor protein kinase ...    185   1e-50   
ref|XP_006395848.1|  hypothetical protein EUTSA_v10003606mg             184   2e-50   Eutrema salsugineum [saltwater cress]
ref|XP_006290562.1|  hypothetical protein CARUB_v10016649mg             184   2e-50   Capsella rubella
ref|XP_010502174.1|  PREDICTED: probable receptor protein kinase ...    184   2e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010513910.1|  PREDICTED: probable receptor protein kinase ...    184   2e-50   Camelina sativa [gold-of-pleasure]
ref|XP_009351578.1|  PREDICTED: probable receptor protein kinase ...    184   3e-50   Pyrus x bretschneideri [bai li]
ref|XP_010511542.1|  PREDICTED: probable receptor protein kinase ...    184   3e-50   Camelina sativa [gold-of-pleasure]
ref|XP_003616214.1|  Kinase-like protein                                184   3e-50   Medicago truncatula
gb|KFK45034.1|  hypothetical protein AALP_AA1G335600                    183   4e-50   Arabis alpina [alpine rockcress]
ref|XP_010424954.1|  PREDICTED: probable receptor protein kinase ...    183   4e-50   Camelina sativa [gold-of-pleasure]
ref|XP_008467095.1|  PREDICTED: probable receptor protein kinase ...    183   4e-50   Cucumis melo [Oriental melon]
dbj|BAD95052.1|  putative receptor-like protein kinase                  174   4e-50   Arabidopsis thaliana [mouse-ear cress]
ref|NP_178291.1|  receptor-like kinase TMK3                             183   5e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002876780.1|  hypothetical protein ARALYDRAFT_484098             183   5e-50   
gb|KFK41035.1|  hypothetical protein AALP_AA2G077000                    183   5e-50   Arabis alpina [alpine rockcress]
emb|CDY17635.1|  BnaA06g34540D                                          182   5e-50   Brassica napus [oilseed rape]
ref|XP_008389147.1|  PREDICTED: probable receptor protein kinase ...    182   7e-50   
ref|XP_006303733.1|  hypothetical protein CARUB_v10011871mg             182   1e-49   
ref|NP_173869.1|  leucine-rich repeat protein kinase family protein     181   1e-49   Arabidopsis thaliana [mouse-ear cress]
gb|KDP38160.1|  hypothetical protein JCGZ_04803                         182   1e-49   Jatropha curcas
emb|CDY03107.1|  BnaC07g21200D                                          180   2e-49   
gb|AAG03120.1|AC004133_14  F5A9.23                                      181   2e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009757873.1|  PREDICTED: probable receptor protein kinase ...    181   2e-49   Nicotiana sylvestris
ref|XP_004298491.1|  PREDICTED: probable receptor protein kinase ...    181   2e-49   Fragaria vesca subsp. vesca
ref|XP_004297409.2|  PREDICTED: probable receptor protein kinase ...    181   2e-49   Fragaria vesca subsp. vesca
emb|CDY52761.1|  BnaC02g47770D                                          181   2e-49   Brassica napus [oilseed rape]
emb|CDY17648.1|  BnaA06g34670D                                          179   2e-49   Brassica napus [oilseed rape]
ref|XP_010462912.1|  PREDICTED: probable receptor protein kinase ...    181   3e-49   Camelina sativa [gold-of-pleasure]
gb|KDO60837.1|  hypothetical protein CISIN_1g002255mg                   179   3e-49   Citrus sinensis [apfelsine]
ref|XP_006448112.1|  hypothetical protein CICLE_v10014172mg             179   3e-49   Citrus clementina [clementine]
ref|XP_011070546.1|  PREDICTED: probable receptor protein kinase ...    179   3e-49   Sesamum indicum [beniseed]
emb|CDY09413.1|  BnaA02g25970D                                          181   4e-49   Brassica napus [oilseed rape]
ref|XP_009129193.1|  PREDICTED: probable receptor protein kinase ...    181   4e-49   Brassica rapa
ref|XP_009101661.1|  PREDICTED: probable receptor protein kinase ...    180   4e-49   
ref|XP_009115288.1|  PREDICTED: probable receptor protein kinase ...    180   4e-49   Brassica rapa
ref|XP_009101318.1|  PREDICTED: probable receptor protein kinase ...    180   6e-49   Brassica rapa
ref|XP_004142822.1|  PREDICTED: probable receptor protein kinase ...    180   6e-49   Cucumis sativus [cucumbers]
ref|XP_007045490.1|  Leucine-rich repeat protein kinase family pr...    180   6e-49   
gb|KJB50422.1|  hypothetical protein B456_008G170100                    180   7e-49   Gossypium raimondii
emb|CDY36253.1|  BnaC07g21070D                                          179   1e-48   Brassica napus [oilseed rape]
gb|KDO60836.1|  hypothetical protein CISIN_1g002255mg                   179   1e-48   Citrus sinensis [apfelsine]
ref|XP_006469286.1|  PREDICTED: probable receptor protein kinase ...    179   1e-48   Citrus sinensis [apfelsine]
ref|XP_006448111.1|  hypothetical protein CICLE_v10014172mg             179   1e-48   Citrus clementina [clementine]
gb|KJB79021.1|  hypothetical protein B456_013G030200                    179   1e-48   Gossypium raimondii
ref|XP_010501607.1|  PREDICTED: probable receptor protein kinase ...    178   2e-48   Camelina sativa [gold-of-pleasure]
ref|XP_010315276.1|  PREDICTED: probable receptor protein kinase ...    179   2e-48   Solanum lycopersicum
ref|XP_004230827.1|  PREDICTED: probable receptor protein kinase ...    179   2e-48   Solanum lycopersicum
gb|AAF66615.1|  LRR receptor-like protein kinase                        178   2e-48   Nicotiana tabacum [American tobacco]
ref|XP_009619244.1|  PREDICTED: probable receptor protein kinase ...    178   2e-48   Nicotiana tomentosiformis
ref|XP_006415826.1|  hypothetical protein EUTSA_v10009860mg             178   3e-48   
ref|XP_009404143.1|  PREDICTED: probable receptor protein kinase ...    178   3e-48   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY03867.1|  BnaC07g10920D                                          177   3e-48   
ref|XP_009380072.1|  PREDICTED: probable receptor protein kinase ...    178   4e-48   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY40785.1|  BnaAnng06480D                                          176   5e-48   Brassica napus [oilseed rape]
ref|XP_011070545.1|  PREDICTED: probable receptor protein kinase ...    177   6e-48   Sesamum indicum [beniseed]
ref|XP_002312477.1|  hypothetical protein POPTR_0008s13710g             177   8e-48   
ref|XP_006346490.1|  PREDICTED: probable receptor protein kinase ...    177   1e-47   Solanum tuberosum [potatoes]
gb|KHN24152.1|  Putative receptor protein kinase TMK1                   176   1e-47   Glycine soja [wild soybean]
gb|KFK44514.1|  hypothetical protein AALP_AA1G266600                    174   2e-47   Arabis alpina [alpine rockcress]
gb|EPS64046.1|  hypothetical protein M569_10735                         176   3e-47   Genlisea aurea
ref|XP_010668632.1|  PREDICTED: probable receptor protein kinase ...    174   9e-47   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010936890.1|  PREDICTED: probable receptor protein kinase ...    174   1e-46   Elaeis guineensis
ref|XP_009138625.1|  PREDICTED: probable receptor protein kinase ...    168   1e-46   Brassica rapa
ref|XP_004503323.1|  PREDICTED: probable receptor protein kinase ...    173   1e-46   Cicer arietinum [garbanzo]
ref|XP_009103048.1|  PREDICTED: probable receptor protein kinase ...    173   1e-46   Brassica rapa
ref|XP_003529231.1|  PREDICTED: probable receptor protein kinase ...    173   1e-46   Glycine max [soybeans]
gb|EYU30155.1|  hypothetical protein MIMGU_mgv1a001033mg                173   1e-46   Erythranthe guttata [common monkey flower]
ref|XP_009414792.1|  PREDICTED: probable receptor protein kinase ...    173   2e-46   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHM99461.1|  Putative receptor protein kinase TMK1                   173   2e-46   Glycine soja [wild soybean]
ref|XP_007034191.1|  Leucine-rich repeat protein kinase family pr...    171   3e-46   
ref|XP_010939998.1|  PREDICTED: probable receptor protein kinase ...    172   3e-46   Elaeis guineensis
ref|XP_007153205.1|  hypothetical protein PHAVU_003G015800g             172   3e-46   Phaseolus vulgaris [French bean]
emb|CDP05529.1|  unnamed protein product                                173   3e-46   Coffea canephora [robusta coffee]
gb|ABV30768.1|  kinase-like protein                                     160   4e-46   Prunus cerasus var. caproniana
ref|XP_009408496.1|  PREDICTED: probable receptor protein kinase ...    172   5e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009794480.1|  PREDICTED: probable receptor protein kinase ...    169   7e-46   Nicotiana sylvestris
ref|XP_009630216.1|  PREDICTED: probable receptor protein kinase ...    169   7e-46   
ref|XP_008358283.1|  PREDICTED: probable receptor protein kinase ...    171   8e-46   
ref|XP_008795408.1|  PREDICTED: probable receptor protein kinase ...    171   9e-46   Phoenix dactylifera
ref|XP_008381802.1|  PREDICTED: probable receptor protein kinase ...    171   1e-45   
ref|XP_010097979.1|  putative receptor protein kinase TMK1              170   2e-45   Morus notabilis
gb|ABV30679.1|  kinase-like protein                                     158   2e-45   Prunus avium [gean]
ref|XP_004247890.2|  PREDICTED: probable receptor protein kinase ...    170   2e-45   Solanum lycopersicum
ref|XP_008458146.1|  PREDICTED: probable receptor protein kinase ...    170   3e-45   Cucumis melo [Oriental melon]
ref|XP_009794479.1|  PREDICTED: probable receptor protein kinase ...    169   3e-45   Nicotiana sylvestris
ref|XP_006448115.1|  hypothetical protein CICLE_v10017453mg             167   4e-45   
ref|XP_002520629.1|  Protein kinase APK1A, chloroplast precursor,...    163   4e-45   Ricinus communis
ref|XP_003631009.1|  Kinase-like protein                                169   5e-45   
gb|KJB71981.1|  hypothetical protein B456_011G151900                    169   5e-45   Gossypium raimondii
gb|KHN16510.1|  Putative receptor protein kinase TMK1                   169   5e-45   Glycine soja [wild soybean]
ref|XP_003532526.1|  PREDICTED: probable receptor protein kinase ...    169   5e-45   Glycine max [soybeans]
ref|XP_007034190.1|  Leucine-rich repeat protein kinase family pr...    169   5e-45   
ref|XP_004498720.1|  PREDICTED: probable receptor protein kinase ...    169   6e-45   Cicer arietinum [garbanzo]
gb|KEH40666.1|  receptor kinase TMK1-like protein                       169   6e-45   Medicago truncatula
ref|XP_008798481.1|  PREDICTED: probable receptor protein kinase ...    169   6e-45   Phoenix dactylifera
gb|KJB71982.1|  hypothetical protein B456_011G151900                    169   7e-45   Gossypium raimondii
ref|XP_010906324.1|  PREDICTED: probable receptor protein kinase ...    168   7e-45   
dbj|BAF01330.1|  putative receptor-like kinase                          160   9e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009343822.1|  PREDICTED: probable receptor protein kinase ...    167   2e-44   Pyrus x bretschneideri [bai li]
ref|XP_010023612.1|  PREDICTED: probable receptor protein kinase ...    167   2e-44   Eucalyptus grandis [rose gum]
gb|KDP32592.1|  hypothetical protein JCGZ_13142                         167   2e-44   Jatropha curcas
ref|XP_006360918.1|  PREDICTED: probable receptor protein kinase ...    167   2e-44   Solanum tuberosum [potatoes]
ref|XP_008222737.1|  PREDICTED: probable receptor protein kinase ...    167   2e-44   Prunus mume [ume]
gb|KHN24033.1|  Putative receptor protein kinase TMK1                   166   2e-44   Glycine soja [wild soybean]
ref|XP_007221303.1|  hypothetical protein PRUPE_ppa001041mg             167   2e-44   Prunus persica
ref|XP_004162388.1|  PREDICTED: LOW QUALITY PROTEIN: probable rec...    167   2e-44   
ref|XP_004140603.1|  PREDICTED: probable receptor protein kinase ...    167   2e-44   Cucumis sativus [cucumbers]
gb|KHN44469.1|  Putative receptor protein kinase TMK1                   166   3e-44   Glycine soja [wild soybean]
ref|XP_007160467.1|  hypothetical protein PHAVU_002G324600g             167   3e-44   Phaseolus vulgaris [French bean]
ref|XP_009373574.1|  PREDICTED: probable receptor protein kinase ...    167   3e-44   Pyrus x bretschneideri [bai li]
ref|XP_008380457.1|  PREDICTED: probable receptor protein kinase ...    167   3e-44   
gb|EPS72320.1|  hypothetical protein M569_02431                         166   4e-44   Genlisea aurea
ref|XP_008787910.1|  PREDICTED: probable receptor protein kinase ...    167   4e-44   Phoenix dactylifera
ref|XP_003537524.1|  PREDICTED: probable receptor protein kinase ...    166   4e-44   Glycine max [soybeans]
ref|XP_006601886.1|  PREDICTED: probable receptor protein kinase ...    166   4e-44   Glycine max [soybeans]
ref|XP_004502257.1|  PREDICTED: probable receptor protein kinase ...    166   4e-44   Cicer arietinum [garbanzo]
emb|CBI39413.3|  unnamed protein product                                166   5e-44   Vitis vinifera
gb|KHG03733.1|  putative receptor protein kinase TMK1                   166   5e-44   Gossypium arboreum [tree cotton]
ref|XP_003601704.1|  Receptor-like kinase                               166   5e-44   Medicago truncatula
emb|CAN69461.1|  hypothetical protein VITISV_043132                     166   5e-44   Vitis vinifera
ref|XP_011101591.1|  PREDICTED: probable receptor protein kinase ...    166   5e-44   Sesamum indicum [beniseed]
ref|XP_010650399.1|  PREDICTED: probable receptor protein kinase ...    166   5e-44   Vitis vinifera
ref|XP_006830550.1|  hypothetical protein AMTR_s00117p00096300          166   6e-44   
gb|KDO47459.1|  hypothetical protein CISIN_1g0023461mg                  165   6e-44   Citrus sinensis [apfelsine]
gb|KHN12355.1|  Putative receptor protein kinase TMK1                   164   6e-44   Glycine soja [wild soybean]
ref|XP_007163803.1|  hypothetical protein PHAVU_001G265500g             166   6e-44   Phaseolus vulgaris [French bean]
ref|XP_010532727.1|  PREDICTED: probable receptor protein kinase ...    166   7e-44   Tarenaya hassleriana [spider flower]
ref|NP_001236710.1|  receptor-like kinase RHG4                          166   8e-44   
ref|XP_011017684.1|  PREDICTED: probable receptor protein kinase ...    166   8e-44   Populus euphratica
ref|XP_002324686.2|  hypothetical protein POPTR_0018s13780g             166   8e-44   
gb|ACN59321.1|  leucine-rich repeat receptor-like protein kinase        166   8e-44   Arabidopsis thaliana [mouse-ear cress]
ref|NP_189017.1|  leucine-rich repeat protein kinase-like protein       166   8e-44   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001236021.1|  Rhg4-like receptor kinase II precursor             166   9e-44   
gb|KEH40668.1|  receptor kinase TMK1-like protein, putative             165   1e-43   Medicago truncatula
gb|ACN87597.1|  kinase-like protein                                     153   1e-43   Corylus avellana [European hazelnut]
gb|EYU40639.1|  hypothetical protein MIMGU_mgv1a027041mg                165   1e-43   Erythranthe guttata [common monkey flower]
dbj|BAH56604.1|  receptor-like kinase                                   165   1e-43   Glycine max [soybeans]
dbj|BAH56605.1|  receptor-like kinase                                   165   1e-43   Glycine max [soybeans]
ref|XP_008789301.1|  PREDICTED: probable receptor protein kinase ...    165   1e-43   Phoenix dactylifera
gb|ACM89489.1|  receptor-like kinase                                    164   1e-43   Glycine max [soybeans]
dbj|BAH56606.1|  receptor-like kinase                                   165   1e-43   Glycine max [soybeans]
gb|ACN87601.1|  kinase-like protein                                     153   1e-43   Corylus avellana [European hazelnut]
ref|XP_006296927.1|  hypothetical protein CARUB_v10012920mg             165   1e-43   Capsella rubella
gb|ADO12863.1|  leucine-rich repeat receptor-like kinase                165   1e-43   Glycine max [soybeans]
gb|ABD96565.1|  Rhg4-like receptor kinase I                             165   1e-43   Glycine max [soybeans]
gb|ABD96567.1|  Rhg4-like receptor kinase I                             165   2e-43   Glycine max [soybeans]
ref|XP_006492525.1|  PREDICTED: probable receptor protein kinase ...    165   2e-43   Citrus sinensis [apfelsine]
ref|XP_006421039.1|  hypothetical protein CICLE_v10004263mg             165   2e-43   Citrus clementina [clementine]
ref|XP_006418841.1|  hypothetical protein EUTSA_v10002394mg             165   2e-43   Eutrema salsugineum [saltwater cress]
ref|XP_002883458.1|  leucine-rich repeat family protein                 164   2e-43   Arabidopsis lyrata subsp. lyrata
ref|XP_010512862.1|  PREDICTED: probable receptor protein kinase ...    164   2e-43   Camelina sativa [gold-of-pleasure]
gb|KHG15618.1|  putative receptor protein kinase TMK1                   164   2e-43   Gossypium arboreum [tree cotton]
ref|XP_010488452.1|  PREDICTED: probable receptor protein kinase ...    164   2e-43   Camelina sativa [gold-of-pleasure]
ref|XP_008809243.1|  PREDICTED: probable receptor protein kinase ...    164   2e-43   Phoenix dactylifera
dbj|BAJ91186.1|  predicted protein                                      162   3e-43   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDP03933.1|  unnamed protein product                                164   3e-43   Coffea canephora [robusta coffee]
ref|XP_010466732.1|  PREDICTED: probable receptor protein kinase ...    164   3e-43   Camelina sativa [gold-of-pleasure]
gb|EMS59747.1|  putative receptor protein kinase TMK1                   162   3e-43   Triticum urartu
ref|XP_010246532.1|  PREDICTED: probable receptor protein kinase ...    164   3e-43   Nelumbo nucifera [Indian lotus]
gb|EEC76074.1|  hypothetical protein OsI_13294                          163   3e-43   Oryza sativa Indica Group [Indian rice]
gb|KJB28085.1|  hypothetical protein B456_005G026700                    164   3e-43   Gossypium raimondii
ref|XP_007162969.1|  hypothetical protein PHAVU_001G195500g             164   4e-43   Phaseolus vulgaris [French bean]
ref|XP_010932521.1|  PREDICTED: LOW QUALITY PROTEIN: probable rec...    164   4e-43   
ref|XP_002308106.1|  hypothetical protein POPTR_0006s07360g             164   4e-43   
ref|NP_001051079.2|  Os03g0717000                                       163   4e-43   
ref|XP_004981977.1|  PREDICTED: probable receptor protein kinase ...    164   4e-43   Setaria italica
ref|XP_008644567.1|  PREDICTED: probable receptor protein kinase ...    164   5e-43   
gb|ABD96566.1|  Rhg4-like receptor kinase II                            163   5e-43   Glycine max [soybeans]
ref|XP_002463990.1|  hypothetical protein SORBIDRAFT_01g010110          164   5e-43   Sorghum bicolor [broomcorn]
ref|XP_009604417.1|  PREDICTED: probable receptor protein kinase ...    163   5e-43   Nicotiana tomentosiformis
ref|XP_004298216.1|  PREDICTED: probable receptor protein kinase ...    163   5e-43   Fragaria vesca subsp. vesca
ref|XP_010673522.1|  PREDICTED: probable receptor protein kinase ...    163   5e-43   Beta vulgaris subsp. vulgaris [field beet]
gb|KEH40667.1|  receptor-like kinase                                    163   5e-43   Medicago truncatula
emb|CDP15110.1|  unnamed protein product                                163   6e-43   Coffea canephora [robusta coffee]
ref|XP_008665300.1|  PREDICTED: probable receptor protein kinase ...    163   6e-43   Zea mays [maize]
gb|EAZ28375.1|  hypothetical protein OsJ_12355                          163   7e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010068984.1|  PREDICTED: probable receptor protein kinase ...    163   7e-43   Eucalyptus grandis [rose gum]
gb|ABF98558.1|  Protein kinase domain containing protein, expressed     163   9e-43   Oryza sativa Japonica Group [Japonica rice]
emb|CAA69028.1|  TMK                                                    163   9e-43   Oryza sativa Indica Group [Indian rice]
gb|EMT14311.1|  Putative receptor protein kinase TMK1                   162   1e-42   
ref|XP_006651752.1|  PREDICTED: probable receptor protein kinase ...    162   1e-42   
ref|XP_003572876.1|  PREDICTED: probable receptor protein kinase ...    162   1e-42   Brachypodium distachyon [annual false brome]
ref|XP_011020360.1|  PREDICTED: probable receptor protein kinase ...    162   2e-42   Populus euphratica
dbj|BAF79934.1|  receptor-like kinase                                   162   2e-42   Marchantia polymorpha
ref|XP_009777291.1|  PREDICTED: probable receptor protein kinase ...    162   2e-42   Nicotiana sylvestris
emb|CDY18093.1|  BnaA01g23540D                                          160   2e-42   Brassica napus [oilseed rape]
ref|XP_009106355.1|  PREDICTED: probable receptor protein kinase ...    161   2e-42   Brassica rapa
emb|CDY50111.1|  BnaC01g43590D                                          157   2e-42   Brassica napus [oilseed rape]
ref|XP_010907801.1|  PREDICTED: probable receptor protein kinase ...    161   2e-42   
ref|XP_010907800.1|  PREDICTED: probable receptor protein kinase ...    161   3e-42   Elaeis guineensis
ref|XP_004252979.1|  PREDICTED: probable receptor protein kinase ...    161   3e-42   Solanum lycopersicum
gb|KFK39671.1|  hypothetical protein AALP_AA3G274200                    161   3e-42   Arabis alpina [alpine rockcress]
emb|CDY63752.1|  BnaAnng19060D                                          161   3e-42   Brassica napus [oilseed rape]
ref|XP_009102585.1|  PREDICTED: probable receptor protein kinase ...    161   4e-42   Brassica rapa
ref|XP_006349904.1|  PREDICTED: probable receptor protein kinase ...    160   5e-42   Solanum tuberosum [potatoes]
gb|KJB16548.1|  hypothetical protein B456_002G235300                    160   5e-42   Gossypium raimondii
gb|KHF97860.1|  putative receptor protein kinase TMK1                   160   6e-42   Gossypium arboreum [tree cotton]
ref|XP_010910643.1|  PREDICTED: LOW QUALITY PROTEIN: probable rec...    160   7e-42   
ref|XP_002975116.1|  hypothetical protein SELMODRAFT_102446             160   7e-42   
ref|XP_002989008.1|  hypothetical protein SELMODRAFT_129007             160   7e-42   
ref|XP_007221309.1|  hypothetical protein PRUPE_ppa020129mg             160   7e-42   
gb|KJB36268.1|  hypothetical protein B456_006G149500                    159   8e-42   Gossypium raimondii
gb|EYU18122.1|  hypothetical protein MIMGU_mgv1a000918mg                160   1e-41   Erythranthe guttata [common monkey flower]
gb|KCW59913.1|  hypothetical protein EUGRSUZ_H02636                     159   1e-41   Eucalyptus grandis [rose gum]
ref|XP_010247019.1|  PREDICTED: probable receptor protein kinase ...    160   1e-41   Nelumbo nucifera [Indian lotus]
ref|XP_009764038.1|  PREDICTED: probable receptor protein kinase ...    159   1e-41   
ref|XP_009393396.1|  PREDICTED: probable receptor protein kinase ...    159   1e-41   
ref|XP_010026683.1|  PREDICTED: LOW QUALITY PROTEIN: probable rec...    159   2e-41   
gb|EYU31524.1|  hypothetical protein MIMGU_mgv1a001083mg                159   2e-41   
gb|AAT96698.1|  putative LRR-like protein kinase 4                      149   2e-41   
ref|XP_011090307.1|  PREDICTED: probable receptor protein kinase ...    159   2e-41   
ref|XP_008222748.1|  PREDICTED: probable receptor protein kinase ...    158   3e-41   
ref|NP_001238095.1|  protein kinase precursor                           159   3e-41   
ref|XP_011094233.1|  PREDICTED: probable receptor protein kinase ...    158   3e-41   
ref|XP_011032474.1|  PREDICTED: probable receptor protein kinase ...    158   3e-41   
ref|XP_006366998.1|  PREDICTED: probable receptor protein kinase ...    158   4e-41   
gb|EPS70217.1|  hypothetical protein M569_04541                         158   4e-41   
ref|XP_004504378.1|  PREDICTED: probable receptor protein kinase ...    158   4e-41   
ref|XP_004247046.1|  PREDICTED: probable receptor protein kinase ...    158   4e-41   
ref|XP_006348472.1|  PREDICTED: probable receptor protein kinase ...    158   5e-41   
ref|XP_002322788.2|  hypothetical protein POPTR_0016s07120g             158   5e-41   
ref|XP_006576140.1|  PREDICTED: protein kinase isoform X1               158   5e-41   
emb|CDY61573.1|  BnaCnng38030D                                          157   5e-41   
gb|ACM89521.1|  receptor-like protein kinase-like protein               157   6e-41   
ref|XP_010247002.1|  PREDICTED: probable receptor protein kinase ...    157   6e-41   
ref|XP_009612396.1|  PREDICTED: probable receptor protein kinase ...    157   6e-41   
ref|XP_008795571.1|  PREDICTED: probable receptor protein kinase ...    157   6e-41   
ref|XP_006296979.1|  hypothetical protein CARUB_v10012974mg             157   6e-41   
ref|XP_006382755.1|  hypothetical protein POPTR_0005s05100g             157   6e-41   
ref|XP_007027971.1|  Leucine-rich repeat protein kinase family pr...    156   6e-41   
ref|XP_004228606.1|  PREDICTED: probable receptor protein kinase ...    157   7e-41   
gb|KEH24239.1|  receptor-kinase-like protein                            157   7e-41   
emb|CBI39471.3|  unnamed protein product                                157   7e-41   
ref|XP_002976801.1|  hypothetical protein SELMODRAFT_268021             157   7e-41   
ref|XP_002313480.2|  hypothetical protein POPTR_0009s02550g             157   7e-41   
ref|XP_002268601.2|  PREDICTED: probable receptor protein kinase ...    157   8e-41   
ref|XP_002980529.1|  hypothetical protein SELMODRAFT_233539             157   8e-41   
gb|KJB37881.1|  hypothetical protein B456_006G224800                    157   9e-41   
ref|XP_010246967.1|  PREDICTED: probable receptor protein kinase ...    157   9e-41   
ref|XP_008442915.1|  PREDICTED: probable receptor protein kinase ...    157   9e-41   
ref|XP_010109186.1|  putative receptor protein kinase TMK1              157   9e-41   
ref|XP_004136513.1|  PREDICTED: probable receptor protein kinase ...    157   9e-41   
ref|XP_006448114.1|  hypothetical protein CICLE_v10018060mg             148   9e-41   
emb|CDP10601.1|  unnamed protein product                                157   1e-40   
ref|XP_010262996.1|  PREDICTED: probable receptor protein kinase ...    157   1e-40   
ref|XP_011089643.1|  PREDICTED: probable receptor protein kinase ...    157   1e-40   
emb|CBI30387.3|  unnamed protein product                                155   1e-40   
gb|KJB36267.1|  hypothetical protein B456_006G149500                    156   1e-40   
ref|XP_010543834.1|  PREDICTED: probable receptor protein kinase ...    157   1e-40   
ref|XP_006282822.1|  hypothetical protein CARUB_v10006622mg             154   1e-40   
gb|KJB36266.1|  hypothetical protein B456_006G149500                    156   1e-40   
ref|XP_011042042.1|  PREDICTED: probable receptor protein kinase ...    157   1e-40   
ref|XP_002976216.1|  hypothetical protein SELMODRAFT_175461             156   2e-40   
ref|XP_002274910.2|  PREDICTED: probable receptor protein kinase ...    156   2e-40   
gb|KEH29775.1|  receptor kinase TMK1-like protein                       156   2e-40   
ref|XP_003629623.1|  Receptor-like kinase                               156   2e-40   
gb|KDP26449.1|  hypothetical protein JCGZ_17607                         155   2e-40   
ref|XP_009789399.1|  PREDICTED: probable receptor protein kinase ...    155   3e-40   
ref|XP_011042599.1|  PREDICTED: probable receptor protein kinase ...    156   3e-40   
ref|XP_009610544.1|  PREDICTED: probable receptor protein kinase ...    155   3e-40   
ref|XP_011046412.1|  PREDICTED: probable receptor protein kinase ...    155   3e-40   
ref|XP_010557995.1|  PREDICTED: probable receptor protein kinase ...    154   3e-40   
ref|XP_002987123.1|  hypothetical protein SELMODRAFT_269219             155   3e-40   
ref|XP_002309250.1|  hypothetical protein POPTR_0006s22000g             155   3e-40   
gb|EPS70426.1|  hypothetical protein M569_04331                         157   3e-40   
gb|KDP36118.1|  hypothetical protein JCGZ_08762                         155   3e-40   
ref|XP_007027970.1|  Leucine-rich repeat protein kinase family pr...    155   3e-40   
ref|XP_006588868.1|  PREDICTED: probable receptor protein kinase ...    155   3e-40   
ref|XP_007145792.1|  hypothetical protein PHAVU_007G268200g             155   3e-40   
gb|KHN02583.1|  Putative receptor protein kinase TMK1                   155   3e-40   
ref|XP_010059098.1|  PREDICTED: probable receptor protein kinase ...    155   3e-40   
ref|XP_004293117.1|  PREDICTED: probable receptor protein kinase ...    155   3e-40   
ref|XP_003518187.1|  PREDICTED: probable receptor protein kinase ...    155   3e-40   
gb|KCW59851.1|  hypothetical protein EUGRSUZ_H02591                     155   4e-40   
gb|KCW59923.1|  hypothetical protein EUGRSUZ_H02647                     155   5e-40   
ref|XP_010451120.1|  PREDICTED: probable receptor protein kinase ...    152   5e-40   
gb|KHN48414.1|  Putative receptor protein kinase TMK1                   155   5e-40   
ref|XP_009408287.1|  PREDICTED: probable receptor protein kinase ...    154   7e-40   
ref|XP_004249405.1|  PREDICTED: probable receptor protein kinase ...    154   7e-40   
ref|XP_006339166.1|  PREDICTED: probable receptor protein kinase ...    154   7e-40   
ref|XP_011077805.1|  PREDICTED: probable receptor protein kinase ...    154   7e-40   
ref|XP_010557993.1|  PREDICTED: probable receptor protein kinase ...    154   7e-40   
ref|XP_002532551.1|  Serine/threonine-protein kinase PBS1, putative     154   9e-40   
gb|KDO70607.1|  hypothetical protein CISIN_1g002150mg                   154   9e-40   
ref|XP_006481595.1|  PREDICTED: probable receptor protein kinase ...    154   1e-39   
ref|XP_006430067.1|  hypothetical protein CICLE_v10010999mg             154   1e-39   
ref|XP_009408286.1|  PREDICTED: probable receptor protein kinase ...    154   1e-39   
ref|XP_006361096.1|  PREDICTED: probable receptor protein kinase ...    154   1e-39   
ref|XP_010092554.1|  putative receptor protein kinase TMK1              154   1e-39   
ref|XP_006481539.1|  PREDICTED: probable receptor protein kinase ...    154   1e-39   
ref|XP_009412894.1|  PREDICTED: probable receptor protein kinase ...    153   2e-39   
ref|XP_010023622.1|  PREDICTED: probable receptor protein kinase ...    154   2e-39   
ref|XP_001778810.1|  predicted protein                                  153   2e-39   
ref|XP_010023621.1|  PREDICTED: probable receptor protein kinase ...    154   2e-39   
ref|XP_010676236.1|  PREDICTED: probable receptor protein kinase ...    153   2e-39   
ref|XP_004487454.1|  PREDICTED: probable receptor protein kinase ...    153   2e-39   
ref|XP_004487455.1|  PREDICTED: probable receptor protein kinase ...    152   2e-39   
gb|KDO58246.1|  hypothetical protein CISIN_1g041143mg                   153   2e-39   
gb|KHG06891.1|  putative receptor protein kinase TMK1                   153   3e-39   
ref|XP_006424117.1|  hypothetical protein CICLE_v10027751mg             153   3e-39   
ref|XP_002867400.1|  predicted protein                                  150   3e-39   
ref|XP_004506220.1|  PREDICTED: probable receptor protein kinase ...    152   4e-39   
gb|EYU36035.1|  hypothetical protein MIMGU_mgv1a000849mg                152   4e-39   
ref|XP_002989354.1|  hypothetical protein SELMODRAFT_129592             152   4e-39   
ref|XP_009629429.1|  PREDICTED: probable receptor protein kinase ...    152   5e-39   
ref|XP_008241052.1|  PREDICTED: probable receptor protein kinase ...    152   5e-39   
ref|XP_010450970.1|  PREDICTED: probable receptor protein kinase ...    152   5e-39   
ref|XP_002980850.1|  hypothetical protein SELMODRAFT_233622             152   5e-39   
ref|XP_008360596.1|  PREDICTED: probable receptor protein kinase ...    152   6e-39   
ref|XP_009420192.1|  PREDICTED: probable receptor protein kinase ...    152   6e-39   
ref|XP_007015693.1|  Leucine-rich repeat protein kinase family pr...    152   6e-39   
ref|XP_006416214.1|  hypothetical protein EUTSA_v10009550mg             149   6e-39   
ref|XP_011005684.1|  PREDICTED: probable receptor protein kinase ...    152   6e-39   
ref|XP_006389323.1|  hypothetical protein POPTR_0030s00450g             152   6e-39   
ref|XP_009349030.1|  PREDICTED: probable receptor protein kinase ...    152   6e-39   
ref|XP_004494248.1|  PREDICTED: probable receptor protein kinase ...    152   6e-39   
ref|XP_011003774.1|  PREDICTED: probable receptor protein kinase ...    152   6e-39   
gb|EYU32717.1|  hypothetical protein MIMGU_mgv1a001138mg                151   8e-39   
ref|XP_010474033.1|  PREDICTED: probable receptor protein kinase ...    141   8e-39   
ref|XP_007203232.1|  hypothetical protein PRUPE_ppa000956mg             151   1e-38   
ref|XP_002299778.2|  hypothetical protein POPTR_0001s22540g             151   1e-38   
ref|XP_004303383.1|  PREDICTED: probable receptor protein kinase ...    151   1e-38   
ref|XP_011010010.1|  PREDICTED: probable receptor protein kinase ...    151   2e-38   
ref|XP_009374103.1|  PREDICTED: probable receptor protein kinase ...    150   2e-38   
ref|XP_010685432.1|  PREDICTED: probable receptor protein kinase ...    150   2e-38   
ref|XP_009767611.1|  PREDICTED: probable receptor protein kinase ...    150   2e-38   
ref|XP_006653057.1|  PREDICTED: probable receptor protein kinase ...    150   2e-38   
ref|XP_010031559.1|  PREDICTED: probable receptor protein kinase ...    150   2e-38   
ref|NP_001054323.1|  Os04g0685900                                       150   2e-38   
emb|CAH68356.1|  H0723C07.6                                             150   2e-38   
gb|AAO72615.1|  receptor-like protein kinase-like protein               150   2e-38   
ref|XP_009419412.1|  PREDICTED: probable receptor protein kinase ...    150   2e-38   
ref|XP_008380290.1|  PREDICTED: probable receptor protein kinase ...    150   2e-38   
ref|XP_004241337.1|  PREDICTED: probable receptor protein kinase ...    150   3e-38   
ref|XP_001783311.1|  predicted protein                                  150   3e-38   
ref|XP_007150032.1|  hypothetical protein PHAVU_005G120300g             150   3e-38   
ref|XP_009625585.1|  PREDICTED: probable receptor protein kinase ...    149   5e-38   
gb|EMT20821.1|  Putative receptor protein kinase TMK1                   149   5e-38   
gb|KHG14431.1|  putative receptor protein kinase TMK1                   149   5e-38   
ref|XP_009767007.1|  PREDICTED: probable receptor protein kinase ...    149   5e-38   
gb|KJB09134.1|  hypothetical protein B456_001G125200                    149   6e-38   
ref|XP_003596879.1|  Receptor-like protein kinase                       149   7e-38   
ref|XP_010685103.1|  PREDICTED: probable receptor protein kinase ...    149   7e-38   
gb|EPS70502.1|  hypothetical protein M569_04241                         148   1e-37   
emb|CDP06852.1|  unnamed protein product                                148   1e-37   
gb|KHG03667.1|  putative receptor protein kinase TMK1                   148   1e-37   
ref|XP_009383147.1|  PREDICTED: probable receptor protein kinase ...    148   2e-37   
gb|KJB35444.1|  hypothetical protein B456_006G115200                    148   2e-37   
gb|KDP23101.1|  hypothetical protein JCGZ_00527                         148   2e-37   
ref|XP_007207216.1|  hypothetical protein PRUPE_ppa001888mg             147   2e-37   
ref|XP_003579497.1|  PREDICTED: probable receptor protein kinase ...    147   2e-37   
emb|CDY59885.1|  BnaC02g47590D                                          140   3e-37   
ref|XP_006591063.1|  PREDICTED: probable receptor protein kinase ...    147   3e-37   
gb|KHN19921.1|  Putative receptor protein kinase TMK1                   147   3e-37   
gb|KJB35445.1|  hypothetical protein B456_006G115200                    147   3e-37   
ref|XP_008230180.1|  PREDICTED: probable receptor protein kinase ...    147   3e-37   
ref|XP_008230174.1|  PREDICTED: probable receptor protein kinase ...    147   4e-37   
ref|XP_008230166.1|  PREDICTED: probable receptor protein kinase ...    147   4e-37   
gb|KHN17972.1|  Putative receptor protein kinase TMK1                   146   5e-37   
ref|XP_006592774.1|  PREDICTED: probable receptor protein kinase ...    146   5e-37   
ref|XP_009369824.1|  PREDICTED: probable receptor protein kinase ...    145   1e-36   
ref|XP_009369830.1|  PREDICTED: probable receptor protein kinase ...    145   1e-36   
ref|XP_002489035.1|  hypothetical protein SORBIDRAFT_0343s002010        145   1e-36   
ref|NP_001131017.1|  uncharacterized LOC100192365 precursor             145   1e-36   
ref|XP_010917500.1|  PREDICTED: probable receptor protein kinase ...    145   2e-36   
gb|ACL52740.1|  unknown                                                 142   2e-36   
gb|ACL54632.1|  unknown                                                 142   3e-36   
ref|XP_009416592.1|  PREDICTED: probable receptor protein kinase ...    144   3e-36   
gb|KHN21189.1|  Putative receptor protein kinase TMK1-like protein      144   4e-36   
ref|XP_006592356.1|  PREDICTED: probable receptor protein kinase ...    144   4e-36   
ref|XP_010474163.1|  PREDICTED: probable receptor protein kinase ...    142   4e-36   
ref|XP_009406339.1|  PREDICTED: probable receptor protein kinase ...    143   5e-36   
emb|CBI24423.3|  unnamed protein product                                143   5e-36   
gb|EYU20650.1|  hypothetical protein MIMGU_mgv1a022135mg                143   6e-36   
gb|EYU28516.1|  hypothetical protein MIMGU_mgv1a019662mg                143   6e-36   
gb|ACL54527.1|  unknown                                                 142   6e-36   
ref|XP_010651647.1|  PREDICTED: probable receptor protein kinase ...    143   7e-36   
ref|XP_010485099.1|  PREDICTED: probable receptor protein kinase ...    140   7e-36   
ref|XP_010421697.1|  PREDICTED: probable LRR receptor-like serine...    140   1e-35   
ref|XP_010446082.1|  PREDICTED: probable receptor protein kinase ...    139   1e-35   
ref|XP_009416591.1|  PREDICTED: probable receptor protein kinase ...    142   2e-35   
ref|XP_009138235.1|  PREDICTED: probable receptor protein kinase ...    140   3e-35   
gb|EAZ29677.1|  hypothetical protein OsJ_13738                          141   3e-35   
ref|XP_006826595.1|  hypothetical protein AMTR_s00138p00056480          140   4e-35   
ref|XP_003576062.1|  PREDICTED: probable receptor protein kinase ...    141   4e-35   
ref|XP_008803916.1|  PREDICTED: uncharacterized protein LOC103717354    142   5e-35   
ref|XP_009138577.1|  PREDICTED: probable receptor protein kinase ...    139   6e-35   
gb|EAY92972.1|  hypothetical protein OsI_14767                          140   6e-35   
ref|NP_001067829.1|  Os11g0448000                                       140   6e-35   
ref|XP_004979222.1|  PREDICTED: probable receptor protein kinase ...    140   7e-35   
ref|XP_010424588.1|  PREDICTED: probable receptor protein kinase ...    134   7e-35   
ref|XP_008670729.1|  PREDICTED: probable receptor protein kinase ...    140   1e-34   
ref|XP_008812470.1|  PREDICTED: probable receptor protein kinase ...    140   1e-34   
ref|XP_002450707.1|  hypothetical protein SORBIDRAFT_05g012530          140   1e-34   
ref|XP_008678122.1|  PREDICTED: probable receptor protein kinase ...    140   1e-34   
gb|EPS68163.1|  hypothetical protein M569_06603                         140   1e-34   
gb|EMT17636.1|  Putative receptor protein kinase TMK1                   139   2e-34   
gb|AID55112.1|  leucine-rich repeat receptor-like protein kinase        139   2e-34   
ref|XP_010908591.1|  PREDICTED: probable receptor protein kinase ...    139   2e-34   
ref|XP_006663422.1|  PREDICTED: probable receptor protein kinase ...    139   2e-34   
gb|EMS63078.1|  putative receptor protein kinase TMK1                   138   3e-34   
ref|XP_008775313.1|  PREDICTED: probable receptor protein kinase ...    137   5e-34   
ref|XP_006854639.1|  hypothetical protein AMTR_s00030p00189200          138   6e-34   
emb|CAN79640.1|  hypothetical protein VITISV_017953                     137   1e-33   
emb|CDX91671.1|  BnaC08g05900D                                          129   6e-32   
emb|CDY42352.1|  BnaA09g15870D                                          125   4e-31   
emb|CDX72439.1|  BnaC07g44610D                                          124   5e-31   
ref|XP_010490083.1|  PREDICTED: probable receptor protein kinase ...    122   1e-29   
ref|XP_002530240.1|  protein binding protein, putative                  122   4e-29   
gb|AES99335.2|  tyrosine kinase family protein                          120   6e-29   
ref|XP_003616377.1|  Receptor-like protein kinase-like protein          119   1e-28   
emb|CDY20940.1|  BnaC06g01600D                                          116   4e-28   
ref|XP_010468419.1|  PREDICTED: probable receptor protein kinase ...    118   2e-27   
ref|XP_009113483.1|  PREDICTED: probable receptor protein kinase ...    113   6e-27   
ref|XP_010512392.1|  PREDICTED: probable receptor protein kinase ...    115   1e-26   
ref|XP_009357506.1|  PREDICTED: chitin elicitor receptor kinase 1...    114   2e-26   
ref|XP_011039703.1|  PREDICTED: lysM domain receptor-like kinase 3      115   3e-26   
ref|XP_008224757.1|  PREDICTED: chitin elicitor receptor kinase 1...    112   1e-25   
emb|CDH30706.1|  putative LysM domain containing receptor kinase        112   2e-25   
gb|ACO25600.1|  protein kinase-coding resistance protein                104   8e-25   
emb|CBI21029.3|  unnamed protein product                                106   2e-24   
ref|XP_010648816.1|  PREDICTED: lysM domain receptor-like kinase 3      109   2e-24   
gb|KFK30782.1|  nak-like ser thr protein kinase                         110   2e-24   
ref|XP_010422657.1|  PREDICTED: proline-rich receptor-like protei...    110   2e-24   
ref|XP_010429034.1|  PREDICTED: proline-rich receptor-like protei...    110   2e-24   
ref|XP_010456096.1|  PREDICTED: proline-rich receptor-like protei...    110   2e-24   



>gb|KDO41054.1| hypothetical protein CISIN_1g002238mg [Citrus sinensis]
Length=580

 Score =   196 bits (499),  Expect = 5e-56, Method: Composition-based stats.
 Identities = 89/93 (96%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            H+FNWAEEGLKPLEW +RLTIALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  483  HIFNWAEEGLKPLEWNRRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  542

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG
Sbjct  543  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  575



>ref|XP_006350960.1| PREDICTED: probable receptor protein kinase TMK1-like [Solanum 
tuberosum]
Length=938

 Score =   198 bits (504),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLFNWAEEGLKP+EWTKRLTIALDVARGVEYLH+LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  671  HLFNWAEEGLKPMEWTKRLTIALDVARGVEYLHSLAHQSFIHRDLKPSNILLGDDMRAKV  730

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA
Sbjct  731  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  762



>ref|XP_009594248.1| PREDICTED: probable receptor protein kinase TMK1 [Nicotiana tomentosiformis]
Length=943

 Score =   197 bits (502),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 90/92 (98%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLFNWAEEGLKPLEWT RLTIALDVARGVEYLH+LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  676  HLFNWAEEGLKPLEWTNRLTIALDVARGVEYLHSLAHQSFIHRDLKPSNILLGDDMRAKV  735

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA
Sbjct  736  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  767



>ref|XP_004249911.1| PREDICTED: probable receptor protein kinase TMK1 [Solanum lycopersicum]
Length=937

 Score =   197 bits (502),  Expect = 3e-55, Method: Composition-based stats.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+WAEEGLKPLEWTKRLTIALDVARGVEYLH+LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  670  HLFDWAEEGLKPLEWTKRLTIALDVARGVEYLHSLAHQSFIHRDLKPSNILLGDDMRAKV  729

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA
Sbjct  730  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  761



>ref|XP_011043912.1| PREDICTED: probable receptor protein kinase TMK1 [Populus euphratica]
Length=946

 Score =   196 bits (499),  Expect = 6e-55, Method: Composition-based stats.
 Identities = 89/92 (97%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLFNWAEEGLKP+EWT+RLTIALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  679  HLFNWAEEGLKPMEWTRRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  738

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA
Sbjct  739  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  770



>ref|XP_011038249.1| PREDICTED: probable receptor protein kinase TMK1 [Populus euphratica]
Length=945

 Score =   196 bits (499),  Expect = 7e-55, Method: Composition-based stats.
 Identities = 89/92 (97%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            H+FNWAEEGLKPLEWT+RLTIALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  679  HIFNWAEEGLKPLEWTRRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  738

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA
Sbjct  739  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  770



>ref|XP_006372526.1| receptor protein kinase TMK1 precursor [Populus trichocarpa]
 gb|ERP50323.1| receptor protein kinase TMK1 precursor [Populus trichocarpa]
Length=945

 Score =   196 bits (499),  Expect = 7e-55, Method: Composition-based stats.
 Identities = 89/92 (97%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            H+FNWAEEGLKPLEWT+RLTIALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  679  HIFNWAEEGLKPLEWTRRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  738

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA
Sbjct  739  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  770



>ref|XP_008463160.1| PREDICTED: probable receptor protein kinase TMK1 [Cucumis melo]
Length=950

 Score =   196 bits (499),  Expect = 8e-55, Method: Composition-based stats.
 Identities = 90/92 (98%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLFNW EEGLKPLEWTKRLTIALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  683  HLFNWPEEGLKPLEWTKRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  742

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA
Sbjct  743  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  774



>ref|XP_007032166.1| Transmembrane kinase 1 isoform 2 [Theobroma cacao]
 gb|EOY03092.1| Transmembrane kinase 1 isoform 2 [Theobroma cacao]
Length=711

 Score =   195 bits (495),  Expect = 8e-55, Method: Composition-based stats.
 Identities = 89/92 (97%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            H+FNWAEEGLKPLEWTKRL IALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  444  HIFNWAEEGLKPLEWTKRLIIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  503

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA
Sbjct  504  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  535



>ref|XP_004140293.1| PREDICTED: probable receptor protein kinase TMK1-like [Cucumis 
sativus]
 ref|XP_004155738.1| PREDICTED: probable receptor protein kinase TMK1-like [Cucumis 
sativus]
 gb|KGN51072.1| hypothetical protein Csa_5G429450 [Cucumis sativus]
Length=953

 Score =   196 bits (498),  Expect = 1e-54, Method: Composition-based stats.
 Identities = 90/92 (98%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLFNW EEGLKPLEWTKRLTIALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  686  HLFNWPEEGLKPLEWTKRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  745

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA
Sbjct  746  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  777



>gb|KDO41053.1| hypothetical protein CISIN_1g002238mg [Citrus sinensis]
Length=787

 Score =   194 bits (494),  Expect = 1e-54, Method: Composition-based stats.
 Identities = 88/92 (96%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            H+FNWAEEGLKPLEW +RLTIALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  681  HIFNWAEEGLKPLEWNRRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  740

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA
Sbjct  741  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  772



>ref|XP_006494665.1| PREDICTED: probable receptor protein kinase TMK1-like isoform 
X2 [Citrus sinensis]
Length=787

 Score =   194 bits (494),  Expect = 1e-54, Method: Composition-based stats.
 Identities = 88/92 (96%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            H+FNWAEEGLKPLEW +RLTIALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  681  HIFNWAEEGLKPLEWNRRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  740

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA
Sbjct  741  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  772



>ref|XP_002305223.1| hypothetical protein POPTR_0004s08230g [Populus trichocarpa]
 gb|EEE85734.1| hypothetical protein POPTR_0004s08230g [Populus trichocarpa]
Length=946

 Score =   195 bits (496),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 88/92 (96%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLFNWAEEGLKP+EWT+RLTIALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  679  HLFNWAEEGLKPMEWTRRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  738

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            +DFGLVRLAPEGKGSIETRIAGTFGYLAPEYA
Sbjct  739  SDFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  770



>ref|XP_006421082.1| hypothetical protein CICLE_v10004322mg [Citrus clementina]
 gb|ESR34322.1| hypothetical protein CICLE_v10004322mg [Citrus clementina]
Length=828

 Score =   194 bits (494),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 88/92 (96%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            H+FNWAEEGLKPLEW +RLTIALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  561  HIFNWAEEGLKPLEWNRRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  620

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA
Sbjct  621  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  652



>ref|XP_007032165.1| Transmembrane kinase 1 isoform 1 [Theobroma cacao]
 gb|EOY03091.1| Transmembrane kinase 1 isoform 1 [Theobroma cacao]
Length=953

 Score =   195 bits (496),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 89/92 (97%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            H+FNWAEEGLKPLEWTKRL IALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  686  HIFNWAEEGLKPLEWTKRLIIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  745

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA
Sbjct  746  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  777



>ref|XP_008343073.1| PREDICTED: LOW QUALITY PROTEIN: probable receptor protein kinase 
TMK1 [Malus domestica]
Length=952

 Score =   195 bits (496),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 89/92 (97%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLFNW EEGLKPLEWT+RLTIALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  685  HLFNWPEEGLKPLEWTRRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  744

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA
Sbjct  745  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  776



>ref|XP_009775667.1| PREDICTED: probable receptor protein kinase TMK1 [Nicotiana sylvestris]
Length=948

 Score =   195 bits (495),  Expect = 3e-54, Method: Composition-based stats.
 Identities = 89/92 (97%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLFNWAEEGLKPLEWT RLTIALDVARGVEYLH+LAHQSFIHRDLKPSNILLGDD RAKV
Sbjct  681  HLFNWAEEGLKPLEWTNRLTIALDVARGVEYLHSLAHQSFIHRDLKPSNILLGDDTRAKV  740

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA
Sbjct  741  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  772



>gb|KDO41052.1| hypothetical protein CISIN_1g002238mg [Citrus sinensis]
Length=948

 Score =   194 bits (494),  Expect = 4e-54, Method: Composition-based stats.
 Identities = 88/92 (96%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            H+FNWAEEGLKPLEW +RLTIALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  681  HIFNWAEEGLKPLEWNRRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  740

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA
Sbjct  741  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  772



>ref|XP_006494664.1| PREDICTED: probable receptor protein kinase TMK1-like isoform 
X1 [Citrus sinensis]
Length=948

 Score =   194 bits (494),  Expect = 4e-54, Method: Composition-based stats.
 Identities = 88/92 (96%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            H+FNWAEEGLKPLEW +RLTIALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  681  HIFNWAEEGLKPLEWNRRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  740

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA
Sbjct  741  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  772



>ref|XP_009378958.1| PREDICTED: probable receptor protein kinase TMK1 [Pyrus x bretschneideri]
Length=950

 Score =   194 bits (494),  Expect = 4e-54, Method: Composition-based stats.
 Identities = 89/92 (97%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLFNW EEGLKPLEWT+RLTIALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  683  HLFNWPEEGLKPLEWTRRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  742

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA
Sbjct  743  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  774



>ref|XP_009587166.1| PREDICTED: probable receptor protein kinase TMK1 [Nicotiana tomentosiformis]
Length=943

 Score =   194 bits (494),  Expect = 4e-54, Method: Composition-based stats.
 Identities = 88/92 (96%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLFNW EE LKPLEWTKRLTIALDVARGVEYLH+LAHQSFIHRDLKPSNILLGDDMRAK+
Sbjct  675  HLFNWREEALKPLEWTKRLTIALDVARGVEYLHSLAHQSFIHRDLKPSNILLGDDMRAKI  734

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA
Sbjct  735  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  766



>ref|XP_009769564.1| PREDICTED: probable receptor protein kinase TMK1 [Nicotiana sylvestris]
Length=943

 Score =   193 bits (491),  Expect = 9e-54, Method: Composition-based stats.
 Identities = 88/92 (96%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLFNW EE LKPLEWTKRLTIALDVARGVEYLH+LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  675  HLFNWREEALKPLEWTKRLTIALDVARGVEYLHSLAHQSFIHRDLKPSNILLGDDMRAKV  734

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGKGSI+TRIAGTFGYLAPEYA
Sbjct  735  ADFGLVRLAPEGKGSIQTRIAGTFGYLAPEYA  766



>ref|XP_010690479.1| PREDICTED: probable receptor protein kinase TMK1 [Beta vulgaris 
subsp. vulgaris]
Length=946

 Score =   193 bits (491),  Expect = 9e-54, Method: Composition-based stats.
 Identities = 86/92 (93%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            H+FNWAEEGLKPLEW++RL+IALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  680  HIFNWAEEGLKPLEWSRRLSIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  739

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGK S+ETRIAGTFGYLAPEYA
Sbjct  740  ADFGLVRLAPEGKASVETRIAGTFGYLAPEYA  771



>ref|XP_004289581.2| PREDICTED: probable receptor protein kinase TMK1 [Fragaria vesca 
subsp. vesca]
Length=913

 Score =   193 bits (490),  Expect = 1e-53, Method: Composition-based stats.
 Identities = 87/92 (95%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            ++FNW EEGLKPLEWTKRLTIALDVARGVEYLH+LAHQSFIHRDLKPSNILLGDD+RAKV
Sbjct  646  YIFNWPEEGLKPLEWTKRLTIALDVARGVEYLHSLAHQSFIHRDLKPSNILLGDDLRAKV  705

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA
Sbjct  706  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  737



>gb|KJB43187.1| hypothetical protein B456_007G187900 [Gossypium raimondii]
Length=953

 Score =   193 bits (490),  Expect = 1e-53, Method: Composition-based stats.
 Identities = 88/92 (96%), Positives = 89/92 (97%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            H+FNW EEGLKPLEWTKRLTIALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  686  HIFNWEEEGLKPLEWTKRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  745

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGK SIETRIAGTFGYLAPEYA
Sbjct  746  ADFGLVRLAPEGKASIETRIAGTFGYLAPEYA  777



>gb|KDP25825.1| hypothetical protein JCGZ_22547 [Jatropha curcas]
Length=951

 Score =   193 bits (490),  Expect = 1e-53, Method: Composition-based stats.
 Identities = 88/92 (96%), Positives = 89/92 (97%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLFNWA EGLKPLEWT+RLTIALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  684  HLFNWANEGLKPLEWTRRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  743

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGK SIETRIAGTFGYLAPEYA
Sbjct  744  ADFGLVRLAPEGKASIETRIAGTFGYLAPEYA  775



>ref|XP_010551437.1| PREDICTED: probable receptor protein kinase TMK1 [Tarenaya hassleriana]
Length=944

 Score =   193 bits (490),  Expect = 1e-53, Method: Composition-based stats.
 Identities = 88/92 (96%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLFNW+EEGLKPLEW +RLTIALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  675  HLFNWSEEGLKPLEWKQRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  734

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA
Sbjct  735  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  766



>gb|KHG20581.1| putative receptor protein kinase TMK1 [Gossypium arboreum]
Length=953

 Score =   193 bits (490),  Expect = 1e-53, Method: Composition-based stats.
 Identities = 88/92 (96%), Positives = 89/92 (97%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            H+FNW EEGLKPLEWTKRLTIALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  686  HIFNWEEEGLKPLEWTKRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  745

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGK SIETRIAGTFGYLAPEYA
Sbjct  746  ADFGLVRLAPEGKASIETRIAGTFGYLAPEYA  777



>ref|XP_010528574.1| PREDICTED: probable receptor protein kinase TMK1 [Tarenaya hassleriana]
Length=944

 Score =   192 bits (489),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 88/92 (96%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLFNW+EEGLKPLEW +RLTIALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  675  HLFNWSEEGLKPLEWKQRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  734

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA
Sbjct  735  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  766



>gb|EYU30867.1| hypothetical protein MIMGU_mgv1a001044mg [Erythranthe guttata]
Length=905

 Score =   192 bits (487),  Expect = 3e-53, Method: Composition-based stats.
 Identities = 87/92 (95%), Positives = 89/92 (97%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            H+FNWAEEGLKPLEW  RLT+ALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  638  HIFNWAEEGLKPLEWKTRLTLALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  697

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA
Sbjct  698  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  729



>gb|KHN41049.1| Putative receptor protein kinase TMK1 [Glycine soja]
Length=812

 Score =   191 bits (485),  Expect = 3e-53, Method: Composition-based stats.
 Identities = 86/92 (93%), Positives = 89/92 (97%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLFNW EEGL+PLEW +RLTIALDVARGVEYLH+LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  544  HLFNWPEEGLEPLEWNRRLTIALDVARGVEYLHSLAHQSFIHRDLKPSNILLGDDMRAKV  603

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGK SIETRIAGTFGYLAPEYA
Sbjct  604  ADFGLVRLAPEGKASIETRIAGTFGYLAPEYA  635



>ref|XP_009370081.1| PREDICTED: probable receptor protein kinase TMK1 [Pyrus x bretschneideri]
Length=949

 Score =   192 bits (487),  Expect = 4e-53, Method: Composition-based stats.
 Identities = 87/92 (95%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            ++FNW EEGLKPLEWT+RLTIALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  682  YIFNWPEEGLKPLEWTRRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  741

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA
Sbjct  742  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  773



>ref|XP_011099938.1| PREDICTED: probable receptor protein kinase TMK1 [Sesamum indicum]
Length=945

 Score =   191 bits (486),  Expect = 4e-53, Method: Composition-based stats.
 Identities = 86/92 (93%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLFNWA+EGL+PLEW +RLT+ALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  678  HLFNWADEGLQPLEWKRRLTVALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  737

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA
Sbjct  738  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  769



>ref|XP_010110337.1| putative receptor protein kinase TMK1 [Morus notabilis]
 gb|EXC25986.1| putative receptor protein kinase TMK1 [Morus notabilis]
Length=826

 Score =   190 bits (482),  Expect = 7e-53, Method: Composition-based stats.
 Identities = 87/92 (95%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLFNW EEGLKPL+W KRLTIALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  559  HLFNWPEEGLKPLKWKKRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  618

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGK SIETRIAGTFGYLAPEYA
Sbjct  619  ADFGLVRLAPEGKASIETRIAGTFGYLAPEYA  650



>gb|KHN08792.1| Putative receptor protein kinase TMK1 [Glycine soja]
Length=277

 Score =   181 bits (458),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/92 (91%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLFNW EEGLKPLEW +RLTIALDVAR VEYLH+LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  9    HLFNWMEEGLKPLEWNRRLTIALDVARAVEYLHSLAHQSFIHRDLKPSNILLGDDMRAKV  68

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            +DFGLVRLAPEGK S+ETRIAGTFGYLAPEYA
Sbjct  69   SDFGLVRLAPEGKASVETRIAGTFGYLAPEYA  100



>ref|XP_010648936.1| PREDICTED: probable receptor protein kinase TMK1 [Vitis vinifera]
Length=948

 Score =   190 bits (483),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 86/92 (93%), Positives = 89/92 (97%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W EEG+KPLEWT+RL IALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  680  HLFSWPEEGIKPLEWTRRLAIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  739

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA
Sbjct  740  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  771



>emb|CAN77178.1| hypothetical protein VITISV_021790 [Vitis vinifera]
Length=304

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/92 (93%), Positives = 89/92 (97%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W EEG+KPLEWT+RL IALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  36   HLFSWPEEGIKPLEWTRRLAIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  95

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA
Sbjct  96   ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  127



>ref|XP_008244390.1| PREDICTED: probable receptor protein kinase TMK1 [Prunus mume]
Length=947

 Score =   190 bits (483),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 88/92 (96%), Positives = 89/92 (97%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            +LFNW EEGLKPLEWTKRLTIALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  687  YLFNWPEEGLKPLEWTKRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  746

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGK SIETRIAGTFGYLAPEYA
Sbjct  747  ADFGLVRLAPEGKFSIETRIAGTFGYLAPEYA  778



>gb|KCW52194.1| hypothetical protein EUGRSUZ_J01624 [Eucalyptus grandis]
Length=825

 Score =   189 bits (480),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 86/92 (93%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLFNW EEG  PLEWT+RLTIALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  559  HLFNWPEEGRAPLEWTRRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  618

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            +DFGLVRLAPEGKGSIETRIAGTFGYLAPEYA
Sbjct  619  SDFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  650



>emb|CBI26796.3| unnamed protein product [Vitis vinifera]
Length=828

 Score =   189 bits (479),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 85/92 (92%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLFNW EEG+KPLEW KRL+IALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  581  HLFNWKEEGMKPLEWMKRLSIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  640

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGK SIETR+AGTFGYLAPEYA
Sbjct  641  ADFGLVRLAPEGKASIETRLAGTFGYLAPEYA  672



>ref|XP_007214949.1| hypothetical protein PRUPE_ppa000942mg [Prunus persica]
 gb|EMJ16148.1| hypothetical protein PRUPE_ppa000942mg [Prunus persica]
Length=954

 Score =   190 bits (482),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 88/92 (96%), Positives = 89/92 (97%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            +LFNW EEGLKPLEWTKRLTIALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  687  YLFNWPEEGLKPLEWTKRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  746

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGK SIETRIAGTFGYLAPEYA
Sbjct  747  ADFGLVRLAPEGKFSIETRIAGTFGYLAPEYA  778



>ref|XP_010553548.1| PREDICTED: probable receptor protein kinase TMK1 isoform X2 [Tarenaya 
hassleriana]
Length=938

 Score =   190 bits (482),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 85/93 (91%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W EEGLKPLEWT+RL+IALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  669  HLFHWEEEGLKPLEWTRRLSIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  728

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            +DFGLVRLAP+GK SIETR+AGTFGYLAPEYAG
Sbjct  729  SDFGLVRLAPDGKHSIETRLAGTFGYLAPEYAG  761



>ref|XP_007141936.1| hypothetical protein PHAVU_008G238600g [Phaseolus vulgaris]
 gb|ESW13930.1| hypothetical protein PHAVU_008G238600g [Phaseolus vulgaris]
Length=947

 Score =   189 bits (481),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 86/92 (93%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLFNW EEGL+PLEW +RLTIALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  679  HLFNWPEEGLEPLEWNRRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  738

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGK SIETRIAGTFGYLAPEYA
Sbjct  739  ADFGLVRLAPEGKASIETRIAGTFGYLAPEYA  770



>ref|XP_002281552.2| PREDICTED: probable receptor protein kinase TMK1 [Vitis vinifera]
Length=937

 Score =   189 bits (479),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 85/92 (92%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLFNW EEG+KPLEW KRL+IALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  671  HLFNWKEEGMKPLEWMKRLSIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  730

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGK SIETR+AGTFGYLAPEYA
Sbjct  731  ADFGLVRLAPEGKASIETRLAGTFGYLAPEYA  762



>ref|XP_002533475.1| receptor protein kinase, putative [Ricinus communis]
 gb|EEF28907.1| receptor protein kinase, putative [Ricinus communis]
Length=951

 Score =   189 bits (479),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 85/92 (92%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+WA++GLKPLEWT+RL IALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  684  HLFHWADDGLKPLEWTRRLIIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  743

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAP+GKGSIETRIAGTFGYLAPEYA
Sbjct  744  ADFGLVRLAPDGKGSIETRIAGTFGYLAPEYA  775



>ref|XP_010032738.1| PREDICTED: probable receptor protein kinase TMK1 [Eucalyptus 
grandis]
Length=946

 Score =   189 bits (479),  Expect = 5e-52, Method: Composition-based stats.
 Identities = 86/92 (93%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLFNW EEG  PLEWT+RLTIALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  680  HLFNWPEEGRAPLEWTRRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  739

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            +DFGLVRLAPEGKGSIETRIAGTFGYLAPEYA
Sbjct  740  SDFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  771



>ref|XP_009351579.1| PREDICTED: probable receptor protein kinase TMK1 isoform X2 [Pyrus 
x bretschneideri]
Length=807

 Score =   187 bits (475),  Expect = 7e-52, Method: Composition-based stats.
 Identities = 84/96 (88%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            +LFNW EEGLKPLEWT+RLTIALDVARGVEYLH LA Q+FIHRDLKPSNILLGDDMRAKV
Sbjct  675  YLFNWKEEGLKPLEWTRRLTIALDVARGVEYLHGLASQTFIHRDLKPSNILLGDDMRAKV  734

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAGIYD  288
            +DFGLVRLAPEGK SIETR+AGTFGYLAPEYAG+ +
Sbjct  735  SDFGLVRLAPEGKASIETRLAGTFGYLAPEYAGLLE  770



>ref|XP_003552883.2| PREDICTED: probable receptor protein kinase TMK1-like [Glycine 
max]
Length=984

 Score =   188 bits (478),  Expect = 9e-52, Method: Composition-based stats.
 Identities = 84/92 (91%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLFNW EEGLKPLEW +RLTIALDVAR VEYLH+LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  716  HLFNWMEEGLKPLEWNRRLTIALDVARAVEYLHSLAHQSFIHRDLKPSNILLGDDMRAKV  775

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            +DFGLVRLAPEGK S+ETRIAGTFGYLAPEYA
Sbjct  776  SDFGLVRLAPEGKASVETRIAGTFGYLAPEYA  807



>ref|XP_010553540.1| PREDICTED: probable receptor protein kinase TMK1 isoform X1 [Tarenaya 
hassleriana]
Length=940

 Score =   187 bits (476),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 84/92 (91%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W EEGLKPLEWT+RL+IALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  669  HLFHWEEEGLKPLEWTRRLSIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  728

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            +DFGLVRLAP+GK SIETR+AGTFGYLAPEYA
Sbjct  729  SDFGLVRLAPDGKHSIETRLAGTFGYLAPEYA  760



>ref|XP_010527815.1| PREDICTED: probable receptor protein kinase TMK1 [Tarenaya hassleriana]
Length=963

 Score =   187 bits (476),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 84/92 (91%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W EEGLKPLEWT+RL+IALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  692  HLFHWKEEGLKPLEWTRRLSIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  751

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            +DFGLVRLAP+GK SIETR+AGTFGYLAPEYA
Sbjct  752  SDFGLVRLAPDGKHSIETRLAGTFGYLAPEYA  783



>gb|KHN39482.1| Putative receptor protein kinase TMK1 [Glycine soja]
Length=912

 Score =   187 bits (475),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 85/92 (92%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W EEGL+PLEW +RLTIALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  644  HLFDWPEEGLEPLEWNRRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  703

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGK SIETRIAGTFGYLAPEYA
Sbjct  704  ADFGLVRLAPEGKASIETRIAGTFGYLAPEYA  735



>ref|NP_001238698.1| NAK-type protein kinase precursor [Glycine max]
 gb|ACM89508.1| NAK-type protein kinase [Glycine max]
Length=941

 Score =   187 bits (475),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 85/92 (92%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W EEGL+PLEW +RLTIALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  673  HLFDWPEEGLEPLEWNRRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  732

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGK SIETRIAGTFGYLAPEYA
Sbjct  733  ADFGLVRLAPEGKASIETRIAGTFGYLAPEYA  764



>ref|XP_010271200.1| PREDICTED: probable receptor protein kinase TMK1 [Nelumbo nucifera]
Length=950

 Score =   187 bits (475),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 85/92 (92%), Positives = 89/92 (97%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W EEGLKPLEWTKRL+IALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  684  HLFDWNEEGLKPLEWTKRLSIALDVARGVEYLHSLAAQSFIHRDLKPSNILLGDDMRAKV  743

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGK SIETR+AGTFGYLAPEYA
Sbjct  744  ADFGLVRLAPEGKASIETRLAGTFGYLAPEYA  775



>ref|XP_002887010.1| hypothetical protein ARALYDRAFT_475717 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63269.1| hypothetical protein ARALYDRAFT_475717 [Arabidopsis lyrata subsp. 
lyrata]
Length=937

 Score =   186 bits (472),  Expect = 4e-51, Method: Composition-based stats.
 Identities = 85/92 (92%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W+EEGLKPL W +RLT+ALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  669  HLFEWSEEGLKPLLWKQRLTLALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  728

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA
Sbjct  729  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  760



>ref|XP_010043988.1| PREDICTED: probable receptor protein kinase TMK1 [Eucalyptus 
grandis]
 gb|KCW85995.1| hypothetical protein EUGRSUZ_B02699 [Eucalyptus grandis]
Length=939

 Score =   186 bits (472),  Expect = 4e-51, Method: Composition-based stats.
 Identities = 85/93 (91%), Positives = 90/93 (97%), Gaps = 1/93 (1%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLFNW +EGLKPLEWT+RL+IALDVARGVEYLH LAHQ+FIHRDLKPSNILLGDDMRAKV
Sbjct  671  HLFNWKDEGLKPLEWTRRLSIALDVARGVEYLHGLAHQTFIHRDLKPSNILLGDDMRAKV  730

Query  181  ADFGLVRLAPE-GKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPE GKGSIETR+AGTFGYLAPEYA
Sbjct  731  ADFGLVRLAPEGGKGSIETRLAGTFGYLAPEYA  763



>ref|XP_006300693.1| hypothetical protein CARUB_v10019739mg [Capsella rubella]
 gb|EOA33591.1| hypothetical protein CARUB_v10019739mg [Capsella rubella]
Length=940

 Score =   186 bits (472),  Expect = 4e-51, Method: Composition-based stats.
 Identities = 85/92 (92%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W+EEGLKPL W +RLT+ALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  672  HLFEWSEEGLKPLLWKQRLTLALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  731

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA
Sbjct  732  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  763



>gb|AAP04161.1| putative receptor protein kinase (TMK1) [Arabidopsis thaliana]
 dbj|BAF00566.1| putative receptor protein kinase [Arabidopsis thaliana]
Length=942

 Score =   186 bits (472),  Expect = 5e-51, Method: Composition-based stats.
 Identities = 85/92 (92%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W+EEGLKPL W +RLT+ALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  674  HLFEWSEEGLKPLLWKQRLTLALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  733

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA
Sbjct  734  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  765



>gb|ACN59264.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
Length=942

 Score =   186 bits (472),  Expect = 5e-51, Method: Composition-based stats.
 Identities = 85/92 (92%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W+EEGLKPL W +RLT+ALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  674  HLFEWSEEGLKPLLWKQRLTLALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  733

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA
Sbjct  734  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  765



>ref|NP_176789.1| transmembrane kinase 1 [Arabidopsis thaliana]
 sp|P43298.1|TMK1_ARATH RecName: Full=Probable receptor protein kinase TMK1; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG51302.1|AC026480_9 receptor protein kinase (TMK1), putative [Arabidopsis thaliana]
 gb|AAA32876.1| protein kinase [Arabidopsis thaliana]
 gb|AEE34468.1| transmembrane kinase 1 [Arabidopsis thaliana]
Length=942

 Score =   186 bits (472),  Expect = 5e-51, Method: Composition-based stats.
 Identities = 85/92 (92%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W+EEGLKPL W +RLT+ALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  674  HLFEWSEEGLKPLLWKQRLTLALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  733

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA
Sbjct  734  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  765



>ref|XP_009105191.1| PREDICTED: probable receptor protein kinase TMK1 [Brassica rapa]
Length=943

 Score =   186 bits (471),  Expect = 6e-51, Method: Composition-based stats.
 Identities = 85/92 (92%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W+EEGLKPL W +RLT+ALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  675  HLFEWSEEGLKPLLWKQRLTLALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  734

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA
Sbjct  735  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  766



>emb|CDY07484.1| BnaA07g25630D [Brassica napus]
Length=943

 Score =   186 bits (471),  Expect = 6e-51, Method: Composition-based stats.
 Identities = 85/92 (92%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W+EEGLKPL W +RLT+ALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  675  HLFEWSEEGLKPLLWKQRLTLALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  734

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA
Sbjct  735  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  766



>ref|XP_010415157.1| PREDICTED: probable receptor protein kinase TMK1 [Camelina sativa]
Length=944

 Score =   186 bits (471),  Expect = 6e-51, Method: Composition-based stats.
 Identities = 85/92 (92%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W+EEGLKPL W +RLT+ALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  676  HLFEWSEEGLKPLLWKQRLTLALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  735

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA
Sbjct  736  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  767



>emb|CDP01661.1| unnamed protein product [Coffea canephora]
Length=943

 Score =   186 bits (471),  Expect = 6e-51, Method: Composition-based stats.
 Identities = 86/92 (93%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLFNWA EGLKPL WTKRL IALDVARGVEYLH LA+QSFIHRDLKPSNILLGDDMRAKV
Sbjct  677  HLFNWANEGLKPLGWTKRLIIALDVARGVEYLHGLANQSFIHRDLKPSNILLGDDMRAKV  736

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
             DFGLVRLAPEGKGSIETRIAGTFGYLAPEYA
Sbjct  737  GDFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  768



>ref|XP_010105561.1| putative receptor protein kinase TMK1 [Morus notabilis]
 gb|EXC05056.1| putative receptor protein kinase TMK1 [Morus notabilis]
Length=958

 Score =   186 bits (471),  Expect = 7e-51, Method: Composition-based stats.
 Identities = 84/92 (91%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            +L NW EEGLKPLEWT+RLTIALDVARGVEYLH+LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  690  YLCNWKEEGLKPLEWTRRLTIALDVARGVEYLHSLAHQSFIHRDLKPSNILLGDDMRAKV  749

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGK S ETR+AGTFGYLAPEYA
Sbjct  750  ADFGLVRLAPEGKASFETRLAGTFGYLAPEYA  781



>emb|CDY39246.1| BnaC06g27450D [Brassica napus]
Length=942

 Score =   186 bits (471),  Expect = 7e-51, Method: Composition-based stats.
 Identities = 85/92 (92%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W+EEGLKPL W +RLT+ALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  674  HLFEWSEEGLKPLLWKQRLTLALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  733

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA
Sbjct  734  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  765



>ref|XP_011021737.1| PREDICTED: probable receptor protein kinase TMK1 [Populus euphratica]
Length=930

 Score =   185 bits (470),  Expect = 7e-51, Method: Composition-based stats.
 Identities = 83/92 (90%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W EEG+KPL+WT+RLTI LDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  669  HLFSWKEEGVKPLDWTRRLTIGLDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  728

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGK SIETR+AGTFGYLAPEYA
Sbjct  729  ADFGLVRLAPEGKASIETRLAGTFGYLAPEYA  760



>ref|XP_006391349.1| hypothetical protein EUTSA_v10018085mg [Eutrema salsugineum]
 gb|ESQ28635.1| hypothetical protein EUTSA_v10018085mg [Eutrema salsugineum]
Length=938

 Score =   185 bits (470),  Expect = 7e-51, Method: Composition-based stats.
 Identities = 85/92 (92%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W+EEGLKPL W +RLT+ALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  670  HLFEWSEEGLKPLLWKQRLTLALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  729

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA
Sbjct  730  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  761



>ref|XP_008220934.1| PREDICTED: probable receptor protein kinase TMK1 [Prunus mume]
Length=941

 Score =   185 bits (470),  Expect = 7e-51, Method: Composition-based stats.
 Identities = 83/93 (89%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLFNW E+GLKPLEWT+RLTIALDVARGVEYLH LA+Q+FIHRDLKPSNILLGDDMRAKV
Sbjct  671  HLFNWKEDGLKPLEWTRRLTIALDVARGVEYLHGLANQTFIHRDLKPSNILLGDDMRAKV  730

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            +DFGLVRLAPEGK SIETR+AGTFGYLAPEYA 
Sbjct  731  SDFGLVRLAPEGKASIETRLAGTFGYLAPEYAA  763



>ref|XP_010556225.1| PREDICTED: probable receptor protein kinase TMK1 [Tarenaya hassleriana]
Length=932

 Score =   185 bits (470),  Expect = 8e-51, Method: Composition-based stats.
 Identities = 82/92 (89%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            H+F W EEGLKPLEWT+RL IALDVARGVEYLH+LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  665  HIFQWKEEGLKPLEWTRRLAIALDVARGVEYLHSLAHQSFIHRDLKPSNILLGDDMRAKV  724

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            +DFGLV+LAPEGK SIETR+AGTFGYLAPEYA
Sbjct  725  SDFGLVKLAPEGKNSIETRLAGTFGYLAPEYA  756



>ref|XP_010470484.1| PREDICTED: probable receptor protein kinase TMK1 [Camelina sativa]
Length=940

 Score =   185 bits (470),  Expect = 8e-51, Method: Composition-based stats.
 Identities = 85/92 (92%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W+EEGLKPL W +RLT+ALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  672  HLFEWSEEGLKPLLWKQRLTLALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  731

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA
Sbjct  732  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  763



>ref|XP_002893435.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69694.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=894

 Score =   184 bits (468),  Expect = 9e-51, Method: Composition-based stats.
 Identities = 83/92 (90%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            H+F+W EEGLKPLEWT+RL+IALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDM AKV
Sbjct  641  HMFHWQEEGLKPLEWTRRLSIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMHAKV  700

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEG  SIET+IAGTFGYLAPEYA
Sbjct  701  ADFGLVRLAPEGTQSIETKIAGTFGYLAPEYA  732



>ref|XP_002314766.1| hypothetical protein POPTR_0010s11360g [Populus trichocarpa]
 gb|EEF00937.1| hypothetical protein POPTR_0010s11360g [Populus trichocarpa]
Length=930

 Score =   185 bits (469),  Expect = 9e-51, Method: Composition-based stats.
 Identities = 83/92 (90%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W EEG+KPL+WT+RLTI LDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  669  HLFSWKEEGVKPLDWTRRLTIGLDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  728

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGK SIETR+AGTFGYLAPEYA
Sbjct  729  ADFGLVRLAPEGKASIETRLAGTFGYLAPEYA  760



>ref|XP_007225345.1| hypothetical protein PRUPE_ppa000982mg [Prunus persica]
 gb|EMJ26544.1| hypothetical protein PRUPE_ppa000982mg [Prunus persica]
Length=941

 Score =   185 bits (469),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 83/93 (89%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLFNW E+GLKPLEWT+RLTIALDVARGVEYLH LA+Q+FIHRDLKPSNILLGDDMRAKV
Sbjct  671  HLFNWKEDGLKPLEWTRRLTIALDVARGVEYLHGLANQTFIHRDLKPSNILLGDDMRAKV  730

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            +DFGLVRLAPEGK SIETR+AGTFGYLAPEYA 
Sbjct  731  SDFGLVRLAPEGKASIETRLAGTFGYLAPEYAA  763



>ref|XP_002527538.1| receptor protein kinase, putative [Ricinus communis]
 gb|EEF34847.1| receptor protein kinase, putative [Ricinus communis]
Length=935

 Score =   185 bits (469),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 83/91 (91%), Positives = 88/91 (97%), Gaps = 0/91 (0%)
 Frame = +1

Query  4    LFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKVA  183
            LFNW EEG+KPL+WT+RLTIALDVARGVEYLH LAHQSFIHRDLKPSNILLGDD+RAKVA
Sbjct  671  LFNWKEEGVKPLDWTRRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDLRAKVA  730

Query  184  DFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            DFGLVRLAPEGK SIETR+AGTFGYLAPEYA
Sbjct  731  DFGLVRLAPEGKASIETRLAGTFGYLAPEYA  761



>ref|XP_004490803.1| PREDICTED: probable receptor protein kinase TMK1-like [Cicer 
arietinum]
Length=976

 Score =   185 bits (469),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 84/92 (91%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            +LFNW +EGL+PL W KRLTIALDVARGVEYLH+LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  709  YLFNWPDEGLEPLGWNKRLTIALDVARGVEYLHSLAHQSFIHRDLKPSNILLGDDMRAKV  768

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGK SIETRIAGTFGYLAPEYA
Sbjct  769  ADFGLVRLAPEGKASIETRIAGTFGYLAPEYA  800



>ref|XP_006395848.1| hypothetical protein EUTSA_v10003606mg [Eutrema salsugineum]
 gb|ESQ33134.1| hypothetical protein EUTSA_v10003606mg [Eutrema salsugineum]
Length=948

 Score =   184 bits (468),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 83/92 (90%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W EEG KPLEWT+RL IALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  674  HLFHWKEEGRKPLEWTRRLAIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  733

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            +DFGLVRLAP+GK SIETR+AGTFGYLAPEYA
Sbjct  734  SDFGLVRLAPDGKYSIETRVAGTFGYLAPEYA  765



>ref|XP_006290562.1| hypothetical protein CARUB_v10016649mg [Capsella rubella]
 gb|EOA23460.1| hypothetical protein CARUB_v10016649mg [Capsella rubella]
Length=947

 Score =   184 bits (468),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 82/92 (89%), Positives = 89/92 (97%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W E+GLKPL+WT+RL IALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  675  HLFHWKEQGLKPLDWTRRLAIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  734

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            +DFGLVRLAP+GK SIETR+AGTFGYLAPEYA
Sbjct  735  SDFGLVRLAPDGKYSIETRVAGTFGYLAPEYA  766



>ref|XP_010502174.1| PREDICTED: probable receptor protein kinase TMK1 isoform X1 [Camelina 
sativa]
 ref|XP_010502175.1| PREDICTED: probable receptor protein kinase TMK1 isoform X2 [Camelina 
sativa]
Length=948

 Score =   184 bits (468),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 82/92 (89%), Positives = 89/92 (97%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W E+GLKPL+WT+RL IALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  676  HLFHWKEQGLKPLDWTRRLAIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  735

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            +DFGLVRLAP+GK SIETR+AGTFGYLAPEYA
Sbjct  736  SDFGLVRLAPDGKYSIETRVAGTFGYLAPEYA  767



>ref|XP_010513910.1| PREDICTED: probable receptor protein kinase TMK1 [Camelina sativa]
Length=953

 Score =   184 bits (468),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 82/92 (89%), Positives = 89/92 (97%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W E+GLKPL+WT+RL IALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  681  HLFHWKEQGLKPLDWTRRLAIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  740

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            +DFGLVRLAP+GK SIETR+AGTFGYLAPEYA
Sbjct  741  SDFGLVRLAPDGKYSIETRVAGTFGYLAPEYA  772



>ref|XP_009351578.1| PREDICTED: probable receptor protein kinase TMK1 isoform X1 [Pyrus 
x bretschneideri]
Length=945

 Score =   184 bits (466),  Expect = 3e-50, Method: Composition-based stats.
 Identities = 83/93 (89%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            +LFNW EEGLKPLEWT+RLTIALDVARGVEYLH LA Q+FIHRDLKPSNILLGDDMRAKV
Sbjct  675  YLFNWKEEGLKPLEWTRRLTIALDVARGVEYLHGLASQTFIHRDLKPSNILLGDDMRAKV  734

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            +DFGLVRLAPEGK SIETR+AGTFGYLAPEYA 
Sbjct  735  SDFGLVRLAPEGKASIETRLAGTFGYLAPEYAA  767



>ref|XP_010511542.1| PREDICTED: probable receptor protein kinase TMK1 [Camelina sativa]
Length=943

 Score =   184 bits (466),  Expect = 3e-50, Method: Composition-based stats.
 Identities = 84/92 (91%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W+EEGL PL W +RLT+ALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  675  HLFEWSEEGLNPLLWKQRLTLALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  734

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA
Sbjct  735  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  766



>ref|XP_003616214.1| Kinase-like protein [Medicago truncatula]
 gb|AES99172.1| LRR receptor-like kinase [Medicago truncatula]
Length=945

 Score =   184 bits (466),  Expect = 3e-50, Method: Composition-based stats.
 Identities = 83/92 (90%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            ++FNW EEGL+PL W KRL IALDVARGVEYLH+LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  678  YIFNWPEEGLEPLGWNKRLVIALDVARGVEYLHSLAHQSFIHRDLKPSNILLGDDMRAKV  737

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGK SIETRIAGTFGYLAPEYA
Sbjct  738  ADFGLVRLAPEGKASIETRIAGTFGYLAPEYA  769



>gb|KFK45034.1| hypothetical protein AALP_AA1G335600 [Arabis alpina]
Length=920

 Score =   183 bits (465),  Expect = 4e-50, Method: Composition-based stats.
 Identities = 82/92 (89%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W EEG KPL+WT+RL IALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  646  HLFHWKEEGRKPLDWTRRLAIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  705

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            +DFGLVRLAP+GK SIETR+AGTFGYLAPEYA
Sbjct  706  SDFGLVRLAPDGKYSIETRVAGTFGYLAPEYA  737



>ref|XP_010424954.1| PREDICTED: probable receptor protein kinase TMK1 [Camelina sativa]
Length=948

 Score =   183 bits (465),  Expect = 4e-50, Method: Composition-based stats.
 Identities = 82/92 (89%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W E GLKPL+WT+RL IALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  676  HLFQWKERGLKPLDWTRRLAIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  735

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            +DFGLVRLAP+GK SIETR+AGTFGYLAPEYA
Sbjct  736  SDFGLVRLAPDGKYSIETRVAGTFGYLAPEYA  767



>ref|XP_008467095.1| PREDICTED: probable receptor protein kinase TMK1 [Cucumis melo]
Length=947

 Score =   183 bits (465),  Expect = 4e-50, Method: Composition-based stats.
 Identities = 81/91 (89%), Positives = 87/91 (96%), Gaps = 0/91 (0%)
 Frame = +1

Query  4    LFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKVA  183
            LFNW EEG+KPLEW +RLT+ LDVARGVEYLH+LAHQSFIHRDLKPSNILLGDD+RAKVA
Sbjct  680  LFNWKEEGIKPLEWKRRLTVVLDVARGVEYLHSLAHQSFIHRDLKPSNILLGDDLRAKVA  739

Query  184  DFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            DFGLVRLAPEGK SIETR+AGTFGYLAPEYA
Sbjct  740  DFGLVRLAPEGKASIETRLAGTFGYLAPEYA  770



>dbj|BAD95052.1| putative receptor-like protein kinase [Arabidopsis thaliana]
Length=306

 Score =   174 bits (442),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/92 (89%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W EEG KPL+WT+RL IALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  34   HLFHWKEEGRKPLDWTRRLAIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  93

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            +DFGLVRLAP+GK SIETR+AGTFGYLAPEYA
Sbjct  94   SDFGLVRLAPDGKYSIETRVAGTFGYLAPEYA  125



>ref|NP_178291.1| receptor-like kinase TMK3 [Arabidopsis thaliana]
 gb|AAD21776.1| putative receptor-like protein kinase [Arabidopsis thaliana]
 gb|ACN59281.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEC05504.1| receptor-like kinase TMK3 [Arabidopsis thaliana]
Length=943

 Score =   183 bits (465),  Expect = 5e-50, Method: Composition-based stats.
 Identities = 82/92 (89%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W EEG KPL+WT+RL IALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  671  HLFHWKEEGRKPLDWTRRLAIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  730

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            +DFGLVRLAP+GK SIETR+AGTFGYLAPEYA
Sbjct  731  SDFGLVRLAPDGKYSIETRVAGTFGYLAPEYA  762



>ref|XP_002876780.1| hypothetical protein ARALYDRAFT_484098 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53039.1| hypothetical protein ARALYDRAFT_484098 [Arabidopsis lyrata subsp. 
lyrata]
Length=946

 Score =   183 bits (465),  Expect = 5e-50, Method: Composition-based stats.
 Identities = 82/92 (89%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W EEG KPL+WT+RL IALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  674  HLFHWKEEGRKPLDWTRRLAIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  733

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            +DFGLVRLAP+GK SIETR+AGTFGYLAPEYA
Sbjct  734  SDFGLVRLAPDGKYSIETRVAGTFGYLAPEYA  765



>gb|KFK41035.1| hypothetical protein AALP_AA2G077000 [Arabis alpina]
Length=939

 Score =   183 bits (464),  Expect = 5e-50, Method: Composition-based stats.
 Identities = 84/92 (91%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W+EEGL PL W +RLT+ALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  671  HLFEWSEEGLTPLLWKQRLTLALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  730

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA
Sbjct  731  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  762



>emb|CDY17635.1| BnaA06g34540D [Brassica napus]
Length=877

 Score =   182 bits (463),  Expect = 5e-50, Method: Composition-based stats.
 Identities = 82/92 (89%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W EE  KPL+WT+RL IALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  635  HLFHWKEEERKPLDWTRRLAIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  694

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            +DFGLVRLAPEGK SIETR+AGTFGYLAPEYA
Sbjct  695  SDFGLVRLAPEGKNSIETRVAGTFGYLAPEYA  726



>ref|XP_008389147.1| PREDICTED: probable receptor protein kinase TMK1 [Malus domestica]
Length=940

 Score =   182 bits (463),  Expect = 7e-50, Method: Composition-based stats.
 Identities = 83/93 (89%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            +LFNW EEGLKPLEWT+RLTIALDVARGVEYLH LA Q+FIHRDLKPSNILLGDDMRAKV
Sbjct  670  YLFNWXEEGLKPLEWTRRLTIALDVARGVEYLHGLAXQTFIHRDLKPSNILLGDDMRAKV  729

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            +DFGLVRLAPEGK SIETR+AGTFGYLAPEYA 
Sbjct  730  SDFGLVRLAPEGKASIETRLAGTFGYLAPEYAA  762



>ref|XP_006303733.1| hypothetical protein CARUB_v10011871mg [Capsella rubella]
 gb|EOA36631.1| hypothetical protein CARUB_v10011871mg [Capsella rubella]
Length=891

 Score =   182 bits (461),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 82/92 (89%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            H+F+W EEGLKPLEW +RL IALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDM AKV
Sbjct  638  HIFHWQEEGLKPLEWARRLIIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMHAKV  697

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEG  SIET+IAGTFGYLAPEYA
Sbjct  698  ADFGLVRLAPEGAQSIETKIAGTFGYLAPEYA  729



>ref|NP_173869.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 gb|AAF97970.1|AC000103_20 F21J9.31 [Arabidopsis thaliana]
 gb|ACN59232.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE30556.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
Length=886

 Score =   181 bits (460),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 82/92 (89%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            H+F W EEGL+PLEWT+RL IALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDM AKV
Sbjct  633  HIFYWKEEGLRPLEWTRRLIIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMHAKV  692

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEG  SIET+IAGTFGYLAPEYA
Sbjct  693  ADFGLVRLAPEGTQSIETKIAGTFGYLAPEYA  724



>gb|KDP38160.1| hypothetical protein JCGZ_04803 [Jatropha curcas]
Length=942

 Score =   182 bits (461),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 81/91 (89%), Positives = 88/91 (97%), Gaps = 0/91 (0%)
 Frame = +1

Query  4    LFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKVA  183
            LF+W ++GLKPLEWT+RL+IALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKVA
Sbjct  678  LFDWRQQGLKPLEWTRRLSIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKVA  737

Query  184  DFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            DFGLVRLAPEGK S+ETR+AGTFGYLAPEYA
Sbjct  738  DFGLVRLAPEGKASVETRLAGTFGYLAPEYA  768



>emb|CDY03107.1| BnaC07g21200D [Brassica napus]
Length=668

 Score =   180 bits (456),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 82/92 (89%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W EE  KPL+WT+RL IALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  394  HLFHWKEEERKPLDWTRRLAIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  453

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            +DFGLVRLAPEGK SIETR+AGTFGYLAPEYA
Sbjct  454  SDFGLVRLAPEGKYSIETRVAGTFGYLAPEYA  485



>gb|AAG03120.1|AC004133_14 F5A9.23 [Arabidopsis thaliana]
Length=924

 Score =   181 bits (460),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 82/92 (89%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            H+F W EEGL+PLEWT+RL IALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDM AKV
Sbjct  633  HIFYWKEEGLRPLEWTRRLIIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMHAKV  692

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEG  SIET+IAGTFGYLAPEYA
Sbjct  693  ADFGLVRLAPEGTQSIETKIAGTFGYLAPEYA  724



>ref|XP_009757873.1| PREDICTED: probable receptor protein kinase TMK1 [Nicotiana sylvestris]
Length=944

 Score =   181 bits (460),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 82/92 (89%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            +LFNW EEGLKPLEWT+RLTIALDVARGVEYLH LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  678  YLFNWKEEGLKPLEWTRRLTIALDVARGVEYLHGLAQQSFIHRDLKPSNILLGDDMRAKV  737

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAP+GK S+ TR+AGTFGYLAPEYA
Sbjct  738  ADFGLVRLAPDGKASVVTRLAGTFGYLAPEYA  769



>ref|XP_004298491.1| PREDICTED: probable receptor protein kinase TMK1 [Fragaria vesca 
subsp. vesca]
Length=915

 Score =   181 bits (460),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 82/93 (88%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLFNW EEGLKPLEWT+RLTIALDVARGV+YLH LA++ FIHRDLKPSNILLGDDMRAKV
Sbjct  646  HLFNWKEEGLKPLEWTRRLTIALDVARGVQYLHGLANEIFIHRDLKPSNILLGDDMRAKV  705

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLVRLAP GK SIETR+AGTFGYLAPEYA 
Sbjct  706  ADFGLVRLAPAGKASIETRLAGTFGYLAPEYAA  738



>ref|XP_004297409.2| PREDICTED: probable receptor protein kinase TMK1 [Fragaria vesca 
subsp. vesca]
Length=924

 Score =   181 bits (460),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 82/93 (88%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLFNW EEGL+PLEWT+RLTIALDVARGVEYLH LA++ FIHRDLKPSNILLGDDMRAKV
Sbjct  655  HLFNWKEEGLEPLEWTRRLTIALDVARGVEYLHGLANEIFIHRDLKPSNILLGDDMRAKV  714

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLVRLAP GK SIETR+AGTFGYLAPEYA 
Sbjct  715  ADFGLVRLAPAGKASIETRLAGTFGYLAPEYAA  747



>emb|CDY52761.1| BnaC02g47770D [Brassica napus]
Length=872

 Score =   181 bits (458),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 81/92 (88%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W EE  KPL+WT+RL +ALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  621  HLFHWKEEERKPLDWTRRLAVALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  680

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            +DFGLVRLAPEGK SIETR+AGTFGYLAPEYA
Sbjct  681  SDFGLVRLAPEGKYSIETRVAGTFGYLAPEYA  712



>emb|CDY17648.1| BnaA06g34670D [Brassica napus]
Length=668

 Score =   179 bits (455),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 82/92 (89%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W EE  KPL+WT+RL IALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  394  HLFHWKEEERKPLDWTRRLAIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  453

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            +DFGLVRLAPEGK SIETR+AGTFGYLAPEYA
Sbjct  454  SDFGLVRLAPEGKYSIETRVAGTFGYLAPEYA  485



>ref|XP_010462912.1| PREDICTED: probable receptor protein kinase TMK1 [Camelina sativa]
Length=871

 Score =   181 bits (458),  Expect = 3e-49, Method: Composition-based stats.
 Identities = 82/92 (89%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            H+F+W  EGLKPLEWT+RL IALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDM AKV
Sbjct  618  HIFHWQVEGLKPLEWTRRLIIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMHAKV  677

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEG  SIET+IAGTFGYLAPEYA
Sbjct  678  ADFGLVRLAPEGAQSIETKIAGTFGYLAPEYA  709



>gb|KDO60837.1| hypothetical protein CISIN_1g002255mg [Citrus sinensis]
Length=779

 Score =   179 bits (455),  Expect = 3e-49, Method: Composition-based stats.
 Identities = 85/94 (90%), Positives = 88/94 (94%), Gaps = 1/94 (1%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLFN  EEGLKPLEWT+RLTIALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  678  HLFNRKEEGLKPLEWTRRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  737

Query  181  ADFGLVRLAPE-GKGSIETRIAGTFGYLAPEYAG  279
            ADFGLVRLAP+ GK SIETR+AGTFGYLAPEYA 
Sbjct  738  ADFGLVRLAPDNGKHSIETRLAGTFGYLAPEYAA  771



>ref|XP_006448112.1| hypothetical protein CICLE_v10014172mg [Citrus clementina]
 gb|ESR61352.1| hypothetical protein CICLE_v10014172mg [Citrus clementina]
Length=779

 Score =   179 bits (455),  Expect = 3e-49, Method: Composition-based stats.
 Identities = 85/94 (90%), Positives = 88/94 (94%), Gaps = 1/94 (1%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLFN  EEGLKPLEWT+RLTIALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  678  HLFNRKEEGLKPLEWTRRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  737

Query  181  ADFGLVRLAPE-GKGSIETRIAGTFGYLAPEYAG  279
            ADFGLVRLAP+ GK SIETR+AGTFGYLAPEYA 
Sbjct  738  ADFGLVRLAPDNGKHSIETRLAGTFGYLAPEYAA  771



>ref|XP_011070546.1| PREDICTED: probable receptor protein kinase TMK1 isoform X2 [Sesamum 
indicum]
Length=775

 Score =   179 bits (455),  Expect = 3e-49, Method: Composition-based stats.
 Identities = 81/92 (88%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = +1

Query  4    LFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKVA  183
            LF+W EEGLKPLEWT+RL IALDVARGVEYLH LA QSFIHRDLKPSNILLGDDMRAKVA
Sbjct  664  LFHWKEEGLKPLEWTRRLIIALDVARGVEYLHGLAQQSFIHRDLKPSNILLGDDMRAKVA  723

Query  184  DFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            DFGLVRLAP+GK S+ TR+AGTFGYLAPEYAG
Sbjct  724  DFGLVRLAPDGKASVATRLAGTFGYLAPEYAG  755



>emb|CDY09413.1| BnaA02g25970D [Brassica napus]
Length=915

 Score =   181 bits (458),  Expect = 4e-49, Method: Composition-based stats.
 Identities = 81/92 (88%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W EE  KPL+WT+RL +ALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  641  HLFHWKEEERKPLDWTRRLAVALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  700

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            +DFGLVRLAPEGK SIETR+AGTFGYLAPEYA
Sbjct  701  SDFGLVRLAPEGKYSIETRVAGTFGYLAPEYA  732



>ref|XP_009129193.1| PREDICTED: probable receptor protein kinase TMK1 isoform X1 [Brassica 
rapa]
 ref|XP_009129194.1| PREDICTED: probable receptor protein kinase TMK1 isoform X2 [Brassica 
rapa]
Length=926

 Score =   181 bits (458),  Expect = 4e-49, Method: Composition-based stats.
 Identities = 81/92 (88%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W EE  KPL+WT+RL +ALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  652  HLFHWKEEERKPLDWTRRLAVALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  711

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            +DFGLVRLAPEGK SIETR+AGTFGYLAPEYA
Sbjct  712  SDFGLVRLAPEGKYSIETRVAGTFGYLAPEYA  743



>ref|XP_009101661.1| PREDICTED: probable receptor protein kinase TMK1 [Brassica rapa]
Length=877

 Score =   180 bits (457),  Expect = 4e-49, Method: Composition-based stats.
 Identities = 81/92 (88%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W EE  KPL+WT+RL IALDVARGVEYLHTL HQSFIHRDLKPSNILLGDDMRAKV
Sbjct  635  HLFHWKEEERKPLDWTRRLAIALDVARGVEYLHTLDHQSFIHRDLKPSNILLGDDMRAKV  694

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            +DFGLVRLAPEGK SIETR+AGTFGYLAPEYA
Sbjct  695  SDFGLVRLAPEGKNSIETRVAGTFGYLAPEYA  726



>ref|XP_009115288.1| PREDICTED: probable receptor protein kinase TMK1 [Brassica rapa]
Length=890

 Score =   180 bits (457),  Expect = 4e-49, Method: Composition-based stats.
 Identities = 81/92 (88%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W EE  KPL+WT+RL I+LDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  616  HLFHWKEEERKPLDWTRRLAISLDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  675

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            +DFGLVRLAPEGK SIETR+AGTFGYLAPEYA
Sbjct  676  SDFGLVRLAPEGKYSIETRVAGTFGYLAPEYA  707



>ref|XP_009101318.1| PREDICTED: probable receptor protein kinase TMK1 [Brassica rapa]
Length=949

 Score =   180 bits (457),  Expect = 6e-49, Method: Composition-based stats.
 Identities = 81/92 (88%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W EE  KPL+WT+RL I+LDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  675  HLFHWKEEERKPLDWTRRLAISLDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  734

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            +DFGLVRLAPEGK SIETR+AGTFGYLAPEYA
Sbjct  735  SDFGLVRLAPEGKYSIETRVAGTFGYLAPEYA  766



>ref|XP_004142822.1| PREDICTED: probable receptor protein kinase TMK1-like [Cucumis 
sativus]
 ref|XP_004170157.1| PREDICTED: probable receptor protein kinase TMK1-like [Cucumis 
sativus]
 gb|KGN51453.1| hypothetical protein Csa_5G550170 [Cucumis sativus]
Length=950

 Score =   180 bits (456),  Expect = 6e-49, Method: Composition-based stats.
 Identities = 79/91 (87%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = +1

Query  4    LFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKVA  183
            LFNW EEG++PLEW +RL + LDVARGVEYLH+LAHQSFIHRDLKPSNILLGDD+RAKVA
Sbjct  682  LFNWKEEGIRPLEWKRRLIVVLDVARGVEYLHSLAHQSFIHRDLKPSNILLGDDLRAKVA  741

Query  184  DFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            DFGLVRLAPEGK SIETR+AGTFGYLAPEYA
Sbjct  742  DFGLVRLAPEGKASIETRLAGTFGYLAPEYA  772



>ref|XP_007045490.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
 gb|EOY01322.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
Length=936

 Score =   180 bits (456),  Expect = 6e-49, Method: Composition-based stats.
 Identities = 83/93 (89%), Positives = 88/93 (95%), Gaps = 1/93 (1%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLFNW +EGLKPLEWT+RLTIALDVARGVEYLH LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  669  HLFNWKDEGLKPLEWTRRLTIALDVARGVEYLHGLAQQSFIHRDLKPSNILLGDDMRAKV  728

Query  181  ADFGLVRLAP-EGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAP +GK S+ETR+AGTFGYLAPEYA
Sbjct  729  ADFGLVRLAPVDGKHSVETRLAGTFGYLAPEYA  761



>gb|KJB50422.1| hypothetical protein B456_008G170100 [Gossypium raimondii]
Length=928

 Score =   180 bits (456),  Expect = 7e-49, Method: Composition-based stats.
 Identities = 83/93 (89%), Positives = 88/93 (95%), Gaps = 1/93 (1%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLFNW +EGLKPLEWT+RLTIALDVARGVEYLH LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  664  HLFNWKDEGLKPLEWTQRLTIALDVARGVEYLHGLAQQSFIHRDLKPSNILLGDDMRAKV  723

Query  181  ADFGLVRLAP-EGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAP +GK SIETR+AGTFGY+APEYA
Sbjct  724  ADFGLVRLAPADGKQSIETRLAGTFGYMAPEYA  756



>emb|CDY36253.1| BnaC07g21070D [Brassica napus]
Length=898

 Score =   179 bits (454),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 81/92 (88%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W EE  KPL+WT+RL IALDVARGVEYLHT AHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  631  HLFHWKEEERKPLDWTRRLAIALDVARGVEYLHTFAHQSFIHRDLKPSNILLGDDMRAKV  690

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEG  SIETR+AGTFGYLAPEYA
Sbjct  691  ADFGLVRLAPEGNYSIETRVAGTFGYLAPEYA  722



>gb|KDO60836.1| hypothetical protein CISIN_1g002255mg [Citrus sinensis]
Length=947

 Score =   179 bits (455),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 1/93 (1%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLFN  EEGLKPLEWT+RLTIALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  678  HLFNRKEEGLKPLEWTRRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  737

Query  181  ADFGLVRLAPE-GKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAP+ GK SIETR+AGTFGYLAPEYA
Sbjct  738  ADFGLVRLAPDNGKHSIETRLAGTFGYLAPEYA  770



>ref|XP_006469286.1| PREDICTED: probable receptor protein kinase TMK1-like [Citrus 
sinensis]
Length=947

 Score =   179 bits (455),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 1/93 (1%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLFN  EEGLKPLEWT+RLTIALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  678  HLFNRKEEGLKPLEWTRRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  737

Query  181  ADFGLVRLAPE-GKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAP+ GK SIETR+AGTFGYLAPEYA
Sbjct  738  ADFGLVRLAPDNGKHSIETRLAGTFGYLAPEYA  770



>ref|XP_006448111.1| hypothetical protein CICLE_v10014172mg [Citrus clementina]
 gb|ESR61351.1| hypothetical protein CICLE_v10014172mg [Citrus clementina]
Length=947

 Score =   179 bits (455),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 1/93 (1%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLFN  EEGLKPLEWT+RLTIALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  678  HLFNRKEEGLKPLEWTRRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKV  737

Query  181  ADFGLVRLAPE-GKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAP+ GK SIETR+AGTFGYLAPEYA
Sbjct  738  ADFGLVRLAPDNGKHSIETRLAGTFGYLAPEYA  770



>gb|KJB79021.1| hypothetical protein B456_013G030200 [Gossypium raimondii]
Length=937

 Score =   179 bits (454),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 84/93 (90%), Positives = 87/93 (94%), Gaps = 1/93 (1%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLFNW  EGLKPLEWT+RLTIALDVARGVEYLH LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  670  HLFNWKHEGLKPLEWTRRLTIALDVARGVEYLHGLAQQSFIHRDLKPSNILLGDDMRAKV  729

Query  181  ADFGLVRLAP-EGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAP +GK SIETR+AGTFGYLAPEYA
Sbjct  730  ADFGLVRLAPVDGKQSIETRLAGTFGYLAPEYA  762



>ref|XP_010501607.1| PREDICTED: probable receptor protein kinase TMK1 [Camelina sativa]
Length=888

 Score =   178 bits (452),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 81/92 (88%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            H+F+W  EGL PLEWT+RL IALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDM AKV
Sbjct  637  HIFHWQVEGLSPLEWTRRLIIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMHAKV  696

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEG  SIET+IAGTFGYLAPEYA
Sbjct  697  ADFGLVRLAPEGAQSIETKIAGTFGYLAPEYA  728



>ref|XP_010315276.1| PREDICTED: probable receptor protein kinase TMK1 isoform X2 [Solanum 
lycopersicum]
Length=913

 Score =   179 bits (453),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 81/92 (88%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            +LFNW EEG+KPLEWT+RL IALDVARGVEYLH LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  647  YLFNWKEEGIKPLEWTRRLIIALDVARGVEYLHGLAQQSFIHRDLKPSNILLGDDMRAKV  706

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGK S+ TR+AGTFGYLAPEYA
Sbjct  707  ADFGLVRLAPEGKTSLVTRLAGTFGYLAPEYA  738



>ref|XP_004230827.1| PREDICTED: probable receptor protein kinase TMK1 isoform X1 [Solanum 
lycopersicum]
Length=940

 Score =   179 bits (453),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 81/92 (88%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            +LFNW EEG+KPLEWT+RL IALDVARGVEYLH LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  674  YLFNWKEEGIKPLEWTRRLIIALDVARGVEYLHGLAQQSFIHRDLKPSNILLGDDMRAKV  733

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGK S+ TR+AGTFGYLAPEYA
Sbjct  734  ADFGLVRLAPEGKTSLVTRLAGTFGYLAPEYA  765



>gb|AAF66615.1| LRR receptor-like protein kinase [Nicotiana tabacum]
Length=945

 Score =   178 bits (452),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 81/92 (88%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            +LFNW EEGLKPLEWT+RLTIALDVARGVEYLH LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  679  YLFNWKEEGLKPLEWTRRLTIALDVARGVEYLHGLAQQSFIHRDLKPSNILLGDDMRAKV  738

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAP+ K S+ TR+AGTFGYLAPEYA
Sbjct  739  ADFGLVRLAPDPKASVVTRLAGTFGYLAPEYA  770



>ref|XP_009619244.1| PREDICTED: probable receptor protein kinase TMK1 [Nicotiana tomentosiformis]
Length=944

 Score =   178 bits (452),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 81/92 (88%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            +LF W EEGLKPLEWT+RLTIALDVARGVEYLH LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  678  YLFYWKEEGLKPLEWTRRLTIALDVARGVEYLHGLAQQSFIHRDLKPSNILLGDDMRAKV  737

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAP+GK S+ TR+AGTFGYLAPEYA
Sbjct  738  ADFGLVRLAPDGKASVVTRLAGTFGYLAPEYA  769



>ref|XP_006415826.1| hypothetical protein EUTSA_v10009860mg [Eutrema salsugineum]
 gb|ESQ34179.1| hypothetical protein EUTSA_v10009860mg [Eutrema salsugineum]
Length=891

 Score =   178 bits (451),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 80/92 (87%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            H+F+W EEGLKPLEW++RL IA DVARGVEYLHTLAH+SFIHRDLKPSNILLGDDM AKV
Sbjct  633  HIFHWQEEGLKPLEWSRRLIIASDVARGVEYLHTLAHKSFIHRDLKPSNILLGDDMHAKV  692

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEG  SIET+IAGTFGYLAPEYA
Sbjct  693  ADFGLVRLAPEGTQSIETKIAGTFGYLAPEYA  724



>ref|XP_009404143.1| PREDICTED: probable receptor protein kinase TMK1 [Musa acuminata 
subsp. malaccensis]
Length=957

 Score =   178 bits (452),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 82/93 (88%), Positives = 88/93 (95%), Gaps = 1/93 (1%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HL +W EEGLKPLEW KRL+IALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDM+AKV
Sbjct  689  HLLDWKEEGLKPLEWKKRLSIALDVARGVEYLHNLAHQSFIHRDLKPSNILLGDDMKAKV  748

Query  181  ADFGLVRLAPEGKG-SIETRIAGTFGYLAPEYA  276
            ADFGLVRLAP+GKG S+ETR+AGTFGYLAPEYA
Sbjct  749  ADFGLVRLAPDGKGCSVETRLAGTFGYLAPEYA  781



>emb|CDY03867.1| BnaC07g10920D [Brassica napus]
Length=889

 Score =   177 bits (450),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 79/92 (86%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLFNW EEGL+PLEW++RL IA DVA+GVEYLH+ AHQSFIHRDLKPSNILLGDDMRA+V
Sbjct  635  HLFNWQEEGLQPLEWSRRLIIASDVAKGVEYLHSQAHQSFIHRDLKPSNILLGDDMRARV  694

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEG  SIET+IAGTFGYLAPEYA
Sbjct  695  ADFGLVRLAPEGTQSIETKIAGTFGYLAPEYA  726



>ref|XP_009380072.1| PREDICTED: probable receptor protein kinase TMK1 [Musa acuminata 
subsp. malaccensis]
Length=964

 Score =   178 bits (451),  Expect = 4e-48, Method: Composition-based stats.
 Identities = 82/93 (88%), Positives = 88/93 (95%), Gaps = 1/93 (1%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HL +W EEGLKPLEW KRL+IALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDM+AKV
Sbjct  696  HLLDWKEEGLKPLEWKKRLSIALDVARGVEYLHNLAHQSFIHRDLKPSNILLGDDMKAKV  755

Query  181  ADFGLVRLAPEGKG-SIETRIAGTFGYLAPEYA  276
            ADFGLVRLAP+GKG S+ETR+AGTFGYLAPEYA
Sbjct  756  ADFGLVRLAPDGKGCSVETRLAGTFGYLAPEYA  788



>emb|CDY40785.1| BnaAnng06480D [Brassica napus]
Length=795

 Score =   176 bits (447),  Expect = 5e-48, Method: Composition-based stats.
 Identities = 78/92 (85%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLFNW +EGL+PLEW++RL IA DVA+GVEYLH+ AHQSFIHRDLKPSNILLGDDMRA+V
Sbjct  565  HLFNWQQEGLQPLEWSRRLIIASDVAKGVEYLHSQAHQSFIHRDLKPSNILLGDDMRARV  624

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEG  SIET+IAGTFGYLAPEYA
Sbjct  625  ADFGLVRLAPEGTQSIETKIAGTFGYLAPEYA  656



>ref|XP_011070545.1| PREDICTED: probable receptor protein kinase TMK1 isoform X1 [Sesamum 
indicum]
Length=930

 Score =   177 bits (449),  Expect = 6e-48, Method: Composition-based stats.
 Identities = 80/91 (88%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = +1

Query  4    LFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKVA  183
            LF+W EEGLKPLEWT+RL IALDVARGVEYLH LA QSFIHRDLKPSNILLGDDMRAKVA
Sbjct  664  LFHWKEEGLKPLEWTRRLIIALDVARGVEYLHGLAQQSFIHRDLKPSNILLGDDMRAKVA  723

Query  184  DFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            DFGLVRLAP+GK S+ TR+AGTFGYLAPEYA
Sbjct  724  DFGLVRLAPDGKASVATRLAGTFGYLAPEYA  754



>ref|XP_002312477.1| hypothetical protein POPTR_0008s13710g [Populus trichocarpa]
 gb|EEE89844.1| hypothetical protein POPTR_0008s13710g [Populus trichocarpa]
Length=931

 Score =   177 bits (448),  Expect = 8e-48, Method: Composition-based stats.
 Identities = 81/92 (88%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W EEG+K LEWT+RLTI LDVARGVEYLH LAHQ FIHRDLKPSNILLGDDMRAKV
Sbjct  670  HLFCWKEEGVKSLEWTRRLTIGLDVARGVEYLHGLAHQCFIHRDLKPSNILLGDDMRAKV  729

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVR APEGK SIETR+AGTFGYLAPEYA
Sbjct  730  ADFGLVRPAPEGKTSIETRLAGTFGYLAPEYA  761



>ref|XP_006346490.1| PREDICTED: probable receptor protein kinase TMK1-like [Solanum 
tuberosum]
Length=942

 Score =   177 bits (448),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 80/92 (87%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            +LFNW EEG+ PLEWT+RL IALDVARGVEYLH LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  676  YLFNWKEEGINPLEWTRRLIIALDVARGVEYLHGLAQQSFIHRDLKPSNILLGDDMRAKV  735

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGK S+ TR+AGTFGYLAPEYA
Sbjct  736  ADFGLVRLAPEGKTSLVTRLAGTFGYLAPEYA  767



>gb|KHN24152.1| Putative receptor protein kinase TMK1 [Glycine soja]
Length=861

 Score =   176 bits (445),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 79/92 (86%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLFNW EEGLKPLEW +RLTIALD+ R VEYLH+LAHQSFIHRDLKP NILLGDDMRAKV
Sbjct  645  HLFNWMEEGLKPLEWNRRLTIALDLTRVVEYLHSLAHQSFIHRDLKPLNILLGDDMRAKV  704

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            +DFGLVRLAPEGK + ETRIAGTFGYLAP+YA
Sbjct  705  SDFGLVRLAPEGKATTETRIAGTFGYLAPKYA  736



>gb|KFK44514.1| hypothetical protein AALP_AA1G266600 [Arabis alpina]
Length=666

 Score =   174 bits (440),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 79/91 (87%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = +1

Query  4    LFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKVA  183
            +F+W EE L+PL+WT+RL IALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDM AKVA
Sbjct  416  IFHWQEEHLEPLKWTRRLIIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMHAKVA  475

Query  184  DFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            DFGLVRLAPEG  SIET+IAGTFGYLAPEYA
Sbjct  476  DFGLVRLAPEGAQSIETKIAGTFGYLAPEYA  506



>gb|EPS64046.1| hypothetical protein M569_10735 [Genlisea aurea]
Length=949

 Score =   176 bits (445),  Expect = 3e-47, Method: Composition-based stats.
 Identities = 80/91 (88%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  4    LFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKVA  183
            LFNW EEGL PLEW KRLTIALDVARGVEYLH LA QSFIHRDLKPSNILLGDDMRAKVA
Sbjct  680  LFNWKEEGLMPLEWMKRLTIALDVARGVEYLHGLAQQSFIHRDLKPSNILLGDDMRAKVA  739

Query  184  DFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            DFGLVRLAP+GK S+ T++AGTFGYLAPEYA
Sbjct  740  DFGLVRLAPDGKASVATKLAGTFGYLAPEYA  770



>ref|XP_010668632.1| PREDICTED: probable receptor protein kinase TMK1 [Beta vulgaris 
subsp. vulgaris]
Length=943

 Score =   174 bits (441),  Expect = 9e-47, Method: Composition-based stats.
 Identities = 80/93 (86%), Positives = 88/93 (95%), Gaps = 1/93 (1%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            ++F+W EE LKPL+W +RLTIALDVARGVEYLH+LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  675  YIFDWQEEKLKPLKWNQRLTIALDVARGVEYLHSLAHQSFIHRDLKPSNILLGDDMRAKV  734

Query  181  ADFGLVRLAPE-GKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAP+ GK SIETR+AGTFGYLAPEYA
Sbjct  735  ADFGLVRLAPDGGKTSIETRLAGTFGYLAPEYA  767



>ref|XP_010936890.1| PREDICTED: probable receptor protein kinase TMK1 [Elaeis guineensis]
Length=958

 Score =   174 bits (441),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 80/92 (87%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLFNW EEGLKPLEW KRL+IALDVARGVEYLH+LAHQSFIHRDLKPSNILLGDDM+AKV
Sbjct  691  HLFNWKEEGLKPLEWKKRLSIALDVARGVEYLHSLAHQSFIHRDLKPSNILLGDDMKAKV  750

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            +DFGLVRLA    GSIET++AGTFGYLAPEYA
Sbjct  751  SDFGLVRLADGKGGSIETKLAGTFGYLAPEYA  782



>ref|XP_009138625.1| PREDICTED: probable receptor protein kinase TMK1 [Brassica rapa]
Length=410

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/90 (88%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = +1

Query  7    FNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKVAD  186
            F+W EE  KPL+WT+RL I+LDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV+D
Sbjct  138  FHWKEEERKPLDWTRRLAISLDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKVSD  197

Query  187  FGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            FGLVRLAPEGK SIETR+AGTFGYLAPEYA
Sbjct  198  FGLVRLAPEGKYSIETRVAGTFGYLAPEYA  227



>ref|XP_004503323.1| PREDICTED: probable receptor protein kinase TMK1-like [Cicer 
arietinum]
Length=890

 Score =   173 bits (439),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 76/93 (82%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLFNW EEG KPLEW  RL+IALDVARGVEYLH L  Q+FIHRDLKPSNILLGDDMRAKV
Sbjct  651  HLFNWKEEGTKPLEWKTRLSIALDVARGVEYLHGLTQQTFIHRDLKPSNILLGDDMRAKV  710

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            +DFGLVRLAPEGK S +T++AGTFGY+APEYA 
Sbjct  711  SDFGLVRLAPEGKASFQTKLAGTFGYMAPEYAA  743



>ref|XP_009103048.1| PREDICTED: probable receptor protein kinase TMK1 [Brassica rapa]
Length=891

 Score =   173 bits (439),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 78/92 (85%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLFNW EEGL+ LEW++RL IA DVA+GVEYLH+ AHQSFIHRDLKPSNILLGDDMRA+V
Sbjct  637  HLFNWQEEGLQLLEWSRRLIIASDVAKGVEYLHSQAHQSFIHRDLKPSNILLGDDMRARV  696

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEG  SIET+IAGTFGYLAPEYA
Sbjct  697  ADFGLVRLAPEGTQSIETKIAGTFGYLAPEYA  728



>ref|XP_003529231.1| PREDICTED: probable receptor protein kinase TMK1-like [Glycine 
max]
Length=932

 Score =   173 bits (439),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 78/92 (85%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W EEGL PLEW +RL+IALDVARGVEYLH LA Q FIHRD+KPSNILLGDDMRAKV
Sbjct  664  HLFEWKEEGLLPLEWKRRLSIALDVARGVEYLHGLAQQIFIHRDIKPSNILLGDDMRAKV  723

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            +DFGLVRLAPEGK S ETR+AGTFGYLAPEYA
Sbjct  724  SDFGLVRLAPEGKASFETRLAGTFGYLAPEYA  755



>gb|EYU30155.1| hypothetical protein MIMGU_mgv1a001033mg [Erythranthe guttata]
Length=907

 Score =   173 bits (439),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 81/91 (89%), Positives = 85/91 (93%), Gaps = 1/91 (1%)
 Frame = +1

Query  4    LFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKVA  183
            LFNW EEGLKPLEWTKRLT+ALDVARGVEYLH LA QSFIHRDLKPSNILLGDDMRAKVA
Sbjct  641  LFNWKEEGLKPLEWTKRLTVALDVARGVEYLHGLAQQSFIHRDLKPSNILLGDDMRAKVA  700

Query  184  DFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            DFGLVRLA +G+ SI TR+AGTFGYLAPEYA
Sbjct  701  DFGLVRLA-DGQASIATRLAGTFGYLAPEYA  730



>ref|XP_009414792.1| PREDICTED: probable receptor protein kinase TMK1 [Musa acuminata 
subsp. malaccensis]
Length=955

 Score =   173 bits (439),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 81/93 (87%), Positives = 87/93 (94%), Gaps = 1/93 (1%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W E G KPLEW KRL+IALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDM+AKV
Sbjct  686  HLFDWKEGGQKPLEWKKRLSIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMKAKV  745

Query  181  ADFGLVRLAPEGKG-SIETRIAGTFGYLAPEYA  276
            ADFGLVRLAP+GKG S+ETRIAGTFGYLAPEYA
Sbjct  746  ADFGLVRLAPDGKGCSVETRIAGTFGYLAPEYA  778



>gb|KHM99461.1| Putative receptor protein kinase TMK1 [Glycine soja]
Length=904

 Score =   173 bits (438),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 78/92 (85%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W EEGL PLEW +RL+IALDVARGVEYLH LA Q FIHRD+KPSNILLGDDMRAKV
Sbjct  636  HLFEWKEEGLLPLEWKRRLSIALDVARGVEYLHGLAQQIFIHRDIKPSNILLGDDMRAKV  695

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            +DFGLVRLAPEGK S ETR+AGTFGYLAPEYA
Sbjct  696  SDFGLVRLAPEGKASFETRLAGTFGYLAPEYA  727



>ref|XP_007034191.1| Leucine-rich repeat protein kinase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY05117.1| Leucine-rich repeat protein kinase family protein isoform 2 [Theobroma 
cacao]
Length=753

 Score =   171 bits (433),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 77/93 (83%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W E G  PL W +R+TIALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  660  HLFEWQENGYAPLTWKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  719

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ APEGK S+ETR+AGTFGYLAPEYAG
Sbjct  720  ADFGLVKNAPEGKYSVETRLAGTFGYLAPEYAG  752



>ref|XP_010939998.1| PREDICTED: probable receptor protein kinase TMK1 [Elaeis guineensis]
Length=955

 Score =   172 bits (437),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 79/92 (86%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W EEGLKPLEW KRL+IALDVARGVEYLH+LAHQSFIHRDLKPSNILLGDDM+AKV
Sbjct  689  HLFDWKEEGLKPLEWKKRLSIALDVARGVEYLHSLAHQSFIHRDLKPSNILLGDDMKAKV  748

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLA    GS+ET++AGTFGYLAPEYA
Sbjct  749  ADFGLVRLADGKGGSVETKLAGTFGYLAPEYA  780



>ref|XP_007153205.1| hypothetical protein PHAVU_003G015800g [Phaseolus vulgaris]
 gb|ESW25199.1| hypothetical protein PHAVU_003G015800g [Phaseolus vulgaris]
Length=929

 Score =   172 bits (437),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 76/92 (83%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W EEG++PL+W +RL+IALDVARGVEYLH LA Q FIHRDLKPSNILLGDDMRAKV
Sbjct  661  HLFDWKEEGIQPLDWKRRLSIALDVARGVEYLHGLAQQIFIHRDLKPSNILLGDDMRAKV  720

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            +DFGLVRLAPEG+ S ETR+AGTFGYLAPEYA
Sbjct  721  SDFGLVRLAPEGQTSFETRLAGTFGYLAPEYA  752



>emb|CDP05529.1| unnamed protein product [Coffea canephora]
Length=1066

 Score =   173 bits (438),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 77/92 (84%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W +E LKPLEW +RLT+ALDVARGVEYLH LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  802  HLFSWKDEQLKPLEWKQRLTVALDVARGVEYLHGLAQQSFIHRDLKPSNILLGDDMRAKV  861

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRL PEGK ++ TR+AGTFGYLAPEYA
Sbjct  862  ADFGLVRLVPEGKATVVTRLAGTFGYLAPEYA  893



>gb|ABV30768.1| kinase-like protein, partial [Prunus cerasus var. caproniana]
 gb|ABV54824.1| kinase-like protein [Prunus serrulata]
Length=153

 Score =   160 bits (404),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLFNW E+GLKPLEWT+RLTIALDVARGVEYLH LA+Q+FIHRDLKPSNILLGDDMRAKV
Sbjct  70   HLFNWKEDGLKPLEWTRRLTIALDVARGVEYLHGLANQTFIHRDLKPSNILLGDDMRAKV  129

Query  181  ADFGLVRLAPEGKGSIETRIAGTF  252
            +DFGLVRLAPEGK SIETR+AGTF
Sbjct  130  SDFGLVRLAPEGKASIETRLAGTF  153



>ref|XP_009408496.1| PREDICTED: probable receptor protein kinase TMK1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009408504.1| PREDICTED: probable receptor protein kinase TMK1 [Musa acuminata 
subsp. malaccensis]
Length=929

 Score =   172 bits (435),  Expect = 5e-46, Method: Composition-based stats.
 Identities = 79/93 (85%), Positives = 86/93 (92%), Gaps = 1/93 (1%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W E GLKPLEW KRL+IALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDM+AKV
Sbjct  661  HLFEWKESGLKPLEWKKRLSIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMKAKV  720

Query  181  ADFGLVRLAPEGKG-SIETRIAGTFGYLAPEYA  276
            ADFGLVRLAP+ KG S++TR+AGTFGYLAPEYA
Sbjct  721  ADFGLVRLAPDEKGCSVQTRVAGTFGYLAPEYA  753



>ref|XP_009794480.1| PREDICTED: probable receptor protein kinase TMK1 isoform X2 [Nicotiana 
sylvestris]
Length=704

 Score =   169 bits (429),  Expect = 7e-46, Method: Composition-based stats.
 Identities = 77/93 (83%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W E G KPL W +R+TIALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  442  HLFEWQEFGYKPLTWKERVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  501

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLVR AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  502  ADFGLVRNAPDGKYSVETRLAGTFGYLAPEYAA  534



>ref|XP_009630216.1| PREDICTED: probable receptor protein kinase TMK1 [Nicotiana tomentosiformis]
Length=700

 Score =   169 bits (429),  Expect = 7e-46, Method: Composition-based stats.
 Identities = 77/93 (83%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W E G KPL W +R+TIALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  438  HLFEWKELGYKPLTWKERVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  497

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLVR AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  498  ADFGLVRNAPDGKYSVETRLAGTFGYLAPEYAA  530



>ref|XP_008358283.1| PREDICTED: probable receptor protein kinase TMK1 [Malus domestica]
Length=925

 Score =   171 bits (433),  Expect = 8e-46, Method: Composition-based stats.
 Identities = 78/93 (84%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            +LFNW EEGLKPLEWT+RLTIALDVARGVEYLH LA Q+FIHRDLKPSNILLGD MRAKV
Sbjct  753  YLFNWKEEGLKPLEWTRRLTIALDVARGVEYLHGLASQTFIHRDLKPSNILLGDXMRAKV  812

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            +DFGLVRL PEG  SI T +AGTFGYLAPEYA 
Sbjct  813  SDFGLVRLXPEGXASIATGLAGTFGYLAPEYAA  845



>ref|XP_008795408.1| PREDICTED: probable receptor protein kinase TMK1 [Phoenix dactylifera]
Length=919

 Score =   171 bits (433),  Expect = 9e-46, Method: Composition-based stats.
 Identities = 79/92 (86%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W E  LKPLEW KRLTIALDVARGVEYLH+LA+Q+FIHRDLKPSNILLGD+MRAKV
Sbjct  658  HLFDWMELELKPLEWKKRLTIALDVARGVEYLHSLANQTFIHRDLKPSNILLGDNMRAKV  717

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPE   SIETR+AGTFGYLAPEYA
Sbjct  718  ADFGLVRLAPEDNRSIETRLAGTFGYLAPEYA  749



>ref|XP_008381802.1| PREDICTED: probable receptor protein kinase TMK1 [Malus domestica]
Length=971

 Score =   171 bits (433),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 78/93 (84%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            +LFNW EEGLKPLEWT+RLTIALDVARGVEYLH LA Q+FIHRDLKPSNILLGD MRAKV
Sbjct  701  YLFNWKEEGLKPLEWTRRLTIALDVARGVEYLHGLAXQTFIHRDLKPSNILLGDXMRAKV  760

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            +DFGLVRL PEG  SI T +AGTFGYLAPEYA 
Sbjct  761  SDFGLVRLXPEGXASIXTXLAGTFGYLAPEYAA  793



>ref|XP_010097979.1| putative receptor protein kinase TMK1 [Morus notabilis]
 gb|EXB73709.1| putative receptor protein kinase TMK1 [Morus notabilis]
Length=925

 Score =   170 bits (431),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 76/93 (82%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W E GL PL W +R+TIALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  664  HLFDWRENGLSPLTWKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  723

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  724  ADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAA  756



>gb|ABV30679.1| kinase-like protein [Prunus avium]
 gb|ABV30770.1| kinase-like protein, partial [Prunus cerasus var. caproniana]
Length=153

 Score =   158 bits (399),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/84 (88%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W E+GLKPLEWT+RLTIALDVARGVEYLH LA+Q+FIHRDLKPSNILLGDDMRAKV
Sbjct  70   HLFDWKEDGLKPLEWTRRLTIALDVARGVEYLHGLANQTFIHRDLKPSNILLGDDMRAKV  129

Query  181  ADFGLVRLAPEGKGSIETRIAGTF  252
            +DFGLVRLAPEGK SIETR+AGTF
Sbjct  130  SDFGLVRLAPEGKASIETRLAGTF  153



>ref|XP_004247890.2| PREDICTED: probable receptor protein kinase TMK1 [Solanum lycopersicum]
Length=929

 Score =   170 bits (430),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 77/93 (83%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W E G KPL W +R+TIALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  666  HLFEWQELGYKPLTWKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  725

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLVR AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  726  ADFGLVRNAPDGKYSVETRLAGTFGYLAPEYAA  758



>ref|XP_008458146.1| PREDICTED: probable receptor protein kinase TMK1 [Cucumis melo]
Length=933

 Score =   170 bits (430),  Expect = 3e-45, Method: Composition-based stats.
 Identities = 76/93 (82%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W E G  PL W +R+TIALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  670  HLFDWQENGYPPLTWKQRITIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  729

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLVR AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  730  ADFGLVRNAPDGKYSVETRLAGTFGYLAPEYAA  762



>ref|XP_009794479.1| PREDICTED: probable receptor protein kinase TMK1 isoform X1 [Nicotiana 
sylvestris]
Length=934

 Score =   169 bits (429),  Expect = 3e-45, Method: Composition-based stats.
 Identities = 77/93 (83%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W E G KPL W +R+TIALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  672  HLFEWQEFGYKPLTWKERVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  731

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLVR AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  732  ADFGLVRNAPDGKYSVETRLAGTFGYLAPEYAA  764



>ref|XP_006448115.1| hypothetical protein CICLE_v10017453mg, partial [Citrus clementina]
 gb|ESR61355.1| hypothetical protein CICLE_v10017453mg, partial [Citrus clementina]
Length=616

 Score =   167 bits (423),  Expect = 4e-45, Method: Composition-based stats.
 Identities = 77/92 (84%), Positives = 83/92 (90%), Gaps = 1/92 (1%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLFNW +EGLKPLEW++RL IALDVARG+EYLH LAH+SFIHRDLKPSNILL  D+RAKV
Sbjct  407  HLFNWKDEGLKPLEWSRRLIIALDVARGIEYLHGLAHESFIHRDLKPSNILLDHDIRAKV  466

Query  181  ADFGLVRLAPE-GKGSIETRIAGTFGYLAPEY  273
            ADFGL RLAPE GK S ETRIAGTFGYLAPEY
Sbjct  467  ADFGLARLAPENGKHSTETRIAGTFGYLAPEY  498



>ref|XP_002520629.1| Protein kinase APK1A, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF41765.1| Protein kinase APK1A, chloroplast precursor, putative [Ricinus 
communis]
Length=363

 Score =   163 bits (412),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W E G  PL W +R+TIALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  107  HLFEWQEHGYSPLAWKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  166

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVR AP+GK S+ETR+AGTFGYLAPEYA
Sbjct  167  ADFGLVRNAPDGKYSVETRLAGTFGYLAPEYA  198



>ref|XP_003631009.1| Kinase-like protein [Medicago truncatula]
 gb|AET05485.1| LRR receptor-like kinase [Medicago truncatula]
Length=925

 Score =   169 bits (428),  Expect = 5e-45, Method: Composition-based stats.
 Identities = 73/92 (79%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W EEG+KPLEW  RL+IALDVARG+EYLH L  Q FIHRD+KPSNILLG+DMRAKV
Sbjct  663  HLFDWKEEGIKPLEWKTRLSIALDVARGIEYLHGLTQQIFIHRDIKPSNILLGEDMRAKV  722

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            +DFGLVRLAPEGK S +TR+AGTFGY+APEYA
Sbjct  723  SDFGLVRLAPEGKASFQTRLAGTFGYMAPEYA  754



>gb|KJB71981.1| hypothetical protein B456_011G151900 [Gossypium raimondii]
Length=864

 Score =   169 bits (427),  Expect = 5e-45, Method: Composition-based stats.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W E G  PL W +R+TIALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  602  HLFEWRENGYAPLTWKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  661

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ APEGK S+ETR+AGTFGYLAPEYA 
Sbjct  662  ADFGLVKNAPEGKYSVETRLAGTFGYLAPEYAA  694



>gb|KHN16510.1| Putative receptor protein kinase TMK1 [Glycine soja]
Length=897

 Score =   169 bits (427),  Expect = 5e-45, Method: Composition-based stats.
 Identities = 76/93 (82%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HL NW  EGLKPLEW  RL IALDVARGVEYLH LA Q FIHRDLKPSNILLGDDMRAKV
Sbjct  644  HLINWKSEGLKPLEWKTRLGIALDVARGVEYLHGLAQQIFIHRDLKPSNILLGDDMRAKV  703

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            +DFGLVRLAPEGK S +T++AGTFGY+APEYA 
Sbjct  704  SDFGLVRLAPEGKTSFQTKLAGTFGYMAPEYAA  736



>ref|XP_003532526.1| PREDICTED: probable receptor protein kinase TMK1-like [Glycine 
max]
Length=897

 Score =   169 bits (427),  Expect = 5e-45, Method: Composition-based stats.
 Identities = 76/93 (82%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HL NW  EGLKPLEW  RL IALDVARGVEYLH LA Q FIHRDLKPSNILLGDDMRAKV
Sbjct  644  HLINWKSEGLKPLEWKTRLGIALDVARGVEYLHGLAQQIFIHRDLKPSNILLGDDMRAKV  703

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            +DFGLVRLAPEGK S +T++AGTFGY+APEYA 
Sbjct  704  SDFGLVRLAPEGKTSFQTKLAGTFGYMAPEYAA  736



>ref|XP_007034190.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY05116.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
Length=922

 Score =   169 bits (427),  Expect = 5e-45, Method: Composition-based stats.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W E G  PL W +R+TIALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  660  HLFEWQENGYAPLTWKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  719

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ APEGK S+ETR+AGTFGYLAPEYA 
Sbjct  720  ADFGLVKNAPEGKYSVETRLAGTFGYLAPEYAA  752



>ref|XP_004498720.1| PREDICTED: probable receptor protein kinase TMK1-like [Cicer 
arietinum]
Length=924

 Score =   169 bits (427),  Expect = 6e-45, Method: Composition-based stats.
 Identities = 75/92 (82%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W ++GL+PL W +RL+IALDVARGVEYLH LA Q FIHRDLKPSNILLGDDMRAKV
Sbjct  655  HLFEWKDDGLEPLGWKRRLSIALDVARGVEYLHGLAQQIFIHRDLKPSNILLGDDMRAKV  714

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            +DFGLVRLAPEG+ S ETR+AGTFGYLAPEYA
Sbjct  715  SDFGLVRLAPEGQASFETRLAGTFGYLAPEYA  746



>gb|KEH40666.1| receptor kinase TMK1-like protein [Medicago truncatula]
Length=933

 Score =   169 bits (427),  Expect = 6e-45, Method: Composition-based stats.
 Identities = 74/92 (80%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W ++GLKPL W +RL+IALDVARGVEYLH LA Q FIHRDLKPSNILLGDDMRAKV
Sbjct  664  HLFDWKDDGLKPLGWKRRLSIALDVARGVEYLHGLAQQIFIHRDLKPSNILLGDDMRAKV  723

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEG+ S +T++AGTFGY+APEYA
Sbjct  724  ADFGLVRLAPEGQASFQTKLAGTFGYMAPEYA  755



>ref|XP_008798481.1| PREDICTED: probable receptor protein kinase TMK1 [Phoenix dactylifera]
Length=956

 Score =   169 bits (427),  Expect = 6e-45, Method: Composition-based stats.
 Identities = 79/93 (85%), Positives = 89/93 (96%), Gaps = 2/93 (2%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W EEGLKPLEW KRL++ALDVARGVEYLH+LAHQSFIHRDLKPSNILLGDDM+AKV
Sbjct  689  HLFSWKEEGLKPLEWKKRLSLALDVARGVEYLHSLAHQSFIHRDLKPSNILLGDDMKAKV  748

Query  181  ADFGLVRLAPEGKG-SIETRIAGTFGYLAPEYA  276
            +DFGLVRLA +GKG S+ET++AGTFGYLAPEYA
Sbjct  749  SDFGLVRLA-DGKGASVETKLAGTFGYLAPEYA  780



>gb|KJB71982.1| hypothetical protein B456_011G151900 [Gossypium raimondii]
Length=920

 Score =   169 bits (427),  Expect = 7e-45, Method: Composition-based stats.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W E G  PL W +R+TIALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  658  HLFEWRENGYAPLTWKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  717

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ APEGK S+ETR+AGTFGYLAPEYA 
Sbjct  718  ADFGLVKNAPEGKYSVETRLAGTFGYLAPEYAA  750



>ref|XP_010906324.1| PREDICTED: probable receptor protein kinase TMK1 [Elaeis guineensis]
Length=889

 Score =   168 bits (426),  Expect = 7e-45, Method: Composition-based stats.
 Identities = 77/92 (84%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W +  LKPLEW KRLTIALDVARGVEYLH+LA+Q+FIHRDLKPSNILLGD+MRAKV
Sbjct  624  HLFDWLKLQLKPLEWKKRLTIALDVARGVEYLHSLANQTFIHRDLKPSNILLGDNMRAKV  683

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRL PE   SIETR+AGTFGYLAPEYA
Sbjct  684  ADFGLVRLVPEDNHSIETRLAGTFGYLAPEYA  715



>dbj|BAF01330.1| putative receptor-like kinase [Arabidopsis thaliana]
Length=273

 Score =   160 bits (404),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W+E G  PL W +R++IALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  9    HLFEWSELGYSPLTWKQRVSIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  68

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  69   ADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAA  101



>ref|XP_009343822.1| PREDICTED: probable receptor protein kinase TMK1 [Pyrus x bretschneideri]
Length=925

 Score =   167 bits (424),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 75/93 (81%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W E G+ PL W +R+TIALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  663  HLFEWRETGVPPLTWKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  722

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  723  ADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAA  755



>ref|XP_010023612.1| PREDICTED: probable receptor protein kinase TMK1 [Eucalyptus 
grandis]
 gb|KCW59921.1| hypothetical protein EUGRSUZ_H02645 [Eucalyptus grandis]
Length=923

 Score =   167 bits (424),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 75/93 (81%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W E+G  PL W +R+TIALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  661  HLFEWQEKGYAPLTWKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  720

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  721  ADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAA  753



>gb|KDP32592.1| hypothetical protein JCGZ_13142 [Jatropha curcas]
Length=917

 Score =   167 bits (424),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 75/93 (81%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W E G  PL W +R+TIALDVARGVEYLH+LA QSFIHRDLKP+NILLGDDMRAKV
Sbjct  655  HLFEWQEHGYPPLTWKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPTNILLGDDMRAKV  714

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLVR AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  715  ADFGLVRNAPDGKYSVETRLAGTFGYLAPEYAA  747



>ref|XP_006360918.1| PREDICTED: probable receptor protein kinase TMK1-like [Solanum 
tuberosum]
Length=932

 Score =   167 bits (423),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W E G KPL W +R+TIALDVARGVEYLH+LA QSFIHRDLKP NILLGDDMRAKV
Sbjct  669  HLFEWQELGYKPLTWKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPLNILLGDDMRAKV  728

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLVR AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  729  ADFGLVRNAPDGKYSVETRLAGTFGYLAPEYAA  761



>ref|XP_008222737.1| PREDICTED: probable receptor protein kinase TMK1 [Prunus mume]
Length=924

 Score =   167 bits (423),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 75/93 (81%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W E G+ PL W +R+TIALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  662  HLFDWREIGVPPLTWKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  721

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  722  ADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAA  754



>gb|KHN24033.1| Putative receptor protein kinase TMK1 [Glycine soja]
Length=815

 Score =   166 bits (421),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 74/93 (80%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W E G  PL W +R+ IALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  554  HLFDWGENGCAPLTWKQRVAIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  613

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  614  ADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAA  646



>ref|XP_007221303.1| hypothetical protein PRUPE_ppa001041mg [Prunus persica]
 gb|EMJ22502.1| hypothetical protein PRUPE_ppa001041mg [Prunus persica]
Length=925

 Score =   167 bits (423),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 75/93 (81%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W E G+ PL W +R+TIALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  663  HLFDWREIGVPPLTWKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  722

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  723  ADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAA  755



>ref|XP_004162388.1| PREDICTED: LOW QUALITY PROTEIN: probable receptor protein kinase 
TMK1-like [Cucumis sativus]
Length=930

 Score =   167 bits (423),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 75/93 (81%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W E G  PL W +R+TIALDVARGVEYLH+LA QSFIHRDLKPSNILL DDMRAKV
Sbjct  667  HLFDWQENGYPPLTWKQRITIALDVARGVEYLHSLAQQSFIHRDLKPSNILLSDDMRAKV  726

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLVR AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  727  ADFGLVRNAPDGKYSVETRLAGTFGYLAPEYAA  759



>ref|XP_004140603.1| PREDICTED: probable receptor protein kinase TMK1-like [Cucumis 
sativus]
 gb|KGN46582.1| hypothetical protein Csa_6G109770 [Cucumis sativus]
Length=930

 Score =   167 bits (423),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 75/93 (81%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W E G  PL W +R+TIALDVARGVEYLH+LA QSFIHRDLKPSNILL DDMRAKV
Sbjct  667  HLFDWQENGYPPLTWKQRITIALDVARGVEYLHSLAQQSFIHRDLKPSNILLSDDMRAKV  726

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLVR AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  727  ADFGLVRNAPDGKYSVETRLAGTFGYLAPEYAA  759



>gb|KHN44469.1| Putative receptor protein kinase TMK1 [Glycine soja]
Length=892

 Score =   166 bits (421),  Expect = 3e-44, Method: Composition-based stats.
 Identities = 74/93 (80%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W E G  PL W +R+ IALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  631  HLFDWGENGCAPLTWKQRVAIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  690

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  691  ADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAA  723



>ref|XP_007160467.1| hypothetical protein PHAVU_002G324600g [Phaseolus vulgaris]
 gb|ESW32461.1| hypothetical protein PHAVU_002G324600g [Phaseolus vulgaris]
Length=918

 Score =   167 bits (422),  Expect = 3e-44, Method: Composition-based stats.
 Identities = 75/93 (81%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HL +W E GLKPLEW  RL+IALDVARGVEYLH LA Q FIHRDLKPSNILLGDDM AKV
Sbjct  659  HLVDWKEAGLKPLEWKTRLSIALDVARGVEYLHGLAQQIFIHRDLKPSNILLGDDMHAKV  718

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            +DFGLVRLAPEGK S +TR+AGTFGY+APEYA 
Sbjct  719  SDFGLVRLAPEGKTSFQTRLAGTFGYMAPEYAA  751



>ref|XP_009373574.1| PREDICTED: probable receptor protein kinase TMK1 [Pyrus x bretschneideri]
Length=924

 Score =   167 bits (422),  Expect = 3e-44, Method: Composition-based stats.
 Identities = 75/93 (81%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W E G+ PL W +R+TIALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  663  HLFEWREIGVPPLTWKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  722

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  723  ADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAA  755



>ref|XP_008380457.1| PREDICTED: probable receptor protein kinase TMK1 [Malus domestica]
Length=924

 Score =   167 bits (422),  Expect = 3e-44, Method: Composition-based stats.
 Identities = 75/93 (81%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W E G+ PL W +R+TIALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  663  HLFEWREIGVPPLTWKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  722

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  723  ADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAA  755



>gb|EPS72320.1| hypothetical protein M569_02431, partial [Genlisea aurea]
Length=898

 Score =   166 bits (421),  Expect = 4e-44, Method: Composition-based stats.
 Identities = 74/93 (80%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W+E G +PL W +R+TIALDVARGVEYLH+LA QSFIHRDLKPSNILL DDMRAKV
Sbjct  638  HLFEWSENGYQPLSWKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILLTDDMRAKV  697

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  698  ADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAA  730



>ref|XP_008787910.1| PREDICTED: probable receptor protein kinase TMK1 [Phoenix dactylifera]
Length=955

 Score =   167 bits (422),  Expect = 4e-44, Method: Composition-based stats.
 Identities = 78/92 (85%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W E GLKPLEW KRL+IALDVARGVEYLH LAHQSFIHRDLKPSNILLGDDM+AKV
Sbjct  689  HLFEWREGGLKPLEWKKRLSIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMKAKV  748

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLA    GS+ET++AGTFGYLAPEYA
Sbjct  749  ADFGLVRLADGKGGSVETKLAGTFGYLAPEYA  780



>ref|XP_003537524.1| PREDICTED: probable receptor protein kinase TMK1-like [Glycine 
max]
Length=927

 Score =   166 bits (421),  Expect = 4e-44, Method: Composition-based stats.
 Identities = 74/93 (80%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W E G  PL W +R+ IALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  666  HLFDWGENGCAPLTWKQRVAIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  725

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  726  ADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAA  758



>ref|XP_006601886.1| PREDICTED: probable receptor protein kinase TMK1-like [Glycine 
max]
Length=928

 Score =   166 bits (421),  Expect = 4e-44, Method: Composition-based stats.
 Identities = 74/93 (80%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W E G  PL W +R+ IALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  667  HLFDWGENGCAPLTWKQRVAIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  726

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  727  ADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAA  759



>ref|XP_004502257.1| PREDICTED: probable receptor protein kinase TMK1-like [Cicer 
arietinum]
Length=933

 Score =   166 bits (421),  Expect = 4e-44, Method: Composition-based stats.
 Identities = 74/93 (80%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W E G  PL W +R+ IALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  671  HLFDWGENGCAPLTWKQRVAIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  730

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  731  ADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAA  763



>emb|CBI39413.3| unnamed protein product [Vitis vinifera]
Length=897

 Score =   166 bits (420),  Expect = 5e-44, Method: Composition-based stats.
 Identities = 74/93 (80%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W E G  PL W +R+TIALDV RGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  635  HLFDWRENGYPPLTWKQRVTIALDVGRGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  694

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  695  ADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAA  727



>gb|KHG03733.1| putative receptor protein kinase TMK1 [Gossypium arboreum]
Length=920

 Score =   166 bits (421),  Expect = 5e-44, Method: Composition-based stats.
 Identities = 75/93 (81%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W E G  P  W +R TIALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  658  HLFEWRENGYAPFTWKQRATIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  717

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ APEGK S+ETR+AGTFGYLAPEYA 
Sbjct  718  ADFGLVKNAPEGKYSVETRLAGTFGYLAPEYAA  750



>ref|XP_003601704.1| Receptor-like kinase [Medicago truncatula]
 gb|AES71955.1| LRR receptor-like kinase [Medicago truncatula]
Length=933

 Score =   166 bits (421),  Expect = 5e-44, Method: Composition-based stats.
 Identities = 74/93 (80%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W E G  PL W +R+ IALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  671  HLFDWGENGCAPLTWLQRVAIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  730

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  731  ADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAA  763



>emb|CAN69461.1| hypothetical protein VITISV_043132 [Vitis vinifera]
Length=921

 Score =   166 bits (420),  Expect = 5e-44, Method: Composition-based stats.
 Identities = 74/93 (80%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W E G  PL W +R+TIALDV RGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  659  HLFDWRENGYPPLTWKQRVTIALDVGRGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  718

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  719  ADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAA  751



>ref|XP_011101591.1| PREDICTED: probable receptor protein kinase TMK1 [Sesamum indicum]
Length=931

 Score =   166 bits (421),  Expect = 5e-44, Method: Composition-based stats.
 Identities = 74/93 (80%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W E G +PL W +R+TIALDVARGVEYLH+LA QSFIHRDLKPSNILL DDMRAKV
Sbjct  669  HLFEWQEHGYQPLSWKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILLSDDMRAKV  728

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  729  ADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAA  761



>ref|XP_010650399.1| PREDICTED: probable receptor protein kinase TMK1 [Vitis vinifera]
Length=927

 Score =   166 bits (420),  Expect = 5e-44, Method: Composition-based stats.
 Identities = 74/93 (80%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W E G  PL W +R+TIALDV RGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  665  HLFDWRENGYPPLTWKQRVTIALDVGRGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  724

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  725  ADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAA  757



>ref|XP_006830550.1| hypothetical protein AMTR_s00117p00096300 [Amborella trichopoda]
 gb|ERM97966.1| hypothetical protein AMTR_s00117p00096300 [Amborella trichopoda]
Length=922

 Score =   166 bits (420),  Expect = 6e-44, Method: Composition-based stats.
 Identities = 73/92 (79%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF++A+ G  PL W +RLTIALDVARGVEYLH+LA +SFIHRDLKPSN+LLGDDMRAKV
Sbjct  664  HLFDYAQNGYPPLSWKQRLTIALDVARGVEYLHSLAQKSFIHRDLKPSNVLLGDDMRAKV  723

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            +DFGLV+LAP+GK S+ETR+AGTFGYLAPEYA
Sbjct  724  SDFGLVKLAPDGKYSVETRLAGTFGYLAPEYA  755



>gb|KDO47459.1| hypothetical protein CISIN_1g0023461mg, partial [Citrus sinensis]
 gb|KDO47460.1| hypothetical protein CISIN_1g0023461mg, partial [Citrus sinensis]
Length=760

 Score =   165 bits (417),  Expect = 6e-44, Method: Composition-based stats.
 Identities = 73/92 (79%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W + G  PL W +R+TIALDVARGVEYLH+LA QSFIHRDLKPSNIL+GDDMRAKV
Sbjct  669  HLFEWHDHGYTPLTWKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILIGDDMRAKV  728

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLV+ AP+GK S+ETR+AGTFGYLAPEYA
Sbjct  729  ADFGLVKNAPDGKYSVETRLAGTFGYLAPEYA  760



>gb|KHN12355.1| Putative receptor protein kinase TMK1 [Glycine soja]
Length=693

 Score =   164 bits (415),  Expect = 6e-44, Method: Composition-based stats.
 Identities = 74/93 (80%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W E G  PL W +R+ IALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  429  HLFEWQEHGYAPLTWKQRVVIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  488

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  489  ADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAA  521



>ref|XP_007163803.1| hypothetical protein PHAVU_001G265500g [Phaseolus vulgaris]
 gb|ESW35797.1| hypothetical protein PHAVU_001G265500g [Phaseolus vulgaris]
Length=931

 Score =   166 bits (420),  Expect = 6e-44, Method: Composition-based stats.
 Identities = 74/93 (80%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W E G  PL W +R+ IALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  670  HLFDWQENGCAPLTWKQRVAIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  729

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  730  ADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAA  762



>ref|XP_010532727.1| PREDICTED: probable receptor protein kinase TMK1 [Tarenaya hassleriana]
Length=931

 Score =   166 bits (419),  Expect = 7e-44, Method: Composition-based stats.
 Identities = 75/93 (81%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W E G  PL W +R+TIALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  668  HLFEWRELGYPPLTWKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  727

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  728  ADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAA  760



>ref|NP_001236710.1| receptor-like kinase RHG4 [Glycine max]
 gb|AAM44275.1| receptor-like kinase RHG4 [Glycine max]
 gb|AAN80746.1| receptor-like kinase RHG4 [Glycine max]
Length=893

 Score =   166 bits (419),  Expect = 8e-44, Method: Composition-based stats.
 Identities = 74/93 (80%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W E+G  PL W +R+ IALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  630  HLFEWQEQGYVPLTWKQRVVIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  689

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  690  ADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAA  722



>ref|XP_011017684.1| PREDICTED: probable receptor protein kinase TMK1 [Populus euphratica]
Length=928

 Score =   166 bits (419),  Expect = 8e-44, Method: Composition-based stats.
 Identities = 75/93 (81%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W E G  PL W +R+TIALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  670  HLFEWQELGYPPLTWKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  729

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  730  ADFGLVKNAPDGKYSMETRLAGTFGYLAPEYAA  762



>ref|XP_002324686.2| hypothetical protein POPTR_0018s13780g [Populus trichocarpa]
 gb|EEF03251.2| hypothetical protein POPTR_0018s13780g [Populus trichocarpa]
Length=929

 Score =   166 bits (419),  Expect = 8e-44, Method: Composition-based stats.
 Identities = 75/93 (81%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W E G  PL W +R+TIALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  670  HLFEWQELGYPPLTWKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  729

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  730  ADFGLVKNAPDGKYSMETRLAGTFGYLAPEYAA  762



>gb|ACN59321.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
Length=928

 Score =   166 bits (419),  Expect = 8e-44, Method: Composition-based stats.
 Identities = 74/93 (80%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W+E G  PL W +R++IALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  664  HLFEWSELGYSPLTWKQRVSIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  723

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  724  ADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAA  756



>ref|NP_189017.1| leucine-rich repeat protein kinase-like protein [Arabidopsis 
thaliana]
 dbj|BAB01851.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE76809.1| leucine-rich repeat protein kinase-like protein [Arabidopsis 
thaliana]
Length=928

 Score =   166 bits (419),  Expect = 8e-44, Method: Composition-based stats.
 Identities = 74/93 (80%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W+E G  PL W +R++IALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  664  HLFEWSELGYSPLTWKQRVSIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  723

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  724  ADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAA  756



>ref|NP_001236021.1| Rhg4-like receptor kinase II precursor [Glycine max]
 gb|ABD96568.1| Rhg4-like receptor kinase II [Glycine max]
Length=921

 Score =   166 bits (419),  Expect = 9e-44, Method: Composition-based stats.
 Identities = 74/93 (80%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W E+G  PL W +R+ IALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  658  HLFEWQEQGYVPLTWKQRVVIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  717

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  718  ADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAA  750



>gb|KEH40668.1| receptor kinase TMK1-like protein, putative [Medicago truncatula]
Length=936

 Score =   165 bits (418),  Expect = 1e-43, Method: Composition-based stats.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 1/93 (1%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W ++GLKPL W  RL+IALDVARGVEYLH LA Q FIHRDLKP+NILLGDDMRAKV
Sbjct  666  HLFEWKDDGLKPLGWKSRLSIALDVARGVEYLHGLAQQIFIHRDLKPTNILLGDDMRAKV  725

Query  181  ADFGLVRLAPEGKGS-IETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEGK S I+TR AGTFGY+APEYA
Sbjct  726  ADFGLVRLAPEGKASLIQTRFAGTFGYMAPEYA  758



>gb|ACN87597.1| kinase-like protein [Corylus avellana]
 gb|ACN87598.1| kinase-like protein [Corylus avellana]
 gb|ACN87600.1| kinase-like protein [Corylus avellana]
Length=153

 Score =   153 bits (387),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLFN  EE LKPLEW +RL+IALDVARGVEYLH+LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  70   HLFNAREESLKPLEWMRRLSIALDVARGVEYLHSLAHQSFIHRDLKPSNILLGDDMRAKV  129

Query  181  ADFGLVRLAPEGKGSIETRIAGTF  252
            +DFGLVRLAPEGK S+ET++AGTF
Sbjct  130  SDFGLVRLAPEGKFSVETKLAGTF  153



>gb|EYU40639.1| hypothetical protein MIMGU_mgv1a027041mg [Erythranthe guttata]
Length=874

 Score =   165 bits (417),  Expect = 1e-43, Method: Composition-based stats.
 Identities = 72/93 (77%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W E G+ PL W +R+T+ALDVARGVEYLH+LA QSFIHRDLKPSNILLGDD+RAKV
Sbjct  625  HLFHWKEMGIPPLNWNQRVTVALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDLRAKV  684

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            +DFGLVR AP+G  S+ETR+AGTFGYLAPEYA 
Sbjct  685  SDFGLVRSAPDGNYSVETRLAGTFGYLAPEYAA  717



>dbj|BAH56604.1| receptor-like kinase [Glycine max]
Length=894

 Score =   165 bits (417),  Expect = 1e-43, Method: Composition-based stats.
 Identities = 74/93 (80%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W E G  PL W +R+ IALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  630  HLFEWQEHGYAPLTWKQRVVIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  689

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  690  ADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAA  722



>dbj|BAH56605.1| receptor-like kinase [Glycine max]
Length=894

 Score =   165 bits (417),  Expect = 1e-43, Method: Composition-based stats.
 Identities = 74/93 (80%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W E G  PL W +R+ IALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  630  HLFEWQEHGYAPLTWKQRVVIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  689

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  690  ADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAA  722



>ref|XP_008789301.1| PREDICTED: probable receptor protein kinase TMK1 [Phoenix dactylifera]
Length=930

 Score =   165 bits (418),  Expect = 1e-43, Method: Composition-based stats.
 Identities = 75/92 (82%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W + GLKPLEW +RLTIALDVARGVEYLH+LA++ FIHRDLKPSNILLGD+MRAKV
Sbjct  662  HLFDWMKAGLKPLEWKRRLTIALDVARGVEYLHSLANRCFIHRDLKPSNILLGDNMRAKV  721

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRL  EG  SIETR+AGTFGYL PEYA
Sbjct  722  ADFGLVRLVQEGNQSIETRLAGTFGYLDPEYA  753



>gb|ACM89489.1| receptor-like kinase [Glycine max]
Length=854

 Score =   164 bits (416),  Expect = 1e-43, Method: Composition-based stats.
 Identities = 74/93 (80%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W E G  PL W +R+ IALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  590  HLFEWQEHGYAPLTWKQRVVIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  649

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  650  ADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAA  682



>dbj|BAH56606.1| receptor-like kinase [Glycine max]
 dbj|BAH56607.1| receptor-like kinase [Glycine max]
Length=894

 Score =   165 bits (417),  Expect = 1e-43, Method: Composition-based stats.
 Identities = 74/93 (80%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W E G  PL W +R+ IALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  630  HLFEWQEHGYAPLTWKQRVVIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  689

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  690  ADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAA  722



>gb|ACN87601.1| kinase-like protein [Corylus avellana]
Length=153

 Score =   153 bits (387),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLFN  EE LKPLEW +RL+IALDVARGVEYLH+LAHQSFIHRDLKPSNILLGDDMRAKV
Sbjct  70   HLFNAREESLKPLEWMRRLSIALDVARGVEYLHSLAHQSFIHRDLKPSNILLGDDMRAKV  129

Query  181  ADFGLVRLAPEGKGSIETRIAGTF  252
            +DFGLVRLAPEGK S+ET++AGTF
Sbjct  130  SDFGLVRLAPEGKFSVETKLAGTF  153



>ref|XP_006296927.1| hypothetical protein CARUB_v10012920mg [Capsella rubella]
 gb|EOA29825.1| hypothetical protein CARUB_v10012920mg [Capsella rubella]
Length=932

 Score =   165 bits (417),  Expect = 1e-43, Method: Composition-based stats.
 Identities = 74/93 (80%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W E G  PL W +R++IALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  668  HLFEWRELGYSPLTWKQRVSIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  727

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  728  ADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAA  760



>gb|ADO12863.1| leucine-rich repeat receptor-like kinase [Glycine max]
Length=920

 Score =   165 bits (417),  Expect = 1e-43, Method: Composition-based stats.
 Identities = 74/93 (80%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W E G  PL W +R+ IALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  656  HLFEWQEHGYAPLTWKQRVVIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  715

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  716  ADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAA  748



>gb|ABD96565.1| Rhg4-like receptor kinase I [Glycine max]
Length=920

 Score =   165 bits (417),  Expect = 1e-43, Method: Composition-based stats.
 Identities = 74/93 (80%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W E G  PL W +R+ IALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  656  HLFEWQEHGYAPLTWKQRVVIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  715

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  716  ADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAA  748



>gb|ABD96567.1| Rhg4-like receptor kinase I [Glycine max]
Length=920

 Score =   165 bits (417),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 74/93 (80%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W E G  PL W +R+ IALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  656  HLFEWQEHGYAPLTWKQRVVIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  715

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  716  ADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAA  748



>ref|XP_006492525.1| PREDICTED: probable receptor protein kinase TMK1-like [Citrus 
sinensis]
Length=933

 Score =   165 bits (417),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 73/93 (78%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W + G  PL W +R+TIALDVARGVEYLH+LA QSFIHRDLKPSNIL+GDDMRAKV
Sbjct  669  HLFEWHDHGYTPLTWKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILIGDDMRAKV  728

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  729  ADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAA  761



>ref|XP_006421039.1| hypothetical protein CICLE_v10004263mg [Citrus clementina]
 gb|ESR34279.1| hypothetical protein CICLE_v10004263mg [Citrus clementina]
Length=933

 Score =   165 bits (417),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 73/93 (78%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W + G  PL W +R+TIALDVARGVEYLH+LA QSFIHRDLKPSNIL+GDDMRAKV
Sbjct  669  HLFEWHDHGYTPLTWKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILIGDDMRAKV  728

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  729  ADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAA  761



>ref|XP_006418841.1| hypothetical protein EUTSA_v10002394mg [Eutrema salsugineum]
 gb|ESQ37277.1| hypothetical protein EUTSA_v10002394mg [Eutrema salsugineum]
Length=931

 Score =   165 bits (417),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 74/93 (80%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W E G  PL W +R++IALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  665  HLFEWGELGYSPLTWKQRVSIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  724

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  725  ADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAA  757



>ref|XP_002883458.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59717.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=930

 Score =   164 bits (416),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 74/93 (80%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W E G  PL W +R++IALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  666  HLFEWRELGYSPLTWKQRVSIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  725

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  726  ADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAA  758



>ref|XP_010512862.1| PREDICTED: probable receptor protein kinase TMK1 [Camelina sativa]
Length=933

 Score =   164 bits (416),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 74/93 (80%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W E G  PL W +R++IALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  669  HLFEWRELGYSPLTWKQRVSIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  728

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  729  ADFGLVKNAPDGKYSLETRLAGTFGYLAPEYAA  761



>gb|KHG15618.1| putative receptor protein kinase TMK1 [Gossypium arboreum]
Length=922

 Score =   164 bits (416),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 74/93 (80%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W E G  PL W +R+TIALDVARGVEYLH+LA QSFIHRDLKP+NILL DDMRAKV
Sbjct  659  HLFEWRENGYAPLTWKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPNNILLSDDMRAKV  718

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ APEGK S+ETR+AGTFGYLAPEYA 
Sbjct  719  ADFGLVKNAPEGKYSLETRLAGTFGYLAPEYAA  751



>ref|XP_010488452.1| PREDICTED: probable receptor protein kinase TMK1 [Camelina sativa]
Length=933

 Score =   164 bits (416),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 74/93 (80%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W E G  PL W +R++IALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  669  HLFEWRELGYSPLTWKQRVSIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  728

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  729  ADFGLVKNAPDGKYSLETRLAGTFGYLAPEYAA  761



>ref|XP_008809243.1| PREDICTED: probable receptor protein kinase TMK1 [Phoenix dactylifera]
Length=942

 Score =   164 bits (416),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 73/92 (79%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W +  L+PL W KRL IALDVARG+EYLH+LAHQSFIHRDLKPSNILL DD RAKV
Sbjct  681  HLFQWKQLNLEPLSWKKRLNIALDVARGMEYLHSLAHQSFIHRDLKPSNILLSDDYRAKV  740

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLV+LAP+GK S+ TR+AGTFGYLAPEYA
Sbjct  741  ADFGLVKLAPDGKNSVATRLAGTFGYLAPEYA  772



>dbj|BAJ91186.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=630

 Score =   162 bits (410),  Expect = 3e-43, Method: Composition-based stats.
 Identities = 76/94 (81%), Positives = 85/94 (90%), Gaps = 2/94 (2%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W E  L+PLEW +RL+IALDVARGVEYLH+LA Q+FIHRDLKPSNILLGDDM+AKV
Sbjct  361  HLFEWKEHNLQPLEWKRRLSIALDVARGVEYLHSLAQQTFIHRDLKPSNILLGDDMKAKV  420

Query  181  ADFGLVRLAP-EGKG-SIETRIAGTFGYLAPEYA  276
            ADFGLVRLAP +GK  S+ETR+AGTFGYLAPEYA
Sbjct  421  ADFGLVRLAPADGKCVSVETRLAGTFGYLAPEYA  454



>emb|CDP03933.1| unnamed protein product [Coffea canephora]
Length=910

 Score =   164 bits (415),  Expect = 3e-43, Method: Composition-based stats.
 Identities = 73/93 (78%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HL +W E G  PL W +RL+IALDVARGVEYLH LA+QSFIHRDLKPSNILLGDDMRAKV
Sbjct  651  HLISWQERGTLPLTWKQRLSIALDVARGVEYLHGLANQSFIHRDLKPSNILLGDDMRAKV  710

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            +DFGLV++AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  711  SDFGLVKIAPDGKHSVETRLAGTFGYLAPEYAA  743



>ref|XP_010466732.1| PREDICTED: probable receptor protein kinase TMK1 [Camelina sativa]
Length=931

 Score =   164 bits (415),  Expect = 3e-43, Method: Composition-based stats.
 Identities = 74/93 (80%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W E G  PL W +R++IALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  667  HLFEWRELGYSPLTWKQRVSIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  726

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  727  ADFGLVKNAPDGKYSLETRLAGTFGYLAPEYAA  759



>gb|EMS59747.1| putative receptor protein kinase TMK1 [Triticum urartu]
Length=706

 Score =   162 bits (410),  Expect = 3e-43, Method: Composition-based stats.
 Identities = 76/94 (81%), Positives = 85/94 (90%), Gaps = 2/94 (2%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W E  L+PLEW +RL+IALDVARGVEYLH+LA Q+FIHRDLKPSNILLGDDM+AKV
Sbjct  437  HLFEWKEHNLQPLEWKRRLSIALDVARGVEYLHSLAQQTFIHRDLKPSNILLGDDMKAKV  496

Query  181  ADFGLVRLAP-EGKG-SIETRIAGTFGYLAPEYA  276
            ADFGLVRLAP +GK  S+ETR+AGTFGYLAPEYA
Sbjct  497  ADFGLVRLAPADGKCVSVETRLAGTFGYLAPEYA  530



>ref|XP_010246532.1| PREDICTED: probable receptor protein kinase TMK1 [Nelumbo nucifera]
Length=928

 Score =   164 bits (415),  Expect = 3e-43, Method: Composition-based stats.
 Identities = 74/93 (80%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W E G  PL W +R+TIALDVARGVEYLH+LA QSFIHRDLKPSNILLGD MRAKV
Sbjct  663  HLFEWNEHGYLPLTWKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDSMRAKV  722

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  723  ADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAA  755



>gb|EEC76074.1| hypothetical protein OsI_13294 [Oryza sativa Indica Group]
Length=844

 Score =   163 bits (413),  Expect = 3e-43, Method: Composition-based stats.
 Identities = 77/94 (82%), Positives = 85/94 (90%), Gaps = 2/94 (2%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W E  L+PLEW KRL+IALDVARGVEYLH+LA Q+FIHRDLKPSNILLGDDM+AKV
Sbjct  631  HLFEWKEHNLRPLEWKKRLSIALDVARGVEYLHSLAQQTFIHRDLKPSNILLGDDMKAKV  690

Query  181  ADFGLVRLAP-EGKG-SIETRIAGTFGYLAPEYA  276
            ADFGLVRLAP +GK  S+ETR+AGTFGYLAPEYA
Sbjct  691  ADFGLVRLAPADGKCVSVETRLAGTFGYLAPEYA  724



>gb|KJB28085.1| hypothetical protein B456_005G026700 [Gossypium raimondii]
Length=921

 Score =   164 bits (414),  Expect = 3e-43, Method: Composition-based stats.
 Identities = 74/93 (80%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W E G  PL W +R+TIALDVARGVEYLH+LA QSFIHRDLKP+NILL DDMRAKV
Sbjct  658  HLFEWRENGYAPLTWKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPNNILLTDDMRAKV  717

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ APEGK S+ETR+AGTFGYLAPEYA 
Sbjct  718  ADFGLVKNAPEGKYSLETRLAGTFGYLAPEYAA  750



>ref|XP_007162969.1| hypothetical protein PHAVU_001G195500g [Phaseolus vulgaris]
 gb|ESW34963.1| hypothetical protein PHAVU_001G195500g [Phaseolus vulgaris]
Length=942

 Score =   164 bits (414),  Expect = 4e-43, Method: Composition-based stats.
 Identities = 72/92 (78%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W   GL+PL W +RL IALDVARG+EYLHTLAHQSFIHRDLKPSNILL DD RAKV
Sbjct  682  HLFHWKSHGLEPLSWKRRLNIALDVARGMEYLHTLAHQSFIHRDLKPSNILLADDFRAKV  741

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            +DFGLV+LAP+G+ S+ TR+AGTFGYLAPEYA
Sbjct  742  SDFGLVKLAPDGEKSVVTRLAGTFGYLAPEYA  773



>ref|XP_010932521.1| PREDICTED: LOW QUALITY PROTEIN: probable receptor protein kinase 
TMK1 [Elaeis guineensis]
Length=937

 Score =   164 bits (414),  Expect = 4e-43, Method: Composition-based stats.
 Identities = 75/92 (82%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+W + GLKPLEW  RLTIALDVARGVEYLH+LA++ FIHRDLKPSNILLGD+MRAKV
Sbjct  669  HLFDWMKVGLKPLEWKTRLTIALDVARGVEYLHSLANRCFIHRDLKPSNILLGDNMRAKV  728

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRL  EG  SIET++AGTFGYLAPEYA
Sbjct  729  ADFGLVRLVHEGNHSIETKLAGTFGYLAPEYA  760



>ref|XP_002308106.1| hypothetical protein POPTR_0006s07360g [Populus trichocarpa]
 gb|EEE91629.1| hypothetical protein POPTR_0006s07360g [Populus trichocarpa]
Length=931

 Score =   164 bits (414),  Expect = 4e-43, Method: Composition-based stats.
 Identities = 74/93 (80%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W E G  PL W +R+TIALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  672  HLFEWQELGYPPLTWKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  731

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ AP+G  S+ETR+AGTFGYLAPEYA 
Sbjct  732  ADFGLVKNAPDGNYSMETRLAGTFGYLAPEYAA  764



>ref|NP_001051079.2| Os03g0717000 [Oryza sativa Japonica Group]
 dbj|BAF12993.2| Os03g0717000, partial [Oryza sativa Japonica Group]
Length=842

 Score =   163 bits (413),  Expect = 4e-43, Method: Composition-based stats.
 Identities = 77/94 (82%), Positives = 85/94 (90%), Gaps = 2/94 (2%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W E  L+PLEW KRL+IALDVARGVEYLH+LA Q+FIHRDLKPSNILLGDDM+AKV
Sbjct  573  HLFEWKEHNLRPLEWKKRLSIALDVARGVEYLHSLAQQTFIHRDLKPSNILLGDDMKAKV  632

Query  181  ADFGLVRLAP-EGKG-SIETRIAGTFGYLAPEYA  276
            ADFGLVRLAP +GK  S+ETR+AGTFGYLAPEYA
Sbjct  633  ADFGLVRLAPADGKCVSVETRLAGTFGYLAPEYA  666



>ref|XP_004981977.1| PREDICTED: probable receptor protein kinase TMK1-like [Setaria 
italica]
Length=963

 Score =   164 bits (414),  Expect = 4e-43, Method: Composition-based stats.
 Identities = 77/94 (82%), Positives = 86/94 (91%), Gaps = 2/94 (2%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W+E  L+PLEW KRL+IALDVARGVEYLH+LA Q+FIHRDLKPSNILLGDDM+AKV
Sbjct  694  HLFEWSENNLRPLEWKKRLSIALDVARGVEYLHSLAQQTFIHRDLKPSNILLGDDMKAKV  753

Query  181  ADFGLVRLAP-EGKG-SIETRIAGTFGYLAPEYA  276
            ADFGLVRLAP +GK  S+ETR+AGTFGYLAPEYA
Sbjct  754  ADFGLVRLAPADGKCVSVETRLAGTFGYLAPEYA  787



>ref|XP_008644567.1| PREDICTED: probable receptor protein kinase TMK1 [Zea mays]
 gb|AFW67806.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=958

 Score =   164 bits (414),  Expect = 5e-43, Method: Composition-based stats.
 Identities = 77/94 (82%), Positives = 87/94 (93%), Gaps = 2/94 (2%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W+E+ L+PLEW KRL+IALDVARGVEYLH+LA Q+FIHRDLKPSNILLGDDM+AKV
Sbjct  689  HLFEWSEKNLRPLEWKKRLSIALDVARGVEYLHSLAQQTFIHRDLKPSNILLGDDMKAKV  748

Query  181  ADFGLVRLAP-EGKG-SIETRIAGTFGYLAPEYA  276
            ADFGLVRLAP +GK  S+ETR+AGTFGYLAPEYA
Sbjct  749  ADFGLVRLAPADGKCVSVETRLAGTFGYLAPEYA  782



>gb|ABD96566.1| Rhg4-like receptor kinase II [Glycine max]
Length=921

 Score =   163 bits (413),  Expect = 5e-43, Method: Composition-based stats.
 Identities = 73/93 (78%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W E+G  PL W +R+ IALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  658  HLFEWQEQGYVPLTWKQRVVIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  717

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ AP+GK S+ETR+AG FGYLAPEYA 
Sbjct  718  ADFGLVKNAPDGKYSVETRLAGAFGYLAPEYAA  750



>ref|XP_002463990.1| hypothetical protein SORBIDRAFT_01g010110 [Sorghum bicolor]
 gb|EER90988.1| hypothetical protein SORBIDRAFT_01g010110 [Sorghum bicolor]
Length=963

 Score =   164 bits (414),  Expect = 5e-43, Method: Composition-based stats.
 Identities = 77/94 (82%), Positives = 86/94 (91%), Gaps = 2/94 (2%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W+E  L+PLEW KRL++ALDVARGVEYLH+LA Q+FIHRDLKPSNILLGDDM+AKV
Sbjct  694  HLFEWSENNLRPLEWKKRLSVALDVARGVEYLHSLAQQTFIHRDLKPSNILLGDDMKAKV  753

Query  181  ADFGLVRLAP-EGKG-SIETRIAGTFGYLAPEYA  276
            ADFGLVRLAP +GK  SIETR+AGTFGYLAPEYA
Sbjct  754  ADFGLVRLAPADGKCVSIETRLAGTFGYLAPEYA  787



>ref|XP_009604417.1| PREDICTED: probable receptor protein kinase TMK1 [Nicotiana tomentosiformis]
Length=927

 Score =   163 bits (413),  Expect = 5e-43, Method: Composition-based stats.
 Identities = 75/93 (81%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W E G   L W +R+TIALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  666  HLFEWQELGYPLLTWKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  725

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLVR AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  726  ADFGLVRNAPDGKYSVETRLAGTFGYLAPEYAA  758



>ref|XP_004298216.1| PREDICTED: probable receptor protein kinase TMK1 [Fragaria vesca 
subsp. vesca]
Length=919

 Score =   163 bits (413),  Expect = 5e-43, Method: Composition-based stats.
 Identities = 74/93 (80%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF+  E G+ PL W +R+TIALDVARGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  658  HLFDLRETGVTPLTWKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  717

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLV+ AP+GK S+ETR+AGTFGYLAPEYA 
Sbjct  718  ADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAA  750



>ref|XP_010673522.1| PREDICTED: probable receptor protein kinase TMK1 [Beta vulgaris 
subsp. vulgaris]
Length=922

 Score =   163 bits (413),  Expect = 5e-43, Method: Composition-based stats.
 Identities = 74/92 (80%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W E G  PL W +R+TIALDVARGVEYLH+LA  SFIHRDLKPSNILLGDDMRAKV
Sbjct  660  HLFEWQELGHSPLTWKQRVTIALDVARGVEYLHSLAQTSFIHRDLKPSNILLGDDMRAKV  719

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLV+ AP+GK S+ETR+AGTFGYLAPEYA
Sbjct  720  ADFGLVKNAPDGKYSVETRLAGTFGYLAPEYA  751



>gb|KEH40667.1| receptor-like kinase [Medicago truncatula]
Length=928

 Score =   163 bits (413),  Expect = 5e-43, Method: Composition-based stats.
 Identities = 74/92 (80%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            H+F+W ++G KPL W  RL+IALDVARGVEYLH LA Q FIHRDLKPSNILLGDDMRAKV
Sbjct  659  HIFDWKDDGSKPLGWKCRLSIALDVARGVEYLHGLAQQIFIHRDLKPSNILLGDDMRAKV  718

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYA  276
            ADFGLVRLAPEG+ S  TR+AGTFGYLAPEYA
Sbjct  719  ADFGLVRLAPEGQTSFATRLAGTFGYLAPEYA  750



>emb|CDP15110.1| unnamed protein product [Coffea canephora]
Length=900

 Score =   163 bits (413),  Expect = 6e-43, Method: Composition-based stats.
 Identities = 74/93 (80%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W E G  PL W +R+TIALDV RGVEYLH+LA QSFIHRDLKPSNILLGDDMRAKV
Sbjct  638  HLFEWQELGYPPLTWKQRVTIALDVGRGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  697

Query  181  ADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAG  279
            ADFGLVR AP G  S+ETR+AGTFGYLAPEYA 
Sbjct  698  ADFGLVRNAPTGNYSVETRLAGTFGYLAPEYAA  730



>ref|XP_008665300.1| PREDICTED: probable receptor protein kinase TMK1 [Zea mays]
 tpg|DAA51027.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=962

 Score =   163 bits (413),  Expect = 6e-43, Method: Composition-based stats.
 Identities = 78/94 (83%), Positives = 86/94 (91%), Gaps = 2/94 (2%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W+E  L+PLEW KRL+IALDVARGVEYLH+LA Q+FIHRDLKPSNILLGDDM+AKV
Sbjct  693  HLFEWSENNLRPLEWKKRLSIALDVARGVEYLHSLAQQTFIHRDLKPSNILLGDDMKAKV  752

Query  181  ADFGLVRLAP-EGKG-SIETRIAGTFGYLAPEYA  276
            ADFGLVRLAP +GK  SIETR+AGTFGYLAPEYA
Sbjct  753  ADFGLVRLAPDDGKCVSIETRLAGTFGYLAPEYA  786



>gb|EAZ28375.1| hypothetical protein OsJ_12355 [Oryza sativa Japonica Group]
Length=917

 Score =   163 bits (412),  Expect = 7e-43, Method: Composition-based stats.
 Identities = 77/94 (82%), Positives = 85/94 (90%), Gaps = 2/94 (2%)
 Frame = +1

Query  1    HLFNWAEEGLKPLEWTKRLTIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKV  180
            HLF W E  L+PLEW KRL+IALDVARGVEYLH+LA Q+FIHRDLKPSNILLGDDM+AKV
Sbjct  648  HLFEWKEHNLRPLEWKKRLSIALDVARGVEYLHSLAQQTFIHRDLKPSNILLGDDMKAKV  707

Query  181  ADFGLVRLAP-EGKG-SIETRIAGTFGYLAPEYA  276
            ADFGLVRLAP +GK  S+ETR+AGTFGYLAPEYA
Sbjct  708  ADFGLVRLAPADGKCVSVETRLAGTFGYLAPEYA  741



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559039970400