BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001F23

Length=445
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAK71504.1|  soluble acid invertase FRUCT2                         95.5    5e-38   Ipomoea batatas [batate]
gb|AAD10239.1|  invertase                                             90.5    6e-35   Oryza sativa Japonica Group [Japonica rice]
gb|AAD01606.1|  beta-fructofuranosidase                               63.9    7e-09   Ipomoea batatas [batate]
gb|AAK71505.2|  soluble acid invertase Ib2FRUCT3                      63.5    8e-09   Ipomoea batatas [batate]
gb|AFU25742.1|  soluble acid invertase 2                              49.3    8e-07   Rhododendron hybrid cultivar
ref|XP_011076337.1|  PREDICTED: beta-fructofuranosidase, soluble ...  56.6    1e-06   Sesamum indicum [beniseed]
gb|AFU25743.1|  truncated soluble acid invertase 1                    49.3    9e-06   Rhododendron hybrid cultivar
ref|NP_001234618.1|  acid beta-fructofuranosidase precursor           54.3    9e-06   
sp|P29000.1|INVA_SOLLC  RecName: Full=Acid beta-fructofuranosidas...  53.9    1e-05   Solanum lycopersicum
gb|ABX55832.1|  soluble acid invertase                                53.9    1e-05   Cucumis melo [Oriental melon]
ref|NP_001234843.1|  acid invertase                                   53.9    1e-05   
gb|AAL75450.1|AF465613_1  minor allergen beta-fructofuranosidase ...  53.9    1e-05   Solanum lycopersicum
gb|ADE44160.1|  acid invertase                                        53.9    1e-05   Solanum lycopersicum var. cerasiforme [cherry tomato]
prf||1905419A  invertase                                              53.9    1e-05
gb|ADF27779.1|  soluble acid invertase 1                              53.9    1e-05   Phelipanche ramosa
sp|P93761.1|INV1_CAPAN  RecName: Full=Acid beta-fructofuranosidas...  53.5    2e-05   Capsicum annuum
gb|AFV59227.2|  vacuolar invertase NvINV                              52.8    3e-05   Elsholtzia haichowensis
gb|AFV59228.1|  vacuolar invertase CvINV                              52.8    3e-05   Elsholtzia haichowensis
ref|NP_001274993.1|  beta-fructosidase                                52.4    4e-05   Solanum tuberosum [potatoes]
gb|AEV46296.1|  vacuolar invertase                                    52.4    4e-05   Solanum tuberosum [potatoes]
gb|ADM47340.1|  vacuolar invertase                                    51.6    6e-05   Solanum tuberosum [potatoes]
gb|AEV46294.1|  vacuolar invertase                                    51.6    6e-05   Solanum tuberosum [potatoes]
gb|ACC93584.1|  beta-fructofuranosidase                               51.6    6e-05   Solanum tuberosum [potatoes]
gb|AAA50305.1|  beta-fructosidase                                     51.6    6e-05   Solanum tuberosum [potatoes]
gb|AEV46289.1|  vacuolar invertase                                    51.6    6e-05   Solanum tuberosum [potatoes]
gb|ABF18956.1|  acid invertase                                        51.6    6e-05   Solanum tuberosum [potatoes]
gb|AEV46287.1|  vacuolar invertase                                    51.2    8e-05   Solanum tuberosum [potatoes]
gb|AAQ17074.1|  acid invertase                                        51.2    8e-05   Solanum tuberosum [potatoes]
gb|AFO84092.1|  vacuolar invertase                                    50.8    1e-04   Actinidia chinensis
emb|CAA49831.1|  beta-fructofuranosidase                              50.4    1e-04   Solanum tuberosum [potatoes]
dbj|BAP47496.1|  invertase                                            49.7    3e-04   Gentiana triflora
gb|ACC93585.1|  beta-fructofuranosidase                               49.7    3e-04   Solanum tuberosum [potatoes]
ref|XP_010259020.1|  PREDICTED: beta-fructofuranosidase, soluble ...  48.9    5e-04   Nelumbo nucifera [Indian lotus]
ref|XP_010259021.1|  PREDICTED: beta-fructofuranosidase, soluble ...  48.5    5e-04   Nelumbo nucifera [Indian lotus]
ref|XP_011101120.1|  PREDICTED: beta-fructofuranosidase, soluble ...  48.1    8e-04   Sesamum indicum [beniseed]



>gb|AAK71504.1| soluble acid invertase FRUCT2 [Ipomoea batatas]
Length=657

 Score = 95.5 bits (236),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 51/63 (81%), Gaps = 9/63 (14%)
 Frame = +1

Query  256  QAPPLSSGGDNSQHPAPSESAQPAAVIPPSRGVSQGVSEKAFRGASGAGNRVSFAWSNLM  435
             APPLSSGGDNSQ         PAAVIPPSRGVSQGVSEKAFRG SGAGN VSFAWSNLM
Sbjct  69   HAPPLSSGGDNSQ---------PAAVIPPSRGVSQGVSEKAFRGGSGAGNGVSFAWSNLM  119

Query  436  LSW  444
            LSW
Sbjct  120  LSW  122


 Score = 88.6 bits (218),  Expect(2) = 5e-38, Method: Composition-based stats.
 Identities = 60/68 (88%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +3

Query  51   MASSHLNPTYDLENAAAAAYTPLPEQPHSAGVQTRDRKPFKVisgiilsslfllalilVA  230
            MASS L P+YDLENAAAA YTPLPEQPHSAGV+ RDRKPFK+ISGIILSSLFLLALILVA
Sbjct  1    MASSPLTPSYDLENAAAAVYTPLPEQPHSAGVEIRDRKPFKIISGIILSSLFLLALILVA  60

Query  231  VNYQAPPS  254
            VNYQ PPS
Sbjct  61   VNYQTPPS  68



>gb|AAD10239.1| invertase [Oryza sativa Japonica Group]
Length=654

 Score = 90.5 bits (223),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 51/65 (78%), Gaps = 9/65 (14%)
 Frame = +1

Query  250  HLQAPPLSSGGDNSQHPAPSESAQPAAVIPPSRGVSQGVSEKAFRGASGAGNRVSFAWSN  429
            + QAPP  S GDNSQ         PAAV+PPSRGVSQGVSEKAFRGASGAGN VSFAWSN
Sbjct  62   NYQAPPSHSSGDNSQ---------PAAVMPPSRGVSQGVSEKAFRGASGAGNGVSFAWSN  112

Query  430  LMLSW  444
            LMLSW
Sbjct  113  LMLSW  117


 Score = 83.6 bits (205),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +3

Query  51   MASSHLNPTYDLENAAAAAYTPLPEQPHSAGVQTRDRKPFKVisgiilsslfllalilVA  230
            MA+S L P YDL+NAAAA YTPLPEQPHSA V+ RDRKPFK+IS IILSSL LLALILVA
Sbjct  1    MATSRLTPAYDLKNAAAAVYTPLPEQPHSAEVEIRDRKPFKIISAIILSSLLLLALILVA  60

Query  231  VNYQAPPS  254
            VNYQAPPS
Sbjct  61   VNYQAPPS  68



>gb|AAD01606.1| beta-fructofuranosidase [Ipomoea batatas]
Length=656

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 3/47 (6%)
 Frame = +1

Query  307  SESAQPAAVIP-PSRGVSQGVSEKAFRGASGAGNRVSFAWSNLMLSW  444
            +ES  P  V+P PSRGVSQGVSEKAFRG SG   R+S+ WSNLML+W
Sbjct  85   AESVNPGVVLPAPSRGVSQGVSEKAFRGVSGG--RISYPWSNLMLTW  129



>gb|AAK71505.2| soluble acid invertase Ib2FRUCT3 [Ipomoea batatas]
Length=661

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 3/47 (6%)
 Frame = +1

Query  307  SESAQPAAVIP-PSRGVSQGVSEKAFRGASGAGNRVSFAWSNLMLSW  444
            +ES  P  V+P PSRGVSQGVSEKAFRG SG   R+S+ WSNLML+W
Sbjct  85   AESVNPGVVLPAPSRGVSQGVSEKAFRGVSGG--RISYPWSNLMLTW  129



>gb|AFU25742.1| soluble acid invertase 2 [Rhododendron hybrid cultivar]
Length=643

 Score = 49.3 bits (116),  Expect(2) = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 37/60 (62%), Gaps = 2/60 (3%)
 Frame = +1

Query  265  PLSSGGDNSQHPAPSESAQPAAVIPPSRGVSQGVSEKAFRGASGAGNRVSFAWSNLMLSW  444
            P S+  D+ +         P +++PPSRGV+QGVSEKA R  SG+G    F W+N ML+W
Sbjct  61   PRSNVNDDQRESTSPSMPVPDSLMPPSRGVAQGVSEKAVREFSGSGP--VFPWTNAMLAW  118


 Score = 30.0 bits (66),  Expect(2) = 8e-07, Method: Composition-based stats.
 Identities = 18/39 (46%), Positives = 23/39 (59%), Gaps = 5/39 (13%)
 Frame = +3

Query  57   SSHLNPTYDLENAAAAAYTPLPEQPHSAGVQTRDRKPFK  173
            +SH +P  DLE   +AAYT LP+ P S       R+PFK
Sbjct  2    NSHSSPPEDLER--SAAYTRLPDHPPSPADH---RRPFK  35



>ref|XP_011076337.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Sesamum indicum]
Length=657

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 42/57 (74%), Gaps = 5/57 (9%)
 Frame = +1

Query  283  DNSQHPA-PSESAQPAAVI--PPSRGVSQGVSEKAFRGASGAGNRVSFAWSNLMLSW  444
            D+ Q P+ P+ S  PA  +  PPSRGV QGVSEKAFR  SG GN +SFAW+N+MLSW
Sbjct  69   DSYQSPSTPTYSFSPARPLAEPPSRGVEQGVSEKAFRRVSG-GN-LSFAWTNVMLSW  123



>gb|AFU25743.1| truncated soluble acid invertase 1 [Rhododendron hybrid cultivar]
Length=434

 Score = 49.3 bits (116),  Expect(2) = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 37/60 (62%), Gaps = 2/60 (3%)
 Frame = +1

Query  265  PLSSGGDNSQHPAPSESAQPAAVIPPSRGVSQGVSEKAFRGASGAGNRVSFAWSNLMLSW  444
            P S+  D+ +         P +++PPSRGV+QGVSEKA R  SG+G    F W+N ML+W
Sbjct  61   PRSNFNDDQRESTSPSMPVPDSLMPPSRGVAQGVSEKAVREFSGSGP--VFPWTNAMLAW  118


 Score = 26.6 bits (57),  Expect(2) = 9e-06, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 23/40 (58%), Gaps = 5/40 (13%)
 Frame = +3

Query  54   ASSHLNPTYDLENAAAAAYTPLPEQPHSAGVQTRDRKPFK  173
             +SH +P  DLE   +AAYT LP+ P S       R+PFK
Sbjct  1    MNSHSSPPEDLER--SAAYTRLPDHPPSPADH---RRPFK  35



>ref|NP_001234618.1| acid beta-fructofuranosidase precursor [Solanum lycopersicum]
 gb|AAL75449.1|AF465612_1 minor allergen beta-fructofuranosidase precursor [Solanum lycopersicum]
 dbj|BAA01954.1| beta-fructosidase [Solanum lycopersicum]
Length=553

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 38/54 (70%), Gaps = 5/54 (9%)
 Frame = +1

Query  286  NSQHPAPS-ESAQPAAVIPPSRGVSQGVSEKAFRGASGAGNRVSFAWSNLMLSW  444
            N+Q P    +S  PA   PPSRGVSQGVS+K FR  +GA + VS+AWSN MLSW
Sbjct  53   NNQSPDLQIDSRSPA---PPSRGVSQGVSDKTFRDVAGA-SHVSYAWSNAMLSW  102



>sp|P29000.1|INVA_SOLLC RecName: Full=Acid beta-fructofuranosidase; AltName: Full=Acid 
invertase; Short=AI; AltName: Full=Acid sucrose hydrolase; 
AltName: Full=Vacuolar invertase; Flags: Precursor [Solanum 
lycopersicum]
 pir||S31157 beta-fructofuranosidase (EC 3.2.1.26) precursor - currant tomato
 emb|CAA78060.1| vacuolar invertase precursor [Solanum lycopersicum]
 emb|CAA78061.1| vacuolar invertase precursor [Solanum pimpinellifolium]
 emb|CAA78062.1| beta-fructofuranosidase [Solanum lycopersicum]
 emb|CAA78063.1| beta-fructofuranosidase [Solanum pimpinellifolium]
 gb|AAA34132.1| acid invertase [Solanum lycopersicum]
Length=636

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 38/54 (70%), Gaps = 5/54 (9%)
 Frame = +1

Query  286  NSQHPAPS-ESAQPAAVIPPSRGVSQGVSEKAFRGASGAGNRVSFAWSNLMLSW  444
            N+Q P    +S  PA   PPSRGVSQGVS+K FR  +GA + VS+AWSN MLSW
Sbjct  53   NNQSPDLQIDSRSPA---PPSRGVSQGVSDKTFRDVAGA-SHVSYAWSNAMLSW  102



>gb|ABX55832.1| soluble acid invertase [Cucumis melo]
Length=636

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 38/54 (70%), Gaps = 5/54 (9%)
 Frame = +1

Query  286  NSQHPAPS-ESAQPAAVIPPSRGVSQGVSEKAFRGASGAGNRVSFAWSNLMLSW  444
            N+Q P    +S  PA   PPSRGVSQGVS+K FR  +GA + VS+AWSN MLSW
Sbjct  53   NNQSPDLQIDSRSPA---PPSRGVSQGVSDKTFRDVAGA-SHVSYAWSNAMLSW  102



>ref|NP_001234843.1| acid invertase [Solanum lycopersicum]
 gb|AAB30874.1| acid invertase [Solanum lycopersicum]
Length=636

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 38/54 (70%), Gaps = 5/54 (9%)
 Frame = +1

Query  286  NSQHPAPS-ESAQPAAVIPPSRGVSQGVSEKAFRGASGAGNRVSFAWSNLMLSW  444
            N+Q P    +S  PA   PPSRGVSQGVS+K FR  +GA + VS+AWSN MLSW
Sbjct  53   NNQSPDLQIDSRSPA---PPSRGVSQGVSDKTFRDVAGA-SHVSYAWSNAMLSW  102



>gb|AAL75450.1|AF465613_1 minor allergen beta-fructofuranosidase precursor [Solanum lycopersicum]
Length=636

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 38/54 (70%), Gaps = 5/54 (9%)
 Frame = +1

Query  286  NSQHPAPS-ESAQPAAVIPPSRGVSQGVSEKAFRGASGAGNRVSFAWSNLMLSW  444
            N+Q P    +S  PA   PPSRGVSQGVS+K FR  +GA + VS+AWSN MLSW
Sbjct  53   NNQSPDLQIDSRSPA---PPSRGVSQGVSDKTFRDVAGA-SHVSYAWSNAMLSW  102



>gb|ADE44160.1| acid invertase [Solanum lycopersicum var. cerasiforme]
Length=636

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 38/54 (70%), Gaps = 5/54 (9%)
 Frame = +1

Query  286  NSQHPAPS-ESAQPAAVIPPSRGVSQGVSEKAFRGASGAGNRVSFAWSNLMLSW  444
            N+Q P    +S  PA   PPSRGVSQGVS+K FR  +GA + VS+AWSN MLSW
Sbjct  53   NNQSPDLQIDSRSPA---PPSRGVSQGVSDKTFRDVAGA-SHVSYAWSNAMLSW  102



>prf||1905419A invertase
Length=635

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 38/54 (70%), Gaps = 5/54 (9%)
 Frame = +1

Query  286  NSQHPAPS-ESAQPAAVIPPSRGVSQGVSEKAFRGASGAGNRVSFAWSNLMLSW  444
            N+Q P    +S  PA   PPSRGVSQGVS+K FR  +GA + VS+AWSN MLSW
Sbjct  53   NNQSPDLQIDSRSPA---PPSRGVSQGVSDKTFRDVAGA-SHVSYAWSNAMLSW  102



>gb|ADF27779.1| soluble acid invertase 1 [Orobanche ramosa]
Length=661

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 32/55 (58%), Positives = 38/55 (69%), Gaps = 4/55 (7%)
 Frame = +1

Query  289  SQHP-APSESAQPA--AVIPPSRGVSQGVSEKAFRGASGAGNRVSFAWSNLMLSW  444
            +Q P A ++S  PA   V PPSRGV+QGVSEK FR   G GN +SF W+N MLSW
Sbjct  73   TQTPSASADSFFPARPTVEPPSRGVAQGVSEKVFRPVGGGGN-LSFTWTNFMLSW  126



>sp|P93761.1|INV1_CAPAN RecName: Full=Acid beta-fructofuranosidase AIV-18; AltName: Full=Acid 
invertase; AltName: Full=Acid sucrose hydrolase [Capsicum 
annuum]
 gb|AAB48484.1| acid beta-fructosidase [Capsicum annuum]
Length=640

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 37/52 (71%), Gaps = 4/52 (8%)
 Frame = +1

Query  289  SQHPAPSESAQPAAVIPPSRGVSQGVSEKAFRGASGAGNRVSFAWSNLMLSW  444
            ++ P+ SE+  PA    PSRGVSQGVSEK F+  SG  ++VS+ WSN ML+W
Sbjct  63   NKSPSASETLTPAT---PSRGVSQGVSEKTFKDVSGT-SQVSYTWSNAMLNW  110



>gb|AFV59227.2| vacuolar invertase NvINV [Elsholtzia haichowensis]
Length=637

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 33/54 (61%), Gaps = 2/54 (4%)
 Frame = +1

Query  283  DNSQHPAPSESAQPAAVIPPSRGVSQGVSEKAFRGASGAGNRVSFAWSNLMLSW  444
            +  Q P P      +    PSRGV+QGVSEK FR  SG  +  SFAW+N+MLSW
Sbjct  53   NQDQKPVPQAKLNTSPAEAPSRGVAQGVSEKVFRRVSGGNS--SFAWTNVMLSW  104



>gb|AFV59228.1| vacuolar invertase CvINV [Elsholtzia haichowensis]
Length=637

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 33/54 (61%), Gaps = 2/54 (4%)
 Frame = +1

Query  283  DNSQHPAPSESAQPAAVIPPSRGVSQGVSEKAFRGASGAGNRVSFAWSNLMLSW  444
            +  Q P P      +    PSRGV+QGVSEK FR  SG  +  SFAW+N+MLSW
Sbjct  53   NQDQKPVPQAKLNTSPAEAPSRGVAQGVSEKVFRRVSGGNS--SFAWTNVMLSW  104



>ref|NP_001274993.1| beta-fructosidase [Solanum tuberosum]
 gb|AEV46297.1| vacuolar invertase [Solanum tuberosum]
Length=639

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 36/53 (68%), Gaps = 3/53 (6%)
 Frame = +1

Query  286  NSQHPAPSESAQPAAVIPPSRGVSQGVSEKAFRGASGAGNRVSFAWSNLMLSW  444
            N+Q P    +A+  A  PPSRGVSQGVS+K FR    A + VS+AWSN MLSW
Sbjct  56   NNQSPDLQSNARSPA--PPSRGVSQGVSDKTFRDVVNA-SHVSYAWSNAMLSW  105



>gb|AEV46296.1| vacuolar invertase [Solanum tuberosum]
Length=639

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 35/53 (66%), Gaps = 3/53 (6%)
 Frame = +1

Query  286  NSQHPAPSESAQPAAVIPPSRGVSQGVSEKAFRGASGAGNRVSFAWSNLMLSW  444
            N+Q P    +A   A  PPSRGVSQGVS+K FR    A + VS+AWSN MLSW
Sbjct  56   NNQSPDLQSNAHSPA--PPSRGVSQGVSDKTFRDVVNA-SHVSYAWSNAMLSW  105



>gb|ADM47340.1| vacuolar invertase [Solanum tuberosum]
 gb|AEV46290.1| vacuolar invertase [Solanum tuberosum]
 gb|AEV46291.1| vacuolar invertase [Solanum tuberosum]
 gb|AEV46292.1| vacuolar invertase [Solanum tuberosum]
 gb|AEV46293.1| vacuolar invertase [Solanum tuberosum]
Length=639

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 36/54 (67%), Gaps = 5/54 (9%)
 Frame = +1

Query  286  NSQHP-APSESAQPAAVIPPSRGVSQGVSEKAFRGASGAGNRVSFAWSNLMLSW  444
            N+Q P   S S  PA   PPSRGVSQGVS+K FR    A + VS+AWSN MLSW
Sbjct  56   NNQSPDLQSNSRSPA---PPSRGVSQGVSDKTFRDVVNA-SHVSYAWSNAMLSW  105



>gb|AEV46294.1| vacuolar invertase [Solanum tuberosum]
 gb|AEV46295.1| vacuolar invertase [Solanum tuberosum]
Length=639

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 36/54 (67%), Gaps = 5/54 (9%)
 Frame = +1

Query  286  NSQHP-APSESAQPAAVIPPSRGVSQGVSEKAFRGASGAGNRVSFAWSNLMLSW  444
            N+Q P   S S  PA   PPSRGVSQGVS+K FR    A + VS+AWSN MLSW
Sbjct  56   NNQSPDLQSNSRSPA---PPSRGVSQGVSDKTFRDVVNA-SHVSYAWSNAMLSW  105



>gb|ACC93584.1| beta-fructofuranosidase, partial [Solanum tuberosum]
Length=635

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 36/54 (67%), Gaps = 5/54 (9%)
 Frame = +1

Query  286  NSQHP-APSESAQPAAVIPPSRGVSQGVSEKAFRGASGAGNRVSFAWSNLMLSW  444
            N+Q P   S S  PA   PPSRGVSQGVS+K FR    A + VS+AWSN MLSW
Sbjct  52   NNQSPDLQSNSRSPA---PPSRGVSQGVSDKTFRDVVNA-SHVSYAWSNAMLSW  101



>gb|AAA50305.1| beta-fructosidase [Solanum tuberosum]
Length=639

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 36/54 (67%), Gaps = 5/54 (9%)
 Frame = +1

Query  286  NSQHP-APSESAQPAAVIPPSRGVSQGVSEKAFRGASGAGNRVSFAWSNLMLSW  444
            N+Q P   S S  PA   PPSRGVSQGVS+K FR    A + VS+AWSN MLSW
Sbjct  56   NNQSPDLQSNSRSPA---PPSRGVSQGVSDKTFRDVVNA-SHVSYAWSNAMLSW  105



>gb|AEV46289.1| vacuolar invertase [Solanum tuberosum]
Length=639

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 36/54 (67%), Gaps = 5/54 (9%)
 Frame = +1

Query  286  NSQHP-APSESAQPAAVIPPSRGVSQGVSEKAFRGASGAGNRVSFAWSNLMLSW  444
            N+Q P   S S  PA   PPSRGVSQGVS+K FR    A + VS+AWSN MLSW
Sbjct  56   NNQSPDLQSNSRSPA---PPSRGVSQGVSDKTFRDVVNA-SHVSYAWSNAMLSW  105



>gb|ABF18956.1| acid invertase [Solanum tuberosum]
Length=639

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 36/54 (67%), Gaps = 5/54 (9%)
 Frame = +1

Query  286  NSQHP-APSESAQPAAVIPPSRGVSQGVSEKAFRGASGAGNRVSFAWSNLMLSW  444
            N+Q P   S S  PA   PPSRGVSQGVS+K FR    A + VS+AWSN MLSW
Sbjct  56   NNQSPDLQSNSRSPA---PPSRGVSQGVSDKTFRDVVNA-SHVSYAWSNAMLSW  105



>gb|AEV46287.1| vacuolar invertase [Solanum tuberosum]
 gb|AEV46288.1| vacuolar invertase [Solanum tuberosum]
Length=639

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 36/54 (67%), Gaps = 5/54 (9%)
 Frame = +1

Query  286  NSQHP-APSESAQPAAVIPPSRGVSQGVSEKAFRGASGAGNRVSFAWSNLMLSW  444
            N+Q P   S S  PA   PPSRGVSQGVS+K FR    A + +S+AWSN MLSW
Sbjct  56   NNQSPDLQSNSRSPA---PPSRGVSQGVSDKTFRDVVNA-SHISYAWSNAMLSW  105



>gb|AAQ17074.1| acid invertase [Solanum tuberosum]
Length=639

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 36/54 (67%), Gaps = 5/54 (9%)
 Frame = +1

Query  286  NSQHP-APSESAQPAAVIPPSRGVSQGVSEKAFRGASGAGNRVSFAWSNLMLSW  444
            N+Q P   S S  PA   PPSRGVSQGVS+K FR    A + +S+AWSN MLSW
Sbjct  56   NNQSPDLQSNSRSPA---PPSRGVSQGVSDKTFRDVVNA-SHISYAWSNAMLSW  105



>gb|AFO84092.1| vacuolar invertase [Actinidia chinensis]
Length=632

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 35/59 (59%), Gaps = 2/59 (3%)
 Frame = +1

Query  268  LSSGGDNSQHPAPSESAQPAAVIPPSRGVSQGVSEKAFRGASGAGNRVSFAWSNLMLSW  444
            L++G  ++ +  P     P   +PPSRGV QGVSEKAFR  SG      + W+N ML+W
Sbjct  45   LNNGPRDAPNNVPKSQVLPETWMPPSRGVEQGVSEKAFREYSGMDPE--YNWTNTMLAW  101



>emb|CAA49831.1| beta-fructofuranosidase [Solanum tuberosum]
Length=634

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 1/36 (3%)
 Frame = +1

Query  337  PPSRGVSQGVSEKAFRGASGAGNRVSFAWSNLMLSW  444
            PPSRGVSQGVS+K FR    A + +S+AWSN MLSW
Sbjct  66   PPSRGVSQGVSDKTFRDVVNA-SHISYAWSNAMLSW  100



>dbj|BAP47496.1| invertase [Gentiana triflora]
Length=658

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 3/47 (6%)
 Frame = +1

Query  307  SESAQPAAVIP-PSRGVSQGVSEKAFRGASGAGNRVSFAWSNLMLSW  444
            SES  P+ + P PSRGVSQGVSEK+FR     G  V F+W+N MLSW
Sbjct  81   SESVLPSNLSPAPSRGVSQGVSEKSFR--VDPGEDVIFSWTNAMLSW  125



>gb|ACC93585.1| beta-fructofuranosidase [Solanum tuberosum]
Length=639

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 35/54 (65%), Gaps = 5/54 (9%)
 Frame = +1

Query  286  NSQHP-APSESAQPAAVIPPSRGVSQGVSEKAFRGASGAGNRVSFAWSNLMLSW  444
            N+Q P   S S  PA   PPSRGVSQGVS+K FR    A + V +AWSN MLSW
Sbjct  56   NNQSPDLQSNSRSPA---PPSRGVSQGVSDKTFRDVVNA-SHVPYAWSNAMLSW  105



>ref|XP_010259020.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
isoform X1 [Nelumbo nucifera]
Length=664

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 29/55 (53%), Positives = 38/55 (69%), Gaps = 6/55 (11%)
 Frame = +1

Query  289  SQHPAPSESAQPAAVIPP---SRGVSQGVSEKAFRGASGAGNRVSFAWSNLMLSW  444
            + HP+   S++P+  I P   SRGVS+GVSEKAFR  S  G+  S+ W+NLMLSW
Sbjct  80   NHHPS-FPSSKPSRAIEPEWVSRGVSEGVSEKAFRPYSEKGD--SYPWTNLMLSW  131



>ref|XP_010259021.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
isoform X2 [Nelumbo nucifera]
Length=593

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 29/55 (53%), Positives = 38/55 (69%), Gaps = 6/55 (11%)
 Frame = +1

Query  289  SQHPAPSESAQPAAVIPP---SRGVSQGVSEKAFRGASGAGNRVSFAWSNLMLSW  444
            + HP+   S++P+  I P   SRGVS+GVSEKAFR  S  G+  S+ W+NLMLSW
Sbjct  80   NHHPS-FPSSKPSRAIEPEWVSRGVSEGVSEKAFRPYSEKGD--SYPWTNLMLSW  131



>ref|XP_011101120.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Sesamum indicum]
Length=652

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 2/36 (6%)
 Frame = +1

Query  337  PPSRGVSQGVSEKAFRGASGAGNRVSFAWSNLMLSW  444
            PPSRGVS G SEK FR  SG    ++F+WSN+MLSW
Sbjct  87   PPSRGVSMGASEKVFRRVSGG--ELTFSWSNVMLSW  120



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557830460880