BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001F21

Length=612
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011022822.1|  PREDICTED: 40S ribosomal protein S6                315   5e-105   Populus euphratica
gb|KDP41410.1|  hypothetical protein JCGZ_15817                         314   1e-104   Jatropha curcas
ref|XP_002531669.1|  40S ribosomal protein S6, putative                 313   1e-104   Ricinus communis
ref|XP_011031062.1|  PREDICTED: 40S ribosomal protein S6-like           313   1e-104   Populus euphratica
ref|XP_009780041.1|  PREDICTED: 40S ribosomal protein S6                313   1e-104   Nicotiana sylvestris
gb|KDP29722.1|  hypothetical protein JCGZ_18657                         313   1e-104   Jatropha curcas
ref|XP_009622898.1|  PREDICTED: 40S ribosomal protein S6                313   2e-104   Nicotiana tomentosiformis
ref|XP_002306298.1|  hypothetical protein POPTR_0005s07380g             313   2e-104   
ref|XP_011003031.1|  PREDICTED: 40S ribosomal protein S6-like           313   2e-104   Populus euphratica
gb|KJB79633.1|  hypothetical protein B456_013G060000                    313   2e-104   Gossypium raimondii
gb|KHG29581.1|  40S ribosomal S6                                        313   3e-104   Gossypium arboreum [tree cotton]
ref|XP_002309965.1|  hypothetical protein POPTR_0007s05090g             312   3e-104   Populus trichocarpa [western balsam poplar]
ref|XP_002285752.1|  PREDICTED: 40S ribosomal protein S6                312   4e-104   Vitis vinifera
ref|XP_009782102.1|  PREDICTED: 40S ribosomal protein S6-like           312   4e-104   Nicotiana sylvestris
gb|KDP40920.1|  hypothetical protein JCGZ_24919                         312   4e-104   Jatropha curcas
ref|XP_009413629.1|  PREDICTED: 40S ribosomal protein S6-like           312   5e-104   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009612288.1|  PREDICTED: 40S ribosomal protein S6-like           312   5e-104   Nicotiana tomentosiformis
ref|XP_009758302.1|  PREDICTED: 40S ribosomal protein S6-like           312   5e-104   Nicotiana sylvestris
ref|XP_009603690.1|  PREDICTED: 40S ribosomal protein S6-like           312   5e-104   Nicotiana tomentosiformis
ref|XP_007018728.1|  Ribosomal protein S6e                              312   6e-104   Theobroma cacao [chocolate]
ref|XP_009404037.1|  PREDICTED: 40S ribosomal protein S6-like           312   6e-104   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009380211.1|  PREDICTED: 40S ribosomal protein S6                311   7e-104   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB44104.1|  hypothetical protein B456_007G234700                    311   7e-104   Gossypium raimondii
ref|XP_009390279.1|  PREDICTED: 40S ribosomal protein S6                311   7e-104   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG00252.1|  40S ribosomal S6                                        311   7e-104   Gossypium arboreum [tree cotton]
gb|KHG15571.1|  40S ribosomal S6                                        311   8e-104   Gossypium arboreum [tree cotton]
ref|XP_009390908.1|  PREDICTED: 40S ribosomal protein S6-like           311   8e-104   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002442150.1|  hypothetical protein SORBIDRAFT_08g015010          311   1e-103   Sorghum bicolor [broomcorn]
ref|XP_002306568.1|  hypothetical protein POPTR_0005s17280g             311   1e-103   Populus trichocarpa [western balsam poplar]
ref|XP_008444852.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    311   1e-103   Cucumis melo [Oriental melon]
ref|NP_001275029.1|  40S ribosomal protein S6-like                      311   1e-103   Solanum tuberosum [potatoes]
gb|KHG00333.1|  40S ribosomal S6                                        311   2e-103   Gossypium arboreum [tree cotton]
ref|XP_002273865.1|  PREDICTED: 40S ribosomal protein S6 isoform X1     311   2e-103   Vitis vinifera
ref|XP_008778719.1|  PREDICTED: 40S ribosomal protein S6-like iso...    310   2e-103   Phoenix dactylifera
ref|XP_002513953.1|  40S ribosomal protein S6, putative                 310   2e-103   Ricinus communis
gb|ADR71291.1|  40S ribosomal protein S6A                               310   2e-103   Hevea brasiliensis [jebe]
ref|XP_004244462.1|  PREDICTED: 40S ribosomal protein S6-like           310   2e-103   Solanum lycopersicum
ref|XP_010937382.1|  PREDICTED: 40S ribosomal protein S6 isoform X1     310   2e-103   Elaeis guineensis
ref|XP_007047873.1|  Ribosomal protein S6e isoform 1                    310   2e-103   
gb|KJB48851.1|  hypothetical protein B456_008G090300                    310   3e-103   Gossypium raimondii
ref|XP_010939689.1|  PREDICTED: 40S ribosomal protein S6 isoform X1     310   3e-103   Elaeis guineensis
ref|XP_008790913.1|  PREDICTED: 40S ribosomal protein S6                310   3e-103   Phoenix dactylifera
ref|XP_002271632.1|  PREDICTED: 40S ribosomal protein S6                310   3e-103   Vitis vinifera
gb|KCW54573.1|  hypothetical protein EUGRSUZ_I00534                     309   3e-103   Eucalyptus grandis [rose gum]
ref|XP_004133785.1|  PREDICTED: 40S ribosomal protein S6-like           310   4e-103   Cucumis sativus [cucumbers]
gb|KHG05484.1|  40S ribosomal S6                                        310   4e-103   Gossypium arboreum [tree cotton]
ref|XP_008804777.1|  PREDICTED: 40S ribosomal protein S6                309   5e-103   Phoenix dactylifera
ref|XP_008778720.1|  PREDICTED: 40S ribosomal protein S6-like iso...    309   5e-103   
ref|XP_010548594.1|  PREDICTED: 40S ribosomal protein S6-2              309   6e-103   Tarenaya hassleriana [spider flower]
ref|XP_011097538.1|  PREDICTED: 40S ribosomal protein S6                309   6e-103   Sesamum indicum [beniseed]
ref|XP_010552269.1|  PREDICTED: 40S ribosomal protein S6-like           309   6e-103   Tarenaya hassleriana [spider flower]
ref|XP_010523300.1|  PREDICTED: 40S ribosomal protein S6-2-like         309   6e-103   Tarenaya hassleriana [spider flower]
ref|XP_010937383.1|  PREDICTED: 40S ribosomal protein S6 isoform X2     309   7e-103   
ref|XP_004152628.1|  PREDICTED: 40S ribosomal protein S6-like           309   8e-103   Cucumis sativus [cucumbers]
ref|XP_004246081.1|  PREDICTED: 40S ribosomal protein S6-like           309   8e-103   Solanum lycopersicum
emb|CDP01503.1|  unnamed protein product                                309   8e-103   Coffea canephora [robusta coffee]
ref|XP_010939691.1|  PREDICTED: 40S ribosomal protein S6 isoform X2     308   1e-102   
ref|XP_010267142.1|  PREDICTED: 40S ribosomal protein S6-like           308   1e-102   Nelumbo nucifera [Indian lotus]
ref|XP_002300192.1|  hypothetical protein POPTR_0001s31850g             308   1e-102   Populus trichocarpa [western balsam poplar]
ref|XP_010519365.1|  PREDICTED: 40S ribosomal protein S6                308   1e-102   Tarenaya hassleriana [spider flower]
ref|XP_010060040.1|  PREDICTED: 40S ribosomal protein S6-2              308   1e-102   Eucalyptus grandis [rose gum]
gb|KJB79635.1|  hypothetical protein B456_013G060000                    308   1e-102   Gossypium raimondii
ref|XP_006854035.1|  hypothetical protein AMTR_s00048p00058600          308   2e-102   Amborella trichopoda
ref|XP_004958354.1|  PREDICTED: 40S ribosomal protein S6-like           308   2e-102   Setaria italica
ref|XP_006421173.1|  hypothetical protein CICLE_v10005711mg             308   2e-102   Citrus clementina [clementine]
ref|XP_011045728.1|  PREDICTED: 40S ribosomal protein S6-like           308   2e-102   Populus euphratica
gb|KJB77543.1|  hypothetical protein B456_012G142800                    308   2e-102   Gossypium raimondii
gb|ABK24202.1|  unknown                                                 308   2e-102   Picea sitchensis
ref|XP_010917302.1|  PREDICTED: 40S ribosomal protein S6-like           308   2e-102   Elaeis guineensis
ref|XP_006842435.1|  hypothetical protein AMTR_s00077p00035710          308   3e-102   Amborella trichopoda
ref|NP_001060313.1|  Os07g0622100                                       308   3e-102   
gb|KFK25336.1|  hypothetical protein AALP_AA8G099500                    307   3e-102   Arabis alpina [alpine rockcress]
ref|XP_006466259.1|  PREDICTED: 40S ribosomal protein S6-like           307   3e-102   Citrus sinensis [apfelsine]
ref|XP_006426342.1|  hypothetical protein CICLE_v10026340mg             307   3e-102   Citrus clementina [clementine]
ref|XP_010259864.1|  PREDICTED: 40S ribosomal protein S6-like iso...    307   3e-102   Nelumbo nucifera [Indian lotus]
ref|XP_010273000.1|  PREDICTED: 40S ribosomal protein S6                307   4e-102   
ref|XP_008782166.1|  PREDICTED: 40S ribosomal protein S6-like iso...    307   4e-102   Phoenix dactylifera
pdb|3J60|G  Chain G, Localization Of The Small Subunit Ribosomal ...    306   5e-102   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006853279.1|  hypothetical protein AMTR_s00038p00238890          307   5e-102   Amborella trichopoda
gb|KJB64238.1|  hypothetical protein B456_010G038700                    306   6e-102   Gossypium raimondii
gb|ADR71292.1|  40S ribosomal protein S6B                               306   7e-102   Hevea brasiliensis [jebe]
gb|KEH22531.1|  40S ribosomal protein S6-2                              306   7e-102   Medicago truncatula
gb|KHG25382.1|  40S ribosomal S6                                        306   7e-102   Gossypium arboreum [tree cotton]
ref|NP_001050273.1|  Os03g0390000                                       306   9e-102   
emb|CDY57887.1|  BnaC03g77310D                                          306   1e-101   Brassica napus [oilseed rape]
ref|XP_007227550.1|  hypothetical protein PRUPE_ppa010452mg             306   1e-101   Prunus persica
ref|XP_002302307.2|  hypothetical protein POPTR_0002s09970g             306   1e-101   Populus trichocarpa [western balsam poplar]
ref|XP_006657975.1|  PREDICTED: 40S ribosomal protein S6-like           306   1e-101   
ref|XP_010259865.1|  PREDICTED: 40S ribosomal protein S6-like iso...    306   1e-101   
ref|XP_004299660.1|  PREDICTED: 40S ribosomal protein S6                306   1e-101   Fragaria vesca subsp. vesca
ref|XP_011100900.1|  PREDICTED: 40S ribosomal protein S6-like           305   2e-101   Sesamum indicum [beniseed]
ref|XP_006650153.1|  PREDICTED: 40S ribosomal protein S6-like           305   2e-101   Oryza brachyantha
ref|NP_001288590.1|  40S ribosomal protein S6-like                      305   2e-101   Zea mays [maize]
sp|Q9M3V8.1|RS6_ASPOF  RecName: Full=40S ribosomal protein S6           305   2e-101   Asparagus officinalis
emb|CDX96995.1|  BnaC09g46300D                                          305   2e-101   
gb|EAY90299.1|  hypothetical protein OsI_11874                          305   3e-101   Oryza sativa Indica Group [Indian rice]
emb|CDX85766.1|  BnaA02g00470D                                          305   3e-101   
ref|XP_011016744.1|  PREDICTED: 40S ribosomal protein S6-like           305   3e-101   Populus euphratica
gb|ADU04154.1|  hypothetical protein                                    305   3e-101   Gossypium hirsutum [American cotton]
ref|XP_004962967.1|  PREDICTED: 40S ribosomal protein S6-like           305   3e-101   Setaria italica
ref|XP_006288531.1|  hypothetical protein CARUB_v10001803mg             305   3e-101   Capsella rubella
ref|XP_009125304.1|  PREDICTED: 40S ribosomal protein S6-2-like         305   3e-101   Brassica rapa
gb|AAZ66937.1|  117M18_18                                               305   3e-101   Brassica rapa
ref|XP_009108917.1|  PREDICTED: 40S ribosomal protein S6-1 isofor...    305   4e-101   Brassica rapa
ref|XP_010247380.1|  PREDICTED: 40S ribosomal protein S6-like           304   5e-101   Nelumbo nucifera [Indian lotus]
emb|CDX75189.1|  BnaA01g05130D                                          304   5e-101   
ref|XP_003622831.1|  40S ribosomal protein S6                           303   5e-101   
ref|XP_008437828.1|  PREDICTED: 40S ribosomal protein S6-like           304   5e-101   Cucumis melo [Oriental melon]
ref|XP_004253069.1|  PREDICTED: 40S ribosomal protein S6                304   6e-101   
emb|CDX69842.1|  BnaA10g21910D                                          304   6e-101   
ref|XP_002863274.1|  predicted protein                                  304   6e-101   Arabidopsis lyrata subsp. lyrata
gb|KJB48856.1|  hypothetical protein B456_008G090300                    304   7e-101   Gossypium raimondii
ref|XP_007134259.1|  hypothetical protein PHAVU_010G032100g             304   7e-101   Phaseolus vulgaris [French bean]
gb|ABS50097.1|  ribosomal protein S6                                    304   7e-101   Glycine max [soybeans]
ref|NP_001105634.1|  ribosomal protein s6 RPS6-2                        303   1e-100   Zea mays [maize]
gb|ACG31980.1|  40S ribosomal protein S6                                303   1e-100   Zea mays [maize]
ref|NP_001105544.1|  ribosomal proteinS6                                303   1e-100   Zea mays [maize]
gb|ACR36795.1|  unknown                                                 303   1e-100   Zea mays [maize]
ref|XP_006399530.1|  hypothetical protein EUTSA_v10014497mg             303   1e-100   Eutrema salsugineum [saltwater cress]
gb|ACU24470.1|  unknown                                                 303   1e-100   Glycine max [soybeans]
ref|XP_004505074.1|  PREDICTED: 40S ribosomal protein S6-like           303   2e-100   Cicer arietinum [garbanzo]
ref|XP_009131151.1|  PREDICTED: 40S ribosomal protein S6-2              303   2e-100   Brassica rapa
ref|XP_003545992.1|  PREDICTED: 40S ribosomal protein S6-like           303   2e-100   Glycine max [soybeans]
gb|AFK37790.1|  unknown                                                 303   2e-100   Medicago truncatula
ref|XP_010491703.1|  PREDICTED: 40S ribosomal protein S6-2-like i...    303   2e-100   Camelina sativa [gold-of-pleasure]
ref|XP_003529334.1|  PREDICTED: 40S ribosomal protein S6                303   2e-100   
ref|XP_002873453.1|  EMB3010                                            303   2e-100   
ref|XP_007148148.1|  hypothetical protein PHAVU_006G184300g             302   3e-100   Phaseolus vulgaris [French bean]
ref|XP_003593601.1|  40S ribosomal protein                              302   3e-100   Medicago truncatula
ref|NP_001274954.1|  40S ribosomal protein S6-1-like                    302   3e-100   Solanum tuberosum [potatoes]
ref|XP_007205780.1|  hypothetical protein PRUPE_ppa010485mg             302   4e-100   Prunus persica
gb|EYU34583.1|  hypothetical protein MIMGU_mgv1a011745mg                303   4e-100   Erythranthe guttata [common monkey flower]
ref|XP_008386113.1|  PREDICTED: 40S ribosomal protein S6                301   5e-100   Malus domestica [apple tree]
ref|XP_009372980.1|  PREDICTED: 40S ribosomal protein S6                301   6e-100   Pyrus x bretschneideri [bai li]
ref|XP_004485798.1|  PREDICTED: 40S ribosomal protein S6-like           301   6e-100   Cicer arietinum [garbanzo]
gb|AHA84247.1|  40S ribosomal protein S6                                301   6e-100   Phaseolus vulgaris [French bean]
ref|XP_006412569.1|  hypothetical protein EUTSA_v10026073mg             301   7e-100   Eutrema salsugineum [saltwater cress]
ref|XP_007140717.1|  hypothetical protein PHAVU_008G135700g             301   7e-100   Phaseolus vulgaris [French bean]
ref|XP_010422849.1|  PREDICTED: 40S ribosomal protein S6-2              301   8e-100   Camelina sativa [gold-of-pleasure]
gb|KHN10923.1|  40S ribosomal protein S6                                301   8e-100   Glycine soja [wild soybean]
ref|XP_009122062.1|  PREDICTED: 40S ribosomal protein S6-2              301   9e-100   Brassica rapa
emb|CAA74381.1|  ribosomal protein S6                                   301   1e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010453063.1|  PREDICTED: 40S ribosomal protein S6-2-like         301   1e-99    Camelina sativa [gold-of-pleasure]
gb|AFK46410.1|  unknown                                                 301   1e-99    Medicago truncatula
ref|NP_001237243.1|  ribosomal protein S6                               301   1e-99    
ref|NP_196598.1|  40S ribosomal protein S6-2                            301   1e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008373000.1|  PREDICTED: 40S ribosomal protein S6-like           301   1e-99    Malus domestica [apple tree]
ref|XP_004288169.1|  PREDICTED: 40S ribosomal protein S6-like           301   1e-99    Fragaria vesca subsp. vesca
ref|XP_008350017.1|  PREDICTED: 40S ribosomal protein S6                301   1e-99    
gb|AHA84164.1|  40S ribosomal protein S6                                300   1e-99    Phaseolus vulgaris [French bean]
gb|AFK34255.1|  unknown                                                 300   2e-99    Medicago truncatula
gb|AFK34739.1|  unknown                                                 300   2e-99    Lotus japonicus
gb|EPS72311.1|  hypothetical protein M569_02446                         300   2e-99    Genlisea aurea
gb|KHN09991.1|  40S ribosomal protein S6                                300   2e-99    Glycine soja [wild soybean]
ref|XP_006284414.1|  hypothetical protein CARUB_v10005584mg             300   2e-99    Capsella rubella
ref|NP_001242836.1|  uncharacterized protein LOC100819697               300   2e-99    
gb|ACU18845.1|  unknown                                                 299   2e-99    Glycine max [soybeans]
ref|NP_001242564.1|  uncharacterized protein LOC100801194               300   3e-99    Glycine max [soybeans]
ref|XP_009126736.1|  PREDICTED: 40S ribosomal protein S6-1              300   3e-99    Brassica rapa
ref|XP_010098627.1|  Serine/threonine-protein kinase SAPK2              311   3e-99    
ref|XP_003532242.1|  PREDICTED: 40S ribosomal protein S6-like           300   3e-99    Glycine max [soybeans]
gb|ABK22338.1|  unknown                                                 300   3e-99    Picea sitchensis
ref|XP_010676041.1|  PREDICTED: 40S ribosomal protein S6-1              300   3e-99    Beta vulgaris subsp. vulgaris [field beet]
gb|EYU23960.1|  hypothetical protein MIMGU_mgv1a012472mg                300   4e-99    Erythranthe guttata [common monkey flower]
emb|CDY40091.1|  BnaC02g00390D                                          300   5e-99    Brassica napus [oilseed rape]
gb|ACU23723.1|  unknown                                                 299   6e-99    Glycine max [soybeans]
emb|CDX68774.1|  BnaC01g06790D                                          300   8e-99    
ref|XP_007159340.1|  hypothetical protein PHAVU_002G229900g             298   9e-99    Phaseolus vulgaris [French bean]
gb|ACJ84577.1|  unknown                                                 297   9e-99    Medicago truncatula
gb|EYU30987.1|  hypothetical protein MIMGU_mgv1a012493mg                298   1e-98    Erythranthe guttata [common monkey flower]
gb|KJB79634.1|  hypothetical protein B456_013G060000                    296   1e-98    Gossypium raimondii
emb|CDY13073.1|  BnaA09g17440D                                          299   1e-98    Brassica napus [oilseed rape]
gb|ACU20345.1|  unknown                                                 298   2e-98    Glycine max [soybeans]
ref|XP_010432832.1|  PREDICTED: 40S ribosomal protein S6-1              298   2e-98    Camelina sativa [gold-of-pleasure]
gb|ACU24208.1|  unknown                                                 298   2e-98    Glycine max [soybeans]
gb|KHN04566.1|  40S ribosomal protein S6                                296   4e-98    Glycine soja [wild soybean]
ref|NP_194898.1|  40S ribosomal protein S6-1                            296   9e-98    Arabidopsis thaliana [mouse-ear cress]
gb|KJB48854.1|  hypothetical protein B456_008G090300                    293   1e-97    Gossypium raimondii
gb|ADU04149.1|  hypothetical protein                                    295   3e-97    Gossypium hirsutum [American cotton]
gb|AFK42970.1|  unknown                                                 294   6e-97    Lotus japonicus
gb|EYU30988.1|  hypothetical protein MIMGU_mgv1a012493mg                293   2e-96    Erythranthe guttata [common monkey flower]
ref|XP_003547761.1|  PREDICTED: 40S ribosomal protein S6-like           293   2e-96    Glycine max [soybeans]
ref|XP_004492256.1|  PREDICTED: 40S ribosomal protein S6-like           292   4e-96    Cicer arietinum [garbanzo]
gb|AAP46142.1|  ribosomal protein S6                                    292   4e-96    Brassica napus [oilseed rape]
gb|KJB64239.1|  hypothetical protein B456_010G038700                    291   5e-96    Gossypium raimondii
ref|XP_007042906.1|  Ribosomal protein S6e                              291   2e-95    
gb|KFK29760.1|  hypothetical protein AALP_AA7G175400                    289   6e-95    Arabis alpina [alpine rockcress]
gb|AFK42374.1|  unknown                                                 286   9e-95    Medicago truncatula
gb|KHN08511.1|  40S ribosomal protein S6                                304   2e-93    Glycine soja [wild soybean]
gb|AAB88298.1|  ribosomal protein S6                                    285   2e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003557781.2|  PREDICTED: abscisic acid-inducible protein k...    296   6e-93    
gb|EMS51115.1|  40S ribosomal protein S6                                284   6e-93    Triticum urartu
tpg|DAA63661.1|  TPA: putative 40S ribosomal protein S6                 283   7e-93    
dbj|BAK06183.1|  predicted protein                                      283   1e-92    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT11004.1|  40S ribosomal protein S6                                282   4e-92    
ref|XP_001758271.1|  predicted protein                                  279   4e-91    
ref|XP_001781778.1|  predicted protein                                  279   5e-91    
ref|XP_001779200.1|  predicted protein                                  279   5e-91    
ref|XP_001779222.1|  predicted protein                                  279   6e-91    
ref|XP_003562681.2|  PREDICTED: serine/threonine-protein kinase S...    288   6e-90    
ref|XP_001779221.1|  predicted protein                                  276   6e-90    
gb|KJB48853.1|  hypothetical protein B456_008G090300                    267   1e-87    Gossypium raimondii
ref|XP_002972307.1|  hypothetical protein SELMODRAFT_172795             270   2e-87    Selaginella moellendorffii
ref|XP_003632467.1|  PREDICTED: 40S ribosomal protein S6 isoform X3     265   8e-87    
ref|XP_008440575.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    265   1e-85    Cucumis melo [Oriental melon]
gb|EMT26436.1|  Serine/threonine-protein kinase SAPK2                   275   2e-85    
gb|KJB79636.1|  hypothetical protein B456_013G060000                    263   6e-85    Gossypium raimondii
ref|XP_010104453.1|  40S ribosomal protein S6                           253   1e-80    
gb|KJB44105.1|  hypothetical protein B456_007G234700                    248   1e-79    Gossypium raimondii
gb|KJB77544.1|  hypothetical protein B456_012G142800                    248   2e-79    Gossypium raimondii
ref|XP_005647484.1|  ribosomal protein S6e                              247   1e-78    Coccomyxa subellipsoidea C-169
ref|XP_005848306.1|  hypothetical protein CHLNCDRAFT_59656              241   2e-76    Chlorella variabilis
ref|XP_011399644.1|  40S ribosomal protein S6                           240   6e-76    Auxenochlorella protothecoides
emb|CAA09042.1|  40S ribosomal protein S6                               239   6e-76    Cicer arietinum [garbanzo]
ref|XP_003055759.1|  predicted protein                                  239   2e-75    Micromonas pusilla CCMP1545
emb|CEF97132.1|  Ribosomal protein S6, eukaryotic                       238   3e-75    Ostreococcus tauri
gb|KDD74799.1|  ribosomal protein S6e                                   237   9e-75    Helicosporidium sp. ATCC 50920
ref|XP_002955255.1|  ribosomal protein S6 component of cytosolic ...    236   2e-74    Volvox carteri f. nagariensis
ref|XP_002499450.1|  predicted protein                                  232   1e-72    Micromonas commoda
gb|KJB44106.1|  hypothetical protein B456_007G234700                    229   6e-72    Gossypium raimondii
ref|XP_007047875.1|  Ribosomal protein S6e isoform 3                    230   6e-72    
ref|XP_001416665.1|  predicted protein                                  228   2e-71    Ostreococcus lucimarinus CCE9901
ref|XP_006576029.1|  PREDICTED: 40S ribosomal protein S6-like           226   2e-71    
gb|ETI52627.1|  hypothetical protein F443_04343                         228   3e-71    Phytophthora parasitica P1569
ref|XP_002909042.1|  40S ribosomal protein S6                           228   3e-71    Phytophthora infestans T30-4
gb|KJB44107.1|  hypothetical protein B456_007G234700                    227   4e-71    Gossypium raimondii
ref|XP_009529593.1|  hypothetical protein PHYSODRAFT_286397             228   5e-71    Phytophthora sojae
gb|KJB18232.1|  hypothetical protein B456_003G041100                    227   6e-71    Gossypium raimondii
gb|KJB48855.1|  hypothetical protein B456_008G090300                    227   7e-71    Gossypium raimondii
ref|XP_001695102.1|  ribosomal protein S6, component of cytosolic...    227   7e-71    Chlamydomonas reinhardtii
ref|XP_007511177.1|  predicted protein                                  226   3e-70    Bathycoccus prasinos
ref|XP_005705742.1|  40S ribosomal protein S6e                          223   2e-69    Galdieria sulphuraria
gb|KHN22177.1|  40S ribosomal protein S6                                220   4e-69    Glycine soja [wild soybean]
emb|CCA15019.1|  40S ribosomal protein S6 putative                      219   1e-67    Albugo laibachii Nc14
gb|EPB91069.1|  40S ribosomal protein S6-B                              218   3e-67    Mucor circinelloides f. circinelloides 1006PhL
emb|CCI41749.1|  unnamed protein product                                218   3e-67    Albugo candida
ref|XP_009829688.1|  hypothetical protein H257_06234                    218   5e-67    Aphanomyces astaci
ref|XP_008873377.1|  hypothetical protein H310_09164                    218   5e-67    Aphanomyces invadans
gb|EPB90139.1|  40S ribosomal protein S6-B                              216   2e-66    Mucor circinelloides f. circinelloides 1006PhL
gb|KDO30078.1|  40S ribosomal protein S6                                216   2e-66    Saprolegnia parasitica CBS 223.65
emb|CEI94743.1|  Putative 40S ribosomal protein S6                      216   2e-66    Rhizopus microsporus
emb|CEG69949.1|  Putative 40S ribosomal protein S6                      216   2e-66    Rhizopus microsporus
gb|AAH61437.1|  40S ribosomal protein S6                                216   2e-66    Xenopus tropicalis [western clawed frog]
ref|XP_003137917.1|  40S ribosomal protein S6                           215   3e-66    
emb|CEG65631.1|  Putative 40S ribosomal protein S6                      217   3e-66    Rhizopus microsporus
gb|EIE84935.1|  40S ribosomal protein S6-B                              215   3e-66    Rhizopus delemar RA 99-880
emb|CEJ04523.1|  Putative 40S ribosomal protein S6                      215   4e-66    Rhizopus microsporus
ref|XP_008610660.1|  40S ribosomal protein S6                           215   4e-66    Saprolegnia diclina VS20
ref|XP_001901616.1|  40S ribosomal protein S6                           215   5e-66    Brugia malayi [agent of lymphatic filariasis]
gb|EFO26158.2|  40S ribosomal protein S6                                214   8e-66    Loa loa
gb|EJW80084.1|  ribosomal protein S6                                    212   1e-65    Wuchereria bancrofti [agent of lymphatic filariasis]
ref|XP_004549562.1|  PREDICTED: 40S ribosomal protein S6-like           214   2e-65    Maylandia zebra
gb|EPB85459.1|  40S ribosomal protein S6-B                              213   2e-65    Mucor circinelloides f. circinelloides 1006PhL
gb|EDL27941.1|  mCG6197                                                 213   2e-65    Mus musculus [mouse]
gb|EJD76600.1|  40S ribosomal protein S6, variant 2                     213   3e-65    Loa loa
gb|ERG81369.1|  40s ribosomal protein s6                                213   3e-65    
emb|CDS09425.1|  Putative 40S ribosomal protein S6                      213   3e-65    Lichtheimia ramosa
emb|CDS05199.1|  Putative 40S ribosomal protein S6                      213   3e-65    Lichtheimia ramosa
emb|CEP11147.1|  hypothetical protein                                   213   4e-65    Parasitella parasitica
gb|KCW54574.1|  hypothetical protein EUGRSUZ_I00534                     210   4e-65    Eucalyptus grandis [rose gum]
gb|ETE61175.1|  40S ribosomal protein S6                                213   5e-65    Ophiophagus hannah
ref|XP_004677742.1|  PREDICTED: 40S ribosomal protein S6                213   5e-65    Condylura cristata
gb|AFM86159.1|  ribosomal protein S6                                    213   5e-65    Callorhinchus milii [Australian ghost shark]
ref|XP_007634539.1|  PREDICTED: 40S ribosomal protein S6                212   6e-65    
emb|CDH60303.1|  40s ribosomal protein s6                               212   7e-65    Lichtheimia corymbifera JMRC:FSU:9682
emb|CDH59580.1|  40s ribosomal protein s6                               212   8e-65    Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_005946886.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    212   1e-64    
ref|XP_006355210.1|  PREDICTED: 40S ribosomal protein S6-like           209   2e-64    Solanum tuberosum [potatoes]
gb|ABW23139.1|  ribosomal protein rps6                                  209   2e-64    Arenicola marina [rock worm]
gb|AFM89156.1|  ribosomal protein S6                                    211   2e-64    Callorhinchus milii [Australian ghost shark]
gb|KJB48852.1|  hypothetical protein B456_008G090300                    209   2e-64    Gossypium raimondii
gb|AFM85534.1|  ribosomal protein S6                                    211   2e-64    Callorhinchus milii [Australian ghost shark]
ref|XP_003216654.1|  PREDICTED: 40S ribosomal protein S6                211   3e-64    Anolis carolinensis [Carolina anole]
ref|NP_001003728.1|  40S ribosomal protein S6                           211   3e-64    Danio rerio [leopard danio]
gb|AFM85774.1|  ribosomal protein S6                                    211   3e-64    Callorhinchus milii [Australian ghost shark]
ref|XP_006094861.1|  PREDICTED: 40S ribosomal protein S6                210   3e-64    Myotis lucifugus
ref|XP_003454240.1|  PREDICTED: 40S ribosomal protein S6-like           210   3e-64    Oreochromis niloticus
gb|ADM64584.1|  ribosomal protein S6                                    210   3e-64    Hypophthalmichthys nobilis [noble carp]
ref|XP_008782167.1|  PREDICTED: 40S ribosomal protein S6-like iso...    209   3e-64    Phoenix dactylifera
gb|AFM89013.1|  ribosomal protein S6                                    210   3e-64    
gb|AAI52628.1|  Zgc:92237                                               210   3e-64    
ref|XP_005880013.1|  PREDICTED: 40S ribosomal protein S6                210   3e-64    
gb|AFK10567.1|  ribosomal protein S6                                    210   3e-64    
ref|XP_005807209.1|  PREDICTED: 40S ribosomal protein S6-like           210   5e-64    
ref|XP_002525831.1|  40S ribosomal protein S6, putative                 208   5e-64    
ref|XP_008069493.1|  PREDICTED: 40S ribosomal protein S6                210   5e-64    
ref|NP_001279051.1|  ribosomal protein S6                               210   5e-64    
ref|XP_009204764.1|  PREDICTED: 40S ribosomal protein S6                209   6e-64    
ref|XP_004065930.1|  PREDICTED: 40S ribosomal protein S6                209   6e-64    
dbj|BAF45894.1|  ribosomal protein S6                                   209   7e-64    
ref|XP_010743206.1|  PREDICTED: 40S ribosomal protein S6                209   7e-64    
ref|XP_007535777.1|  PREDICTED: 40S ribosomal protein S6                209   8e-64    
gb|ERE66210.1|  40S ribosomal protein S6-like protein                   209   9e-64    
gb|KDO60704.1|  hypothetical protein CISIN_1g025698mg                   207   9e-64    
ref|XP_004373572.1|  PREDICTED: 40S ribosomal protein S6                209   1e-63    
ref|NP_033122.1|  40S ribosomal protein S6                              209   1e-63    
gb|ACO14480.1|  40S ribosomal protein S6                                209   1e-63    
ref|NP_001290657.1|  ribosomal protein S6                               209   1e-63    
gb|AAH27620.1|  Ribosomal protein S6                                    209   1e-63    
gb|AAX43323.1|  ribosomal protein S6                                    209   1e-63    
ref|XP_004311116.1|  PREDICTED: 40S ribosomal protein S6                209   1e-63    
ref|XP_008284743.1|  PREDICTED: 40S ribosomal protein S6                209   1e-63    
dbj|BAC25813.1|  unnamed protein product                                209   1e-63    
ref|XP_006881341.1|  PREDICTED: 40S ribosomal protein S6                209   1e-63    
ref|XP_008315087.1|  PREDICTED: 40S ribosomal protein S6                209   1e-63    
ref|XP_004404044.1|  PREDICTED: 40S ribosomal protein S6-like           209   1e-63    
ref|XP_005155033.1|  PREDICTED: 40S ribosomal protein S6 isoform X1     209   1e-63    
ref|XP_004658480.1|  PREDICTED: 40S ribosomal protein S6                209   1e-63    
ref|XP_006976343.1|  PREDICTED: 40S ribosomal protein S6-like           209   1e-63    
gb|AFM89653.1|  ribosomal protein S6                                    209   1e-63    
gb|ABZ04258.1|  ribosomal protein rps6                                  207   1e-63    
ref|XP_008582989.1|  PREDICTED: 40S ribosomal protein S6 isoform X2     209   2e-63    
gb|KDO48241.1|  hypothetical protein CISIN_1g025591mg                   207   2e-63    
ref|XP_006209289.1|  PREDICTED: 40S ribosomal protein S6-like           208   2e-63    
ref|NP_001015548.1|  40S ribosomal protein S6                           208   2e-63    
ref|XP_001363014.2|  PREDICTED: 40S ribosomal protein S6                208   2e-63    
ref|XP_011446088.1|  PREDICTED: 40S ribosomal protein S6-like           208   2e-63    
tpg|DAA63660.1|  TPA: putative 40S ribosomal protein S6                 207   2e-63    
ref|XP_004600231.1|  PREDICTED: 40S ribosomal protein S6                208   2e-63    
ref|XP_007423540.1|  PREDICTED: 40S ribosomal protein S6                208   2e-63    
gb|EJD76601.1|  40S ribosomal protein S6, variant 3                     207   2e-63    
gb|ELU05989.1|  hypothetical protein CAPTEDRAFT_160712                  209   2e-63    
gb|AAH13296.1|  Ribosomal protein S6                                    208   2e-63    
gb|AFM90218.1|  ribosomal protein S6                                    208   3e-63    
ref|XP_003472269.1|  PREDICTED: 40S ribosomal protein S6                208   3e-63    
ref|NP_001187071.1|  40S ribosomal protein S6                           208   3e-63    
ref|XP_005683689.1|  PREDICTED: 40S ribosomal protein S6                208   3e-63    
ref|XP_008688029.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    208   3e-63    
gb|EHH57369.1|  Phosphoprotein NP33                                     208   3e-63    
gb|ABN80445.1|  ribosomal protein S6                                    207   3e-63    
gb|ACH71013.1|  ribosomal protein S6-2                                  207   3e-63    
ref|XP_005242224.1|  PREDICTED: 40S ribosomal protein S6 isoform X1     207   4e-63    
ref|XP_006003764.1|  PREDICTED: 40S ribosomal protein S6                207   4e-63    
gb|ACH71012.1|  ribosomal protein S6-1                                  207   4e-63    
emb|CAG01285.1|  unnamed protein product                                207   4e-63    
ref|XP_003971993.1|  PREDICTED: 40S ribosomal protein S6-like           207   4e-63    
dbj|BAE38939.1|  unnamed protein product                                207   4e-63    
ref|XP_007237623.1|  PREDICTED: 40S ribosomal protein S6-like iso...    207   4e-63    
ref|XP_010724000.1|  PREDICTED: 40S ribosomal protein S6                207   4e-63    
ref|XP_004436828.1|  PREDICTED: 40S ribosomal protein S6                207   5e-63    
gb|ACN09990.1|  40S ribosomal protein S6                                207   5e-63    
gb|AFJ91756.1|  ribosomal protein S6                                    207   5e-63    
ref|XP_003995546.2|  PREDICTED: 40S ribosomal protein S6                209   5e-63    
ref|XP_001629284.1|  predicted protein                                  207   5e-63    
tpg|DAA26959.1|  TPA: 40S ribosomal protein S6                          206   6e-63    
gb|ACQ57903.1|  40S ribosomal protein S6                                207   6e-63    
ref|XP_010944327.1|  PREDICTED: 40S ribosomal protein S6                207   6e-63    
gb|KFZ58933.1|  40S ribosomal protein S6                                207   8e-63    
ref|NP_001191465.1|  40S ribosomal protein S6                           207   8e-63    
emb|CDP98623.1|  Protein BM-RPS-6, isoform b                            206   8e-63    
gb|AFM86798.1|  ribosomal protein S6                                    207   9e-63    
dbj|BAM99015.1|  ribosomal protein S6                                   206   9e-63    
ref|NP_001080171.1|  ribosomal protein S6                               206   1e-62    
tpg|DAA32337.1|  TPA: ribosomal protein S6-like                         206   1e-62    
ref|XP_008942004.1|  PREDICTED: 40S ribosomal protein S6                206   1e-62    
ref|XP_005155034.1|  PREDICTED: 40S ribosomal protein S6 isoform X2     206   2e-62    
ref|XP_005060955.1|  PREDICTED: 40S ribosomal protein S6                206   2e-62    
gb|ACO08923.1|  40S ribosomal protein S6                                206   2e-62    
tpg|DAA33322.1|  TPA: ribosomal protein S6-like                         206   2e-62    
gb|ELK29328.1|  40S ribosomal protein S6                                206   2e-62    
ref|XP_006180439.1|  PREDICTED: 40S ribosomal protein S6                206   2e-62    
gb|KFZ66132.1|  40S ribosomal protein S6                                205   3e-62    
ref|XP_009638335.1|  PREDICTED: 40S ribosomal protein S6                207   3e-62    
emb|CDQ64190.1|  unnamed protein product                                205   3e-62    
ref|XP_007967323.1|  PREDICTED: 40S ribosomal protein S6                205   3e-62    
ref|XP_004838392.1|  PREDICTED: 40S ribosomal protein S6 isoform X1     206   3e-62    
ref|XP_009508321.1|  PREDICTED: 40S ribosomal protein S6                205   3e-62    
ref|XP_003928182.1|  PREDICTED: 40S ribosomal protein S6                205   3e-62    
ref|XP_010166974.1|  PREDICTED: 40S ribosomal protein S6                206   3e-62    
gb|AAH09427.2|  RPS6 protein                                            205   3e-62    
ref|XP_005692718.1|  PREDICTED: 40S ribosomal protein S6-like           205   3e-62    
ref|XP_004002385.1|  PREDICTED: 40S ribosomal protein S6-like           205   4e-62    
ref|NP_989152.1|  ribosomal protein S6                                  205   4e-62    
gb|KIY93960.1|  40S ribosomal protein S6                                202   4e-62    
ref|XP_009864173.1|  PREDICTED: 40S ribosomal protein S6                206   4e-62    
gb|ACD65139.1|  putative 40S ribosomal protein RPS6                     204   4e-62    
ref|NP_001080589.1|  40S ribosomal protein S6                           205   5e-62    
gb|EMC84790.1|  40S ribosomal protein S6                                205   5e-62    
ref|XP_004885568.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    205   5e-62    
ref|XP_010775089.1|  PREDICTED: 40S ribosomal protein S6                205   5e-62    
ref|XP_005508203.1|  PREDICTED: 40S ribosomal protein S6 isoform X3     204   5e-62    
ref|XP_004405490.1|  PREDICTED: 40S ribosomal protein S6-like           204   5e-62    
ref|XP_005539185.1|  40S ribosomal protein S6                           204   5e-62    
ref|XP_009978903.1|  PREDICTED: 40S ribosomal protein S6                204   5e-62    
ref|XP_010017471.1|  PREDICTED: 40S ribosomal protein S6                205   6e-62    
ref|XP_007270385.1|  ribosomal protein S6e                              203   6e-62    
ref|XP_009819934.1|  PREDICTED: 40S ribosomal protein S6                204   6e-62    
gb|KFO30432.1|  40S ribosomal protein S6                                205   6e-62    
gb|AAA60288.1|  ribosomal protein s6                                    204   6e-62    
gb|EDL29549.1|  mCG22088                                                204   7e-62    
ref|NP_990556.1|  40S ribosomal protein S6                              204   7e-62    
gb|ELR51659.1|  40S ribosomal protein S6                                204   7e-62    
gb|KFV94312.1|  40S ribosomal protein S6                                204   7e-62    
gb|KHN48771.1|  40S ribosomal protein S6                                201   8e-62    
ref|NP_001117716.1|  40S ribosomal protein S6                           204   8e-62    
ref|XP_010491704.1|  PREDICTED: 40S ribosomal protein S6-2-like i...    202   8e-62    
ref|XP_005508201.1|  PREDICTED: 40S ribosomal protein S6 isoform X1     205   8e-62    
gb|EPY84384.1|  40S ribosomal protein S6-like protein                   205   9e-62    
emb|CBJ34010.1|  conserved unknown protein                              204   9e-62    
ref|XP_004465525.1|  PREDICTED: 40S ribosomal protein S6 isoform 1      204   9e-62    
ref|XP_009698171.1|  PREDICTED: 40S ribosomal protein S6                204   1e-61    
ref|XP_002615457.1|  hypothetical protein CLUG_04339                    203   1e-61    
ref|XP_005660137.1|  PREDICTED: 40S ribosomal protein S6 isoform X2     205   1e-61    
ref|XP_005660141.1|  PREDICTED: 40S ribosomal protein S6 isoform X6     204   1e-61    
gb|EDL76013.1|  rCG23030, isoform CRA_e                                 201   1e-61    
ref|XP_009940734.1|  PREDICTED: 40S ribosomal protein S6                204   1e-61    
ref|XP_005508202.1|  PREDICTED: 40S ribosomal protein S6 isoform X2     204   1e-61    
ref|XP_005013410.1|  PREDICTED: 40S ribosomal protein S6                204   1e-61    
gb|ABK32076.1|  ribosomal protein S6                                    203   1e-61    
gb|AAF18987.1|  ribosomal protein S6                                    204   1e-61    
gb|KFQ85509.1|  40S ribosomal protein S6                                204   1e-61    
ref|XP_010085051.1|  PREDICTED: 40S ribosomal protein S6                205   2e-61    
ref|XP_006869820.1|  PREDICTED: 40S ribosomal protein S6-like           203   2e-61    
ref|XP_009916380.1|  PREDICTED: 40S ribosomal protein S6                204   2e-61    
gb|EPQ16224.1|  40S ribosomal protein S6                                205   2e-61    
ref|XP_003911728.1|  PREDICTED: 40S ribosomal protein S6                203   2e-61    
gb|EDL30995.1|  mCG6542, isoform CRA_e                                  201   2e-61    
gb|KFP53888.1|  40S ribosomal protein S6                                203   2e-61    
ref|XP_009054706.1|  hypothetical protein LOTGIDRAFT_66846              202   2e-61    
ref|XP_006750825.1|  PREDICTED: 40S ribosomal protein S6-like           201   2e-61    
ref|XP_005322508.1|  PREDICTED: 40S ribosomal protein S6-like           205   2e-61    
ref|XP_009957475.1|  PREDICTED: 40S ribosomal protein S6                204   2e-61    
ref|XP_008042139.1|  40S ribosomal protein S6                           202   3e-61    
ref|XP_005694901.1|  PREDICTED: 40S ribosomal protein S6-like           203   3e-61    
emb|CCQ18665.1|  40S ribosomal protein S6                               202   3e-61    
gb|KFO97601.1|  40S ribosomal protein S6                                202   4e-61    
gb|KFP77452.1|  40S ribosomal protein S6                                202   4e-61    
ref|XP_009070030.1|  PREDICTED: 40S ribosomal protein S6                202   4e-61    
ref|XP_002741732.1|  PREDICTED: 40S ribosomal protein S6-like           202   5e-61    
gb|KFU85801.1|  40S ribosomal protein S6                                202   5e-61    
ref|XP_005441094.1|  PREDICTED: 40S ribosomal protein S6                203   5e-61    
ref|XP_006677808.1|  hypothetical protein BATDEDRAFT_19235              202   6e-61    
ref|XP_011270371.1|  ribosomal protein S6, variant                      202   6e-61    
ref|XP_006732954.1|  PREDICTED: 40S ribosomal protein S6-like           202   6e-61    
gb|KFW74304.1|  40S ribosomal protein S6                                202   6e-61    
gb|KJE93376.1|  ribosomal protein S6, variant 1                         202   7e-61    
ref|XP_008504096.1|  PREDICTED: 40S ribosomal protein S6                204   8e-61    
ref|XP_004631807.1|  PREDICTED: 40S ribosomal protein S6                203   8e-61    
ref|XP_001832136.1|  40S ribosomal protein S6                           201   8e-61    
emb|CEP15569.1|  hypothetical protein                                   201   9e-61    
gb|KJE93375.1|  ribosomal protein S6                                    202   9e-61    
emb|CEP07934.1|  hypothetical protein                                   201   9e-61    
ref|XP_005827228.1|  small subunit ribosomal protein S6e, cytopla...    201   1e-60    
ref|XP_002111070.1|  expressed hypothetical protein                     202   1e-60    
ref|XP_007950728.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    201   1e-60    
gb|ELK06982.1|  40S ribosomal protein S6                                204   1e-60    
gb|AAA60287.1|  ribosomal protein S6                                    201   1e-60    
ref|XP_002142786.1|  40S ribosomal protein S6                           200   1e-60    
ref|XP_009469285.1|  PREDICTED: 40S ribosomal protein S6                203   1e-60    
ref|XP_009041386.1|  hypothetical protein AURANDRAFT_55398              201   1e-60    
emb|CCA23177.1|  40S ribosomal protein S6 putative                      215   1e-60    
ref|NP_001190274.1|  40S ribosomal protein S6-2                         199   1e-60    
gb|ADW95786.1|  40S ribosomal S6-like protein                           201   1e-60    
ref|XP_005682089.1|  PREDICTED: 40S ribosomal protein S6-like           201   1e-60    
ref|XP_004347999.2|  ribosomal protein S6                               202   1e-60    
emb|CCA23176.1|  40S ribosomal protein S6 putative                      215   2e-60    
gb|ACO08909.1|  40S ribosomal protein S6                                198   2e-60    
gb|ACS72283.1|  ribosomal protein S6                                    201   2e-60    
ref|XP_007368911.1|  ribosomal protein S6e                              201   2e-60    
ref|XP_006130060.1|  PREDICTED: 40S ribosomal protein S6                203   2e-60    
ref|XP_006629787.1|  PREDICTED: 40S ribosomal protein S6-like           200   2e-60    
ref|XP_009570700.1|  PREDICTED: 40S ribosomal protein S6                202   2e-60    
gb|KFH64581.1|  40S ribosomal protein S6                                200   2e-60    
ref|XP_008933154.1|  PREDICTED: 40S ribosomal protein S6                201   2e-60    
ref|XP_007176859.1|  PREDICTED: 40S ribosomal protein S6                200   2e-60    
gb|EWC47649.1|  40S ribosomal protein S6-B                              200   2e-60    
ref|XP_004270102.1|  PREDICTED: 40S ribosomal protein S6-like           200   2e-60    
sp|O01727.1|RS6_BRAFL  RecName: Full=40S ribosomal protein S6           200   2e-60    
ref|XP_009481341.1|  PREDICTED: 40S ribosomal protein S6                203   3e-60    
gb|EDL35850.1|  mCG10567                                                200   3e-60    
ref|XP_003474170.1|  PREDICTED: 40S ribosomal protein S6-like           200   3e-60    
ref|XP_010186220.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    202   4e-60    
gb|EDL76011.1|  rCG23030, isoform CRA_c                                 197   4e-60    
prf||1403252A  ribosomal protein S6                                     200   4e-60 
ref|XP_010006787.1|  PREDICTED: 40S ribosomal protein S6                201   4e-60    
gb|AFM74231.1|  40S ribosomal protein S6                                199   4e-60    
ref|XP_009690514.1|  40S ribosomal protein S6                           199   4e-60    
ref|XP_005977735.1|  PREDICTED: 40S ribosomal protein S6                200   5e-60    
ref|XP_008702483.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    199   5e-60    
gb|ESA09000.1|  hypothetical protein GLOINDRAFT_348870                  199   5e-60    
ref|XP_003737895.1|  PREDICTED: 40S ribosomal protein S6-like           202   7e-60    
ref|XP_007099175.1|  PREDICTED: LOW QUALITY PROTEIN: ribosomal pr...    201   7e-60    
gb|ABX44778.1|  putative 40S ribosomal protein RPS6                     199   7e-60    
gb|KIM35681.1|  hypothetical protein M413DRAFT_32337                    201   8e-60    
gb|EJT51175.1|  hypothetical protein A1Q1_07639                         198   1e-59    
ref|XP_007007283.1|  hypothetical protein TREMEDRAFT_40747              198   1e-59    
ref|XP_003027700.1|  40S ribosomal protein S6                           199   1e-59    
ref|XP_005491009.1|  PREDICTED: 40S ribosomal protein S6                201   1e-59    
ref|XP_010562775.1|  PREDICTED: 40S ribosomal protein S6                204   1e-59    
ref|XP_005074391.1|  PREDICTED: 40S ribosomal protein S6                198   1e-59    
ref|XP_005677723.1|  PREDICTED: 40S ribosomal protein S6-like           198   1e-59    
gb|AAX48882.1|  S6                                                      198   1e-59    
emb|CAD27733.1|  S6 ribosomal protein                                   198   2e-59    
ref|XP_009326441.1|  PREDICTED: 40S ribosomal protein S6                201   2e-59    
ref|XP_505593.1|  40S ribosomal protein S6                              198   2e-59    
emb|CDO71009.1|  hypothetical protein BN946_scf184844.g13               198   2e-59    
ref|XP_009025699.1|  hypothetical protein HELRODRAFT_107583             199   2e-59    
ref|XP_952228.1|  40S ribosomal subunit protein S6                      197   2e-59    
ref|XP_765053.1|  40S ribosomal protein S6                              197   2e-59    
gb|EDL25802.1|  mCG7176                                                 197   3e-59    



>ref|XP_011022822.1| PREDICTED: 40S ribosomal protein S6 [Populus euphratica]
Length=249

 Score =   315 bits (806),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 171/179 (96%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD+EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTKSGKK SKAPK
Sbjct  121  NDLPGLTDVEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKVSKAPK  179



>gb|KDP41410.1| hypothetical protein JCGZ_15817 [Jatropha curcas]
Length=249

 Score =   314 bits (804),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 171/179 (96%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
             DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR+FTTKSGKK SKAPK
Sbjct  121  QDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRSFTTKSGKKVSKAPK  179



>ref|XP_002531669.1| 40S ribosomal protein S6, putative [Ricinus communis]
 gb|EEF30713.1| 40S ribosomal protein S6, putative [Ricinus communis]
Length=247

 Score =   313 bits (803),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 171/179 (96%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD+EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTKSGKK SKAPK
Sbjct  121  NDLPGLTDVEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKVSKAPK  179



>ref|XP_011031062.1| PREDICTED: 40S ribosomal protein S6-like [Populus euphratica]
Length=249

 Score =   313 bits (803),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 170/179 (95%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD+EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTKSGKK SKAP+
Sbjct  121  NDLPGLTDVEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKVSKAPR  179



>ref|XP_009780041.1| PREDICTED: 40S ribosomal protein S6 [Nicotiana sylvestris]
Length=249

 Score =   313 bits (803),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 172/179 (96%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALGDEFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLYRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRRNFTTK+GKKASKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRNFTTKTGKKASKAPK  179



>gb|KDP29722.1| hypothetical protein JCGZ_18657 [Jatropha curcas]
Length=249

 Score =   313 bits (803),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 171/179 (96%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
             DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTKSGKK SKAPK
Sbjct  121  QDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKVSKAPK  179



>ref|XP_009622898.1| PREDICTED: 40S ribosomal protein S6 [Nicotiana tomentosiformis]
Length=249

 Score =   313 bits (802),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 172/179 (96%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALGDEFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLYRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRRNFTTK+GKKASKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRNFTTKNGKKASKAPK  179



>ref|XP_002306298.1| hypothetical protein POPTR_0005s07380g [Populus trichocarpa]
 ref|XP_006382894.1| hypothetical protein POPTR_0005s07380g [Populus trichocarpa]
 gb|ABK94702.1| unknown [Populus trichocarpa]
 gb|EEE93294.1| hypothetical protein POPTR_0005s07380g [Populus trichocarpa]
 gb|ERP60691.1| hypothetical protein POPTR_0005s07380g [Populus trichocarpa]
Length=249

 Score =   313 bits (802),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 171/179 (96%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLYRGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD+EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTKSGKK SKAPK
Sbjct  121  NDLPGLTDVEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKVSKAPK  179



>ref|XP_011003031.1| PREDICTED: 40S ribosomal protein S6-like [Populus euphratica]
Length=249

 Score =   313 bits (801),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 170/179 (95%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR+FTTK+GKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRSFTTKAGKKVSKAPK  179



>gb|KJB79633.1| hypothetical protein B456_013G060000 [Gossypium raimondii]
Length=250

 Score =   313 bits (801),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 170/179 (95%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEV+GDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVAGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTKSGKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKVSKAPK  179



>gb|KHG29581.1| 40S ribosomal S6 [Gossypium arboreum]
 gb|KJB77542.1| hypothetical protein B456_012G142800 [Gossypium raimondii]
Length=249

 Score =   313 bits (801),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 170/179 (95%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEV+GDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVAGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTKSGKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKVSKAPK  179



>ref|XP_002309965.1| hypothetical protein POPTR_0007s05090g [Populus trichocarpa]
 gb|EEE90415.1| hypothetical protein POPTR_0007s05090g [Populus trichocarpa]
Length=249

 Score =   312 bits (800),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 170/179 (95%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EF GYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFNGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD+EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTKSGKK SKAPK
Sbjct  121  NDLPGLTDVEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKVSKAPK  179



>ref|XP_002285752.1| PREDICTED: 40S ribosomal protein S6 [Vitis vinifera]
 emb|CBI19191.3| unnamed protein product [Vitis vinifera]
Length=249

 Score =   312 bits (800),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 170/179 (95%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EF GYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFNGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRV LLL RGTPCFRGYGRRNGERRRK+VRGCIVSQDLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVSLLLHRGTPCFRGYGRRNGERRRKAVRGCIVSQDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            SDLPGLTD EKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRR+FTTKSGKK SKAPK
Sbjct  121  SDLPGLTDTEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRSFTTKSGKKCSKAPK  179



>ref|XP_009782102.1| PREDICTED: 40S ribosomal protein S6-like [Nicotiana sylvestris]
Length=249

 Score =   312 bits (799),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 171/179 (96%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEV+GDALGDEFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVAGDALGDEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLYRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRRNFTTK+GKKASKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRNFTTKTGKKASKAPK  179



>gb|KDP40920.1| hypothetical protein JCGZ_24919 [Jatropha curcas]
Length=249

 Score =   312 bits (799),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 171/179 (96%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTKSGKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKVSKAPK  179



>ref|XP_009413629.1| PREDICTED: 40S ribosomal protein S6-like [Musa acuminata subsp. 
malaccensis]
Length=249

 Score =   312 bits (799),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 171/179 (96%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTDIEKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTKSGKK SKAPK
Sbjct  121  NDLPGLTDIEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKCSKAPK  179



>ref|XP_009612288.1| PREDICTED: 40S ribosomal protein S6-like [Nicotiana tomentosiformis]
Length=249

 Score =   312 bits (799),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 171/179 (96%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEV+GDALGDEFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVAGDALGDEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLYRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRRNFTTK+GKKASKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRNFTTKNGKKASKAPK  179



>ref|XP_009758302.1| PREDICTED: 40S ribosomal protein S6-like [Nicotiana sylvestris]
Length=249

 Score =   312 bits (799),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 171/179 (96%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQ+KLEIDDDQKLRAFF KRISQEVSGDALGDEFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQRKLEIDDDQKLRAFFDKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLYRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
             DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRRNFTTK+GKKASKAPK
Sbjct  121  KDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRNFTTKTGKKASKAPK  179



>ref|XP_009603690.1| PREDICTED: 40S ribosomal protein S6-like [Nicotiana tomentosiformis]
Length=249

 Score =   312 bits (799),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 171/179 (96%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQ+KLEIDDDQKLRAFF KRISQEVSGDALGDEFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQRKLEIDDDQKLRAFFDKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLYRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
             DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRRNFTTK+GKKASKAPK
Sbjct  121  KDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRNFTTKTGKKASKAPK  179



>ref|XP_007018728.1| Ribosomal protein S6e [Theobroma cacao]
 gb|EOY15953.1| Ribosomal protein S6e [Theobroma cacao]
Length=249

 Score =   312 bits (799),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 171/179 (96%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTDIEKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR+FTTK+GKKASKAPK
Sbjct  121  NDLPGLTDIEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRSFTTKTGKKASKAPK  179



>ref|XP_009404037.1| PREDICTED: 40S ribosomal protein S6-like [Musa acuminata subsp. 
malaccensis]
Length=249

 Score =   312 bits (799),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 171/179 (96%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTDIEKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTKSGKK SKAPK
Sbjct  121  NDLPGLTDIEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKCSKAPK  179



>ref|XP_009380211.1| PREDICTED: 40S ribosomal protein S6 [Musa acuminata subsp. malaccensis]
Length=249

 Score =   311 bits (798),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 171/179 (96%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTDIEKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTKSGKK SKAPK
Sbjct  121  NDLPGLTDIEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKCSKAPK  179



>gb|KJB44104.1| hypothetical protein B456_007G234700 [Gossypium raimondii]
Length=249

 Score =   311 bits (798),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 171/179 (96%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTKSGKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKVSKAPK  179



>ref|XP_009390279.1| PREDICTED: 40S ribosomal protein S6 [Musa acuminata subsp. malaccensis]
Length=249

 Score =   311 bits (798),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 171/179 (96%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTDIEKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTKSGKK SKAPK
Sbjct  121  NDLPGLTDIEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKCSKAPK  179



>gb|KHG00252.1| 40S ribosomal S6 [Gossypium arboreum]
 gb|KJB18231.1| hypothetical protein B456_003G041100 [Gossypium raimondii]
Length=249

 Score =   311 bits (798),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 171/179 (96%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTKSGKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKVSKAPK  179



>gb|KHG15571.1| 40S ribosomal S6 [Gossypium arboreum]
Length=249

 Score =   311 bits (798),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 171/179 (96%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EFKGYVFKI GGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYVFKIKGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR+FTTKSGKKASKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRSFTTKSGKKASKAPK  179



>ref|XP_009390908.1| PREDICTED: 40S ribosomal protein S6-like [Musa acuminata subsp. 
malaccensis]
Length=249

 Score =   311 bits (798),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 171/179 (96%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTDIEKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTKSGKK SKAPK
Sbjct  121  NDLPGLTDIEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKCSKAPK  179



>ref|XP_002442150.1| hypothetical protein SORBIDRAFT_08g015010 [Sorghum bicolor]
 gb|EES15988.1| hypothetical protein SORBIDRAFT_08g015010 [Sorghum bicolor]
Length=251

 Score =   311 bits (797),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 170/179 (95%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLR FF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRVFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVSQDLSV+NLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVINLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRR FTTKSGKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRTFTTKSGKKVSKAPK  179



>ref|XP_002306568.1| hypothetical protein POPTR_0005s17280g [Populus trichocarpa]
 gb|ABK93192.1| unknown [Populus trichocarpa]
 gb|EEE93564.1| hypothetical protein POPTR_0005s17280g [Populus trichocarpa]
Length=249

 Score =   311 bits (796),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 170/179 (95%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLYRGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR+FTTK+GKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRSFTTKAGKKVSKAPK  179



>ref|XP_008444852.1| PREDICTED: LOW QUALITY PROTEIN: 40S ribosomal protein S6-like 
[Cucumis melo]
Length=249

 Score =   311 bits (796),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGD+LG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDSLGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKG+
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGD  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR+FTTKSGKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRSFTTKSGKKVSKAPK  179



>ref|NP_001275029.1| 40S ribosomal protein S6-like [Solanum tuberosum]
 gb|ABB87117.1| unknown [Solanum tuberosum]
Length=249

 Score =   311 bits (796),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRG+GRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLYRGTPCFRGHGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRRNFTTK+GK ASKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRNFTTKTGKNASKAPK  179



>gb|KHG00333.1| 40S ribosomal S6 [Gossypium arboreum]
Length=250

 Score =   311 bits (796),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEV+GD LG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVAGDTLGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTKSGKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKVSKAPK  179



>ref|XP_002273865.1| PREDICTED: 40S ribosomal protein S6 isoform X1 [Vitis vinifera]
 ref|XP_010652675.1| PREDICTED: 40S ribosomal protein S6 isoform X1 [Vitis vinifera]
 ref|XP_010652676.1| PREDICTED: 40S ribosomal protein S6 isoform X1 [Vitis vinifera]
 ref|XP_010652677.1| PREDICTED: 40S ribosomal protein S6 isoform X2 [Vitis vinifera]
 emb|CBI33138.3| unnamed protein product [Vitis vinifera]
Length=249

 Score =   311 bits (796),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRV+LLL RGTPCFRGYGRRNGERRRK+VRGCIVSQDLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVQLLLHRGTPCFRGYGRRNGERRRKAVRGCIVSQDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
             +LPGLTD+EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTKSGKK SKAPK
Sbjct  121  GELPGLTDVEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKCSKAPK  179



>ref|XP_008778719.1| PREDICTED: 40S ribosomal protein S6-like isoform X1 [Phoenix 
dactylifera]
Length=249

 Score =   310 bits (795),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 171/179 (96%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTDIEKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTKSGKK SKAPK
Sbjct  121  NDLPGLTDIEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKCSKAPK  179



>ref|XP_002513953.1| 40S ribosomal protein S6, putative [Ricinus communis]
 gb|EEF48536.1| 40S ribosomal protein S6, putative [Ricinus communis]
Length=249

 Score =   310 bits (795),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 170/179 (95%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKG+
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGD  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR+FTTKSGKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRSFTTKSGKKVSKAPK  179



>gb|ADR71291.1| 40S ribosomal protein S6A [Hevea brasiliensis]
Length=249

 Score =   310 bits (795),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 170/179 (95%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSHDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTKSGKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKVSKAPK  179



>ref|XP_004244462.1| PREDICTED: 40S ribosomal protein S6-like [Solanum lycopersicum]
Length=249

 Score =   310 bits (795),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGD+LG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDSLGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRRNFTTK+GK ASKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRNFTTKTGKNASKAPK  179



>ref|XP_010937382.1| PREDICTED: 40S ribosomal protein S6 isoform X1 [Elaeis guineensis]
Length=249

 Score =   310 bits (794),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 171/179 (96%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTDIEKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTKSGKK SKAPK
Sbjct  121  NDLPGLTDIEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKCSKAPK  179



>ref|XP_007047873.1| Ribosomal protein S6e isoform 1 [Theobroma cacao]
 ref|XP_007047874.1| Ribosomal protein S6e isoform 1 [Theobroma cacao]
 gb|EOX92030.1| Ribosomal protein S6e isoform 1 [Theobroma cacao]
 gb|EOX92031.1| Ribosomal protein S6e isoform 1 [Theobroma cacao]
Length=249

 Score =   310 bits (794),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 170/179 (95%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR F TKSGKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFNTKSGKKVSKAPK  179



>gb|KJB48851.1| hypothetical protein B456_008G090300 [Gossypium raimondii]
Length=249

 Score =   310 bits (794),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 170/179 (95%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTK+GKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKNGKKVSKAPK  179



>ref|XP_010939689.1| PREDICTED: 40S ribosomal protein S6 isoform X1 [Elaeis guineensis]
Length=249

 Score =   310 bits (794),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EF+GYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFQGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRR+GERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRDGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTDIEKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTKSGKK SKAPK
Sbjct  121  NDLPGLTDIEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKCSKAPK  179



>ref|XP_008790913.1| PREDICTED: 40S ribosomal protein S6 [Phoenix dactylifera]
Length=249

 Score =   310 bits (794),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 171/179 (96%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTDIEKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTKSGKK SKAPK
Sbjct  121  NDLPGLTDIEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKCSKAPK  179



>ref|XP_002271632.1| PREDICTED: 40S ribosomal protein S6 [Vitis vinifera]
 emb|CBI34076.3| unnamed protein product [Vitis vinifera]
Length=249

 Score =   310 bits (794),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAF+ KRISQEV+GDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFYDKRISQEVNGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRV LLL RGTPCFRGYGRRNGERRRK+VRGCIVSQDLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVSLLLHRGTPCFRGYGRRNGERRRKAVRGCIVSQDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            SDLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTKSGKK SKAPK
Sbjct  121  SDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKCSKAPK  179



>gb|KCW54573.1| hypothetical protein EUGRSUZ_I00534 [Eucalyptus grandis]
Length=232

 Score =   309 bits (792),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 170/179 (95%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EF GYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFNGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            S+LPGLTDIEKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTK+GKK SKAPK
Sbjct  121  SELPGLTDIEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKAGKKVSKAPK  179



>ref|XP_004133785.1| PREDICTED: 40S ribosomal protein S6-like [Cucumis sativus]
 ref|XP_004155185.1| PREDICTED: 40S ribosomal protein S6-like [Cucumis sativus]
 gb|KGN56379.1| hypothetical protein Csa_3G118140 [Cucumis sativus]
Length=250

 Score =   310 bits (793),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEV+GD+LG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVAGDSLGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKG+
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGD  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR+FTTKSGKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRSFTTKSGKKVSKAPK  179



>gb|KHG05484.1| 40S ribosomal S6 [Gossypium arboreum]
Length=249

 Score =   310 bits (793),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 170/179 (95%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRV LLL RGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVHLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTKSGKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKVSKAPK  179



>ref|XP_008804777.1| PREDICTED: 40S ribosomal protein S6 [Phoenix dactylifera]
Length=249

 Score =   309 bits (792),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAF+ KRISQEVSGD+LG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFYDKRISQEVSGDSLGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTDIEKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTKSGKK SKAPK
Sbjct  121  NDLPGLTDIEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKCSKAPK  179



>ref|XP_008778720.1| PREDICTED: 40S ribosomal protein S6-like isoform X2 [Phoenix 
dactylifera]
Length=249

 Score =   309 bits (792),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 170/179 (95%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            M+FNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MQFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTDIEKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTKSGKK SKAPK
Sbjct  121  NDLPGLTDIEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKCSKAPK  179



>ref|XP_010548594.1| PREDICTED: 40S ribosomal protein S6-2 [Tarenaya hassleriana]
Length=250

 Score =   309 bits (792),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTK+GKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKTGKKVSKAPK  179



>ref|XP_011097538.1| PREDICTED: 40S ribosomal protein S6 [Sesamum indicum]
Length=248

 Score =   309 bits (792),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLR F+ KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRVFWDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTDIEKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTKSGKK SKAPK
Sbjct  121  NDLPGLTDIEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKVSKAPK  179



>ref|XP_010552269.1| PREDICTED: 40S ribosomal protein S6-like [Tarenaya hassleriana]
Length=249

 Score =   309 bits (792),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTK+GKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKTGKKVSKAPK  179



>ref|XP_010523300.1| PREDICTED: 40S ribosomal protein S6-2-like [Tarenaya hassleriana]
Length=250

 Score =   309 bits (792),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EF+GYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFRGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTKSGKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKVSKAPK  179



>ref|XP_010937383.1| PREDICTED: 40S ribosomal protein S6 isoform X2 [Elaeis guineensis]
Length=249

 Score =   309 bits (791),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 170/179 (95%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            M+FNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MQFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTDIEKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTKSGKK SKAPK
Sbjct  121  NDLPGLTDIEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKCSKAPK  179



>ref|XP_004152628.1| PREDICTED: 40S ribosomal protein S6-like [Cucumis sativus]
 ref|XP_004168910.1| PREDICTED: 40S ribosomal protein S6-like [Cucumis sativus]
 gb|KGN62705.1| hypothetical protein Csa_2G369060 [Cucumis sativus]
Length=249

 Score =   309 bits (791),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGD+LG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDSLGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKG+
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGD  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR+FTTK+GKK SKAPK
Sbjct  121  NDLPGLTDSEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRSFTTKAGKKVSKAPK  179



>ref|XP_004246081.1| PREDICTED: 40S ribosomal protein S6-like [Solanum lycopersicum]
Length=249

 Score =   309 bits (791),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGD+LG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDSLGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLYRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRRNFTTK+GK ASKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRNFTTKTGKNASKAPK  179



>emb|CDP01503.1| unnamed protein product [Coffea canephora]
Length=249

 Score =   309 bits (791),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLR F+ KRISQEVSGDALGDEFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRIFWDKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTDIEKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTK+GKK SKAPK
Sbjct  121  NDLPGLTDIEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKAGKKVSKAPK  179



>ref|XP_010939691.1| PREDICTED: 40S ribosomal protein S6 isoform X2 [Elaeis guineensis]
Length=249

 Score =   308 bits (790),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            M+FNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EF+GYVFKIMGGCDKQG
Sbjct  1    MQFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFQGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRR+GERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRDGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTDIEKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTKSGKK SKAPK
Sbjct  121  NDLPGLTDIEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKCSKAPK  179



>ref|XP_010267142.1| PREDICTED: 40S ribosomal protein S6-like [Nelumbo nucifera]
Length=249

 Score =   308 bits (790),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 170/179 (95%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK DDVRKYVNTYRR FTTKSGKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKQDDVRKYVNTYRRTFTTKSGKKCSKAPK  179



>ref|XP_002300192.1| hypothetical protein POPTR_0001s31850g [Populus trichocarpa]
 gb|ABK92992.1| unknown [Populus trichocarpa]
 gb|EEE84997.1| hypothetical protein POPTR_0001s31850g [Populus trichocarpa]
Length=249

 Score =   308 bits (790),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGD+LG+EF GYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDSLGEEFNGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKG+
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGD  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTKSGKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKVSKAPK  179



>ref|XP_010519365.1| PREDICTED: 40S ribosomal protein S6 [Tarenaya hassleriana]
Length=250

 Score =   308 bits (790),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EFKGY+FKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYIFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTK+GKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKTGKKVSKAPK  179



>ref|XP_010060040.1| PREDICTED: 40S ribosomal protein S6-2 [Eucalyptus grandis]
 gb|KCW66569.1| hypothetical protein EUGRSUZ_F00368 [Eucalyptus grandis]
Length=249

 Score =   308 bits (790),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KR+SQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRLSQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            S+LPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTK+GKK SKAPK
Sbjct  121  SELPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKAGKKVSKAPK  179



>gb|KJB79635.1| hypothetical protein B456_013G060000 [Gossypium raimondii]
Length=251

 Score =   308 bits (790),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 170/180 (94%), Positives = 174/180 (97%), Gaps = 1/180 (1%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEV+GDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVAGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQR-GTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKG  431
            FPMKQGVLTPGRVRLLL R GTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKG
Sbjct  61   FPMKQGVLTPGRVRLLLHRAGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKG  120

Query  432  ESDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            E+DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTKSGKK SKAPK
Sbjct  121  ENDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKVSKAPK  180



>ref|XP_006854035.1| hypothetical protein AMTR_s00048p00058600 [Amborella trichopoda]
 gb|ERN15502.1| hypothetical protein AMTR_s00048p00058600 [Amborella trichopoda]
Length=249

 Score =   308 bits (789),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAF+ KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFYDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTK+GKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKAGKKCSKAPK  179



>ref|XP_004958354.1| PREDICTED: 40S ribosomal protein S6-like [Setaria italica]
Length=251

 Score =   308 bits (789),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLT GRVRLLL RGTPCFRGYGRR+GERRRKSVRGCIVSQDLSV+NLVIVKKGE
Sbjct  61   FPMKQGVLTSGRVRLLLHRGTPCFRGYGRRDGERRRKSVRGCIVSQDLSVINLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRR FTTK+GKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRTFTTKNGKKVSKAPK  179



>ref|XP_006421173.1| hypothetical protein CICLE_v10005711mg [Citrus clementina]
 ref|XP_006491492.1| PREDICTED: 40S ribosomal protein S6-like [Citrus sinensis]
 gb|ESR34413.1| hypothetical protein CICLE_v10005711mg [Citrus clementina]
 gb|KDO48240.1| hypothetical protein CISIN_1g025591mg [Citrus sinensis]
Length=250

 Score =   308 bits (789),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRR+GERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRDGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
             DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTK+GKK SKAPK
Sbjct  121  HDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKTGKKVSKAPK  179



>ref|XP_011045728.1| PREDICTED: 40S ribosomal protein S6-like [Populus euphratica]
Length=249

 Score =   308 bits (789),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGD+LG+EF GYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDSLGEEFNGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKG+
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGD  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTKSGKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKVSKAPK  179



>gb|KJB77543.1| hypothetical protein B456_012G142800 [Gossypium raimondii]
Length=250

 Score =   308 bits (789),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 170/180 (94%), Positives = 174/180 (97%), Gaps = 1/180 (1%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEV+GDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVAGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQR-GTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKG  431
            FPMKQGVLTPGRVRLLL R GTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKG
Sbjct  61   FPMKQGVLTPGRVRLLLHRAGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKG  120

Query  432  ESDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            E+DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTKSGKK SKAPK
Sbjct  121  ENDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKVSKAPK  180



>gb|ABK24202.1| unknown [Picea sitchensis]
Length=253

 Score =   308 bits (789),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAF+ KR+SQEV+GDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFYDKRLSQEVNGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRG+GRR GERRRKSVRGCIVSQDLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGFGRRKGERRRKSVRGCIVSQDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNL+KDDDVRKYVNTYRR F TKSGKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLTKDDDVRKYVNTYRRTFVTKSGKKCSKAPK  179



>ref|XP_010917302.1| PREDICTED: 40S ribosomal protein S6-like [Elaeis guineensis]
Length=249

 Score =   308 bits (788),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 170/179 (95%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGD+LG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDSLGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTDIEKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTKSGKK SKAPK
Sbjct  121  NDLPGLTDIEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKCSKAPK  179



>ref|XP_006842435.1| hypothetical protein AMTR_s00077p00035710 [Amborella trichopoda]
 gb|ERN04110.1| hypothetical protein AMTR_s00077p00035710 [Amborella trichopoda]
Length=249

 Score =   308 bits (788),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAF+ KRISQEVSGDALG+EF GYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFYDKRISQEVSGDALGEEFNGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRR+GERRRKSVRGCIVSQDLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRDGERRRKSVRGCIVSQDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKY+NTYRR FTTK+GKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYINTYRRTFTTKAGKKVSKAPK  179



>ref|NP_001060313.1| Os07g0622100 [Oryza sativa Japonica Group]
 dbj|BAC10193.1| putative 40S ribosomal protein S6 [Oryza sativa Japonica Group]
 dbj|BAF22227.1| Os07g0622100 [Oryza sativa Japonica Group]
 gb|EAZ04750.1| hypothetical protein OsI_26912 [Oryza sativa Indica Group]
 gb|EAZ40700.1| hypothetical protein OsJ_25168 [Oryza sativa Japonica Group]
 dbj|BAG91448.1| unnamed protein product [Oryza sativa Japonica Group]
Length=250

 Score =   308 bits (788),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLT GRVRLLL RGTPCFRGYGRR+GERRRKSVRGCIVSQDLSV+NLVIVKKGE
Sbjct  61   FPMKQGVLTAGRVRLLLHRGTPCFRGYGRRDGERRRKSVRGCIVSQDLSVINLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRR FTTK+GKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRTFTTKNGKKVSKAPK  179



>gb|KFK25336.1| hypothetical protein AALP_AA8G099500 [Arabis alpina]
Length=249

 Score =   307 bits (787),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAF+ KR+SQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFYDKRLSQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRG+GRR GERRRKSVRGCIVSQDLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGHGRRTGERRRKSVRGCIVSQDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            SDLPGLTD EKPRMRGPKRASKIRKLFNL K+DDVRKYVNTYRR FT K GKK SKAPK
Sbjct  121  SDLPGLTDTEKPRMRGPKRASKIRKLFNLGKEDDVRKYVNTYRRTFTNKKGKKVSKAPK  179



>ref|XP_006466259.1| PREDICTED: 40S ribosomal protein S6-like [Citrus sinensis]
Length=249

 Score =   307 bits (787),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEV+GDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVNGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRR+GERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRDGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
             DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTKSGKK SKAPK
Sbjct  121  HDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKVSKAPK  179



>ref|XP_006426342.1| hypothetical protein CICLE_v10026340mg [Citrus clementina]
 gb|ESR39582.1| hypothetical protein CICLE_v10026340mg [Citrus clementina]
 gb|KDO60703.1| hypothetical protein CISIN_1g025698mg [Citrus sinensis]
Length=249

 Score =   307 bits (787),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEV+GDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVNGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRR+GERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRDGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
             DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTKSGKK SKAPK
Sbjct  121  HDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKVSKAPK  179



>ref|XP_010259864.1| PREDICTED: 40S ribosomal protein S6-like isoform X1 [Nelumbo 
nucifera]
Length=249

 Score =   307 bits (787),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 170/179 (95%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK DDVRKYVNTYRR FTTKSGKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKQDDVRKYVNTYRRTFTTKSGKKCSKAPK  179



>ref|XP_010273000.1| PREDICTED: 40S ribosomal protein S6 [Nelumbo nucifera]
 ref|XP_010273001.1| PREDICTED: 40S ribosomal protein S6 [Nelumbo nucifera]
Length=249

 Score =   307 bits (787),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLF+LSK DDVRKYVNTYRR FTTKSGKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFDLSKQDDVRKYVNTYRRTFTTKSGKKCSKAPK  179



>ref|XP_008782166.1| PREDICTED: 40S ribosomal protein S6-like isoform X1 [Phoenix 
dactylifera]
Length=249

 Score =   307 bits (786),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKK+EIDDDQKLRAFF KRISQEVSGDALG+EF GYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKIEIDDDQKLRAFFDKRISQEVSGDALGEEFNGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTDIEKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTKSGKK SKAPK
Sbjct  121  NDLPGLTDIEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKCSKAPK  179



>pdb|3J60|G Chain G, Localization Of The Small Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
Length=245

 Score =   306 bits (785),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLT GRVRLLL RGTPCFRGYGRR+GERRRKSVRGCIVSQDLSV+NLVIVKKGE
Sbjct  61   FPMKQGVLTAGRVRLLLHRGTPCFRGYGRRDGERRRKSVRGCIVSQDLSVINLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRR FTTK+GKK  KAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRTFTTKNGKKVXKAPK  179



>ref|XP_006853279.1| hypothetical protein AMTR_s00038p00238890 [Amborella trichopoda]
 gb|ERN14746.1| hypothetical protein AMTR_s00038p00238890 [Amborella trichopoda]
Length=249

 Score =   307 bits (786),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAF+ KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFYDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RG PCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGIPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTKSGKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKCSKAPK  179



>gb|KJB64238.1| hypothetical protein B456_010G038700 [Gossypium raimondii]
Length=249

 Score =   306 bits (785),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEV GDALG+EFKGYVFKI GGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVIGDALGEEFKGYVFKIKGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKG+
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGD  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR+FTTKSGKKASKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRSFTTKSGKKASKAPK  179



>gb|ADR71292.1| 40S ribosomal protein S6B [Hevea brasiliensis]
Length=249

 Score =   306 bits (785),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGD+LG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDSLGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLT GRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTSGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSHDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTKSGKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKVSKAPK  179



>gb|KEH22531.1| 40S ribosomal protein S6-2 [Medicago truncatula]
Length=248

 Score =   306 bits (785),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFN+ANPTTGCQKKLEIDDDQKLRAF+ KRISQEV+GDALG+EFKGYVFKI GGCDKQG
Sbjct  1    MKFNVANPTTGCQKKLEIDDDQKLRAFWDKRISQEVNGDALGEEFKGYVFKITGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRG+GRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGHGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD+EKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRR FTTK GKK SKAPK
Sbjct  121  NDLPGLTDVEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRTFTTKDGKKVSKAPK  179



>gb|KHG25382.1| 40S ribosomal S6 [Gossypium arboreum]
Length=249

 Score =   306 bits (785),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RG PCF GYGRRNGERRRKSVRGCIVSQDLSVLNL+IVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGIPCFCGYGRRNGERRRKSVRGCIVSQDLSVLNLIIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTK+GKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKNGKKVSKAPK  179



>ref|NP_001050273.1| Os03g0390000 [Oryza sativa Japonica Group]
 gb|AAR06352.1| ribosomal protein s6 RPS6-2 [Oryza sativa Japonica Group]
 gb|ABF96353.1| 40S ribosomal protein S6, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12187.1| Os03g0390000 [Oryza sativa Japonica Group]
 gb|EAZ27176.1| hypothetical protein OsJ_11113 [Oryza sativa Japonica Group]
 dbj|BAG88134.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00579.1| unnamed protein product [Oryza sativa Japonica Group]
Length=245

 Score =   306 bits (784),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAF+ KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFYDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLT GRVRLLL RGTPCFRGYGRR+GERRRKSVRGCIVSQDLSV+NLVIVKKG+
Sbjct  61   FPMKQGVLTSGRVRLLLHRGTPCFRGYGRRDGERRRKSVRGCIVSQDLSVINLVIVKKGD  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNL+KDDDVRKYVNTYRR FTTK+GKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLAKDDDVRKYVNTYRRTFTTKNGKKVSKAPK  179



>emb|CDY57887.1| BnaC03g77310D [Brassica napus]
Length=250

 Score =   306 bits (784),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 163/179 (91%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFN+ANPTTGCQKKLEIDDDQKLRAF+ KR+SQEVSGDALGDEFKGYVFKIMGGCDKQG
Sbjct  1    MKFNVANPTTGCQKKLEIDDDQKLRAFYDKRLSQEVSGDALGDEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRG+GRR GERRRKSVRGCIVSQDLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGHGRRTGERRRKSVRGCIVSQDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
             DLPGLTD EKPRMRGPKRASKIRKLFNL+K+DDVRKYVNTYRR FT K GK+ SKAPK
Sbjct  121  KDLPGLTDTEKPRMRGPKRASKIRKLFNLTKEDDVRKYVNTYRRKFTNKKGKEVSKAPK  179



>ref|XP_007227550.1| hypothetical protein PRUPE_ppa010452mg [Prunus persica]
 ref|XP_008219332.1| PREDICTED: 40S ribosomal protein S6-like [Prunus mume]
 gb|EMJ28749.1| hypothetical protein PRUPE_ppa010452mg [Prunus persica]
Length=249

 Score =   306 bits (784),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDD KLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDHKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            SDLPGLTD EKPRMRGPKRASKIRKLFNLSK DDVRKYVNTYRR+FT+K+GKK SKAPK
Sbjct  121  SDLPGLTDTEKPRMRGPKRASKIRKLFNLSKVDDVRKYVNTYRRSFTSKTGKKVSKAPK  179



>ref|XP_002302307.2| hypothetical protein POPTR_0002s09970g [Populus trichocarpa]
 gb|EEE81580.2| hypothetical protein POPTR_0002s09970g [Populus trichocarpa]
Length=249

 Score =   306 bits (783),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIA PTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EFKGYVF I GGCDKQG
Sbjct  1    MKFNIAYPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYVFAIKGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR+FTTKSGKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRSFTTKSGKKVSKAPK  179



>ref|XP_006657975.1| PREDICTED: 40S ribosomal protein S6-like [Oryza brachyantha]
Length=250

 Score =   306 bits (783),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKK+EIDDDQKLRAFF KRISQEVSGDALG+EFKGY+FKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKVEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYIFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLT GRVRLLL RGTPCFRGYGRR+GERRRKSVRGCIVSQDLSV+NLVIVKKGE
Sbjct  61   FPMKQGVLTAGRVRLLLHRGTPCFRGYGRRDGERRRKSVRGCIVSQDLSVINLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRR FTTK+GKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRTFTTKNGKKVSKAPK  179



>ref|XP_010259865.1| PREDICTED: 40S ribosomal protein S6-like isoform X2 [Nelumbo 
nucifera]
Length=249

 Score =   306 bits (783),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            M+FNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MQFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK DDVRKYVNTYRR FTTKSGKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKQDDVRKYVNTYRRTFTTKSGKKCSKAPK  179



>ref|XP_004299660.1| PREDICTED: 40S ribosomal protein S6 [Fragaria vesca subsp. vesca]
Length=249

 Score =   306 bits (783),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDD KLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDHKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRG+GRRNGERRRKSVRGCIVS DLSVLNLVIVKKG+
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGHGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGD  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR+FT+K+GKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRSFTSKTGKKVSKAPK  179



>ref|XP_011100900.1| PREDICTED: 40S ribosomal protein S6-like [Sesamum indicum]
Length=249

 Score =   305 bits (782),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLR F+ KRISQEVSGDALG+EF GYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRVFWDKRISQEVSGDALGEEFNGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            SDLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTKSGKK SKAPK
Sbjct  121  SDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKVSKAPK  179



>ref|XP_006650153.1| PREDICTED: 40S ribosomal protein S6-like [Oryza brachyantha]
Length=250

 Score =   305 bits (782),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEV+GDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVNGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLT GRVRLLL RGTPCFRGYGRR+GERRRKSVRGCIVSQDLSV+NLVIVKKG+
Sbjct  61   FPMKQGVLTSGRVRLLLHRGTPCFRGYGRRDGERRRKSVRGCIVSQDLSVINLVIVKKGD  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRR FTTK+GKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRTFTTKNGKKVSKAPK  179



>ref|NP_001288590.1| 40S ribosomal protein S6-like [Zea mays]
 gb|ACG30953.1| 40S ribosomal protein S6 [Zea mays]
 gb|ACG30956.1| 40S ribosomal protein S6 [Zea mays]
 gb|ACG34794.1| 40S ribosomal protein S6 [Zea mays]
 tpg|DAA63655.1| TPA: putative 40S ribosomal protein S6 [Zea mays]
 tpg|DAA63656.1| TPA: putative 40S ribosomal protein S6 [Zea mays]
 tpg|DAA63658.1| TPA: putative 40S ribosomal protein S6 [Zea mays]
 tpg|DAA63659.1| TPA: putative 40S ribosomal protein S6 [Zea mays]
 tpg|DAA63662.1| TPA: putative 40S ribosomal protein S6 [Zea mays]
Length=251

 Score =   305 bits (782),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANP+TGCQKKLEIDDDQKLRAF+ +RISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPSTGCQKKLEIDDDQKLRAFYDRRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLT GRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVSQDLSV+NLVIVKKGE
Sbjct  61   FPMKQGVLTSGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVINLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNL+KDDDVRKYVNTYRR FTTK+GKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLNKDDDVRKYVNTYRRTFTTKNGKKVSKAPK  179



>sp|Q9M3V8.1|RS6_ASPOF RecName: Full=40S ribosomal protein S6 [Asparagus officinalis]
 emb|CAB89081.1| S6 ribosomal protein [Asparagus officinalis]
Length=251

 Score =   305 bits (782),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAF+ KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFYDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD+EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FT K GK  SKAPK
Sbjct  121  NDLPGLTDVEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTNKKGKTCSKAPK  179



>emb|CDX96995.1| BnaC09g46300D [Brassica napus]
Length=249

 Score =   305 bits (781),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFN+ANPTTGCQKKLEIDDDQKLRAF+ KR+SQEVSGDALG+EFKGY+FKIMGGCDKQG
Sbjct  1    MKFNVANPTTGCQKKLEIDDDQKLRAFYDKRLSQEVSGDALGEEFKGYIFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRG+GRR GERRRKSVRGCIVSQDLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGHGRRTGERRRKSVRGCIVSQDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
             DLPGLTD EKPRMRGPKRASKIRKLFNL+KDDDVRKYVNTYRR FT K GK+ SKAPK
Sbjct  121  KDLPGLTDTEKPRMRGPKRASKIRKLFNLTKDDDVRKYVNTYRRKFTNKKGKEVSKAPK  179



>gb|EAY90299.1| hypothetical protein OsI_11874 [Oryza sativa Indica Group]
Length=250

 Score =   305 bits (781),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAF+ KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFYDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLT GRVRLLL RGTPCFRGYGRR+GERRRKSVRGCIVSQDLSV+NLVIVKKG+
Sbjct  61   FPMKQGVLTSGRVRLLLHRGTPCFRGYGRRDGERRRKSVRGCIVSQDLSVINLVIVKKGD  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNL+KDDDVRKYVNTYRR FTTK+GKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLAKDDDVRKYVNTYRRTFTTKNGKKVSKAPK  179



>emb|CDX85766.1| BnaA02g00470D [Brassica napus]
 emb|CDX81169.1| BnaC03g04230D [Brassica napus]
Length=249

 Score =   305 bits (781),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 163/179 (91%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFN+ANPTTGCQKKLEIDDDQKLRAF+ KR+SQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNVANPTTGCQKKLEIDDDQKLRAFYDKRLSQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRG+GRR GERRRKSVRGCIVSQDLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGHGRRTGERRRKSVRGCIVSQDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
             DLPGLTD EKPRMRGPKRASKIRKLFNL KDDDVRKYVNTYRR FT K GK+ SKAPK
Sbjct  121  KDLPGLTDTEKPRMRGPKRASKIRKLFNLGKDDDVRKYVNTYRRKFTNKKGKEVSKAPK  179



>ref|XP_011016744.1| PREDICTED: 40S ribosomal protein S6-like [Populus euphratica]
Length=249

 Score =   305 bits (781),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIA PTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EFKGYVF I GGCDKQG
Sbjct  1    MKFNIAYPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYVFVIKGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR+FTTKSGKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRSFTTKSGKKVSKAPK  179



>gb|ADU04154.1| hypothetical protein [Gossypium hirsutum]
Length=249

 Score =   305 bits (781),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQ+KLEIDDDQKLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQEKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGC VSQDLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCFVSQDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR  TTK+GKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTLTTKNGKKVSKAPK  179



>ref|XP_004962967.1| PREDICTED: 40S ribosomal protein S6-like [Setaria italica]
Length=251

 Score =   305 bits (781),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEV GDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVLGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLT GRVRLLL RGTPCFRGYGRR+GERRRKSVRGCIVSQDLSV+NLVIVKKGE
Sbjct  61   FPMKQGVLTSGRVRLLLHRGTPCFRGYGRRDGERRRKSVRGCIVSQDLSVINLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNL+KDDDVRKYVNTYRR FTTK+GKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLTKDDDVRKYVNTYRRTFTTKNGKKVSKAPK  179



>ref|XP_006288531.1| hypothetical protein CARUB_v10001803mg [Capsella rubella]
 gb|EOA21429.1| hypothetical protein CARUB_v10001803mg [Capsella rubella]
Length=249

 Score =   305 bits (780),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KR+SQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRLSQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRG+GRR GERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGHGRRTGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            SDLPGLTD EKPRMRGPKRASKIRKLFNL K+DDVRKYVNTYRR FT K GKK SKAPK
Sbjct  121  SDLPGLTDTEKPRMRGPKRASKIRKLFNLGKEDDVRKYVNTYRRTFTNKKGKKVSKAPK  179



>ref|XP_009125304.1| PREDICTED: 40S ribosomal protein S6-2-like [Brassica rapa]
Length=249

 Score =   305 bits (780),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 163/179 (91%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFN+ANPTTGCQKKLEIDDDQKLRAF+ KR+SQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNVANPTTGCQKKLEIDDDQKLRAFYDKRLSQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRG+GRR GERRRKSVRGCIVSQDLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGHGRRTGERRRKSVRGCIVSQDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
             DLPGLTD EKPRMRGPKRASKIRKLFNL KDDDVRKYVNTYRR FT K GK+ SKAPK
Sbjct  121  KDLPGLTDTEKPRMRGPKRASKIRKLFNLGKDDDVRKYVNTYRRKFTNKKGKEVSKAPK  179



>gb|AAZ66937.1| 117M18_18 [Brassica rapa]
 emb|CDX78375.1| BnaA03g02870D [Brassica napus]
Length=249

 Score =   305 bits (780),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 163/179 (91%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFN+ANPTTGCQKKLEIDDDQKLRAF+ KR+SQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNVANPTTGCQKKLEIDDDQKLRAFYDKRLSQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRG+GRR GERRRKSVRGCIVSQDLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGHGRRTGERRRKSVRGCIVSQDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
             DLPGLTD EKPRMRGPKRASKIRKLFNL KDDDVRKYVNTYRR FT K GK+ SKAPK
Sbjct  121  KDLPGLTDTEKPRMRGPKRASKIRKLFNLGKDDDVRKYVNTYRRKFTNKKGKEVSKAPK  179



>ref|XP_009108917.1| PREDICTED: 40S ribosomal protein S6-1 isoform X1 [Brassica rapa]
 ref|XP_009108918.1| PREDICTED: 40S ribosomal protein S6-1 isoform X2 [Brassica rapa]
 emb|CDY65659.1| BnaA08g30710D [Brassica napus]
Length=250

 Score =   305 bits (780),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFN+ANPTTGCQKKLEIDDDQKLRAF+ KR+SQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNVANPTTGCQKKLEIDDDQKLRAFYDKRLSQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRG+GRR GERRRKSVRGCIVSQDLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGHGRRTGERRRKSVRGCIVSQDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
             DLPGLTD EKPRMRGPKRASKIRKLFNL+K+DDVRKYVNTYRR FT K GK+ SKAPK
Sbjct  121  KDLPGLTDTEKPRMRGPKRASKIRKLFNLTKEDDVRKYVNTYRRKFTNKKGKEVSKAPK  179



>ref|XP_010247380.1| PREDICTED: 40S ribosomal protein S6-like [Nelumbo nucifera]
Length=249

 Score =   304 bits (779),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRV+LLL RG PCFRGYGRR+GERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVQLLLHRGAPCFRGYGRRDGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTDIEKPRMRGPKRASKIRKLFNLSK DDVRKYVNTYRR F TKSGKK SKAPK
Sbjct  121  NDLPGLTDIEKPRMRGPKRASKIRKLFNLSKQDDVRKYVNTYRRTFPTKSGKKCSKAPK  179



>emb|CDX75189.1| BnaA01g05130D [Brassica napus]
Length=250

 Score =   304 bits (779),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFN+ANPTTGCQKKLEIDDDQKLRAF+ KR+SQEVSGDALG+EFKGY+FKIMGGCDKQG
Sbjct  1    MKFNVANPTTGCQKKLEIDDDQKLRAFYDKRLSQEVSGDALGEEFKGYIFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRG+GRR GERRRKSVRGCIVSQDLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGHGRRTGERRRKSVRGCIVSQDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
             DLPGLTD EKPRMRGPKRASKIRKLFNL+K+DDVRKYVNTYRR FT K GK+ SKAPK
Sbjct  121  KDLPGLTDTEKPRMRGPKRASKIRKLFNLTKEDDVRKYVNTYRRKFTNKKGKEVSKAPK  179



>ref|XP_003622831.1| 40S ribosomal protein S6, partial [Medicago truncatula]
Length=214

 Score =   303 bits (776),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFN+ANPTTGCQKKLEIDDDQKLRAF+ KRISQEV+GDALG+EFKGYVFKI GGCDKQG
Sbjct  1    MKFNVANPTTGCQKKLEIDDDQKLRAFWDKRISQEVNGDALGEEFKGYVFKITGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRG+GRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGHGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD+EKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRR FTTK GKK SKAPK
Sbjct  121  NDLPGLTDVEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRTFTTKDGKKVSKAPK  179



>ref|XP_008437828.1| PREDICTED: 40S ribosomal protein S6-like [Cucumis melo]
Length=250

 Score =   304 bits (779),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEV+GD+LG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVTGDSLGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKG+
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGD  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR+FT KSGKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRSFTIKSGKKVSKAPK  179



>ref|XP_004253069.1| PREDICTED: 40S ribosomal protein S6 [Solanum lycopersicum]
Length=249

 Score =   304 bits (779),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNL KDDDVRKYVNTYRR FT K GK+ SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLGKDDDVRKYVNTYRRTFTNKKGKEVSKAPK  179



>emb|CDX69842.1| BnaA10g21910D [Brassica napus]
Length=249

 Score =   304 bits (779),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFN+ANPTTGCQKKLEIDDDQKLRAF+ KR+SQEVSGDALG+EFKGY+FKIMGGCDKQG
Sbjct  1    MKFNVANPTTGCQKKLEIDDDQKLRAFYDKRLSQEVSGDALGEEFKGYIFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRG+GRR GERRRKSVRGCIVSQDLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGHGRRTGERRRKSVRGCIVSQDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
             DLPGLTD EKPRMRGPKRASKIRKLFNL+K+DDVRKYVNTYRR FT K GK+ SKAPK
Sbjct  121  KDLPGLTDTEKPRMRGPKRASKIRKLFNLTKEDDVRKYVNTYRRKFTNKKGKEVSKAPK  179



>ref|XP_002863274.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39533.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=249

 Score =   304 bits (778),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KR+SQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRLSQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRG+GRR GERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGHGRRTGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            SDLPGLTD EKPRMRGPKRASKIRKLFNL K+DDVRKYVNTYRR FT K GKK SKAPK
Sbjct  121  SDLPGLTDTEKPRMRGPKRASKIRKLFNLGKEDDVRKYVNTYRRTFTNKKGKKVSKAPK  179



>gb|KJB48856.1| hypothetical protein B456_008G090300 [Gossypium raimondii]
Length=248

 Score =   304 bits (778),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 173/179 (97%), Gaps = 1/179 (1%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTK+G K SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKNG-KVSKAPK  178



>ref|XP_007134259.1| hypothetical protein PHAVU_010G032100g [Phaseolus vulgaris]
 gb|ESW06253.1| hypothetical protein PHAVU_010G032100g [Phaseolus vulgaris]
Length=249

 Score =   304 bits (778),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDD KLRAF+ KRISQEV GDALG+EFKGYVFKI GGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDLKLRAFWDKRISQEVHGDALGEEFKGYVFKITGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            SDLPGLTD+EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTK+GKK SKAPK
Sbjct  121  SDLPGLTDVEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKAGKKVSKAPK  179



>gb|ABS50097.1| ribosomal protein S6 [Glycine max]
 gb|KHN42792.1| 40S ribosomal protein S6 [Glycine soja]
Length=247

 Score =   304 bits (778),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIA+PTTGCQKKLEIDDDQKLRAF+ KRISQEVSGDALG+EFKGYVFKI GGCDKQG
Sbjct  1    MKFNIASPTTGCQKKLEIDDDQKLRAFWDKRISQEVSGDALGEEFKGYVFKITGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTK+GKK SKAPK
Sbjct  121  NDLPGLTDAEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKAGKKVSKAPK  179



>ref|NP_001105634.1| ribosomal protein s6 RPS6-2 [Zea mays]
 gb|AAG02240.1|AF295599_1 ribosomal protein s6 RPS6-2 [Zea mays]
 gb|ACG41143.1| 40S ribosomal protein S6 [Zea mays]
 tpg|DAA41494.1| TPA: putative 40S ribosomal protein S6 [Zea mays]
Length=251

 Score =   303 bits (777),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANP+TGCQKKLEIDDDQKLRAF+ +RISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPSTGCQKKLEIDDDQKLRAFYDRRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLT GRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVSQDLSV+NLVIVKKGE
Sbjct  61   FPMKQGVLTSGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVINLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNL+KDDDVRKYVNTYRR FTTK+GKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLAKDDDVRKYVNTYRRTFTTKNGKKVSKAPK  179



>gb|ACG31980.1| 40S ribosomal protein S6 [Zea mays]
Length=251

 Score =   303 bits (777),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANP+TGCQKKLEIDDDQKLRAF+ +RISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPSTGCQKKLEIDDDQKLRAFYDRRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLT GRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVSQDLSV+NLVIVKKGE
Sbjct  61   FPMKQGVLTSGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVINLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNL+KDDDVRKYVNTYRR FTTK+GKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLAKDDDVRKYVNTYRRTFTTKNGKKVSKAPK  179



>ref|NP_001105544.1| ribosomal proteinS6 [Zea mays]
 gb|AAB51304.1| ribosomal protein S6 RPS6-1 [Zea mays]
 gb|ACG31908.1| 40S ribosomal protein S6 [Zea mays]
 tpg|DAA63654.1| TPA: putative 40S ribosomal protein S6 [Zea mays]
Length=251

 Score =   303 bits (777),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANP+TGCQKKLEIDDDQKLRAF+ +RISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPSTGCQKKLEIDDDQKLRAFYDRRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLT GRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVSQDLSV+NLVIVKKGE
Sbjct  61   FPMKQGVLTSGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVINLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNL+KDDDVRKYVNTYRR FTTK+GKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLNKDDDVRKYVNTYRRTFTTKNGKKVSKAPK  179



>gb|ACR36795.1| unknown [Zea mays]
Length=251

 Score =   303 bits (776),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANP+TGCQKKLEIDDDQKLRAF+ +RISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPSTGCQKKLEIDDDQKLRAFYDRRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLT GRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVSQDLSV+NLVIVKKGE
Sbjct  61   FPMKQGVLTSGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVINLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNL+KDDDVRKYVNTYRR FTTK+GKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLAKDDDVRKYVNTYRRTFTTKNGKKVSKAPK  179



>ref|XP_006399530.1| hypothetical protein EUTSA_v10014497mg [Eutrema salsugineum]
 gb|ESQ40983.1| hypothetical protein EUTSA_v10014497mg [Eutrema salsugineum]
Length=249

 Score =   303 bits (776),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 163/179 (91%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFN+ANPTTGCQKKLEIDDDQKLRAFF KR+SQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNVANPTTGCQKKLEIDDDQKLRAFFDKRLSQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRG+GRR GERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGHGRRTGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNL K+DDVRKYVNTYRR FT K GKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLGKEDDVRKYVNTYRRTFTNKKGKKVSKAPK  179



>gb|ACU24470.1| unknown [Glycine max]
Length=249

 Score =   303 bits (776),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDD KLRAF+ KRISQEV GDALG+EFKGYVFKI GGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDLKLRAFWDKRISQEVVGDALGEEFKGYVFKITGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRN ERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNRERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            SDLPGLTD+EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTK+GKK SKAPK
Sbjct  121  SDLPGLTDVEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKNGKKVSKAPK  179



>ref|XP_004505074.1| PREDICTED: 40S ribosomal protein S6-like [Cicer arietinum]
Length=249

 Score =   303 bits (776),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFN+ANPTTGCQKKLEIDDD KLRAF+ KRISQEV GDALG+EFKGYVFKI GGCDKQG
Sbjct  1    MKFNVANPTTGCQKKLEIDDDLKLRAFWDKRISQEVLGDALGEEFKGYVFKITGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD+EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRRNFTTK+GKK SKAPK
Sbjct  121  NDLPGLTDVEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRNFTTKAGKKVSKAPK  179



>ref|XP_009131151.1| PREDICTED: 40S ribosomal protein S6-2 [Brassica rapa]
Length=249

 Score =   303 bits (776),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFN+ANPTTGCQKKLEIDDDQKLRAF+ KR+SQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNVANPTTGCQKKLEIDDDQKLRAFYDKRLSQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVL PGRVRLLL RGTPCFRG+GRR GERRRKSVRGCIVSQDLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLAPGRVRLLLHRGTPCFRGHGRRTGERRRKSVRGCIVSQDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
             DLPGLTD EKPRMRGPKRASKIRKLFNL KDDDVRKYVNTYRR FT K GK+ SKAPK
Sbjct  121  KDLPGLTDTEKPRMRGPKRASKIRKLFNLGKDDDVRKYVNTYRRKFTNKKGKEVSKAPK  179



>ref|XP_003545992.1| PREDICTED: 40S ribosomal protein S6-like [Glycine max]
 gb|KHN24770.1| 40S ribosomal protein S6 [Glycine soja]
Length=249

 Score =   303 bits (776),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDD KLRAF+ KRISQEV GDALG+EFKGYVFKI GGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDLKLRAFWDKRISQEVVGDALGEEFKGYVFKITGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            SDLPGLTD+EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTK+GKK SKAPK
Sbjct  121  SDLPGLTDVEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKNGKKVSKAPK  179



>gb|AFK37790.1| unknown [Medicago truncatula]
Length=248

 Score =   303 bits (775),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFN+ANPTTG QKKLEIDDDQKLRAF+ KRISQEV+GDALG+EFKGYVFKI GGCDKQG
Sbjct  1    MKFNVANPTTGYQKKLEIDDDQKLRAFWDKRISQEVNGDALGEEFKGYVFKITGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRG+GRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGHGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD+EKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRR FTTK GKK SKAPK
Sbjct  121  NDLPGLTDVEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRTFTTKDGKKVSKAPK  179



>ref|XP_010491703.1| PREDICTED: 40S ribosomal protein S6-2-like isoform X1 [Camelina 
sativa]
Length=249

 Score =   303 bits (775),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KR+SQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRLSQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRG+GRR GERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGHGRRTGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNL KDDDVRKYVNTYRR FT K GK+ SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLGKDDDVRKYVNTYRRTFTNKKGKEVSKAPK  179



>ref|XP_003529334.1| PREDICTED: 40S ribosomal protein S6 [Glycine max]
 gb|ACU16657.1| unknown [Glycine max]
 gb|KHN16260.1| 40S ribosomal protein S6 [Glycine soja]
Length=249

 Score =   303 bits (775),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDD KLRAF+ KRISQEV GDALG+EFKGYVFKI GGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDLKLRAFWDKRISQEVLGDALGEEFKGYVFKITGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            SDLPGLTD+EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTK+GKK SKAPK
Sbjct  121  SDLPGLTDVEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKAGKKVSKAPK  179



>ref|XP_002873453.1| EMB3010 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49712.1| EMB3010 [Arabidopsis lyrata subsp. lyrata]
Length=249

 Score =   303 bits (775),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KR+SQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRLSQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRG+GRR GERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGHGRRTGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            SDLPGLTD EKPRMRGPKRASKIRKLFNL K+DDVRKYVNTYRR FT K GKK  KAPK
Sbjct  121  SDLPGLTDTEKPRMRGPKRASKIRKLFNLGKEDDVRKYVNTYRRTFTNKKGKKVGKAPK  179



>ref|XP_007148148.1| hypothetical protein PHAVU_006G184300g [Phaseolus vulgaris]
 gb|ESW20142.1| hypothetical protein PHAVU_006G184300g [Phaseolus vulgaris]
Length=249

 Score =   302 bits (774),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDD KLRAF+ KRISQEV GDALG+EFKGYVFKI GGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDLKLRAFWDKRISQEVLGDALGEEFKGYVFKITGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD+EKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRR FTTK+GKK SKAPK
Sbjct  121  NDLPGLTDVEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRTFTTKAGKKVSKAPK  179



>ref|XP_003593601.1| 40S ribosomal protein [Medicago truncatula]
 gb|ABD32373.1| Ribosomal protein S6e [Medicago truncatula]
 gb|AES63852.1| 40S ribosomal protein S6-2 [Medicago truncatula]
Length=248

 Score =   302 bits (774),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFN+ANPTTGCQKKLEIDDD KLRAF+ KRISQEV GDALG+EFKGYVFKI GGCDKQG
Sbjct  1    MKFNVANPTTGCQKKLEIDDDMKLRAFWDKRISQEVLGDALGEEFKGYVFKITGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRG+GRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGHGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD+EKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRR FTTK+GKK SKAPK
Sbjct  121  NDLPGLTDVEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRTFTTKAGKKQSKAPK  179



>ref|NP_001274954.1| 40S ribosomal protein S6-1-like [Solanum tuberosum]
 gb|ABA40470.1| ribosomal protein S6-like protein [Solanum tuberosum]
Length=249

 Score =   302 bits (774),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAF+ KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFYDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRG+GRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLYRGTPCFRGHGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNL KDDDVRKYVNTYRR FT K GK+ SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLGKDDDVRKYVNTYRRTFTNKKGKEVSKAPK  179



>ref|XP_007205780.1| hypothetical protein PRUPE_ppa010485mg [Prunus persica]
 ref|XP_008235060.1| PREDICTED: 40S ribosomal protein S6 [Prunus mume]
 gb|EMJ06979.1| hypothetical protein PRUPE_ppa010485mg [Prunus persica]
Length=248

 Score =   302 bits (773),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDD KLRAF+ KRISQEV+GDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDAKLRAFWDKRISQEVNGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKG+
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGD  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD+EKPRMRGPKRASKIRKLFNL+KDDDVRKYVNTYRR FT+K+GKK SKAPK
Sbjct  121  NDLPGLTDVEKPRMRGPKRASKIRKLFNLTKDDDVRKYVNTYRRTFTSKTGKKCSKAPK  179



>gb|EYU34583.1| hypothetical protein MIMGU_mgv1a011745mg [Erythranthe guttata]
Length=272

 Score =   303 bits (775),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 166/181 (92%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  69   QKMKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDK  248
            +KMKFNIANPTTGCQKKLEIDDD KLR F+ KRISQEV+GDALG+EFKGYVFKIMGGCDK
Sbjct  22   KKMKFNIANPTTGCQKKLEIDDDLKLRVFWDKRISQEVNGDALGEEFKGYVFKIMGGCDK  81

Query  249  QGFPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKK  428
            QGFPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKK
Sbjct  82   QGFPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKK  141

Query  429  GESDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAP  608
            G++DLPGLTD+EKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRR FT KSGKK SKAP
Sbjct  142  GDNDLPGLTDVEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRTFTNKSGKKISKAP  201

Query  609  K  611
            K
Sbjct  202  K  202



>ref|XP_008386113.1| PREDICTED: 40S ribosomal protein S6 [Malus domestica]
Length=249

 Score =   301 bits (772),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDD KLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDHKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKG+
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGD  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FT K GK+ SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTNKKGKEVSKAPK  179



>ref|XP_009372980.1| PREDICTED: 40S ribosomal protein S6 [Pyrus x bretschneideri]
Length=249

 Score =   301 bits (772),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDD KLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDHKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKG+
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGD  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FT K GK+ SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTNKKGKEVSKAPK  179



>ref|XP_004485798.1| PREDICTED: 40S ribosomal protein S6-like [Cicer arietinum]
Length=248

 Score =   301 bits (772),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFN+ANPTTGCQKKLEIDDD KLRAF+ KRISQEV+GDALG+EFKGYVFKI GGCDKQG
Sbjct  1    MKFNVANPTTGCQKKLEIDDDLKLRAFWDKRISQEVNGDALGEEFKGYVFKITGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD+EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTK+GKK SKAPK
Sbjct  121  NDLPGLTDVEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKAGKKVSKAPK  179



>gb|AHA84247.1| 40S ribosomal protein S6 [Phaseolus vulgaris]
Length=249

 Score =   301 bits (772),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDD KLRAF+ KRISQEV GDALG+EFKGYVFKI GGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDLKLRAFWDKRISQEVLGDALGEEFKGYVFKITGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD+EKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRR FTTK+GKK SKAPK
Sbjct  121  NDLPGLTDVEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRTFTTKAGKKVSKAPK  179



>ref|XP_006412569.1| hypothetical protein EUTSA_v10026073mg [Eutrema salsugineum]
 gb|ESQ54022.1| hypothetical protein EUTSA_v10026073mg [Eutrema salsugineum]
Length=250

 Score =   301 bits (772),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MK N+ANPTTGCQKKLEIDD+QKLRAF+ KR+SQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKLNVANPTTGCQKKLEIDDEQKLRAFYDKRLSQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRG+GRR GERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGHGRRTGERRRKSVRGCIVSHDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FT K GK+ SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRKFTNKKGKEVSKAPK  179



>ref|XP_007140717.1| hypothetical protein PHAVU_008G135700g [Phaseolus vulgaris]
 ref|XP_007140725.1| hypothetical protein PHAVU_008G136400g [Phaseolus vulgaris]
 gb|AGV54885.1| 40S ribosomal protein S6-like protein [Phaseolus vulgaris]
 gb|ESW12711.1| hypothetical protein PHAVU_008G135700g [Phaseolus vulgaris]
 gb|ESW12719.1| hypothetical protein PHAVU_008G136400g [Phaseolus vulgaris]
Length=247

 Score =   301 bits (771),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDD KLRAF+ KRISQEV+GDALG+EFKGYVFKI GGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDLKLRAFWDKRISQEVNGDALGEEFKGYVFKITGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTK+GKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKAGKKVSKAPK  179



>ref|XP_010422849.1| PREDICTED: 40S ribosomal protein S6-2 [Camelina sativa]
Length=249

 Score =   301 bits (771),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 163/179 (91%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KR+SQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRLSQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRG+GRR GERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGHGRRTGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNL K+DDVRKYVNTYRR FT K GK+ SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLGKEDDVRKYVNTYRRTFTNKKGKEVSKAPK  179



>gb|KHN10923.1| 40S ribosomal protein S6 [Glycine soja]
Length=247

 Score =   301 bits (771),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDD KLRAF+ KRISQEV GDALG+EFKGYVFKI GGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDLKLRAFWDKRISQEVIGDALGEEFKGYVFKITGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD+EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTK+GKK SKAPK
Sbjct  121  NDLPGLTDVEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKAGKKVSKAPK  179



>ref|XP_009122062.1| PREDICTED: 40S ribosomal protein S6-2 [Brassica rapa]
Length=249

 Score =   301 bits (771),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFN+ANPTTGCQKKLEIDDDQKLRAF+ KR+SQEVSGDALG+EFKGY+FKIMGGCDKQG
Sbjct  1    MKFNVANPTTGCQKKLEIDDDQKLRAFYDKRLSQEVSGDALGEEFKGYIFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRG+GRR GERRRK VRGCIVSQDLSVLNLV VKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGHGRRTGERRRKYVRGCIVSQDLSVLNLVSVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
             DLPGLTD EKPRMRGPKRASKIRKLFNL+K+DDVRKYVNTYRR FT K GK+ SKAPK
Sbjct  121  KDLPGLTDTEKPRMRGPKRASKIRKLFNLTKEDDVRKYVNTYRRKFTNKKGKEVSKAPK  179



>emb|CAA74381.1| ribosomal protein S6 [Arabidopsis thaliana]
Length=249

 Score =   301 bits (771),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 163/179 (91%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFN+ANPTTGCQKKLEIDDDQKLRAFF KR+SQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNVANPTTGCQKKLEIDDDQKLRAFFDKRLSQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRG+GRR GERRRKSVRGCIVS DLSVLNLVIVKKG 
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGHGRRTGERRRKSVRGCIVSPDLSVLNLVIVKKGV  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            SDLPGLTD EKPRMRGPKRASKIRKLFNL K+DDVRKYVNTYRR FT K GKK SKAPK
Sbjct  121  SDLPGLTDTEKPRMRGPKRASKIRKLFNLGKEDDVRKYVNTYRRTFTNKKGKKVSKAPK  179



>ref|XP_010453063.1| PREDICTED: 40S ribosomal protein S6-2-like [Camelina sativa]
Length=249

 Score =   301 bits (770),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 163/179 (91%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KR+SQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRLSQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRG+GRR GERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGHGRRTGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNL K+DDVRKYVNTYRR FT K GK+ SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLGKEDDVRKYVNTYRRTFTNKKGKEVSKAPK  179



>gb|AFK46410.1| unknown [Medicago truncatula]
Length=262

 Score =   301 bits (772),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFN+ANPTTGCQKKLEIDDD KLRAF+ KRISQEV GDALG+EFKGYVFKI GGCDKQG
Sbjct  1    MKFNVANPTTGCQKKLEIDDDMKLRAFWDKRISQEVLGDALGEEFKGYVFKITGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRG+GRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGHGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD+EKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRR FTTK+GKK SKAPK
Sbjct  121  NDLPGLTDVEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRTFTTKAGKKQSKAPK  179



>ref|NP_001237243.1| ribosomal protein S6 [Glycine max]
 gb|AAS47511.1| ribosomal protein S6 [Glycine max]
Length=247

 Score =   301 bits (770),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDD KLRAF+ KRISQEV GDALG+EFKGYVFKI GGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDLKLRAFWDKRISQEVIGDALGEEFKGYVFKITGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNL+IVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLIIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD+EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTK+GKK SKAPK
Sbjct  121  NDLPGLTDVEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKAGKKVSKAPK  179



>ref|NP_196598.1| 40S ribosomal protein S6-2 [Arabidopsis thaliana]
 sp|P51430.3|RS62_ARATH RecName: Full=40S ribosomal protein S6-2; AltName: Full=Protein 
EMBRYO DEFECTIVE 3010 [Arabidopsis thaliana]
 emb|CAB89407.1| 40S ribsomal protein S6 [Arabidopsis thaliana]
 gb|AAK73952.1| AT5g10360/F12B17_290 [Arabidopsis thaliana]
 gb|AAL15265.1| AT5g10360/F12B17_290 [Arabidopsis thaliana]
 gb|AAM10399.1| AT5g10360/F12B17_290 [Arabidopsis thaliana]
 gb|AED91531.1| 40S ribosomal protein S6-2 [Arabidopsis thaliana]
Length=249

 Score =   301 bits (770),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 163/179 (91%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFN+ANPTTGCQKKLEIDDDQKLRAFF KR+SQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNVANPTTGCQKKLEIDDDQKLRAFFDKRLSQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRG+GRR GERRRKSVRGCIVS DLSVLNLVIVKKG 
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGHGRRTGERRRKSVRGCIVSPDLSVLNLVIVKKGV  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            SDLPGLTD EKPRMRGPKRASKIRKLFNL K+DDVRKYVNTYRR FT K GKK SKAPK
Sbjct  121  SDLPGLTDTEKPRMRGPKRASKIRKLFNLGKEDDVRKYVNTYRRTFTNKKGKKVSKAPK  179



>ref|XP_008373000.1| PREDICTED: 40S ribosomal protein S6-like [Malus domestica]
Length=249

 Score =   301 bits (770),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDD KLRAFF KRISQEVSGDALG+EF+GYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDHKLRAFFDKRISQEVSGDALGEEFRGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKG+
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGD  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FT K GK+ SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTNKKGKEVSKAPK  179



>ref|XP_004288169.1| PREDICTED: 40S ribosomal protein S6-like [Fragaria vesca subsp. 
vesca]
Length=248

 Score =   301 bits (770),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDD KLRAF+ KRISQEV+GDALG+EF+GYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDTKLRAFWDKRISQEVNGDALGEEFRGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRG+GRRNGERRRKSVRGCIVS DLSVLNLVIVKKG+
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGHGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGD  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTDIEKPRMRGPKRASKIRKLFNL+KDDDVRKYVNTYRR FT+K+GK  SKAPK
Sbjct  121  NDLPGLTDIEKPRMRGPKRASKIRKLFNLTKDDDVRKYVNTYRRKFTSKTGKNCSKAPK  179



>ref|XP_008350017.1| PREDICTED: 40S ribosomal protein S6 [Malus domestica]
Length=271

 Score =   301 bits (772),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDD KLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDHKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKG+
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGD  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FT K GK+ SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTNKKGKEVSKAPK  179



>gb|AHA84164.1| 40S ribosomal protein S6 [Phaseolus vulgaris]
Length=249

 Score =   300 bits (769),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDD KLRAF+ KRISQEV GDALG+EFKGYVFKI GGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDLKLRAFWDKRISQEVHGDALGEEFKGYVFKITGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKK E
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKRE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            SDLPGLTD+EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTK+GKK SKAPK
Sbjct  121  SDLPGLTDVEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKAGKKVSKAPK  179



>gb|AFK34255.1| unknown [Medicago truncatula]
 gb|KEH31033.1| 40S ribosomal protein S6-2 [Medicago truncatula]
Length=248

 Score =   300 bits (769),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 163/179 (91%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFN+ANPTTGCQKKLEIDDD KLRAF+ KRISQEV GDALG+EFKGYVFKI GGCDKQG
Sbjct  1    MKFNVANPTTGCQKKLEIDDDMKLRAFWDKRISQEVLGDALGEEFKGYVFKITGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRG+GRRNGERRRKSVRGCIVS DLSVLNLVIVKKG+
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGHGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGD  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD+EKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRR FTTK GKK SKAPK
Sbjct  121  NDLPGLTDVEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRTFTTKDGKKVSKAPK  179



>gb|AFK34739.1| unknown [Lotus japonicus]
Length=249

 Score =   300 bits (769),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDD KLRAF+ KRISQEV GDALG+EFKGYVFKI GGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDLKLRAFWDKRISQEVLGDALGEEFKGYVFKITGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKG+
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGD  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD+EKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRR FTTK+GKK SKAPK
Sbjct  121  NDLPGLTDVEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRTFTTKAGKKVSKAPK  179



>gb|EPS72311.1| hypothetical protein M569_02446, partial [Genlisea aurea]
Length=247

 Score =   300 bits (768),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQK+LEIDDD KLR F+ KRISQEVSGDALG+EFKGYVFKI GGCDKQG
Sbjct  1    MKFNIANPTTGCQKRLEIDDDLKLRVFWDKRISQEVSGDALGEEFKGYVFKIKGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLLQRGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLQRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLF+LSK+DDVRKYVNTYRRNFTTK+GKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFSLSKEDDVRKYVNTYRRNFTTKNGKKVSKAPK  179



>gb|KHN09991.1| 40S ribosomal protein S6 [Glycine soja]
Length=249

 Score =   300 bits (768),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDD KLRAF+ KRISQEV GDALG+EFKGYVFKI GGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDLKLRAFWDKRISQEVLGDALGEEFKGYVFKITGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            SDLPGLTD+EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR F TK+GKK SKAPK
Sbjct  121  SDLPGLTDVEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFITKAGKKVSKAPK  179



>ref|XP_006284414.1| hypothetical protein CARUB_v10005584mg [Capsella rubella]
 gb|EOA17312.1| hypothetical protein CARUB_v10005584mg [Capsella rubella]
Length=250

 Score =   300 bits (768),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KR+SQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRLSQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRG+GRR GERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGHGRRTGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNL K+DDVR YVNTYRR FT K GK+ SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLKKEDDVRTYVNTYRRKFTNKKGKEVSKAPK  179



>ref|NP_001242836.1| uncharacterized protein LOC100819697 [Glycine max]
 gb|ACU20951.1| unknown [Glycine max]
Length=249

 Score =   300 bits (768),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDD KLRAF+ KRISQEV GDALG+EFKGYVFKI GGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDLKLRAFWDKRISQEVLGDALGEEFKGYVFKITGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            SDLPGLTD+EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR F TK+GKK SKAPK
Sbjct  121  SDLPGLTDVEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFITKAGKKVSKAPK  179



>gb|ACU18845.1| unknown [Glycine max]
Length=220

 Score =   299 bits (765),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIA+PTTGCQKKLEIDDDQKLRAF+ KRISQEVSGDALG+EFKGYVFKI GGCDKQG
Sbjct  1    MKFNIASPTTGCQKKLEIDDDQKLRAFWDKRISQEVSGDALGEEFKGYVFKITGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTK+GKK SKAPK
Sbjct  121  NDLPGLTDAEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKAGKKVSKAPK  179



>ref|NP_001242564.1| uncharacterized protein LOC100801194 [Glycine max]
 gb|ACU15831.1| unknown [Glycine max]
Length=249

 Score =   300 bits (768),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDD KLRAF+ KRISQEV GDALG+EF+GYVFKI GGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDLKLRAFWDKRISQEVVGDALGEEFEGYVFKITGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD+EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTK+GKK SKAPK
Sbjct  121  NDLPGLTDVEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKNGKKVSKAPK  179



>ref|XP_009126736.1| PREDICTED: 40S ribosomal protein S6-1 [Brassica rapa]
Length=250

 Score =   300 bits (768),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFN+ANPTTGCQKKLEIDDDQKLRAF+ KR+SQEVSGDALG+EFKGY+FKIMGGCDKQG
Sbjct  1    MKFNVANPTTGCQKKLEIDDDQKLRAFYDKRLSQEVSGDALGEEFKGYIFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRG+GRR GERRRK VRGCIVSQDLSVLNLVIVKK E
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGHGRRTGERRRKYVRGCIVSQDLSVLNLVIVKKSE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
             DLPGLTD +KPRMRGPKRASKIRKLFNL+K+DDVRKYVNTYRR FT K GK+ SKAPK
Sbjct  121  KDLPGLTDTDKPRMRGPKRASKIRKLFNLTKEDDVRKYVNTYRRKFTNKKGKEVSKAPK  179



>ref|XP_010098627.1| Serine/threonine-protein kinase SAPK2 [Morus notabilis]
 gb|EXB75366.1| Serine/threonine-protein kinase SAPK2 [Morus notabilis]
Length=590

 Score =   311 bits (797),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 170/181 (94%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = +3

Query  69   QKMKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDK  248
            Q ++FNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGD+LG+EFKGYVFKIMGGCDK
Sbjct  340  QILQFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDSLGEEFKGYVFKIMGGCDK  399

Query  249  QGFPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKK  428
            QGFPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKK
Sbjct  400  QGFPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKK  459

Query  429  GESDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAP  608
            GE+DLPGLTDIEKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR+FTTKSGKK SKAP
Sbjct  460  GENDLPGLTDIEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRSFTTKSGKKVSKAP  519

Query  609  K  611
            K
Sbjct  520  K  520



>ref|XP_003532242.1| PREDICTED: 40S ribosomal protein S6-like [Glycine max]
Length=248

 Score =   300 bits (767),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDD KLRAF+ KRISQEV GDALG+EFKGYVFKI GGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDLKLRAFWDKRISQEVIGDALGEEFKGYVFKITGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD+EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTK+GKK SKAPK
Sbjct  121  NDLPGLTDVEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKAGKKVSKAPK  179



>gb|ABK22338.1| unknown [Picea sitchensis]
 gb|ACN40226.1| unknown [Picea sitchensis]
Length=249

 Score =   300 bits (767),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 163/179 (91%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAF+ KR++QEV+GDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFYDKRLAQEVNGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR F +KSGK  SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFQSKSGKTRSKAPK  179



>ref|XP_010676041.1| PREDICTED: 40S ribosomal protein S6-1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010676312.1| PREDICTED: 40S ribosomal protein S6-1 [Beta vulgaris subsp. vulgaris]
Length=250

 Score =   300 bits (767),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MK NIANPTTGCQKKLEIDD+QKLR F+ KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKCNIANPTTGCQKKLEIDDEQKLRVFYDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGT CFRG+GRR+GERRRKSVRGCIVSQDLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTSCFRGHGRRDGERRRKSVRGCIVSQDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
             DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRRNFT+K+GK  SKAPK
Sbjct  121  KDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRNFTSKTGKNVSKAPK  179



>gb|EYU23960.1| hypothetical protein MIMGU_mgv1a012472mg [Erythranthe guttata]
Length=249

 Score =   300 bits (767),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDD KLR F+ KRISQEV+GDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDLKLRVFWDKRISQEVNGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKG+
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGD  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD+EKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRR FT K+GKK SKAPK
Sbjct  121  NDLPGLTDVEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRTFTNKAGKKISKAPK  179



>emb|CDY40091.1| BnaC02g00390D [Brassica napus]
Length=264

 Score =   300 bits (767),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  78   KFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQGF  257
            +FN+ANPTTGCQKKLEIDDDQKLRAF+ KR+SQEVSGDALG+EFKGYVFKIMGGCDKQGF
Sbjct  17   QFNVANPTTGCQKKLEIDDDQKLRAFYDKRLSQEVSGDALGEEFKGYVFKIMGGCDKQGF  76

Query  258  PMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGES  437
            PMKQGVLTPGRVRLLL RGTPCFRG+GRR GERRRKSVRGCIVSQDLSVLNLVIVKKGE 
Sbjct  77   PMKQGVLTPGRVRLLLHRGTPCFRGHGRRTGERRRKSVRGCIVSQDLSVLNLVIVKKGEK  136

Query  438  DLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            DLPGLTD EKPRMRGPKRASKIRKLFNL KDDDVRKYVNTYRR FT K GK+ SKAPK
Sbjct  137  DLPGLTDTEKPRMRGPKRASKIRKLFNLGKDDDVRKYVNTYRRKFTNKKGKEVSKAPK  194



>gb|ACU23723.1| unknown [Glycine max]
Length=248

 Score =   299 bits (765),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDD KLRAF+ KRISQEV GDALG+EFKGYVFKI GGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDLKLRAFWDKRISQEVIGDALGEEFKGYVFKITGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSV GCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVPGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD+EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTK+GKK SKAPK
Sbjct  121  NDLPGLTDVEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKAGKKVSKAPK  179



>emb|CDX68774.1| BnaC01g06790D [Brassica napus]
Length=278

 Score =   300 bits (767),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
             +FN+ANPTTGCQKKLEIDDDQKLRAF+ KR+SQEVSGDALG+EFKGY+FKIMGGCDKQG
Sbjct  29   FQFNVANPTTGCQKKLEIDDDQKLRAFYDKRLSQEVSGDALGEEFKGYIFKIMGGCDKQG  88

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRG+GRR GERRRKSVRGCIVSQDLSVLNLVIVKKGE
Sbjct  89   FPMKQGVLTPGRVRLLLHRGTPCFRGHGRRTGERRRKSVRGCIVSQDLSVLNLVIVKKGE  148

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
             DLPGLTD EKPRMRGPKRASKIRKLFNL+K+DDVRKYVNTYRR FT K GK+ SKAPK
Sbjct  149  KDLPGLTDTEKPRMRGPKRASKIRKLFNLTKEDDVRKYVNTYRRKFTNKKGKEVSKAPK  207



>ref|XP_007159340.1| hypothetical protein PHAVU_002G229900g [Phaseolus vulgaris]
 gb|ESW31334.1| hypothetical protein PHAVU_002G229900g [Phaseolus vulgaris]
Length=249

 Score =   298 bits (764),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDD KLRAF+ KRISQEV GDALG+EFKGYVFKI GGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDLKLRAFWDKRISQEVLGDALGEEFKGYVFKITGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKG+
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGD  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD+EKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRR FT K+GKK SKAPK
Sbjct  121  NDLPGLTDVEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRTFTNKAGKKVSKAPK  179



>gb|ACJ84577.1| unknown [Medicago truncatula]
Length=220

 Score =   297 bits (761),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 163/179 (91%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFN+ANPTTGCQKKLEIDDD KLRAF+ KRISQEV G ALG+EFKGYVFKI GGCDKQG
Sbjct  1    MKFNVANPTTGCQKKLEIDDDMKLRAFWDKRISQEVLGGALGEEFKGYVFKITGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRG+GRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGHGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD+EKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRR FTTK+GKK SKAPK
Sbjct  121  NDLPGLTDVEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRTFTTKAGKKQSKAPK  179



>gb|EYU30987.1| hypothetical protein MIMGU_mgv1a012493mg [Erythranthe guttata]
Length=249

 Score =   298 bits (763),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 163/179 (91%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDD KLR F+ KRISQEV+GDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDLKLRVFWDKRISQEVNGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKG+
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGD  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD+EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FT K+GKK SKAPK
Sbjct  121  NDLPGLTDVEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTNKAGKKISKAPK  179



>gb|KJB79634.1| hypothetical protein B456_013G060000 [Gossypium raimondii]
Length=196

 Score =   296 bits (758),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 165/177 (93%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEV+GDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVAGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKA  605
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTKSGK  S +
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKVVSSS  177



>emb|CDY13073.1| BnaA09g17440D [Brassica napus]
Length=274

 Score =   299 bits (765),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
             +FN+ANPTTGCQKKLEIDDDQKLRAF+ KR+SQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  65   FQFNVANPTTGCQKKLEIDDDQKLRAFYDKRLSQEVSGDALGEEFKGYVFKIMGGCDKQG  124

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRG+GRR GERRRKSVRGCIVSQDLSVLNLVIVKKGE
Sbjct  125  FPMKQGVLTPGRVRLLLHRGTPCFRGHGRRTGERRRKSVRGCIVSQDLSVLNLVIVKKGE  184

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
             DLPGLTD EKPRMRGPKRASKIRKLFNL+K+DDVRKYVNTYRR FT K GK+ SKAPK
Sbjct  185  KDLPGLTDTEKPRMRGPKRASKIRKLFNLTKEDDVRKYVNTYRRKFTNKKGKEVSKAPK  243



>gb|ACU20345.1| unknown [Glycine max]
Length=249

 Score =   298 bits (763),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDD KLRAF+ KRISQEV GDALG+EFKGYVFKI GGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDLKLRAFWDKRISQEVVGDALGEEFKGYVFKITGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLT GRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTRGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD+EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTK+GKK SKAPK
Sbjct  121  NDLPGLTDVEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKNGKKVSKAPK  179



>ref|XP_010432832.1| PREDICTED: 40S ribosomal protein S6-1 [Camelina sativa]
 ref|XP_010438012.1| PREDICTED: 40S ribosomal protein S6-1 isoform X1 [Camelina sativa]
 ref|XP_010438013.1| PREDICTED: 40S ribosomal protein S6-1 isoform X2 [Camelina sativa]
 ref|XP_010447531.1| PREDICTED: 40S ribosomal protein S6-1 [Camelina sativa]
Length=250

 Score =   298 bits (763),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KR+SQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRLSQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRG+GRR GERRRKSVRGCIVS DLSVLNLVIVKKG+
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGHGRRTGERRRKSVRGCIVSPDLSVLNLVIVKKGD  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNL K+DDVR YVNTYRR FT K GK+ SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLKKEDDVRTYVNTYRRKFTNKKGKEVSKAPK  179



>gb|ACU24208.1| unknown [Glycine max]
Length=249

 Score =   298 bits (762),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDD KLRAF+ KRISQEV GDALG+EFKGYVFKI GGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDLKLRAFWDKRISQEVLGDALGEEFKGYVFKITGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLN VIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNSVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            SDLPGLTD+EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR F TK+GKK SKAPK
Sbjct  121  SDLPGLTDVEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFITKAGKKVSKAPK  179



>gb|KHN04566.1| 40S ribosomal protein S6, partial [Glycine soja]
Length=229

 Score =   296 bits (758),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 162/177 (92%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +3

Query  81   FNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQGFP  260
            FNIANPTTGCQKKLEIDDDQKLRAF+ KRISQEV+GDALG+EFKGYVFKI GGCDKQGFP
Sbjct  1    FNIANPTTGCQKKLEIDDDQKLRAFWDKRISQEVNGDALGEEFKGYVFKITGGCDKQGFP  60

Query  261  MKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGESD  440
            MKQGVLTPG V LLL RGTPCFRGYGRRN ERRRKSVRGCIVS DLSVLNLVIVKKGESD
Sbjct  61   MKQGVLTPGCVHLLLHRGTPCFRGYGRRNEERRRKSVRGCIVSPDLSVLNLVIVKKGESD  120

Query  441  LPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            LPGLTD+EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTK+GKK SKAPK
Sbjct  121  LPGLTDVEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKAGKKVSKAPK  177



>ref|NP_194898.1| 40S ribosomal protein S6-1 [Arabidopsis thaliana]
 sp|O48549.2|RS61_ARATH RecName: Full=40S ribosomal protein S6-1 [Arabidopsis thaliana]
 emb|CAA19753.1| ribosomal protein S6 - like [Arabidopsis thaliana]
 emb|CAB79888.1| ribosomal protein S6-like [Arabidopsis thaliana]
 gb|AAK92738.1| putative ribosomal protein S6 [Arabidopsis thaliana]
 gb|AAM45031.1| putative ribosomal protein S6 [Arabidopsis thaliana]
 gb|AAN31838.1| putative ribosomal protein S6 [Arabidopsis thaliana]
 gb|AEE85946.1| 40S ribosomal protein S6-1 [Arabidopsis thaliana]
Length=250

 Score =   296 bits (758),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFN+ANPTTGCQKKLEIDDDQKLRAF+ KRISQEVSGDALG+EFKGYVFKI GGCDKQG
Sbjct  1    MKFNVANPTTGCQKKLEIDDDQKLRAFYDKRISQEVSGDALGEEFKGYVFKIKGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRG+GRR GERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGHGRRTGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNL K+DDVR YVNTYRR FT K GK+ SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLKKEDDVRTYVNTYRRKFTNKKGKEVSKAPK  179



>gb|KJB48854.1| hypothetical protein B456_008G090300 [Gossypium raimondii]
Length=181

 Score =   293 bits (751),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSG  587
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTK+G
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKNG  171



>gb|ADU04149.1| hypothetical protein [Gossypium hirsutum]
Length=260

 Score =   295 bits (756),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 171/190 (90%), Gaps = 11/190 (6%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RG PCF GYGRRNGERRRKSVRGCIVSQDLSVLNL+IVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGIPCFCGYGRRNGERRRKSVRGCIVSQDLSVLNLIIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTK-----------  581
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTK           
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKNDECKIFIIVS  180

Query  582  SGKKASKAPK  611
            S KK SKAPK
Sbjct  181  SCKKVSKAPK  190



>gb|AFK42970.1| unknown [Lotus japonicus]
Length=249

 Score =   294 bits (752),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDD KLRAF+ KRISQEV GDALG+EFKGYVFKI GGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDLKLRAFWDKRISQEVIGDALGEEFKGYVFKITGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTP FRGYGRRNGERRRKSVRGCIVS DLSVLNLV+VKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPSFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVVVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKR+SKIRKLFNLSK+DDVRKYVNTYRR FTTK+GKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRSSKIRKLFNLSKEDDVRKYVNTYRRTFTTKAGKKVSKAPK  179



>gb|EYU30988.1| hypothetical protein MIMGU_mgv1a012493mg [Erythranthe guttata]
Length=248

 Score =   293 bits (749),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 163/179 (91%), Positives = 170/179 (95%), Gaps = 1/179 (1%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDD KLR F+ KRISQEV+GDALG EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDLKLRVFWDKRISQEVNGDALG-EFKGYVFKIMGGCDKQG  59

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKG+
Sbjct  60   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGD  119

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD+EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FT K+GKK SKAPK
Sbjct  120  NDLPGLTDVEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTNKAGKKISKAPK  178



>ref|XP_003547761.1| PREDICTED: 40S ribosomal protein S6-like [Glycine max]
Length=249

 Score =   293 bits (749),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAF+ KRISQEV+ DALG+EFKGYVFKI GGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFWDKRISQEVNIDALGEEFKGYVFKITGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPG V LLL RGTPCFRGYGRRNGERRRK VRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGCVHLLLHRGTPCFRGYGRRNGERRRKFVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            SDLP LTD+EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTK GKK SKAPK
Sbjct  121  SDLPRLTDVEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKVGKKVSKAPK  179



>ref|XP_004492256.1| PREDICTED: 40S ribosomal protein S6-like [Cicer arietinum]
Length=249

 Score =   292 bits (747),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFN+ANPTTGCQKKLEIDDD KLRAF+ KRISQEV+GDALG+EFKGYVFKI GGCDKQG
Sbjct  1    MKFNVANPTTGCQKKLEIDDDLKLRAFWDKRISQEVNGDALGEEFKGYVFKITGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAP  608
            +DLPGLTD+EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTK+GK +   P
Sbjct  121  NDLPGLTDVEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKAGKLSGSLP  178



>gb|AAP46142.1| ribosomal protein S6 [Brassica napus]
Length=249

 Score =   292 bits (747),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 166/179 (93%), Gaps = 1/179 (1%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFN+ANPTTGCQKKLEIDDDQKLRAF+ KR+SQEVSGDALG+EFKGY+FKIMGGCDKQG
Sbjct  1    MKFNVANPTTGCQKKLEIDDDQKLRAFYDKRLSQEVSGDALGEEFKGYIFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRG+GRR GERRRKSVRGCIVSQDLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGHGRRTGERRRKSVRGCIVSQDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
             DLPGLTD E  RMRGPKRASKIRKLFN  K+DDVRKYVNTYRR FT K GK+ SKAPK
Sbjct  121  KDLPGLTDTE-SRMRGPKRASKIRKLFNFIKEDDVRKYVNTYRRKFTNKKGKEVSKAPK  178



>gb|KJB64239.1| hypothetical protein B456_010G038700 [Gossypium raimondii]
Length=231

 Score =   291 bits (744),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEV GDALG+EFKGYVFKI GGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVIGDALGEEFKGYVFKIKGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKG+
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGD  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKAS  599
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR+FTTKSG+ +S
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRSFTTKSGRVSS  175



>ref|XP_007042906.1| Ribosomal protein S6e [Theobroma cacao]
 gb|EOX98737.1| Ribosomal protein S6e [Theobroma cacao]
Length=279

 Score =   291 bits (745),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 169/209 (81%), Positives = 173/209 (83%), Gaps = 30/209 (14%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEV GDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVVGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQR------------------------------GTPCFrgygrr  344
            FPMKQGVLTPGRVRLLL R                              GTPCFRGYGRR
Sbjct  61   FPMKQGVLTPGRVRLLLHRGIGLGGNSMFRLILLASFNVYACFSIVAIVGTPCFRGYGRR  120

Query  345  ngerrrksvrgCIVSQDLSVLNLVIVKKGESDLPGLTDIEKPRMRGPKRASKIRKLFNLS  524
            NGERRRKSVRGCIVSQDLSVLNLVIVKKGE+DLPGLTD +KPRMRGPKRASKIRKLFNLS
Sbjct  121  NGERRRKSVRGCIVSQDLSVLNLVIVKKGENDLPGLTDTDKPRMRGPKRASKIRKLFNLS  180

Query  525  KDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            K+DDVRKYVNTYRR FTTKSGKK SKAPK
Sbjct  181  KEDDVRKYVNTYRRTFTTKSGKKVSKAPK  209



>gb|KFK29760.1| hypothetical protein AALP_AA7G175400 [Arabis alpina]
Length=250

 Score =   289 bits (739),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MK NIANPTTGCQKKLEIDDDQKLR F+ KR+SQEV GD LG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKLNIANPTTGCQKKLEIDDDQKLRGFYDKRLSQEVHGDVLGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRG+GRR GERRRKSVRGCIVS DLSVLNLVIVKKG+
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGHGRRTGERRRKSVRGCIVSPDLSVLNLVIVKKGD  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNL K+DDVR YVNTYRR FT K GK+ SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLKKEDDVRTYVNTYRRKFTNKKGKEVSKAPK  179



>gb|AFK42374.1| unknown [Medicago truncatula]
Length=186

 Score =   286 bits (732),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 157/176 (89%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFN+ANPTTGCQKKLEIDDD KLRAF+ KRISQEV GDALG+EFKGYVFKI GGCDKQG
Sbjct  1    MKFNVANPTTGCQKKLEIDDDMKLRAFWDKRISQEVLGDALGEEFKGYVFKITGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRG+GRRNGERRRKSVRGCIVS DLSVLNLVIVKKG+
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGHGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGD  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASK  602
            +DLPGLTD+EKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRR FTTK G++ +K
Sbjct  121  NDLPGLTDVEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRTFTTKDGRRLAK  176



>gb|KHN08511.1| 40S ribosomal protein S6 [Glycine soja]
Length=928

 Score =   304 bits (778),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 166/180 (92%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = +3

Query  72   KMKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQ  251
            KMKFNIANPTTGCQKKLEIDDD KLRAF+ KRISQEV GDALG+EFKGYVFKI GGCDKQ
Sbjct  679  KMKFNIANPTTGCQKKLEIDDDLKLRAFWDKRISQEVVGDALGEEFKGYVFKITGGCDKQ  738

Query  252  GFPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKG  431
            GFPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKG
Sbjct  739  GFPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKG  798

Query  432  ESDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            E+DLPGLTD+EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTK+GKK SKAPK
Sbjct  799  ENDLPGLTDVEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKNGKKVSKAPK  858



>gb|AAB88298.1| ribosomal protein S6 [Arabidopsis thaliana]
Length=249

 Score =   285 bits (730),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 165/179 (92%), Gaps = 1/179 (1%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFN+ANPTTGCQKKLEIDDDQKLRAF+ KRISQEVSGDALG+EFKGYVFKI GGCDKQG
Sbjct  1    MKFNVANPTTGCQKKLEIDDDQKLRAFYDKRISQEVSGDALGEEFKGYVFKIKGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRG+GRR GERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGHGRRTGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD E  +MRGPKRASKIRKLFNL K+DDVR YVNTYRR FT K GK+ SKAPK
Sbjct  121  NDLPGLTDHE-SKMRGPKRASKIRKLFNLKKEDDVRTYVNTYRRKFTNKKGKEVSKAPK  178



>ref|XP_003557781.2| PREDICTED: abscisic acid-inducible protein kinase [Brachypodium 
distachyon]
Length=641

 Score =   296 bits (758),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = +3

Query  63   PQQKMKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGC  242
            P   MKFNIANPTTGCQKKLEIDDDQKLR FF KRISQEV GD LG+EFKGYVFKIMGGC
Sbjct  388  PDATMKFNIANPTTGCQKKLEIDDDQKLRVFFDKRISQEVLGDHLGEEFKGYVFKIMGGC  447

Query  243  DKQGFPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIV  422
            DKQGFPMKQGVL+ GRVRLLL RGTPCFRGYGRR+GERRRKSVRGCIVSQDLSV+NLVIV
Sbjct  448  DKQGFPMKQGVLSSGRVRLLLHRGTPCFRGYGRRDGERRRKSVRGCIVSQDLSVINLVIV  507

Query  423  KKGESDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASK  602
            KKG++DLPGLTD EKPRMRGPKRASKIRKLFNL+KDDDVRKYVNTYRR FT K+GKK SK
Sbjct  508  KKGDNDLPGLTDTEKPRMRGPKRASKIRKLFNLAKDDDVRKYVNTYRRTFTNKNGKKVSK  567

Query  603  APK  611
            APK
Sbjct  568  APK  570



>gb|EMS51115.1| 40S ribosomal protein S6 [Triticum urartu]
 gb|EMS51116.1| 40S ribosomal protein S6 [Triticum urartu]
 gb|EMT11003.1| 40S ribosomal protein S6 [Aegilops tauschii]
Length=250

 Score =   284 bits (726),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MK NIANPTTGCQKK+EIDDDQKLR  + KRISQEV GD LG+EFKGY+FKIMGGCDKQG
Sbjct  1    MKLNIANPTTGCQKKVEIDDDQKLRNLYDKRISQEVVGDLLGEEFKGYIFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLT GRVRLLL RGTPCFRG+GRRNGERRRKSVRGCIVSQDLSV+NLVIVKKGE
Sbjct  61   FPMKQGVLTSGRVRLLLHRGTPCFRGFGRRNGERRRKSVRGCIVSQDLSVINLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKI+KLFNL KDDDVR YVNTYRR F  K GKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIKKLFNLGKDDDVRSYVNTYRRTFLNKKGKKVSKAPK  179



>tpg|DAA63661.1| TPA: putative 40S ribosomal protein S6 [Zea mays]
Length=243

 Score =   283 bits (725),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 165/179 (92%), Gaps = 8/179 (4%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANP+TGCQKKLEIDDDQKLRAF+ +RISQE        EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPSTGCQKKLEIDDDQKLRAFYDRRISQE--------EFKGYVFKIMGGCDKQG  52

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLT GRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVSQDLSV+NLVIVKKGE
Sbjct  53   FPMKQGVLTSGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVINLVIVKKGE  112

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNL+KDDDVRKYVNTYRR FTTK+GKK SKAPK
Sbjct  113  NDLPGLTDTEKPRMRGPKRASKIRKLFNLNKDDDVRKYVNTYRRTFTTKNGKKVSKAPK  171



>dbj|BAK06183.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=250

 Score =   283 bits (724),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MK NIANPTTGCQKK+EIDDDQKLR  + KRISQEV GD LG+EF+GY+FKIMGGCDKQG
Sbjct  1    MKLNIANPTTGCQKKVEIDDDQKLRNLYDKRISQEVVGDLLGEEFEGYIFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGT CFRG+GRR GERRRKSVRGCIVSQDLSV+NLVIVKKG+
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTSCFRGHGRRVGERRRKSVRGCIVSQDLSVINLVIVKKGK  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKI+KLFNL KDDDVR+YVNTYRR+FT K GK  SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIKKLFNLGKDDDVRQYVNTYRRSFTNKKGKTVSKAPK  179



>gb|EMT11004.1| 40S ribosomal protein S6 [Aegilops tauschii]
Length=250

 Score =   282 bits (721),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MK NIANPTTGCQKK+EIDDDQKLR  + KRISQEV GD LG+EFKGY+FKIMGGCDKQG
Sbjct  1    MKLNIANPTTGCQKKVEIDDDQKLRNLYDKRISQEVVGDLLGEEFKGYIFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLT GRVRLLL RGTPCFRG+GRRNGERRRKSVRGCIVSQDLSV+NLVIVKKGE
Sbjct  61   FPMKQGVLTSGRVRLLLHRGTPCFRGFGRRNGERRRKSVRGCIVSQDLSVINLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKI+KLFNL  DDDVR YVNTYRR F  K GKK SKAPK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIKKLFNLGTDDDVRSYVNTYRRTFLNKKGKKVSKAPK  179



>ref|XP_001758271.1| predicted protein [Physcomitrella patens]
 gb|EDQ77093.1| predicted protein [Physcomitrella patens]
Length=249

 Score =   279 bits (713),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MK NIANPTTGCQKK+EIDDD KLR F+ KR++QEVSGD LGDEFKGYVFKIMGGCDKQG
Sbjct  1    MKLNIANPTTGCQKKVEIDDDAKLRQFYDKRLAQEVSGDQLGDEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLT GRV+LL+ RG  CFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVK+G+
Sbjct  61   FPMKQGVLTQGRVQLLMHRGVSCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKQGD  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTDIEKPRMRGPKRA+KIRKLFNL+K+DDVRKYVNTYRR+F + +GKK SKAPK
Sbjct  121  NDLPGLTDIEKPRMRGPKRATKIRKLFNLTKEDDVRKYVNTYRRSFVSATGKKRSKAPK  179



>ref|XP_001781778.1| predicted protein [Physcomitrella patens]
 gb|EDQ53426.1| predicted protein [Physcomitrella patens]
Length=249

 Score =   279 bits (713),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MK NIANPTTGCQKK+EIDDD KLR F+ KR++QEVSGD LGDEFKGYVFKIMGGCDKQG
Sbjct  1    MKLNIANPTTGCQKKVEIDDDAKLRQFYDKRLAQEVSGDQLGDEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLT GRV+LL+ RG  CFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVK+G+
Sbjct  61   FPMKQGVLTQGRVQLLMHRGVSCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKQGD  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTDIEKPRMRGPKRA+KIRKLFNL+K+DDVRKYVNTYRR+F + +GKK SKAPK
Sbjct  121  NDLPGLTDIEKPRMRGPKRATKIRKLFNLTKEDDVRKYVNTYRRSFVSATGKKRSKAPK  179



>ref|XP_001779200.1| predicted protein [Physcomitrella patens]
 gb|EDQ55963.1| predicted protein [Physcomitrella patens]
Length=247

 Score =   279 bits (713),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MK NIANPTTGCQKK+EIDDD KLR F+ KR++QEVSGD LGDEFKGYVFKIMGGCDKQG
Sbjct  1    MKLNIANPTTGCQKKVEIDDDAKLRQFYDKRLAQEVSGDQLGDEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLT GRV+LL+ RG  CFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVK+G+
Sbjct  61   FPMKQGVLTQGRVQLLMHRGVSCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKQGD  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTDIEKPRMRGPKRA+KIRKLFNL+K+DDVRKYVNTYRR+F + +GKK SKAPK
Sbjct  121  NDLPGLTDIEKPRMRGPKRATKIRKLFNLTKEDDVRKYVNTYRRSFVSATGKKRSKAPK  179



>ref|XP_001779222.1| predicted protein [Physcomitrella patens]
 gb|EDQ55985.1| predicted protein [Physcomitrella patens]
Length=247

 Score =   279 bits (713),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MK NIANPTTGCQKK+EIDDD KLR F+ KR++QEVSGD LGDEFKGYVFKIMGGCDKQG
Sbjct  1    MKLNIANPTTGCQKKVEIDDDAKLRQFYDKRLAQEVSGDQLGDEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLT GRV+LL+ RG  CFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVK+G+
Sbjct  61   FPMKQGVLTQGRVQLLMHRGVSCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKQGD  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTDIEKPRMRGPKRA+KIRKLFNL+K+DDVRKYVNTYRR+F + +GKK SKAPK
Sbjct  121  NDLPGLTDIEKPRMRGPKRATKIRKLFNLTKEDDVRKYVNTYRRSFVSATGKKRSKAPK  179



>ref|XP_003562681.2| PREDICTED: serine/threonine-protein kinase SAPK2 [Brachypodium 
distachyon]
Length=608

 Score =   288 bits (736),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MK NIANPTTGCQKKLEIDDDQKLR  + KRISQEV GD LGDEFKGYVFKIMGGCDKQG
Sbjct  359  MKLNIANPTTGCQKKLEIDDDQKLRHLYDKRISQEVPGDHLGDEFKGYVFKIMGGCDKQG  418

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLT GRVRLLL RGTPCFRGYGRR+GERRRKSVRGCIVSQDLSV+NLVIVKKGE
Sbjct  419  FPMKQGVLTAGRVRLLLHRGTPCFRGYGRRDGERRRKSVRGCIVSQDLSVINLVIVKKGE  478

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKI+KLFNL KDDDVR YVNTYRR F  K GKK SKAPK
Sbjct  479  NDLPGLTDTEKPRMRGPKRASKIKKLFNLGKDDDVRNYVNTYRRTFINKKGKKTSKAPK  537



>ref|XP_001779221.1| predicted protein [Physcomitrella patens]
 gb|EDQ55984.1| predicted protein, partial [Physcomitrella patens]
Length=247

 Score =   276 bits (706),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            ++ NIANPTTGCQKK+EIDDD KLR F+ KR++QEVSGD LGDEFKGYVFKIMGGCDKQG
Sbjct  1    LQLNIANPTTGCQKKVEIDDDAKLRQFYDKRLAQEVSGDQLGDEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLT GRV+LL+ RG  CFRGYGRRNGERRRKSVRGCIVS DLSVLNLVIVK+G+
Sbjct  61   FPMKQGVLTQGRVQLLMHRGVSCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKQGD  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTDIEKPRMRGPKRA+KIRKLFNL+K+DDVRKYVNTYRR+F + +GKK SKAPK
Sbjct  121  NDLPGLTDIEKPRMRGPKRATKIRKLFNLTKEDDVRKYVNTYRRSFVSATGKKRSKAPK  179



>gb|KJB48853.1| hypothetical protein B456_008G090300 [Gossypium raimondii]
Length=157

 Score =   267 bits (682),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 151/157 (96%), Positives = 154/157 (98%), Gaps = 0/157 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRK  545
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRK
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRK  157



>ref|XP_002972307.1| hypothetical protein SELMODRAFT_172795 [Selaginella moellendorffii]
 ref|XP_002984216.1| hypothetical protein SELMODRAFT_180914 [Selaginella moellendorffii]
 gb|EFJ14726.1| hypothetical protein SELMODRAFT_180914 [Selaginella moellendorffii]
 gb|EFJ26393.1| hypothetical protein SELMODRAFT_172795 [Selaginella moellendorffii]
Length=250

 Score =   270 bits (690),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 158/179 (88%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MK NIANPTTGCQKK++IDDDQKL+ F+ KRISQEV GD LG+EFKGYVFKIMGGCDK G
Sbjct  1    MKLNIANPTTGCQKKVDIDDDQKLKIFYEKRISQEVPGDGLGEEFKGYVFKIMGGCDKDG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVL   RVRLLL RG  CFRGYGRR+GERRRKSVRGCIVS DLSVLNLVIVK+GE
Sbjct  61   FPMKQGVLKTKRVRLLLNRGDTCFRGYGRRDGERRRKSVRGCIVSHDLSVLNLVIVKQGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
              LP LTD EKPRMRGPKRASKIRKLFNL K+DDVRKYVNTYRRNFT  SGKK SKAPK
Sbjct  121  KHLPDLTDTEKPRMRGPKRASKIRKLFNLDKEDDVRKYVNTYRRNFTAPSGKKRSKAPK  179



>ref|XP_003632467.1| PREDICTED: 40S ribosomal protein S6 isoform X3 [Vitis vinifera]
Length=157

 Score =   265 bits (677),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 148/157 (94%), Positives = 154/157 (98%), Gaps = 0/157 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRV+LLL RGTPCFRGYGRRNGERRRK+VRGCIVSQDLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVQLLLHRGTPCFRGYGRRNGERRRKAVRGCIVSQDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRK  545
             +LPGLTD+EKPRMRGPKRASKIRKLFNLSK+DDVRK
Sbjct  121  GELPGLTDVEKPRMRGPKRASKIRKLFNLSKEDDVRK  157



>ref|XP_008440575.1| PREDICTED: LOW QUALITY PROTEIN: 40S ribosomal protein S6 [Cucumis 
melo]
Length=248

 Score =   265 bits (677),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 152/179 (85%), Gaps = 1/179 (1%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKK EIDDD KLRAF+ KRISQEV+GDALG++FKGYVFKIMG CDKQG
Sbjct  1    MKFNIANPTTGCQKKFEIDDDAKLRAFWDKRISQEVNGDALGEDFKGYVFKIMGVCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FP KQGV T GRV LLL RGTPCF     R    RRKSVRGCIV+ DLSVLNLV V+ GE
Sbjct  61   FPKKQGVWTTGRVCLLLHRGTPCF-CGYGRRNGERRKSVRGCIVNPDLSVLNLVTVRXGE  119

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTDI+KPRMRGPKR SKIRKLFNLSKDDDVRKYVNTY + FT K GKK SKAPK
Sbjct  120  NDLPGLTDIKKPRMRGPKRPSKIRKLFNLSKDDDVRKYVNTYSKTFTDKLGKKCSKAPK  178



>gb|EMT26436.1| Serine/threonine-protein kinase SAPK2 [Aegilops tauschii]
Length=588

 Score =   275 bits (703),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = +3

Query  81   FNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQGFP  260
             NIANPTTGCQKK+EIDDD KLR  + KRISQEV GD LG+EF+GY+FKIMGGCDKQGFP
Sbjct  341  LNIANPTTGCQKKVEIDDDMKLRNLYDKRISQEVVGDLLGEEFEGYIFKIMGGCDKQGFP  400

Query  261  MKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGESD  440
            MKQGVLTPGRVRLLL RGT CFRG+GRR GERRRKSVRGCIVSQDLSV+NLVIVKKG++D
Sbjct  401  MKQGVLTPGRVRLLLHRGTSCFRGHGRRVGERRRKSVRGCIVSQDLSVINLVIVKKGKND  460

Query  441  LPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            LPGLTD EKPRMRGPKRASKI+KLFNL KDDDVR+YVNTYRR+FT K GK  SKAPK
Sbjct  461  LPGLTDTEKPRMRGPKRASKIKKLFNLGKDDDVRQYVNTYRRSFTNKKGKTVSKAPK  517



>gb|KJB79636.1| hypothetical protein B456_013G060000 [Gossypium raimondii]
Length=233

 Score =   263 bits (671),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 146/155 (94%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +3

Query  147  RAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQGFPMKQGVLTPGRVRLLLQRGTPCF  326
            RAFF KRISQEV+GDALG+EFKGYVFKIMGGCDKQGFPMKQGVLTPGRVRLLL RGTPCF
Sbjct  8    RAFFDKRISQEVAGDALGEEFKGYVFKIMGGCDKQGFPMKQGVLTPGRVRLLLHRGTPCF  67

Query  327  rgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGESDLPGLTDIEKPRMRGPKRASKIR  506
            RGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE+DLPGLTD EKPRMRGPKRASKIR
Sbjct  68   RGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGENDLPGLTDTEKPRMRGPKRASKIR  127

Query  507  KLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            KLFNLSK+DDVRKYVNTYRR FTTKSGKK SKAPK
Sbjct  128  KLFNLSKEDDVRKYVNTYRRTFTTKSGKKVSKAPK  162



>ref|XP_010104453.1| 40S ribosomal protein S6 [Morus notabilis]
 gb|EXC00986.1| 40S ribosomal protein S6 [Morus notabilis]
Length=266

 Score =   253 bits (647),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 146/168 (87%), Positives = 151/168 (90%), Gaps = 13/168 (8%)
 Frame = +3

Query  147  RAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQGFPMKQGVLTPGRVRLLLQRGTPCF  326
            RAFF KRISQEVSGD+LG+EFKGYVFKIMGGCDKQGFPMKQGVLTPGRVRLLL RGTPCF
Sbjct  29   RAFFDKRISQEVSGDSLGEEFKGYVFKIMGGCDKQGFPMKQGVLTPGRVRLLLHRGTPCF  88

Query  327  rgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGESDLPGLTDIEKPRMRGPKRASKIR  506
            RGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE+DLPGLTD EKPRMRGPKRASKIR
Sbjct  89   RGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGENDLPGLTDTEKPRMRGPKRASKIR  148

Query  507  KLFNLSKDDDVRKYVNTYRRNFTTKS-------------GKKASKAPK  611
            KLFNLSK+DDVRKYVNTYRR+FTTKS             GKK SKAPK
Sbjct  149  KLFNLSKEDDVRKYVNTYRRSFTTKSGEAPKHLEALVFAGKKVSKAPK  196



>gb|KJB44105.1| hypothetical protein B456_007G234700 [Gossypium raimondii]
Length=192

 Score =   248 bits (632),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 139/144 (97%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEVSGDALG+EFKGYVFKIMGGCDKQG
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIR  506
            +DLPGLTD EKPRMRGPKRASKIR
Sbjct  121  NDLPGLTDTEKPRMRGPKRASKIR  144



>gb|KJB77544.1| hypothetical protein B456_012G142800 [Gossypium raimondii]
Length=224

 Score =   248 bits (634),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 150/179 (84%), Gaps = 25/179 (14%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MKFNIANPTTGCQKKLEIDDDQKLRAFF KRISQEV+GDALG+EFKGYVFKIMGG     
Sbjct  1    MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVAGDALGEEFKGYVFKIMGG-----  55

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
                                TPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE
Sbjct  56   --------------------TPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE  95

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR FTTKSGKK SKAPK
Sbjct  96   NDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKVSKAPK  154



>ref|XP_005647484.1| ribosomal protein S6e [Coccomyxa subellipsoidea C-169]
 gb|EIE22940.1| ribosomal protein S6e [Coccomyxa subellipsoidea C-169]
Length=252

 Score =   247 bits (631),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 153/179 (85%), Gaps = 1/179 (1%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MK NIA P TG QKKLEID+D KLRAF+ KR++QEV G+ALGDE+KGY+FKIMGG DKQG
Sbjct  1    MKLNIAYPPTGAQKKLEIDEDSKLRAFYDKRLAQEVDGEALGDEYKGYIFKIMGGQDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            F MKQGVL PGRV+LL+  G  CFRG+GRR GERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FGMKQGVLVPGRVQLLMAPGDSCFRGFGRRKGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            S++ GLTD EKPRMRGPKRASKIRKLFNLS DDDVRKYVNTY R    K GKK SKAPK
Sbjct  121  SEIAGLTDEEKPRMRGPKRASKIRKLFNLSGDDDVRKYVNTY-RTVKEKDGKKHSKAPK  178



>ref|XP_005848306.1| hypothetical protein CHLNCDRAFT_59656 [Chlorella variabilis]
 gb|EFN56204.1| hypothetical protein CHLNCDRAFT_59656 [Chlorella variabilis]
Length=247

 Score =   241 bits (616),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 155/179 (87%), Gaps = 1/179 (1%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MK NIA P+TGCQKKLEI+DD KLRAF+ KR+SQEV G+ALG+EFKGYVFKIMGG DKQG
Sbjct  1    MKLNIAFPSTGCQKKLEIEDDAKLRAFYDKRVSQEVDGEALGEEFKGYVFKIMGGQDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLT GRV++L+  G  CFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE
Sbjct  61   FPMKQGVLTNGRVQVLMSPGDQCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            ++LPGLTD EKPR RGPKRASKIRK+FNL+KDDDVR YV  Y +    K+GK + K PK
Sbjct  121  AELPGLTDEEKPRQRGPKRASKIRKMFNLTKDDDVRHYVKIYGKK-VEKNGKTSVKCPK  178



>ref|XP_011399644.1| 40S ribosomal protein S6 [Auxenochlorella protothecoides]
 gb|KFM26706.1| 40S ribosomal protein S6 [Auxenochlorella protothecoides]
Length=246

 Score =   240 bits (613),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 137/179 (77%), Positives = 151/179 (84%), Gaps = 1/179 (1%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MK NIA P TGCQKKL+IDDD KLRAF+ KRISQEV G+ALG EFKGY+FKI GG DKQG
Sbjct  1    MKLNIAYPATGCQKKLDIDDDAKLRAFYDKRISQEVDGEALG-EFKGYIFKIKGGQDKQG  59

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLTPGRVR+L+  G  CFRG+GRR+GERRRKSVRGCIVS DLSVLNLVIV+KG 
Sbjct  60   FPMKQGVLTPGRVRVLMSPGDSCFRGHGRRDGERRRKSVRGCIVSSDLSVLNLVIVRKGV  119

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            ++LPGLTD EKPR RGPKRASKIRK+FNL+KDDDVR YV  Y R    K+GK   KAPK
Sbjct  120  AELPGLTDEEKPRQRGPKRASKIRKMFNLTKDDDVRHYVKIYGRKIEKKNGKTTIKAPK  178



>emb|CAA09042.1| 40S ribosomal protein S6 [Cicer arietinum]
Length=212

 Score =   239 bits (610),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 133/142 (94%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = +3

Query  186  GDALGDEFKGYVFKIMGGCDKQGFPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrk  365
            GDALG+EFKGYVFKI GGCDKQGFPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRK
Sbjct  1    GDALGEEFKGYVFKITGGCDKQGFPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRK  60

Query  366  svrgCIVSQDLSVLNLVIVKKGESDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRK  545
            SVRGCIVS DLSVLNLVIVKKGE+DLPGLTD+EKPRMRGPKRASKIRKLFNLSK+DDVRK
Sbjct  61   SVRGCIVSPDLSVLNLVIVKKGENDLPGLTDVEKPRMRGPKRASKIRKLFNLSKEDDVRK  120

Query  546  YVNTYRRNFTTKSGKKASKAPK  611
            YVNTYRRNFTTK+GKK SKAPK
Sbjct  121  YVNTYRRNFTTKAGKKVSKAPK  142



>ref|XP_003055759.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH61011.1| predicted protein [Micromonas pusilla CCMP1545]
Length=246

 Score =   239 bits (609),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 151/179 (84%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MK NIANP TGCQKK+EI+DD KLR F+ KRI+ E+ G+ LG+EFKGY+FKIMGG DKQG
Sbjct  1    MKLNIANPATGCQKKIEINDDSKLRIFYDKRIAAEIDGEGLGEEFKGYIFKIMGGNDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            F MKQG+LT  RV LL+++GT  F G+GRR GERRRK+VRGCIVSQD++VLNL+IVK+G 
Sbjct  61   FGMKQGILTAQRVFLLMKQGTSGFLGHGRRKGERRRKAVRGCIVSQDIAVLNLMIVKQGP  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
              LPGLTD EKPR+RGPKRASKIRKLF L K DDVRKYVNTYRR F + +GKK SKAPK
Sbjct  121  GPLPGLTDDEKPRLRGPKRASKIRKLFALDKKDDVRKYVNTYRREFESATGKKKSKAPK  179



>emb|CEF97132.1| Ribosomal protein S6, eukaryotic [Ostreococcus tauri]
Length=244

 Score =   238 bits (608),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 152/179 (85%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MK NIANP TG QKK+EI D+ KLRAF+ KRIS EV GD LGDE+KGYVFKIMGG DKQG
Sbjct  1    MKLNIANPQTGAQKKIEITDENKLRAFYDKRISAEVEGDDLGDEWKGYVFKIMGGNDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            F MKQGVLT  RV LL+ +GT  FRG+GRR GERRRK+ RGCIVSQD++VLNLVIVK+G+
Sbjct  61   FGMKQGVLTNQRVFLLMSQGTSGFRGHGRRKGERRRKACRGCIVSQDIAVLNLVIVKQGD  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +D+ GLTD E PR+RGPKRASKIRKLF L+K+DDVR+YVNTYRR F + +GKK SKAPK
Sbjct  121  ADVAGLTDTEVPRLRGPKRASKIRKLFALTKEDDVRQYVNTYRREFESATGKKKSKAPK  179



>gb|KDD74799.1| ribosomal protein S6e [Helicosporidium sp. ATCC 50920]
Length=245

 Score =   237 bits (605),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 152/179 (85%), Gaps = 1/179 (1%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MK NIA P TGCQKKLE++D+ KLRAF+ KRISQEV+G+ALG+EFKGY+FKI GG DKQG
Sbjct  1    MKLNIAYPPTGCQKKLEVEDEAKLRAFYDKRISQEVAGEALGEEFKGYIFKIKGGQDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLT  RVRLLL+RG  CFRG+GRR+GERRRKSVRGCIVS DLSVLNLVIV+KGE
Sbjct  61   FPMKQGVLTTDRVRLLLKRGDSCFRGHGRRDGERRRKSVRGCIVSHDLSVLNLVIVRKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            ++LPGLTD EKPR RGPKRAS+IRK+FNLSK+DDVR YV  Y +    K GK   K PK
Sbjct  121  AELPGLTDEEKPRQRGPKRASRIRKMFNLSKEDDVRHYVKIYGKKI-EKDGKTRVKCPK  178



>ref|XP_002955255.1| ribosomal protein S6 component of cytosolic 80S ribosome and 
40S small subunit [Volvox carteri f. nagariensis]
 gb|EFJ43774.1| ribosomal protein S6 component of cytosolic 80S ribosome and 
40S small subunit [Volvox carteri f. nagariensis]
Length=250

 Score =   236 bits (603),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 148/179 (83%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MK NIA P TGCQKKLE+DDD KLRAF+ KR++ EV G+ALG+EFKGYV KI GG DKQG
Sbjct  1    MKLNIAYPATGCQKKLEVDDDAKLRAFYDKRLAAEVDGEALGEEFKGYVLKIAGGQDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            F MKQGVLT GRVRLL+  G   FRG+GRR GERRRKSVRGCIVS DLSVLNLVIVKKGE
Sbjct  61   FAMKQGVLTNGRVRLLMTPGDQGFRGHGRRKGERRRKSVRGCIVSPDLSVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            ++LPGLTD EKPRMRGPKRASKIRK+FNLSK+DDVRKYV  Y R    K+GK   K PK
Sbjct  121  AELPGLTDEEKPRMRGPKRASKIRKMFNLSKEDDVRKYVTIYSRERKDKNGKTHRKCPK  179



>ref|XP_002499450.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO60708.1| predicted protein [Micromonas sp. RCC299]
Length=246

 Score =   232 bits (591),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 149/179 (83%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MK NIANP TG QKKLEI D+ KLR F+ KRI+ E+ G+ALGDE+KGY+FK+MGG DKQG
Sbjct  1    MKLNIANPATGQQKKLEITDESKLRVFYDKRIAAEIPGEALGDEYKGYIFKVMGGNDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            F M+QGVLT  RV LL+   T   RG+GRR GERRRK+ RGCI+S D++VLNL+IVK+G+
Sbjct  61   FGMRQGVLTAQRVFLLMSPKTQGMRGHGRRKGERRRKACRGCIISPDIAVLNLMIVKQGD  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            + LPGLTD EKPRMRGPKRASKIRKLF LSKDDDVRKYVNTYRR F + +GKK SKAPK
Sbjct  121  AALPGLTDEEKPRMRGPKRASKIRKLFALSKDDDVRKYVNTYRREFESATGKKKSKAPK  179



>gb|KJB44106.1| hypothetical protein B456_007G234700 [Gossypium raimondii]
Length=231

 Score =   229 bits (585),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 130/136 (96%), Positives = 132/136 (97%), Gaps = 0/136 (0%)
 Frame = +3

Query  204  EFKGYVFKIMGGCDKQGFPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCI  383
            EFKGYVFKIMGGCDKQGFPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCI
Sbjct  26   EFKGYVFKIMGGCDKQGFPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCI  85

Query  384  VSQDLSVLNLVIVKKGESDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYR  563
            VSQDLSVLNLVIVKKGE+DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYR
Sbjct  86   VSQDLSVLNLVIVKKGENDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYR  145

Query  564  RNFTTKSGKKASKAPK  611
            R FTTKSGKK SKAPK
Sbjct  146  RTFTTKSGKKVSKAPK  161



>ref|XP_007047875.1| Ribosomal protein S6e isoform 3 [Theobroma cacao]
 gb|EOX92032.1| Ribosomal protein S6e isoform 3 [Theobroma cacao]
Length=250

 Score =   230 bits (587),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 131/153 (86%), Positives = 137/153 (90%), Gaps = 0/153 (0%)
 Frame = +3

Query  153  FFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQGFPMKQGVLTPGRVRLLLQRGTPCFrg  332
            F  +   +++ G     EFKGYVFKIMGGCDKQGFPMKQGVLTPGRVRLLL RGTPCFRG
Sbjct  28   FLTRGFHRKLVGMPWVREFKGYVFKIMGGCDKQGFPMKQGVLTPGRVRLLLHRGTPCFRG  87

Query  333  ygrrngerrrksvrgCIVSQDLSVLNLVIVKKGESDLPGLTDIEKPRMRGPKRASKIRKL  512
            YGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGE+DLPGLTD EKPRMRGPKRASKIRKL
Sbjct  88   YGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGENDLPGLTDTEKPRMRGPKRASKIRKL  147

Query  513  FNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            FNLSK+DDVRKYVNTYRR F TKSGKK SKAPK
Sbjct  148  FNLSKEDDVRKYVNTYRRTFNTKSGKKVSKAPK  180


 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 35/57 (61%), Gaps = 0/57 (0%)
 Frame = +1

Query  91   QIRPLGARRSLRSTMIRNSEPFLSRGFLRRSAVMLWEMSSRDTCLRLWEAVTNKVFP  261
            QI+PL ARRSL+STM RNSEPFL+RGF R+   M W    +    ++      + FP
Sbjct  7    QIQPLVARRSLKSTMTRNSEPFLTRGFHRKLVGMPWVREFKGYVFKIMGGCDKQGFP  63



>ref|XP_001416665.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO94958.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=236

 Score =   228 bits (582),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 149/178 (84%), Gaps = 0/178 (0%)
 Frame = +3

Query  78   KFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQGF  257
            + NIANP TG QKK+EI D+ KLR F+ KRIS EV GD LGDE+KGY+FKIMGG DKQGF
Sbjct  1    QLNIANPQTGAQKKIEIVDENKLRCFYDKRISAEVEGDELGDEWKGYIFKIMGGNDKQGF  60

Query  258  PMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGES  437
             MKQGVLT  RV LL+ +GT  FRG GRR GERRRK+ RGCIVSQD++VLNL+IVK+G++
Sbjct  61   GMKQGVLTNQRVFLLMSQGTSGFRGNGRRKGERRRKACRGCIVSQDIAVLNLLIVKQGDA  120

Query  438  DLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            ++PGLTD E  R+RGPKRASKIRKLF L+K+DDVR+YVNTYRR F + +GKK SKAPK
Sbjct  121  EVPGLTDTEVARLRGPKRASKIRKLFALTKEDDVRQYVNTYRREFESATGKKKSKAPK  178



>ref|XP_006576029.1| PREDICTED: 40S ribosomal protein S6-like [Glycine max]
Length=182

 Score =   226 bits (577),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 139/150 (93%), Gaps = 1/150 (1%)
 Frame = +3

Query  150  AFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQGFPMKQGVLTPGRVRLLLQRGTPCFr  329
             F+ KRISQEV GDALG+EFKGYVF I GGCDKQGFP+KQGVLTPGRVRLLL RGTPCFR
Sbjct  15   TFWNKRISQEVVGDALGEEFKGYVFIITGGCDKQGFPIKQGVLTPGRVRLLLHRGTPCFR  74

Query  330  gygrrngerrrksvrgCIVSQDLSVLNLVIVKKGESDLPGLTDIEKPRMRGPKRASKIRK  509
            GYGRRNGERRRKSVRGCIVS DLSVLNLVIVKKGESDLPGLTD+EKPRMRGPKRASKIRK
Sbjct  75   GYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGESDLPGLTDVEKPRMRGPKRASKIRK  134

Query  510  LFNLSKDDDVRKYVNTYRRNFTTKSGKKAS  599
            LFNLSK DDVRKYVNTYRR FTTK+GK  S
Sbjct  135  LFNLSK-DDVRKYVNTYRRTFTTKNGKVPS  163



>gb|ETI52627.1| hypothetical protein F443_04343 [Phytophthora parasitica P1569]
 gb|ETI52628.1| hypothetical protein, variant [Phytophthora parasitica P1569]
 gb|ETK92507.1| hypothetical protein L915_04197 [Phytophthora parasitica]
 gb|ETK92508.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETL45916.1| hypothetical protein L916_04151 [Phytophthora parasitica]
 gb|ETL45917.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETL99077.1| hypothetical protein L917_04051 [Phytophthora parasitica]
 gb|ETL99078.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETM52231.1| hypothetical protein L914_04163 [Phytophthora parasitica]
 gb|ETM52232.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETO76893.1| hypothetical protein F444_07782 [Phytophthora parasitica P1976]
 gb|ETO76894.1| hypothetical protein, variant [Phytophthora parasitica P1976]
 gb|ETP22489.1| hypothetical protein F441_04288 [Phytophthora parasitica CJ01A1]
 gb|ETP22490.1| hypothetical protein, variant [Phytophthora parasitica CJ01A1]
 gb|ETP50371.1| hypothetical protein F442_04309 [Phytophthora parasitica P10297]
 gb|ETP50372.1| hypothetical protein, variant [Phytophthora parasitica P10297]
Length=242

 Score =   228 bits (581),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 145/179 (81%), Gaps = 4/179 (2%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MK NIANP TG QK LE+DD+ KLRAF+ KRISQEV GD LGDEFKG++F++ GG DKQG
Sbjct  1    MKLNIANPLTGAQKVLEVDDEHKLRAFYDKRISQEVEGDVLGDEFKGFIFRVSGGNDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVL+ GR RLLL +G  C+    RR GER+RKSVRGCIV  DLSVLNLV+VK GE
Sbjct  61   FPMKQGVLSNGRARLLLSKGKSCY--RPRRKGERKRKSVRGCIVGPDLSVLNLVVVKAGE  118

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +D+PGLTD++ PR  GPKRAS IRKLFNL+K+DDVRKYV   RR F +K+GKK  KAPK
Sbjct  119  ADVPGLTDVQIPRRLGPKRASNIRKLFNLTKEDDVRKYV--IRRKFESKTGKKNDKAPK  175



>ref|XP_002909042.1| 40S ribosomal protein S6 [Phytophthora infestans T30-4]
 gb|EEY57856.1| 40S ribosomal protein S6 [Phytophthora infestans T30-4]
Length=242

 Score =   228 bits (581),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 145/179 (81%), Gaps = 4/179 (2%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MK NIANP TG QK LE+DD+ KLRAF+ KRISQEV GD LGDEFKG++F++ GG DKQG
Sbjct  1    MKLNIANPLTGAQKVLEVDDEHKLRAFYEKRISQEVEGDVLGDEFKGFIFRVSGGNDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVL+ GR RLLL +G  C+    RR GER+RKSVRGCIV  DLSVLNLV+VK GE
Sbjct  61   FPMKQGVLSNGRARLLLSKGKSCY--RPRRKGERKRKSVRGCIVGPDLSVLNLVVVKAGE  118

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +D+PGLTD++ PR  GPKRAS IRKLFNL+K+DDVRKYV   RR F +K+GKK  KAPK
Sbjct  119  ADVPGLTDVQIPRRLGPKRASNIRKLFNLTKEDDVRKYV--IRRKFDSKTGKKNDKAPK  175



>gb|KJB44107.1| hypothetical protein B456_007G234700 [Gossypium raimondii]
Length=230

 Score =   227 bits (579),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 131/135 (97%), Gaps = 0/135 (0%)
 Frame = +3

Query  207  FKGYVFKIMGGCDKQGFPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIV  386
            FKGYVFKIMGGCDKQGFPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIV
Sbjct  26   FKGYVFKIMGGCDKQGFPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIV  85

Query  387  SQDLSVLNLVIVKKGESDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRR  566
            SQDLSVLNLVIVKKGE+DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR
Sbjct  86   SQDLSVLNLVIVKKGENDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRR  145

Query  567  NFTTKSGKKASKAPK  611
             FTTKSGKK SKAPK
Sbjct  146  TFTTKSGKKVSKAPK  160



>ref|XP_009529593.1| hypothetical protein PHYSODRAFT_286397 [Phytophthora sojae]
 gb|EGZ15844.1| hypothetical protein PHYSODRAFT_286397 [Phytophthora sojae]
Length=242

 Score =   228 bits (580),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 145/179 (81%), Gaps = 4/179 (2%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MK NIANP TG QK LE+DD+ KLRAF+ KRISQEV GD LGDEFKG++F++ GG DKQG
Sbjct  1    MKLNIANPLTGAQKVLEVDDEHKLRAFYDKRISQEVEGDVLGDEFKGFIFRVSGGNDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVL+ GR RLLL +G  C+    RR GER+RKSVRGCIV  DLSVLNLV+VK GE
Sbjct  61   FPMKQGVLSNGRARLLLSKGKTCY--RPRRKGERKRKSVRGCIVGPDLSVLNLVVVKAGE  118

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +D+PGLTD++ PR  GPKRAS IRKLFNL+K+DDVRKYV   RR F +K+GKK  KAPK
Sbjct  119  ADVPGLTDVQIPRRLGPKRASNIRKLFNLTKEDDVRKYV--IRRKFDSKTGKKNDKAPK  175



>gb|KJB18232.1| hypothetical protein B456_003G041100 [Gossypium raimondii]
Length=231

 Score =   227 bits (578),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 131/135 (97%), Gaps = 0/135 (0%)
 Frame = +3

Query  207  FKGYVFKIMGGCDKQGFPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIV  386
            FKGYVFKIMGGCDKQGFPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVRGCIV
Sbjct  27   FKGYVFKIMGGCDKQGFPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIV  86

Query  387  SQDLSVLNLVIVKKGESDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRR  566
            SQDLSVLNLVIVKKGE+DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVNTYRR
Sbjct  87   SQDLSVLNLVIVKKGENDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRR  146

Query  567  NFTTKSGKKASKAPK  611
             FTTKSGKK SKAPK
Sbjct  147  TFTTKSGKKVSKAPK  161



>gb|KJB48855.1| hypothetical protein B456_008G090300 [Gossypium raimondii]
Length=230

 Score =   227 bits (578),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  195  LGDEFKGYVFKIMGGCDKQGFPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvr  374
            L   FKGYVFKIMGGCDKQGFPMKQGVLTPGRVRLLL RGTPCFRGYGRRNGERRRKSVR
Sbjct  22   LARYFKGYVFKIMGGCDKQGFPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVR  81

Query  375  gCIVSQDLSVLNLVIVKKGESDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVN  554
            GCIVSQDLSVLNLVIVKKGE+DLPGLTD EKPRMRGPKRASKIRKLFNLSK+DDVRKYVN
Sbjct  82   GCIVSQDLSVLNLVIVKKGENDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVN  141

Query  555  TYRRNFTTKSGKKASKAPK  611
            TYRR FTTK+GKK SKAPK
Sbjct  142  TYRRTFTTKNGKKVSKAPK  160



>ref|XP_001695102.1| ribosomal protein S6, component of cytosolic 80S ribosome and 
40S small subunit [Chlamydomonas reinhardtii]
 gb|EDP01810.1| ribosomal protein S6 [Chlamydomonas reinhardtii]
Length=248

 Score =   227 bits (579),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 131/179 (73%), Positives = 145/179 (81%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MK NIA P TGCQKKLE+DD+ KLRAF+ +R++ EV G+ LG+EFKGYV KI GG DKQG
Sbjct  1    MKLNIAYPATGCQKKLEVDDEAKLRAFYDRRVAAEVDGEVLGEEFKGYVLKIAGGQDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            F MKQGVLT  RVRLL+  G   FRGYGRR GERRRKSVRGCIVS DL+VLNLVIVKKGE
Sbjct  61   FAMKQGVLTNARVRLLMTPGDQGFRGYGRRKGERRRKSVRGCIVSPDLAVLNLVIVKKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
             +LPGLTD EKPR+RGPKRASKIRK+FNL K DDVRKYV  Y R  T K+GKK  K PK
Sbjct  121  QELPGLTDEEKPRIRGPKRASKIRKMFNLGKVDDVRKYVTIYSRERTDKNGKKHRKCPK  179



>ref|XP_007511177.1| predicted protein [Bathycoccus prasinos]
 emb|CCO66737.1| predicted protein [Bathycoccus prasinos]
Length=246

 Score =   226 bits (575),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 146/179 (82%), Gaps = 0/179 (0%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MK NIANP TGCQKK+EI D+ KLR F+ KRIS EV  D+LGDE+KGY+FKIMGG DKQG
Sbjct  1    MKLNIANPATGCQKKIEITDENKLRVFYDKRISAEVEADSLGDEWKGYIFKIMGGNDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            F MKQGVLT  RV LL  RGT  F+G+GRR GERRRK+ RGCIVSQD+SVLN+ IVK+G+
Sbjct  61   FGMKQGVLTNQRVFLLQVRGTQGFQGHGRRKGERRRKACRGCIVSQDISVLNVAIVKQGD  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +D+PGLTD E PRMRGPKRASKIRKLF LSK+D V  YVN+ RR F + +GKK SKA K
Sbjct  121  ADVPGLTDTEVPRMRGPKRASKIRKLFALSKEDSVFPYVNSMRREFESATGKKKSKAQK  179



>ref|XP_005705742.1| 40S ribosomal protein S6e [Galdieria sulphuraria]
 gb|EME29222.1| 40S ribosomal protein S6e [Galdieria sulphuraria]
Length=237

 Score =   223 bits (568),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 151/181 (83%), Gaps = 4/181 (2%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MK NIANPTTGCQK++E+DD++KLRAF+ KR++QEV GDALGDEFKGY+FKIMGG DK+G
Sbjct  1    MKLNIANPTTGCQKQIEVDDERKLRAFYDKRLAQEVPGDALGDEFKGYIFKIMGGQDKEG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            F MKQGVLT GRVRLLL++G    RGYG R+GERRRKSVRGCIVS D++VLNL+I++KGE
Sbjct  61   FAMKQGVLTTGRVRLLLKKGDSGCRGYGMRDGERRRKSVRGCIVSPDIAVLNLIILRKGE  120

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTK--SGKKASKAP  608
             D+PGLTD   PR  GPKRASKIRKLFNLSK+DDVRKYV   RR  T K    K  SKAP
Sbjct  121  EDIPGLTDTTIPRRLGPKRASKIRKLFNLSKEDDVRKYV--IRREITPKKEGAKPYSKAP  178

Query  609  K  611
            K
Sbjct  179  K  179



>gb|KHN22177.1| 40S ribosomal protein S6 [Glycine soja]
Length=175

 Score =   220 bits (561),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 124/140 (89%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = +3

Query  144  LRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQGFPMKQGVLTPGRVRLLLQRGTPC  323
            LRAF+ KRISQEVSGDALG+EFKGYVFKI GGC KQGFPMKQGVLTPG VRLLL RGTPC
Sbjct  36   LRAFWDKRISQEVSGDALGEEFKGYVFKITGGCGKQGFPMKQGVLTPGHVRLLLHRGTPC  95

Query  324  FrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGESDLPGLTDIEKPRMRGPKRASKI  503
            F GYGR NGERRRKSV GCIVS DLSVLNLVIVKKGE+DLPGLTD+EKPRMRGPKR SKI
Sbjct  96   FCGYGRHNGERRRKSVPGCIVSPDLSVLNLVIVKKGENDLPGLTDVEKPRMRGPKRVSKI  155

Query  504  RKLFNLSKDDDVRKYVNTYR  563
            RKLFNLSK+DDVR YVNTYR
Sbjct  156  RKLFNLSKEDDVRNYVNTYR  175



>emb|CCA15019.1| 40S ribosomal protein S6 putative [Albugo laibachii Nc14]
Length=241

 Score =   219 bits (557),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 143/179 (80%), Gaps = 4/179 (2%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MK NIANP TG QK +EIDD+ KL AF+ KRISQEV G ALGDEFKGY+F+I GG DKQG
Sbjct  1    MKLNIANPLTGAQKVIEIDDEHKLHAFYEKRISQEVDGSALGDEFKGYIFRISGGNDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLT  RVRLLL +G  C+    RR GER+RKSVRGCIV  DLSVLNLV+VK G+
Sbjct  61   FPMKQGVLTNTRVRLLLSKGKSCY--RPRRKGERKRKSVRGCIVGPDLSVLNLVVVKTGD  118

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +++ GLTD++ PR  GPKR +KI+KLFNLSK+DDVRKYV   RR F +K+GKK  KAPK
Sbjct  119  AEVTGLTDVQCPRRLGPKRKTKIQKLFNLSKEDDVRKYV--IRRKFVSKTGKKNDKAPK  175



>gb|EPB91069.1| 40S ribosomal protein S6-B [Mucor circinelloides f. circinelloides 
1006PhL]
 gb|EPB93115.1| 40S ribosomal protein S6-B [Mucor circinelloides f. circinelloides 
1006PhL]
Length=241

 Score =   218 bits (555),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 146/181 (81%), Gaps = 6/181 (3%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MK NIANP TGCQK +EI+D+++LR F+ KR++QEVSGD+LGDEFKGYVF+I GG DKQG
Sbjct  1    MKLNIANPATGCQKLIEIEDERRLRGFYDKRMAQEVSGDSLGDEFKGYVFRISGGNDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVL P RVRLLL +G  C+    RR GER+RKSVRGCIV  DLSVL+LV+VK+GE
Sbjct  61   FPMKQGVLLPHRVRLLLSKGHSCY--RPRRTGERKRKSVRGCIVGSDLSVLSLVVVKQGE  118

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKS-GKKA-SKAP  608
             D+PGLTD   P+  GPKRASKIRK FNLSK+DDVRKYV   RR    K+ GKKA +KAP
Sbjct  119  QDIPGLTDTTVPKRLGPKRASKIRKFFNLSKEDDVRKYV--IRREVQPKAEGKKAYTKAP  176

Query  609  K  611
            K
Sbjct  177  K  177



>emb|CCI41749.1| unnamed protein product [Albugo candida]
Length=230

 Score =   218 bits (554),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 143/179 (80%), Gaps = 4/179 (2%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MK NIANP TG QK LEIDD+ KL AF+ KRISQEV G ALGDEFKG++F+I GG DKQG
Sbjct  1    MKLNIANPLTGAQKVLEIDDEHKLHAFYEKRISQEVDGSALGDEFKGFIFRISGGNDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLT  RVRLLL +G  C+    RR GER+RKSVRGCIV  DLSVLNLV+VK G+
Sbjct  61   FPMKQGVLTNTRVRLLLSKGKSCY--RPRRKGERKRKSVRGCIVGPDLSVLNLVVVKTGD  118

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            S++ GLTD++ PR  GPKR +KI+KLFNLSK+DDVRKYV   RR F +K+GKK  KAPK
Sbjct  119  SEVAGLTDVQCPRRLGPKRKTKIQKLFNLSKEDDVRKYV--IRRKFVSKTGKKNDKAPK  175



>ref|XP_009829688.1| hypothetical protein H257_06234 [Aphanomyces astaci]
 gb|ETV80741.1| hypothetical protein H257_06234 [Aphanomyces astaci]
Length=245

 Score =   218 bits (554),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 142/179 (79%), Gaps = 4/179 (2%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MK NIANP TG QK LEIDD+ KLRAF+ KR++QEV G+ LG+EFKG+VFKI GG DKQG
Sbjct  1    MKLNIANPHTGTQKVLEIDDEHKLRAFYEKRMTQEVDGEHLGEEFKGFVFKISGGNDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLT GR RLLL +G  C+    RR GER+RKSVRGCIV  DLSVLNLV+VK G+
Sbjct  61   FPMKQGVLTNGRARLLLSKGKSCY--RPRRKGERKRKSVRGCIVGPDLSVLNLVVVKTGD  118

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +++ GLTD   PR  GPKRAS IRKLFNL+K+DDVRKYV   RR F +K+GKK  KAPK
Sbjct  119  NEVAGLTDGHIPRRLGPKRASNIRKLFNLTKEDDVRKYV--IRRKFDSKTGKKNDKAPK  175



>ref|XP_008873377.1| hypothetical protein H310_09164 [Aphanomyces invadans]
 gb|ETV97816.1| hypothetical protein H310_09164 [Aphanomyces invadans]
Length=245

 Score =   218 bits (554),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 142/179 (79%), Gaps = 4/179 (2%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MK NIANP TG QK LEIDD+ KLRAF+ KR++QEV G+ LG+EFKG+VFKI GG DKQG
Sbjct  1    MKLNIANPHTGTQKVLEIDDEHKLRAFYEKRMTQEVDGEHLGEEFKGFVFKISGGNDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLT GR RLLL +G  C+    RR GER+RKSVRGCIV  DLSVLNLV+VK G+
Sbjct  61   FPMKQGVLTNGRARLLLSKGKSCY--RPRRKGERKRKSVRGCIVGPDLSVLNLVVVKTGD  118

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +++ GLTD   PR  GPKRAS IRKLFNL+K+DDVRKYV   RR F +K+GKK  KAPK
Sbjct  119  NEVAGLTDGHIPRRLGPKRASNIRKLFNLTKEDDVRKYV--IRRKFDSKTGKKNDKAPK  175



>gb|EPB90139.1| 40S ribosomal protein S6-B [Mucor circinelloides f. circinelloides 
1006PhL]
Length=241

 Score =   216 bits (549),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 145/181 (80%), Gaps = 6/181 (3%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            M  NIANP TGCQK +EI+D+++LR F+ KR++QEVSGD+LGDEFKGYVF+I GG DKQG
Sbjct  1    MDLNIANPATGCQKLIEIEDERRLRGFYDKRMAQEVSGDSLGDEFKGYVFRISGGNDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVL P RVRLLL +G  C+    RR GER+RKSVRGCIV  DLSVL+LV+VK+GE
Sbjct  61   FPMKQGVLLPHRVRLLLSKGHSCY--RPRRTGERKRKSVRGCIVGSDLSVLSLVVVKQGE  118

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKS-GKKA-SKAP  608
             D+PGLTD   P+  GPKRASKIRK FNLSK+DDVRKYV   RR    K+ GKKA +KAP
Sbjct  119  QDIPGLTDTTVPKRLGPKRASKIRKFFNLSKEDDVRKYV--IRREVQPKAEGKKAYTKAP  176

Query  609  K  611
            K
Sbjct  177  K  177



>gb|KDO30078.1| 40S ribosomal protein S6 [Saprolegnia parasitica CBS 223.65]
Length=247

 Score =   216 bits (549),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 142/179 (79%), Gaps = 4/179 (2%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MK NIANP TG QK +E DD+ KLRAF+ KR++QEV G+ LG+EFKG+VF+I GG DKQG
Sbjct  1    MKLNIANPHTGMQKVIECDDELKLRAFYEKRMAQEVDGEHLGEEFKGFVFRISGGNDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLT GR RLLL +G  C+    RR GER+RKSVRGCIV  DLSVLNLV+VK G+
Sbjct  61   FPMKQGVLTNGRARLLLSKGKTCY--RPRRKGERKRKSVRGCIVGPDLSVLNLVVVKAGD  118

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +D+PGLTD   PR  GPKRAS IRKLFNLSK+DDVRKYV   RR F +K+GKK  KAPK
Sbjct  119  NDVPGLTDGHIPRRLGPKRASNIRKLFNLSKEDDVRKYV--IRRKFDSKTGKKNDKAPK  175



>emb|CEI94743.1| Putative 40S ribosomal protein S6 [Rhizopus microsporus]
Length=241

 Score =   216 bits (549),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 146/181 (81%), Gaps = 6/181 (3%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MK NIANP TGCQK +EI+D+++LR F+ KR++QEVSGDALGDEFKGYVF+I GG DKQG
Sbjct  1    MKLNIANPATGCQKLIEIEDERRLRGFYDKRMAQEVSGDALGDEFKGYVFRITGGNDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVL P RV+LL+ +G  C+    RR GER+RKSVRGCIV  DLSVL+LV+VK+GE
Sbjct  61   FPMKQGVLLPHRVKLLMSKGHSCY--RPRRTGERKRKSVRGCIVGPDLSVLSLVVVKQGE  118

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKS-GKKA-SKAP  608
             D+PGLTD   P+  GPKRASKIRK FNLSK+DDVRKYV   RR    K+ GKKA +KAP
Sbjct  119  QDIPGLTDTTVPKRLGPKRASKIRKFFNLSKEDDVRKYV--IRREVQPKTEGKKAYTKAP  176

Query  609  K  611
            K
Sbjct  177  K  177



>emb|CEG69949.1| Putative 40S ribosomal protein S6 [Rhizopus microsporus]
 emb|CEI90159.1| Putative 40S ribosomal protein S6 [Rhizopus microsporus]
Length=241

 Score =   216 bits (549),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 146/181 (81%), Gaps = 6/181 (3%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MK NIANP TGCQK +EI+D+++LR F+ KR++QEVSGDALGDEFKGYVF+I GG DKQG
Sbjct  1    MKLNIANPATGCQKLIEIEDERRLRGFYDKRMAQEVSGDALGDEFKGYVFRITGGNDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVL P RV+LL+ +G  C+    RR GER+RKSVRGCIV  DLSVL+LV+VK+GE
Sbjct  61   FPMKQGVLLPHRVKLLMSKGHSCY--RPRRTGERKRKSVRGCIVGPDLSVLSLVVVKQGE  118

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKS-GKKA-SKAP  608
             D+PGLTD   P+  GPKRASKIRK FNLSK+DDVRKYV   RR    K+ GKKA +KAP
Sbjct  119  QDIPGLTDTTVPKRLGPKRASKIRKFFNLSKEDDVRKYV--IRREVQPKAEGKKAYTKAP  176

Query  609  K  611
            K
Sbjct  177  K  177



>gb|AAH61437.1| 40S ribosomal protein S6 [Xenopus (Silurana) tropicalis]
Length=247

 Score =   216 bits (549),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 142/179 (79%), Gaps = 4/179 (2%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MK NIANP TG QK +E DD+ KLRAF+ KR++QEV G+ LG+EFKG+VFKI GG DKQG
Sbjct  1    MKLNIANPHTGMQKVIECDDELKLRAFYEKRMTQEVDGEHLGEEFKGFVFKISGGNDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLT GR RLLL +G  C+    RR GER+RKSVRGCIV  DLSVLNLV+VK G+
Sbjct  61   FPMKQGVLTNGRARLLLSKGKSCY--RPRRKGERKRKSVRGCIVGPDLSVLNLVVVKAGD  118

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +++PGLTD   PR  GPKRAS IRKLFNLSK+DDVRKYV   RR F +K+GKK  KAPK
Sbjct  119  AEVPGLTDGHIPRRLGPKRASNIRKLFNLSKEDDVRKYV--IRRKFDSKTGKKNDKAPK  175



>ref|XP_003137917.1| 40S ribosomal protein S6 [Loa loa]
 gb|EJD76599.1| 40S ribosomal protein S6, variant 1 [Loa loa]
Length=240

 Score =   215 bits (548),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 141/180 (78%), Gaps = 5/180 (3%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MK NIA PTTGCQK  EIDDD+KLR F+ KR++QEV  DALGDE+KGYV +I GG DKQG
Sbjct  1    MKLNIAYPTTGCQKVFEIDDDKKLRIFYEKRMAQEVEADALGDEWKGYVLRITGGNDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLT GRVRLLL +G  C+    RR+GER+RKSVRGCIV  +LS L L+IVKKGE
Sbjct  61   FPMKQGVLTNGRVRLLLSKGHSCY--RSRRDGERKRKSVRGCIVDANLSALALIIVKKGE  118

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKA-SKAPK  611
             ++PGLTD   PR  GPKRASKIRKLFNL+K+DDVRKYV   RR    K G+K  SKAPK
Sbjct  119  QEIPGLTDTTVPRRLGPKRASKIRKLFNLTKNDDVRKYV--IRRKLPEKEGQKPRSKAPK  176



>emb|CEG65631.1| Putative 40S ribosomal protein S6 [Rhizopus microsporus]
Length=296

 Score =   217 bits (553),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 125/185 (68%), Positives = 147/185 (79%), Gaps = 6/185 (3%)
 Frame = +3

Query  63   PQQKMKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGC  242
            P   MK NIANP TGCQK +EI+D+++LR F+ KR++QEVSGDALGDEFKGYVF+I GG 
Sbjct  52   PTATMKLNIANPATGCQKLIEIEDERRLRGFYDKRMAQEVSGDALGDEFKGYVFRITGGN  111

Query  243  DKQGFPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIV  422
            DKQGFPMKQGVL P RV+LL+ +G  C+    RR GER+RKSVRGCIV  DLSVL+LV+V
Sbjct  112  DKQGFPMKQGVLLPHRVKLLMSKGHSCY--RPRRTGERKRKSVRGCIVGPDLSVLSLVVV  169

Query  423  KKGESDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKS-GKKA-  596
            K+GE D+PGLTD   P+  GPKRASKIRK FNLSK+DDVRKYV   RR    K+ GKKA 
Sbjct  170  KQGEQDIPGLTDTTVPKRLGPKRASKIRKFFNLSKEDDVRKYV--IRREVQPKTEGKKAY  227

Query  597  SKAPK  611
            +KAPK
Sbjct  228  TKAPK  232



>gb|EIE84935.1| 40S ribosomal protein S6-B [Rhizopus delemar RA 99-880]
 gb|EIE91086.1| 40S ribosomal protein S6-B [Rhizopus delemar RA 99-880]
Length=241

 Score =   215 bits (548),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 145/181 (80%), Gaps = 6/181 (3%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MK NIANP TGCQK +EI+D+++LR F+ KR++QEVSGD LGDEFKGYVF+I GG DKQG
Sbjct  1    MKLNIANPATGCQKLIEIEDERRLRGFYDKRMAQEVSGDTLGDEFKGYVFRITGGNDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVL P RVRLL+ +G  C+    RR GER+RKSVRGCIV  DLSVL+LV+VK+GE
Sbjct  61   FPMKQGVLLPHRVRLLMSKGHSCY--RPRRTGERKRKSVRGCIVGSDLSVLSLVVVKQGE  118

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKS-GKKA-SKAP  608
             D+PGLTD   P+  GPKRASKIR+ FNLSK+DDVRKYV   RR    K+ GKKA +KAP
Sbjct  119  QDIPGLTDTTVPKRLGPKRASKIRRFFNLSKEDDVRKYV--IRREVQPKTEGKKAYTKAP  176

Query  609  K  611
            K
Sbjct  177  K  177



>emb|CEJ04523.1| Putative 40S ribosomal protein S6 [Rhizopus microsporus]
Length=241

 Score =   215 bits (547),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 146/181 (81%), Gaps = 6/181 (3%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MK NIANP TGCQK +EI+D+++LR F+ KR++QEVSGDALGDEFKGYVF+I GG DKQG
Sbjct  1    MKLNIANPATGCQKLIEIEDERRLRGFYDKRMAQEVSGDALGDEFKGYVFRITGGNDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVL P RV+LL+ +G  C+    RR GER+RKSVRGCIV  DLSVL+LV+VK+GE
Sbjct  61   FPMKQGVLLPRRVKLLMSKGHSCY--RPRRTGERKRKSVRGCIVGPDLSVLSLVVVKQGE  118

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKS-GKKA-SKAP  608
             D+PGLTD   P+  GPKRASKIRK FNLSK+DDVRKYV   RR    K+ GKKA +KAP
Sbjct  119  QDIPGLTDTTVPKRLGPKRASKIRKFFNLSKEDDVRKYV--IRREVQPKAEGKKAYTKAP  176

Query  609  K  611
            K
Sbjct  177  K  177



>ref|XP_008610660.1| 40S ribosomal protein S6 [Saprolegnia diclina VS20]
 gb|EQC35898.1| 40S ribosomal protein S6 [Saprolegnia diclina VS20]
Length=247

 Score =   215 bits (547),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 142/179 (79%), Gaps = 4/179 (2%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MK NIANP TG QK +E DD+ KLRAF+ KR++QEV G+ LG+EFKG+VF+I GG DKQG
Sbjct  1    MKLNIANPHTGMQKVIECDDELKLRAFYEKRMAQEVEGEHLGEEFKGFVFRISGGNDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLT GR RLLL +G  C+    RR GER+RKSVRGCIV  DLSVLNLV+VK G+
Sbjct  61   FPMKQGVLTNGRARLLLSKGKTCY--RPRRKGERKRKSVRGCIVGPDLSVLNLVVVKAGD  118

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKASKAPK  611
            +D+PGLTD   PR  GPKRAS IRKLFNL+K+DDVRKYV   RR F +K+GKK  KAPK
Sbjct  119  NDVPGLTDGHIPRRLGPKRASNIRKLFNLTKEDDVRKYV--IRRKFDSKTGKKNDKAPK  175



>ref|XP_001901616.1| 40S ribosomal protein S6 [Brugia malayi]
Length=248

 Score =   215 bits (547),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 141/180 (78%), Gaps = 5/180 (3%)
 Frame = +3

Query  75   MKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCDKQG  254
            MK NIA PTTGCQK  EIDD++KLR F+ KR++QEV  DALGDE+KGYV +I GG DKQG
Sbjct  1    MKLNIAYPTTGCQKVFEIDDEKKLRIFYEKRMAQEVEADALGDEWKGYVLRITGGNDKQG  60

Query  255  FPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVKKGE  434
            FPMKQGVLT GRVRLLL +G  C+    RR+GER+RKSVRGCIV  +LS L L+IVKKGE
Sbjct  61   FPMKQGVLTNGRVRLLLSKGHSCY--RARRDGERKRKSVRGCIVDANLSALALIIVKKGE  118

Query  435  SDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKA-SKAPK  611
             ++PGLTD   PR  GPKRASKIRKLFNL+K+DDVRKYV   RR    K GKK  SKAPK
Sbjct  119  QEIPGLTDTTVPRRLGPKRASKIRKLFNLTKNDDVRKYV--IRRKLPEKEGKKPRSKAPK  176



>gb|EFO26158.2| 40S ribosomal protein S6 [Loa loa]
Length=251

 Score =   214 bits (546),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 124/183 (68%), Positives = 144/183 (79%), Gaps = 5/183 (3%)
 Frame = +3

Query  66   QQKMKFNIANPTTGCQKKLEIDDDQKLRAFFVKRISQEVSGDALGDEFKGYVFKIMGGCD  245
            +++MK NIA PTTGCQK  EIDDD+KLR F+ KR++QEV  DALGDE+KGYV +I GG D
Sbjct  14   KERMKLNIAYPTTGCQKVFEIDDDKKLRIFYEKRMAQEVEADALGDEWKGYVLRITGGND  73

Query  246  KQGFPMKQGVLTPGRVRLLLQRGTPCFrgygrrngerrrksvrgCIVSQDLSVLNLVIVK  425
            KQGFPMKQGVLT GRVRLLL +G  C+    RR+GER+RKSVRGCIV  +LS L L+IVK
Sbjct  74   KQGFPMKQGVLTNGRVRLLLSKGHSCY--RSRRDGERKRKSVRGCIVDANLSALALIIVK  131

Query  426  KGESDLPGLTDIEKPRMRGPKRASKIRKLFNLSKDDDVRKYVNTYRRNFTTKSGKKA-SK  602
            KGE ++PGLTD   PR  GPKRASKIRKLFNL+K+DDVRKYV   RR    K G+K  SK
Sbjct  132  KGEQEIPGLTDTTVPRRLGPKRASKIRKLFNLTKNDDVRKYV--IRRKLPEKEGQKPRSK  189

Query  603  APK  611
            APK
Sbjct  190  APK  192



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 842962938660