BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001F20

Length=603
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDO99450.1|  unnamed protein product                              86.7    3e-18   Coffea canephora [robusta coffee]
emb|CDP21271.1|  unnamed protein product                              85.9    7e-18   Coffea canephora [robusta coffee]
gb|KJB69156.1|  hypothetical protein B456_011G008600                  88.2    1e-17   Gossypium raimondii
ref|XP_009795883.1|  PREDICTED: neurofilament heavy polypeptide-like  87.4    3e-17   Nicotiana sylvestris
ref|XP_009606116.1|  PREDICTED: pollen-specific leucine-rich repe...  87.4    4e-17   Nicotiana tomentosiformis
gb|KHN40795.1|  hypothetical protein glysoja_015162                   86.7    4e-17   Glycine soja [wild soybean]
ref|XP_009801191.1|  PREDICTED: pollen-specific leucine-rich repe...  87.0    4e-17   Nicotiana sylvestris
emb|CDP04524.1|  unnamed protein product                              83.2    6e-17   Coffea canephora [robusta coffee]
ref|XP_008384171.1|  PREDICTED: uncharacterized protein LOC103446809  85.1    8e-17   
gb|ACF74351.1|  putative metal ion-binding protein                    85.5    9e-17   Arachis hypogaea [goober]
ref|XP_007147620.1|  hypothetical protein PHAVU_006G139900g           85.5    1e-16   Phaseolus vulgaris [French bean]
gb|KEH36983.1|  heavy-metal-associated domain protein                 85.5    1e-16   Medicago truncatula
ref|XP_007026351.1|  Heavy metal transport/detoxification superfa...  85.1    1e-16   
ref|XP_004250292.1|  PREDICTED: pollen-specific leucine-rich repe...  85.1    2e-16   Solanum lycopersicum
ref|XP_011086262.1|  PREDICTED: pollen-specific leucine-rich repe...  84.3    3e-16   Sesamum indicum [beniseed]
ref|XP_008384174.1|  PREDICTED: leucine-rich repeat extensin-like...  83.6    3e-16   
ref|XP_009378156.1|  PREDICTED: pollen-specific leucine-rich repe...  84.0    3e-16   
ref|XP_009377504.1|  PREDICTED: pollen-specific leucine-rich repe...  84.0    3e-16   Pyrus x bretschneideri [bai li]
ref|XP_008370968.1|  PREDICTED: leucine-rich repeat extensin-like...  84.0    4e-16   
ref|XP_004239815.1|  PREDICTED: pollen-specific leucine-rich repe...  84.0    5e-16   
emb|CDP04521.1|  unnamed protein product                              81.6    5e-16   Coffea canephora [robusta coffee]
gb|KJB67415.1|  hypothetical protein B456_010G190100                  83.6    6e-16   Gossypium raimondii
ref|XP_009613311.1|  PREDICTED: pollen-specific leucine-rich repe...  83.6    6e-16   Nicotiana tomentosiformis
ref|XP_008224624.1|  PREDICTED: anthrax toxin receptor-like           83.2    6e-16   Prunus mume [ume]
ref|XP_008357424.1|  PREDICTED: putative cuticle collagen 155         83.2    7e-16   
ref|XP_009796355.1|  PREDICTED: uncharacterized protein LOC104242939  82.4    7e-16   Nicotiana sylvestris
ref|XP_006365842.1|  PREDICTED: pollen-specific leucine-rich repe...  83.6    8e-16   Solanum tuberosum [potatoes]
ref|XP_009796356.1|  PREDICTED: pollen-specific leucine-rich repe...  83.2    8e-16   Nicotiana sylvestris
gb|EYU27661.1|  hypothetical protein MIMGU_mgv1a012649mg              82.0    1e-15   Erythranthe guttata [common monkey flower]
gb|KJB69158.1|  hypothetical protein B456_011G008600                  82.0    1e-15   Gossypium raimondii
gb|KHG01648.1|  hypothetical protein F383_21782                       81.6    2e-15   Gossypium arboreum [tree cotton]
ref|XP_004293391.1|  PREDICTED: neurofilament heavy polypeptide-like  81.6    2e-15   Fragaria vesca subsp. vesca
ref|XP_006352451.1|  PREDICTED: uncharacterized protein LOC102600600  80.9    2e-15   Solanum tuberosum [potatoes]
ref|XP_007211910.1|  hypothetical protein PRUPE_ppa010456mg           81.6    2e-15   Prunus persica
ref|XP_009591786.1|  PREDICTED: pollen-specific leucine-rich repe...  81.6    3e-15   Nicotiana tomentosiformis
ref|XP_004486344.1|  PREDICTED: pollen-specific leucine-rich repe...  81.3    3e-15   Cicer arietinum [garbanzo]
ref|XP_004293393.1|  PREDICTED: FK506-binding protein 4-like          80.9    3e-15   Fragaria vesca subsp. vesca
ref|XP_008384172.1|  PREDICTED: leucine-rich repeat extensin-like...  80.9    3e-15   
gb|AFK36989.1|  unknown                                               80.5    4e-15   Medicago truncatula
ref|XP_011095916.1|  PREDICTED: pollen-specific leucine-rich repe...  80.9    5e-15   Sesamum indicum [beniseed]
ref|XP_004236656.1|  PREDICTED: neurofilament heavy polypeptide       80.5    6e-15   Solanum lycopersicum
ref|XP_008224622.1|  PREDICTED: pollen-specific leucine-rich repe...  80.5    6e-15   Prunus mume [ume]
ref|XP_004507598.1|  PREDICTED: pollen-specific leucine-rich repe...  80.1    7e-15   Cicer arietinum [garbanzo]
ref|XP_006467282.1|  PREDICTED: transcription initiation factor T...  80.1    7e-15   Citrus sinensis [apfelsine]
ref|XP_006352327.1|  PREDICTED: protein TsetseEP-like                 80.5    7e-15   Solanum tuberosum [potatoes]
ref|XP_006449920.1|  hypothetical protein CICLE_v10017543mg           79.7    8e-15   Citrus clementina [clementine]
ref|XP_009374862.1|  PREDICTED: chitin-binding lectin 1-like          79.3    9e-15   Pyrus x bretschneideri [bai li]
ref|XP_006350257.1|  PREDICTED: neurofilament heavy polypeptide-like  79.7    1e-14   Solanum tuberosum [potatoes]
gb|AFK35490.1|  unknown                                               79.3    1e-14   Medicago truncatula
ref|XP_003610595.1|  Proline-rich protein                             79.3    1e-14   Medicago truncatula
ref|XP_007026352.1|  Heavy metal transport/detoxification superfa...  78.2    3e-14   
emb|CAA07370.1|  proline-rich protein                                 77.8    4e-14   Capsicum annuum
ref|XP_010434837.1|  PREDICTED: neurofilament medium polypeptide ...  78.6    4e-14   Camelina sativa [gold-of-pleasure]
ref|NP_001235946.1|  uncharacterized protein LOC547653                77.8    4e-14   
ref|XP_004293395.1|  PREDICTED: uncharacterized protein LOC101299556  77.0    4e-14   Fragaria vesca subsp. vesca
emb|CDY42537.1|  BnaC08g10660D                                        77.0    6e-14   Brassica napus [oilseed rape]
ref|XP_010542187.1|  PREDICTED: anther-specific proline-rich prot...  77.4    7e-14   Tarenaya hassleriana [spider flower]
ref|XP_007154042.1|  hypothetical protein PHAVU_003G086300g           77.0    7e-14   Phaseolus vulgaris [French bean]
ref|XP_006449921.1|  hypothetical protein CICLE_v10016401mg           77.0    9e-14   Citrus clementina [clementine]
ref|XP_006467280.1|  PREDICTED: neurofilament heavy polypeptide-like  76.6    1e-13   Citrus sinensis [apfelsine]
gb|KDO78536.1|  hypothetical protein CISIN_1g025287mg                 76.6    1e-13   Citrus sinensis [apfelsine]
emb|CDY09699.1|  BnaC07g33620D                                        76.3    1e-13   Brassica napus [oilseed rape]
emb|CDY22767.1|  BnaA08g05970D                                        76.3    2e-13   Brassica napus [oilseed rape]
ref|XP_002870162.1|  hypothetical protein ARALYDRAFT_493247           76.3    2e-13   
ref|XP_008384170.1|  PREDICTED: uncharacterized protein LOC103446807  77.0    2e-13   
ref|XP_006467281.1|  PREDICTED: transcription initiation factor T...  75.9    2e-13   Citrus sinensis [apfelsine]
gb|ACJ83874.1|  unknown                                               75.1    2e-13   Medicago truncatula
emb|CDX90529.1|  BnaA03g42520D                                        75.9    2e-13   
ref|XP_006414360.1|  hypothetical protein EUTSA_v10026065mg           75.5    2e-13   Eutrema salsugineum [saltwater cress]
gb|KEH22674.1|  hypothetical protein MTR_7g056413                     75.1    2e-13   Medicago truncatula
gb|AAL38281.1|  unknown protein                                       75.1    4e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004172606.1|  PREDICTED: uncharacterized protein LOC101224516  72.4    4e-13   
ref|XP_006284371.1|  hypothetical protein CARUB_v10005542mg           75.1    4e-13   Capsella rubella
ref|XP_004139513.1|  PREDICTED: uncharacterized protein LOC101212464  75.1    4e-13   Cucumis sativus [cucumbers]
ref|XP_008464282.1|  PREDICTED: leucine-rich repeat extensin-like...  75.5    4e-13   Cucumis melo [Oriental melon]
ref|XP_010686629.1|  PREDICTED: skin secretory protein xP2            75.1    5e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_974559.5|  metal ion binding protein                           74.7    5e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010449800.1|  PREDICTED: pollen-specific leucine-rich repe...  74.7    5e-13   Camelina sativa [gold-of-pleasure]
emb|CDY34460.1|  BnaC01g21730D                                        74.7    5e-13   Brassica napus [oilseed rape]
emb|CDP05626.1|  unnamed protein product                              74.3    7e-13   Coffea canephora [robusta coffee]
emb|CDY32238.1|  BnaA01g17460D                                        74.3    7e-13   Brassica napus [oilseed rape]
ref|XP_009124518.1|  PREDICTED: LOW QUALITY PROTEIN: protein Tset...  74.3    7e-13   Brassica rapa
ref|XP_004293392.1|  PREDICTED: vacuolar protein-sorting protein ...  73.9    1e-12   Fragaria vesca subsp. vesca
ref|XP_007026349.1|  Heavy metal transport/detoxification superfa...  71.6    1e-12   
ref|XP_007212403.1|  hypothetical protein PRUPE_ppa016415mg           73.2    1e-12   
ref|XP_009591790.1|  PREDICTED: uncharacterized protein LOC104088756  72.0    2e-12   Nicotiana tomentosiformis
ref|XP_010449799.1|  PREDICTED: pollen-specific leucine-rich repe...  73.2    2e-12   
gb|KFK26549.1|  hypothetical protein AALP_AA8G263000                  72.8    2e-12   Arabis alpina [alpine rockcress]
emb|CDY72414.1|  BnaCnng77490D                                        72.0    2e-12   Brassica napus [oilseed rape]
ref|XP_009374864.1|  PREDICTED: uncharacterized protein LOC103963741  69.7    3e-12   
emb|CDP04720.1|  unnamed protein product                              70.5    5e-12   Coffea canephora [robusta coffee]
emb|CDY34454.1|  BnaC01g21790D                                        70.9    6e-12   Brassica napus [oilseed rape]
ref|XP_004134803.1|  PREDICTED: uncharacterized protein LOC101208367  70.5    9e-12   
ref|XP_004513528.1|  PREDICTED: vasodilator-stimulated phosphopro...  70.9    9e-12   
ref|XP_007026350.1|  Heavy metal transport/detoxification superfa...  68.9    1e-11   
ref|XP_006414359.1|  hypothetical protein EUTSA_v10026065mg           70.1    2e-11   
ref|XP_008440982.1|  PREDICTED: protein PXR1-like                     70.1    2e-11   Cucumis melo [Oriental melon]
gb|EYU33837.1|  hypothetical protein MIMGU_mgv1a027133mg              69.7    2e-11   Erythranthe guttata [common monkey flower]
ref|XP_008378227.1|  PREDICTED: putative cuticle collagen 155         70.5    3e-11   
emb|CBI18632.3|  unnamed protein product                              68.2    3e-11   Vitis vinifera
gb|ABM05953.1|  proline-rich protein                                  68.9    3e-11   Gossypium hirsutum [American cotton]
emb|CDY34453.1|  BnaC01g21800D                                        68.9    3e-11   Brassica napus [oilseed rape]
ref|XP_004168629.1|  PREDICTED: uncharacterized protein LOC101231712  68.9    4e-11   
ref|XP_006584100.1|  PREDICTED: uncharacterized protein LOC102666282  66.2    5e-11   Glycine max [soybeans]
gb|KJB69157.1|  hypothetical protein B456_011G008600                  67.8    8e-11   Gossypium raimondii
gb|KCW75116.1|  hypothetical protein EUGRSUZ_E03867                   68.2    2e-10   Eucalyptus grandis [rose gum]
ref|XP_010057804.1|  PREDICTED: transcription initiation factor T...  66.6    2e-10   Eucalyptus grandis [rose gum]
ref|XP_003635154.1|  PREDICTED: sulfated surface glycoprotein 185...  66.6    3e-10   Vitis vinifera
ref|XP_006446044.1|  hypothetical protein CICLE_v10017991mg           66.6    3e-10   Citrus clementina [clementine]
ref|XP_006467207.1|  PREDICTED: uncharacterized protein LOC102618...  66.2    3e-10   Citrus sinensis [apfelsine]
ref|XP_002269930.2|  PREDICTED: sulfated surface glycoprotein 185...  66.2    3e-10   Vitis vinifera
gb|ABK95210.1|  unknown                                               65.5    5e-10   Populus trichocarpa [western balsam poplar]
ref|XP_009146037.1|  PREDICTED: pollen-specific leucine-rich repe...  66.2    5e-10   Brassica rapa
ref|XP_006380915.1|  hypothetical protein POPTR_0006s02010g           65.9    5e-10   
gb|KGN49037.1|  hypothetical protein Csa_6G511040                     65.5    7e-10   Cucumis sativus [cucumbers]
gb|KFK35881.1|  hypothetical protein AALP_AA4G048900                  64.7    7e-10   Arabis alpina [alpine rockcress]
ref|XP_002894181.1|  predicted protein                                64.7    7e-10   
emb|CAN77897.1|  hypothetical protein VITISV_036665                   63.5    7e-10   Vitis vinifera
ref|XP_009107183.1|  PREDICTED: uncharacterized protein LOC103832845  64.7    8e-10   Brassica rapa
ref|XP_010057802.1|  PREDICTED: chitin-binding lectin 1-like isof...  65.9    9e-10   Eucalyptus grandis [rose gum]
ref|XP_010057800.1|  PREDICTED: basic salivary proline-rich prote...  65.5    2e-09   Eucalyptus grandis [rose gum]
ref|XP_010445352.1|  PREDICTED: acidic proline-rich protein PRP25...  63.9    2e-09   
gb|AAD43158.1|AC007504_13  Hypothetical Protein                       63.2    2e-09   Arabidopsis thaliana [mouse-ear cress]
ref|NP_175367.2|  metal ion binding protein                           63.5    2e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010057798.1|  PREDICTED: uncharacterized protein LOC104445595  63.2    3e-09   Eucalyptus grandis [rose gum]
ref|XP_010434838.1|  PREDICTED: predicted GPI-anchored protein 58...  63.9    3e-09   Camelina sativa [gold-of-pleasure]
ref|NP_001118990.4|  metal ion binding protein                        63.5    3e-09   
ref|XP_010057795.1|  PREDICTED: circumsporozoite protein-like         63.5    4e-09   Eucalyptus grandis [rose gum]
gb|KDP32907.1|  hypothetical protein JCGZ_13688                       63.2    6e-09   Jatropha curcas
ref|XP_011004530.1|  PREDICTED: uncharacterized protein LOC105111002  62.4    7e-09   Populus euphratica
gb|KFK34181.1|  hypothetical protein AALP_AA5G111100                  61.6    8e-09   Arabis alpina [alpine rockcress]
gb|KDO64832.1|  hypothetical protein CISIN_1g046486mg                 62.0    9e-09   Citrus sinensis [apfelsine]
ref|XP_010463316.1|  PREDICTED: uncharacterized protein LOC104743984  61.6    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_006467204.1|  PREDICTED: skin secretory protein xP2-like i...  63.5    1e-08   Citrus sinensis [apfelsine]
ref|XP_010501910.1|  PREDICTED: uncharacterized protein LOC104779240  61.2    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_006393258.1|  hypothetical protein EUTSA_v10012208mg           60.8    1e-08   Eutrema salsugineum [saltwater cress]
ref|XP_011004529.1|  PREDICTED: neurofilament medium polypeptide-...  62.4    1e-08   Populus euphratica
ref|XP_010479376.1|  PREDICTED: uncharacterized protein LOC104758247  61.2    2e-08   Camelina sativa [gold-of-pleasure]
gb|KJB57880.1|  hypothetical protein B456_009G184500                  60.5    2e-08   Gossypium raimondii
ref|XP_010087650.1|  hypothetical protein L484_010601                 61.2    2e-08   Morus notabilis
gb|EPS71651.1|  hypothetical protein M569_03110                       61.2    3e-08   Genlisea aurea
ref|XP_007026348.1|  Uncharacterized protein TCM_030423               59.7    4e-08   
ref|XP_011004527.1|  PREDICTED: uncharacterized protein LOC105110...  60.1    4e-08   Populus euphratica
ref|XP_010057796.1|  PREDICTED: uncharacterized protein LOC104445592  62.0    4e-08   Eucalyptus grandis [rose gum]
emb|CBI25755.3|  unnamed protein product                              59.3    4e-08   Vitis vinifera
ref|XP_011004528.1|  PREDICTED: uncharacterized protein LOC105110999  59.7    5e-08   Populus euphratica
gb|KJB57879.1|  hypothetical protein B456_009G184400                  59.3    6e-08   Gossypium raimondii
ref|NP_175520.1|  uncharacterized protein                             59.3    6e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010646272.1|  PREDICTED: uncharacterized protein LOC104878151  59.3    7e-08   
gb|ABK95097.1|  unknown                                               59.3    7e-08   Populus trichocarpa [western balsam poplar]
ref|XP_006306406.1|  hypothetical protein CARUB_v10012321mg           58.9    8e-08   Capsella rubella
ref|XP_002322503.1|  heavy-metal-associated domain-containing fam...  59.3    8e-08   Populus trichocarpa [western balsam poplar]
gb|ABK94919.1|  unknown                                               59.3    8e-08   Populus trichocarpa [western balsam poplar]
ref|XP_011004523.1|  PREDICTED: sperm mitochondrial-associated cy...  58.9    9e-08   Populus euphratica
ref|XP_011010370.1|  PREDICTED: uncharacterized protein LOC105115225  58.2    9e-08   Populus euphratica
emb|CDY51248.1|  BnaC03g77720D                                        58.5    1e-07   Brassica napus [oilseed rape]
ref|XP_011014663.1|  PREDICTED: anthrax toxin receptor-like           58.5    1e-07   Populus euphratica
emb|CDY46563.1|  BnaA08g02020D                                        58.2    1e-07   Brassica napus [oilseed rape]
ref|XP_011004526.1|  PREDICTED: keratinocyte proline-rich protein...  58.9    1e-07   Populus euphratica
ref|XP_011004531.1|  PREDICTED: 104 kDa microneme/rhoptry antigen...  58.9    1e-07   Populus euphratica
ref|XP_006380916.1|  hypothetical protein POPTR_0006s02010g           58.9    2e-07   
ref|XP_002891615.1|  hypothetical protein ARALYDRAFT_892070           57.8    2e-07   
emb|CBI25759.3|  unnamed protein product                              57.0    2e-07   Vitis vinifera
ref|XP_011010372.1|  PREDICTED: anthrax toxin receptor-like isofo...  58.2    2e-07   Populus euphratica
ref|XP_010052969.1|  PREDICTED: uncharacterized protein LOC104441514  58.2    2e-07   Eucalyptus grandis [rose gum]
ref|XP_011004525.1|  PREDICTED: uncharacterized protein LOC105110...  58.2    2e-07   Populus euphratica
ref|XP_011010371.1|  PREDICTED: anthrax toxin receptor-like isofo...  58.2    2e-07   Populus euphratica
ref|XP_009148212.1|  PREDICTED: dnaJ homolog subfamily B member 6     57.8    3e-07   Brassica rapa
ref|XP_006393083.1|  hypothetical protein EUTSA_v10011834mg           57.0    3e-07   Eutrema salsugineum [saltwater cress]
ref|XP_011004524.1|  PREDICTED: latent-transforming growth factor...  57.8    3e-07   Populus euphratica
emb|CDY32237.1|  BnaA01g17470D                                        57.8    4e-07   Brassica napus [oilseed rape]
ref|XP_006380919.1|  hypothetical protein POPTR_0006s02030g           55.5    9e-07   
ref|XP_006380911.1|  hypothetical protein POPTR_0006s01980g           55.8    1e-06   
emb|CDY48866.1|  BnaA06g03160D                                        55.8    1e-06   Brassica napus [oilseed rape]
ref|XP_010039454.1|  PREDICTED: uncharacterized protein LOC104428151  55.1    2e-06   Eucalyptus grandis [rose gum]
ref|XP_010646271.1|  PREDICTED: uncharacterized protein LOC104878150  54.3    2e-06   Vitis vinifera
gb|KDO64836.1|  hypothetical protein CISIN_1g030989mg                 54.7    3e-06   Citrus sinensis [apfelsine]
ref|XP_010479564.1|  PREDICTED: LOW QUALITY PROTEIN: cathelicidin...  54.7    3e-06   Camelina sativa [gold-of-pleasure]
emb|CDY60306.1|  BnaUnng00670D                                        54.7    3e-06   Brassica napus [oilseed rape]
ref|XP_006380910.1|  hypothetical protein POPTR_0006s01980g           54.7    3e-06   
ref|XP_003635040.1|  PREDICTED: uncharacterized protein LOC100852...  55.1    3e-06   Vitis vinifera
ref|XP_010087653.1|  hypothetical protein L484_010605                 54.7    4e-06   
ref|XP_010057803.1|  PREDICTED: uncharacterized protein LOC104445598  53.1    4e-06   Eucalyptus grandis [rose gum]
ref|XP_010057799.1|  PREDICTED: uncharacterized protein LOC104445596  54.7    5e-06   Eucalyptus grandis [rose gum]
ref|XP_010501952.1|  PREDICTED: embryonal Fyn-associated substrat...  54.3    5e-06   Camelina sativa [gold-of-pleasure]
ref|XP_009136759.1|  PREDICTED: pollen-specific leucine-rich repe...  55.1    5e-06   Brassica rapa
emb|CAN60751.1|  hypothetical protein VITISV_044288                   55.5    6e-06   Vitis vinifera
ref|XP_010087652.1|  hypothetical protein L484_010604                 55.1    7e-06   
ref|XP_006380914.1|  hypothetical protein POPTR_0006s02000g           53.9    8e-06   
emb|CBI35729.3|  unnamed protein product                              52.0    8e-06   Vitis vinifera
ref|XP_010052967.1|  PREDICTED: uncharacterized protein LOC104441509  53.1    1e-05   Eucalyptus grandis [rose gum]
ref|XP_010252760.1|  PREDICTED: extensin-like                         53.1    2e-05   Nelumbo nucifera [Indian lotus]
ref|XP_006380926.1|  hypothetical protein POPTR_0006s02060g           52.4    2e-05   
ref|XP_010042953.1|  PREDICTED: cyclic nucleotide-gated cation ch...  52.4    2e-05   
gb|KCW75114.1|  hypothetical protein EUGRSUZ_E03865                   53.5    3e-05   Eucalyptus grandis [rose gum]
ref|XP_010647322.1|  PREDICTED: acrosin-like                          51.6    3e-05   
ref|XP_006380918.1|  hypothetical protein POPTR_0006s02030g           51.2    4e-05   
ref|XP_002308818.2|  hypothetical protein POPTR_0006s02080g           50.8    4e-05   Populus trichocarpa [western balsam poplar]
ref|XP_010646276.1|  PREDICTED: sulfated surface glycoprotein 185...  52.0    5e-05   Vitis vinifera
ref|XP_006380925.1|  hypothetical protein POPTR_0006s02050g           51.2    5e-05   
ref|XP_006380920.1|  hypothetical protein POPTR_0006s02030g           50.8    5e-05   
ref|XP_006380928.1|  hypothetical protein POPTR_0006s02090g           51.2    5e-05   Populus trichocarpa [western balsam poplar]
ref|XP_006380917.1|  hypothetical protein POPTR_0006s02020g           51.2    6e-05   Populus trichocarpa [western balsam poplar]
emb|CBI25758.3|  unnamed protein product                              49.7    6e-05   Vitis vinifera
ref|XP_010647603.1|  PREDICTED: uncharacterized protein LOC104878696  50.8    7e-05   Vitis vinifera
ref|XP_011040171.1|  PREDICTED: sulfated surface glycoprotein 185...  51.2    8e-05   Populus euphratica
ref|XP_007026356.1|  Uncharacterized protein TCM_030429               52.0    8e-05   
ref|XP_006380908.1|  hypothetical protein POPTR_0006s01980g           50.4    1e-04   
ref|XP_010270224.1|  PREDICTED: cornifin-B-like                       51.2    1e-04   Nelumbo nucifera [Indian lotus]
ref|XP_006380909.1|  hypothetical protein POPTR_0006s01980g           50.1    1e-04   
ref|XP_002522884.1|  conserved hypothetical protein                   51.2    1e-04   Ricinus communis
gb|KCW75117.1|  hypothetical protein EUGRSUZ_E03868                   50.4    2e-04   Eucalyptus grandis [rose gum]
ref|XP_006380930.1|  hypothetical protein POPTR_0006s02130g           50.1    2e-04   Populus trichocarpa [western balsam poplar]
ref|XP_006380929.1|  hypothetical protein POPTR_0006s02110g           50.1    2e-04   
gb|KDP35494.1|  hypothetical protein JCGZ_08932                       50.1    2e-04   Jatropha curcas
gb|KCW77121.1|  hypothetical protein EUGRSUZ_D014612                  48.9    2e-04   Eucalyptus grandis [rose gum]
ref|XP_010042466.1|  PREDICTED: sodium/potassium/calcium exchange...  49.3    3e-04   Eucalyptus grandis [rose gum]
ref|XP_011010374.1|  PREDICTED: uncharacterized protein LOC105115227  49.3    3e-04   Populus euphratica
gb|KDP35497.1|  hypothetical protein JCGZ_08935                       48.9    4e-04   Jatropha curcas
gb|KJB57881.1|  hypothetical protein B456_009G184600                  48.1    5e-04   Gossypium raimondii
ref|XP_006380906.1|  hypothetical protein POPTR_0006s01940g           47.0    7e-04   
gb|KCW75121.1|  hypothetical protein EUGRSUZ_E03872                   48.9    8e-04   Eucalyptus grandis [rose gum]
ref|XP_006380907.1|  hypothetical protein POPTR_0006s01960g           48.1    8e-04   



>emb|CDO99450.1| unnamed protein product [Coffea canephora]
Length=105

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK TVM L+VDL+C SCYKKVKK++CK PQIRDQ+Y+E++N V ITVVCCSPEKIRDKLC
Sbjct  3    EKVTVMRLNVDLQCPSCYKKVKKILCKFPQIRDQVYDEKQNLVTITVVCCSPEKIRDKLC  62

Query  302  YKGGGVIKSIEIV  340
             KGG VIKSIEIV
Sbjct  63   CKGGKVIKSIEIV  75



>emb|CDP21271.1| unnamed protein product [Coffea canephora]
Length=116

 Score = 85.9 bits (211),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T M L VDL+C  CYKKVKK++CK PQIRDQIY+E++N V ITVVCCSPEKIRDKLC
Sbjct  3    EKVTTMRLKVDLQCPCCYKKVKKILCKFPQIRDQIYDEKQNLVTITVVCCSPEKIRDKLC  62

Query  302  YKGGGVIKSIEIV  340
             KGG VIKSIEIV
Sbjct  63   CKGGKVIKSIEIV  75



>gb|KJB69156.1| hypothetical protein B456_011G008600 [Gossypium raimondii]
Length=252

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T+M L VDL+CS CYKKVKKV+CK PQIRDQ+Y+E+ N V ITVVCCSPEKIRDKLC
Sbjct  3    EKVTIMVLKVDLQCSKCYKKVKKVLCKYPQIRDQMYDEKANTVTITVVCCSPEKIRDKLC  62

Query  302  YKGGGVIKSIEI  337
            YKGGG IKSIE+
Sbjct  63   YKGGGSIKSIEL  74



>ref|XP_009795883.1| PREDICTED: neurofilament heavy polypeptide-like [Nicotiana sylvestris]
Length=271

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EKTT M L VDL+C  CYKK KKV+CK+PQ+RDQ+Y+E+ N V ITVVCCSPEKIRDKLC
Sbjct  7    EKTTKMVLKVDLQCPCCYKKAKKVLCKMPQVRDQVYDEKANTVTITVVCCSPEKIRDKLC  66

Query  302  YKGGGVIKSIEI  337
            YKGG  IKSIEI
Sbjct  67   YKGGKAIKSIEI  78



>ref|XP_009606116.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1 [Nicotiana tomentosiformis]
Length=321

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EKTTVM L VDL+CSSCYKKVKKV+CK PQIRDQ+Y+E+ N + ITV+CC+PEKIRDKLC
Sbjct  7    EKTTVMVLKVDLQCSSCYKKVKKVLCKFPQIRDQVYDEKANTITITVLCCNPEKIRDKLC  66

Query  302  YKGGGVIKSIEI  337
             KGGGVIKSIEI
Sbjct  67   CKGGGVIKSIEI  78



>gb|KHN40795.1| hypothetical protein glysoja_015162 [Glycine soja]
Length=268

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T+M L VDL+C  CYKKVKK++ K PQIRDQ ++E+EN V ITVVCCSPEKIRDKLC
Sbjct  3    EKVTIMKLKVDLECEKCYKKVKKLLGKYPQIRDQKFDEKENIVFITVVCCSPEKIRDKLC  62

Query  302  YKGGGVIKSIEIV  340
            YKGGG IKSIEI+
Sbjct  63   YKGGGSIKSIEIL  75



>ref|XP_009801191.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1 [Nicotiana sylvestris]
Length=293

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EKTT+M L VDL+C+SCYKKVKKV+CK PQIRDQ+Y+E+ N + ITV+CC+PEKIRDKLC
Sbjct  7    EKTTIMVLKVDLQCTSCYKKVKKVLCKFPQIRDQVYDEKANTITITVLCCNPEKIRDKLC  66

Query  302  YKGGGVIKSIEI  337
             KGGGVIKSIEI
Sbjct  67   CKGGGVIKSIEI  78



>emb|CDP04524.1| unnamed protein product [Coffea canephora]
Length=102

 Score = 83.2 bits (204),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T M L VDL+C  CYKKVKK++CK PQIRDQ+Y+E++N V ITVVCCSPEKIRDKLC
Sbjct  3    EKVTTMRLKVDLQCPCCYKKVKKILCKFPQIRDQMYDEKQNLVTITVVCCSPEKIRDKLC  62

Query  302  YKGGGVIKSIEIV  340
             KGG VIKSI+IV
Sbjct  63   CKGGKVIKSIDIV  75



>ref|XP_008384171.1| PREDICTED: uncharacterized protein LOC103446809 [Malus domestica]
Length=201

 Score = 85.1 bits (209),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T+M L VDL+C  CYKKVKKV+ K PQI+DQIY+E++N+V I VVCCSPEKIRDK+C
Sbjct  5    EKVTIMVLKVDLQCHKCYKKVKKVLRKFPQIQDQIYDEKQNQVVIKVVCCSPEKIRDKIC  64

Query  302  YKGGGVIKSIEI  337
            YKGG VIKSIEI
Sbjct  65   YKGGSVIKSIEI  76



>gb|ACF74351.1| putative metal ion-binding protein [Arachis hypogaea]
Length=232

 Score = 85.5 bits (210),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK TVM L VDL+C  CYKKVKKV+ K PQIRD+ ++E++N V ITVVCCSPEKIRDKLC
Sbjct  3    EKVTVMKLKVDLECHKCYKKVKKVLAKFPQIRDEKFDEKQNIVTITVVCCSPEKIRDKLC  62

Query  302  YKGGGVIKSIEIV  340
            YKGGG IKSIEIV
Sbjct  63   YKGGGSIKSIEIV  75



>ref|XP_007147620.1| hypothetical protein PHAVU_006G139900g [Phaseolus vulgaris]
 gb|ESW19614.1| hypothetical protein PHAVU_006G139900g [Phaseolus vulgaris]
Length=251

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T M L VDL+C  C KKVKKV+ K PQIRDQ ++E+EN V ITVVCCSPEKIRDKLC
Sbjct  3    EKVTFMKLKVDLECGKCCKKVKKVLAKYPQIRDQRFSEKENMVIITVVCCSPEKIRDKLC  62

Query  302  YKGGGVIKSIEIV  340
            YKGGG IKSIEI+
Sbjct  63   YKGGGSIKSIEIL  75



>gb|KEH36983.1| heavy-metal-associated domain protein [Medicago truncatula]
Length=251

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T+M L VDL+C  CYKKV+K++ K PQIRDQ Y+++ N V ITVVCCSPEKIRDKLC
Sbjct  3    EKVTIMRLKVDLECEKCYKKVRKLLNKYPQIRDQNYDDKANIVTITVVCCSPEKIRDKLC  62

Query  302  YKGGGVIKSIEIV  340
            YKGGG IKSIEIV
Sbjct  63   YKGGGSIKSIEIV  75



>ref|XP_007026351.1| Heavy metal transport/detoxification superfamily protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY28973.1| Heavy metal transport/detoxification superfamily protein, putative 
isoform 1 [Theobroma cacao]
Length=260

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  113  MAPEKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRD  292
            MA +K T M L VDL+C  CYKKVKKV+ KIPQI+DQ+YNE+ N V ITVVCCSPEKIRD
Sbjct  1    MAEKKVTTMVLKVDLQCYRCYKKVKKVLSKIPQIQDQVYNEKANTVTITVVCCSPEKIRD  60

Query  293  KLCYKGGGVIKSIEI  337
            K+C KGGG IKSIEI
Sbjct  61   KICCKGGGSIKSIEI  75



>ref|XP_004250292.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1 [Solanum lycopersicum]
Length=296

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +2

Query  113  MAPEKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRD  292
            M  EKTT+M L VDL+CSSCYKKVKK++CK PQIRDQ+Y+E+ N V ITVVCC+PEK+RD
Sbjct  1    MGGEKTTIMVLKVDLQCSSCYKKVKKILCKFPQIRDQVYDEKGNTVTITVVCCNPEKLRD  60

Query  293  KLCYKGGGVIKSIEI  337
            KLC KG GVIKSIEI
Sbjct  61   KLCCKGCGVIKSIEI  75



>ref|XP_011086262.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1 [Sesamum indicum]
Length=282

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = +2

Query  113  MAPEKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRD  292
            MA EK T M L VDL+C  CYKK+KK +CK PQIRDQ+Y+E+ N V ITVVCCSPEKIRD
Sbjct  1    MAVEKVTPMVLRVDLQCPCCYKKIKKTLCKFPQIRDQVYDEKNNTVAITVVCCSPEKIRD  60

Query  293  KLCYKGGGVIKSIEIV  340
            KLC KGG VIKSIEI+
Sbjct  61   KLCCKGGKVIKSIEII  76



>ref|XP_008384174.1| PREDICTED: leucine-rich repeat extensin-like protein 3 isoform 
X2 [Malus domestica]
 ref|XP_008366090.1| PREDICTED: leucine-rich repeat extensin-like protein 3 isoform 
X2 [Malus domestica]
Length=210

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T+M L VDL+C  CYKKVKKV+CK PQIRDQIY+E++N+V I VVCCSPEKIRDK+C
Sbjct  5    EKVTIMVLKVDLQCHKCYKKVKKVLCKFPQIRDQIYDEKQNQVVIKVVCCSPEKIRDKIC  64

Query  302  YKGGGVIKSIEI  337
             KGGG IKSIEI
Sbjct  65   CKGGGAIKSIEI  76



>ref|XP_009378156.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1 isoform X2 [Pyrus x bretschneideri]
Length=241

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T+M L VDL C  CYKKVKKV+CK PQIRDQIY+E++N+V I VVCCSPEKIRDK+C
Sbjct  5    EKVTIMVLKVDLGCHKCYKKVKKVLCKFPQIRDQIYDEKQNQVVIKVVCCSPEKIRDKIC  64

Query  302  YKGGGVIKSIEI  337
             KGGG IKSIEI
Sbjct  65   CKGGGAIKSIEI  76



>ref|XP_009377504.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 2 isoform X1 [Pyrus x bretschneideri]
Length=253

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T+M L VDL C  CYKKVKKV+CK PQIRDQIY+E++N+V I VVCCSPEKIRDK+C
Sbjct  5    EKVTIMVLKVDLGCHKCYKKVKKVLCKFPQIRDQIYDEKQNQVVIKVVCCSPEKIRDKIC  64

Query  302  YKGGGVIKSIEI  337
             KGGG IKSIEI
Sbjct  65   CKGGGAIKSIEI  76



>ref|XP_008370968.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Malus 
domestica]
Length=264

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T+M L VDL C  CYKKVKKV+ K PQIRDQIY+E++N+V I VVCCSPEKIRDK+C
Sbjct  5    EKVTIMVLKVDLGCHKCYKKVKKVLXKFPQIRDQIYDEKQNQVVIKVVCCSPEKIRDKIC  64

Query  302  YKGGGVIKSIEI  337
             KGGG IKSIEI
Sbjct  65   CKGGGAIKSIEI  76



>ref|XP_004239815.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1 [Solanum lycopersicum]
Length=326

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T+M L VDL+CSSCYKKVKK++CK PQIRDQ+Y+E+ N + ITV+CC+PEKIRDKLC
Sbjct  7    EKITIMMLKVDLQCSSCYKKVKKILCKFPQIRDQVYDEKANIITITVLCCNPEKIRDKLC  66

Query  302  YKGGGVIKSIEI  337
             KGGGVIKSIEI
Sbjct  67   CKGGGVIKSIEI  78



>emb|CDP04521.1| unnamed protein product [Coffea canephora]
Length=138

 Score = 81.6 bits (200),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 56/73 (77%), Gaps = 1/73 (1%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T M L VDL+CS  Y+  K +    PQIRDQIY+E++N V ITVVCCSPEKIRDKLC
Sbjct  3    EKVTTMRLKVDLQCSCSYEVKKILCKF-PQIRDQIYDEKQNLVTITVVCCSPEKIRDKLC  61

Query  302  YKGGGVIKSIEIV  340
             KGG VIKSIEIV
Sbjct  62   CKGGKVIKSIEIV  74



>gb|KJB67415.1| hypothetical protein B456_010G190100 [Gossypium raimondii]
Length=263

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK TVM L VDL+C  CYKKVKKV+CK PQIRDQIYNE+ N V ITVVCC+PEK+RDK+C
Sbjct  3    EKVTVMVLKVDLQCWRCYKKVKKVLCKFPQIRDQIYNEKANTVTITVVCCNPEKLRDKIC  62

Query  302  YKGGGVIKSIEI  337
             KG G IKSIEI
Sbjct  63   CKGAGSIKSIEI  74



>ref|XP_009613311.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 2 [Nicotiana tomentosiformis]
Length=278

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EKTTVM L VDL+C  CYKK KKV+CK+PQ+RDQ+Y+E+ N V ITVVCCSPE IRDKLC
Sbjct  7    EKTTVMVLKVDLQCPCCYKKAKKVLCKMPQVRDQVYDEKANTVTITVVCCSPENIRDKLC  66

Query  302  YKGGGVIKSIEI  337
             KGG  IKSIEI
Sbjct  67   CKGGKAIKSIEI  78



>ref|XP_008224624.1| PREDICTED: anthrax toxin receptor-like [Prunus mume]
Length=235

 Score = 83.2 bits (204),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T+M L VDL+C  CYKKVKKV+CK PQIRDQIY+E++N+V I VVCCSPEKIRD++C
Sbjct  5    EKVTIMVLKVDLQCHKCYKKVKKVLCKFPQIRDQIYDEKQNQVVIKVVCCSPEKIRDRIC  64

Query  302  YKGGGVIKSIEI  337
             KGGG IKSIEI
Sbjct  65   CKGGGAIKSIEI  76



>ref|XP_008357424.1| PREDICTED: putative cuticle collagen 155 [Malus domestica]
Length=290

 Score = 83.2 bits (204),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T+M L VDL+C  CYKKVKKV+CK PQIRDQ+YNE++N+V I VVCCSPEKIRDK+C
Sbjct  5    EKVTIMVLKVDLQCHKCYKKVKKVLCKFPQIRDQVYNEKQNQVVIKVVCCSPEKIRDKIC  64

Query  302  YKGGGVIKSIEIV  340
             KGG  IKSIEI+
Sbjct  65   CKGGSAIKSIEIM  77



>ref|XP_009796355.1| PREDICTED: uncharacterized protein LOC104242939 [Nicotiana sylvestris]
Length=201

 Score = 82.4 bits (202),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EKTT M L VDL+CS CYKKVKKV+CK PQIRDQ+Y+E+ N V ITVVCC+PEKIRDKLC
Sbjct  7    EKTTKMVLKVDLQCSCCYKKVKKVLCKFPQIRDQVYDEKANTVTITVVCCNPEKIRDKLC  66

Query  302  YKGGGVIKSIEI  337
             KG GVIKSIEI
Sbjct  67   SKGCGVIKSIEI  78



>ref|XP_006365842.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1-like [Solanum tuberosum]
Length=327

 Score = 83.6 bits (205),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T+M L VDL+CSSCYKKVKK++CK PQIRDQ Y+E+ N V ITV+CC+PEKIRDKLC
Sbjct  7    EKITIMLLKVDLQCSSCYKKVKKILCKFPQIRDQTYDEKANIVTITVLCCNPEKIRDKLC  66

Query  302  YKGGGVIKSIEI  337
             KGGGVIKSIEI
Sbjct  67   CKGGGVIKSIEI  78



>ref|XP_009796356.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1 [Nicotiana sylvestris]
Length=276

 Score = 83.2 bits (204),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EKTT+M L VDL+CSSCYKKVKKV+CK PQIRDQ+Y+E+ N V ITVVCC PEK RDKLC
Sbjct  7    EKTTIMVLKVDLQCSSCYKKVKKVLCKFPQIRDQVYDEKGNTVTITVVCCDPEKFRDKLC  66

Query  302  YKGGGVIKSIEI  337
             KG GVIKSIEI
Sbjct  67   CKGCGVIKSIEI  78



>gb|EYU27661.1| hypothetical protein MIMGU_mgv1a012649mg [Erythranthe guttata]
Length=244

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK TVM L VDL+C  CYKKVKK++CK PQIRDQ+Y+E+ N V ITVVCCSPEKIRDKLC
Sbjct  3    EKVTVMVLKVDLQCPCCYKKVKKILCKFPQIRDQVYDEKANTVTITVVCCSPEKIRDKLC  62

Query  302  YKGGGVIKSIEI  337
             KG  VIKSIEI
Sbjct  63   RKGSKVIKSIEI  74



>gb|KJB69158.1| hypothetical protein B456_011G008600 [Gossypium raimondii]
Length=245

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  137  MFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGG  316
            M L VDL+CS CYKKVKKV+CK PQIRDQ+Y+E+ N V ITVVCCSPEKIRDKLCYKGGG
Sbjct  1    MVLKVDLQCSKCYKKVKKVLCKYPQIRDQMYDEKANTVTITVVCCSPEKIRDKLCYKGGG  60

Query  317  VIKSIEI  337
             IKSIE+
Sbjct  61   SIKSIEL  67



>gb|KHG01648.1| hypothetical protein F383_21782 [Gossypium arboreum]
Length=254

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK TVM L VDL+C  CYKKVKKV+CK PQIRDQIY+E+ N V ITVVCC+PEK+RDK+C
Sbjct  3    EKVTVMVLKVDLQCWRCYKKVKKVLCKFPQIRDQIYDEKTNTVTITVVCCNPEKLRDKIC  62

Query  302  YKGGGVIKSIEI  337
             KG G IKSIEI
Sbjct  63   CKGAGSIKSIEI  74



>ref|XP_004293391.1| PREDICTED: neurofilament heavy polypeptide-like [Fragaria vesca 
subsp. vesca]
Length=238

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = +2

Query  113  MAPEKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRD  292
            M  +K T+M L VDL+C  CYKKVKKV+CK PQIRDQ Y+E+ N+V I VVCCSPEKIRD
Sbjct  1    MGEKKVTIMVLKVDLQCEKCYKKVKKVLCKFPQIRDQAYDEKNNQVIIKVVCCSPEKIRD  60

Query  293  KLCYKGGGVIKSIEIV  340
            KLC KGGG IKSI+I+
Sbjct  61   KLCCKGGGAIKSIDIL  76



>ref|XP_006352451.1| PREDICTED: uncharacterized protein LOC102600600 [Solanum tuberosum]
Length=200

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  113  MAPEKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRD  292
            M  EKT +M L VDL+CS+CYKKVKK++CK PQIRDQ+Y+E+ N V ITVVCC+PEK+RD
Sbjct  1    MGGEKTAIMVLKVDLQCSNCYKKVKKILCKFPQIRDQVYDEKGNTVTITVVCCNPEKLRD  60

Query  293  KLCYKGGGVIKSIEI  337
            KLC KG GVI+SIEI
Sbjct  61   KLCSKGCGVIESIEI  75



>ref|XP_007211910.1| hypothetical protein PRUPE_ppa010456mg [Prunus persica]
 gb|EMJ13109.1| hypothetical protein PRUPE_ppa010456mg [Prunus persica]
Length=249

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T+M L VDL+C  CYKKVKKV+CK PQIRDQIY+E++N+V I VVCCSPEKIRD++C
Sbjct  5    EKETIMVLKVDLQCHKCYKKVKKVLCKFPQIRDQIYDEKQNQVVIKVVCCSPEKIRDRIC  64

Query  302  YKGGGVIKSIEI  337
             KGGG IK IEI
Sbjct  65   CKGGGAIKGIEI  76



>ref|XP_009591786.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 2 [Nicotiana tomentosiformis]
Length=262

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EKTT+M L VDL+CS CYKKVKKV+CK PQIRDQ+Y+E+ N V ITVVCC PE+ RDKLC
Sbjct  7    EKTTIMVLKVDLQCSCCYKKVKKVLCKFPQIRDQVYDEKANTVTITVVCCDPERFRDKLC  66

Query  302  YKGGGVIKSIEI  337
             KG GVIKSIEI
Sbjct  67   SKGCGVIKSIEI  78



>ref|XP_004486344.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1-like [Cicer arietinum]
Length=242

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T+M L VDL+C  CYKKVKK++ K PQIRDQ Y+E+ N V I VVCCSPEKIRDKLC
Sbjct  3    EKVTIMKLKVDLECDKCYKKVKKLLSKYPQIRDQKYDEKANIVAIMVVCCSPEKIRDKLC  62

Query  302  YKGGGVIKSIEIV  340
             KGGG IKSIEIV
Sbjct  63   CKGGGSIKSIEIV  75



>ref|XP_004293393.1| PREDICTED: FK506-binding protein 4-like [Fragaria vesca subsp. 
vesca]
Length=209

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = +2

Query  113  MAPEKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRD  292
            M  +K T+M L VDL+C  CYKKVKKV+CK PQIRDQ Y+E+ N+V I VVCCSPEKIRD
Sbjct  1    MGEKKVTIMVLKVDLQCEKCYKKVKKVLCKFPQIRDQTYDEKNNQVIIKVVCCSPEKIRD  60

Query  293  KLCYKGGGVIKSIEI  337
            KLC KGGG IKSI+I
Sbjct  61   KLCCKGGGAIKSIDI  75



>ref|XP_008384172.1| PREDICTED: leucine-rich repeat extensin-like protein 3 isoform 
X1 [Malus domestica]
 ref|XP_008366089.1| PREDICTED: leucine-rich repeat extensin-like protein 3 isoform 
X1 [Malus domestica]
Length=211

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            +  T+M L VDL+C  CYKKVKKV+CK PQIRDQIY+E++N+V I VVCCSPEKIRDK+C
Sbjct  6    QSVTIMVLKVDLQCHKCYKKVKKVLCKFPQIRDQIYDEKQNQVVIKVVCCSPEKIRDKIC  65

Query  302  YKGGGVIKSIEI  337
             KGGG IKSIEI
Sbjct  66   CKGGGAIKSIEI  77



>gb|AFK36989.1| unknown [Medicago truncatula]
Length=209

 Score = 80.5 bits (197),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +2

Query  125  KTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLCY  304
            K T+M L VDL+C+ CYKKVKKV+CK PQIRDQ+Y+E+ N V ITVVCCSPEKIRDK+C 
Sbjct  8    KVTIMKLKVDLQCAKCYKKVKKVLCKFPQIRDQVYDEKNNIVTITVVCCSPEKIRDKICC  67

Query  305  KGGGVIKSIEIV  340
            KG G IKSIEIV
Sbjct  68   KGCGAIKSIEIV  79



>ref|XP_011095916.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1 [Sesamum indicum]
Length=275

 Score = 80.9 bits (198),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK TVM L VDL+C  CYKKVKK++CK PQIRDQ+Y+E+ N V ITVVCCSPEKIRDKLC
Sbjct  3    EKVTVMVLKVDLQCPCCYKKVKKILCKFPQIRDQVYDEKANTVTITVVCCSPEKIRDKLC  62

Query  302  YKGGGVIKSIEI  337
             KG  VIKSI+I
Sbjct  63   CKGSKVIKSIDI  74



>ref|XP_004236656.1| PREDICTED: neurofilament heavy polypeptide [Solanum lycopersicum]
Length=266

 Score = 80.5 bits (197),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EKTTVM L VDL+C  CYKK KK++CK+PQ+RDQ+Y+E+ N + I VVCCSPE+IRDKLC
Sbjct  7    EKTTVMVLKVDLQCPCCYKKAKKILCKMPQVRDQMYDEKANTITILVVCCSPERIRDKLC  66

Query  302  YKGGGVIKSIEI  337
             KGG  IKSIEI
Sbjct  67   CKGGKAIKSIEI  78



>ref|XP_008224622.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1 [Prunus mume]
Length=247

 Score = 80.5 bits (197),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T M L VDL+C  CYKKVKKV+CK PQIRDQ Y+E++N+V I VVCCSPEKIRD++C
Sbjct  5    EKVTTMVLKVDLQCHKCYKKVKKVLCKFPQIRDQTYDEKQNQVIIKVVCCSPEKIRDRIC  64

Query  302  YKGGGVIKSIEI  337
             KGGG IKSIEI
Sbjct  65   CKGGGAIKSIEI  76



>ref|XP_004507598.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1-like isoform X1 [Cicer arietinum]
 ref|XP_004507599.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1-like isoform X2 [Cicer arietinum]
Length=252

 Score = 80.1 bits (196),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +2

Query  125  KTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLCY  304
            K T+M L VDL+C  CYKKVKKV+CK PQIRDQ+Y+E+ N V ITVVCCSPEKIRDKLC 
Sbjct  6    KVTIMKLKVDLQCDKCYKKVKKVLCKFPQIRDQVYDEKNNIVTITVVCCSPEKIRDKLCC  65

Query  305  KGGGVIKSIEIV  340
            KG G IKSIEIV
Sbjct  66   KGCGAIKSIEIV  77



>ref|XP_006467282.1| PREDICTED: transcription initiation factor TFIID subunit 3-like 
isoform X2 [Citrus sinensis]
 gb|KDO78535.1| hypothetical protein CISIN_1g043718mg [Citrus sinensis]
Length=228

 Score = 80.1 bits (196),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +2

Query  119  PEKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKL  298
            P+K T M L VDL+CS CYKKVKKV+ K PQI+DQIY+E++NKV I VVCC PEK+RDK+
Sbjct  2    PDKVTTMVLKVDLQCSKCYKKVKKVLSKFPQIQDQIYDEKQNKVTIKVVCCCPEKMRDKI  61

Query  299  CYKGGGVIKSIEI  337
            C KG GVIKSIEI
Sbjct  62   CCKGDGVIKSIEI  74



>ref|XP_006352327.1| PREDICTED: protein TsetseEP-like [Solanum tuberosum]
Length=291

 Score = 80.5 bits (197),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  113  MAPEKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRD  292
            M   KTT+M L VDL+CSSCYKKVK+++CK PQIRDQ+Y+E+ N V ITVVCC+PEK+RD
Sbjct  1    MGGGKTTIMVLKVDLQCSSCYKKVKQILCKFPQIRDQVYDEKGNTVTITVVCCNPEKLRD  60

Query  293  KLCYKGGGVIKSIEI  337
            KLC KG GVIK IEI
Sbjct  61   KLCSKGCGVIKRIEI  75



>ref|XP_006449920.1| hypothetical protein CICLE_v10017543mg [Citrus clementina]
 gb|ESR63160.1| hypothetical protein CICLE_v10017543mg [Citrus clementina]
Length=233

 Score = 79.7 bits (195),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +2

Query  119  PEKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKL  298
            P+K T M L VDL+CS CYKKVKKV+ K PQI+DQIY+E++NKV I VVCC PEK+RDK+
Sbjct  2    PDKVTTMVLKVDLQCSKCYKKVKKVLSKFPQIQDQIYDEKQNKVTIKVVCCCPEKMRDKI  61

Query  299  CYKGGGVIKSIEI  337
            C KG GVIKSIEI
Sbjct  62   CCKGDGVIKSIEI  74



>ref|XP_009374862.1| PREDICTED: chitin-binding lectin 1-like [Pyrus x bretschneideri]
Length=206

 Score = 79.3 bits (194),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T+M L VDL+C  CYKKVKKV+CK PQIRDQIY E++N+V I VVCCSPEKIRDK+C
Sbjct  5    EKVTIMVLKVDLQCHKCYKKVKKVLCKFPQIRDQIYYEKQNQVVIKVVCCSPEKIRDKIC  64

Query  302  YKGGGVIKSIEI  337
             KGG  IKSIEI
Sbjct  65   CKGGCAIKSIEI  76



>ref|XP_006350257.1| PREDICTED: neurofilament heavy polypeptide-like [Solanum tuberosum]
Length=260

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EKTT+M L VDL+C  CYKK KK++CK+PQ+RDQ+Y+E+ N + I VVCCSPE+IRDKLC
Sbjct  7    EKTTIMVLKVDLQCPCCYKKAKKILCKMPQVRDQMYDEKANTITILVVCCSPERIRDKLC  66

Query  302  YKGGGVIKSIEI  337
             KGG  IKSIEI
Sbjct  67   CKGGKAIKSIEI  78



>gb|AFK35490.1| unknown [Medicago truncatula]
Length=261

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +2

Query  125  KTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLCY  304
            K T+M L VDL+C+ CYKKVKKV+CK PQIRDQ+Y+E+ N V ITVVCCSPEKIRDK+C 
Sbjct  8    KVTIMKLKVDLQCAKCYKKVKKVLCKFPQIRDQVYDEKNNIVTITVVCCSPEKIRDKICC  67

Query  305  KGGGVIKSIEIV  340
            KG G IKSIEIV
Sbjct  68   KGCGAIKSIEIV  79



>ref|XP_003610595.1| Proline-rich protein [Medicago truncatula]
 gb|AES92792.1| heavy-metal-associated domain protein [Medicago truncatula]
Length=261

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +2

Query  125  KTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLCY  304
            K T+M L VDL+C+ CYKKVKKV+CK PQIRDQ+Y+E+ N V ITVVCCSPEKIRDK+C 
Sbjct  8    KVTIMKLKVDLQCAKCYKKVKKVLCKFPQIRDQVYDEKNNIVTITVVCCSPEKIRDKICC  67

Query  305  KGGGVIKSIEIV  340
            KG G IKSIEIV
Sbjct  68   KGCGAIKSIEIV  79



>ref|XP_007026352.1| Heavy metal transport/detoxification superfamily protein, putative 
isoform 2 [Theobroma cacao]
 gb|EOY28974.1| Heavy metal transport/detoxification superfamily protein, putative 
isoform 2 [Theobroma cacao]
Length=252

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  137  MFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGG  316
            M L VDL+C  CYKKVKKV+ KIPQI+DQ+YNE+ N V ITVVCCSPEKIRDK+C KGGG
Sbjct  1    MVLKVDLQCYRCYKKVKKVLSKIPQIQDQVYNEKANTVTITVVCCSPEKIRDKICCKGGG  60

Query  317  VIKSIEI  337
             IKSIEI
Sbjct  61   SIKSIEI  67



>emb|CAA07370.1| proline-rich protein [Capsicum annuum]
Length=238

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +2

Query  137  MFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGG  316
            M L VDL+C SCYKKVKK++CK PQIRDQIY+E+ NKV ITV+CC+PEK+RDKLC KG G
Sbjct  1    MVLKVDLQCCSCYKKVKKILCKFPQIRDQIYDEKGNKVTITVICCNPEKLRDKLCSKGCG  60

Query  317  VIKSIEIV  340
            VIKSIEI+
Sbjct  61   VIKSIEII  68



>ref|XP_010434837.1| PREDICTED: neurofilament medium polypeptide isoform X1 [Camelina 
sativa]
Length=324

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 68/93 (73%), Gaps = 8/93 (9%)
 Frame = +2

Query  86   SSARSQLSAM--------APEKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEE  241
            S  RSQ+SA+          EK T+M L VDL C+ CYKKVKKV+CK PQIRDQ+++E+ 
Sbjct  57   SDFRSQISALHTKAMTEKGKEKVTMMKLKVDLDCAKCYKKVKKVLCKFPQIRDQLFDEKA  116

Query  242  NKVRITVVCCSPEKIRDKLCYKGGGVIKSIEIV  340
            N V I VVCCSPE+I DKLC KGGG IK+IEIV
Sbjct  117  NIVIIKVVCCSPERIMDKLCSKGGGSIKTIEIV  149



>ref|NP_001235946.1| uncharacterized protein LOC547653 [Glycine max]
 gb|AAN03471.1| unknown protein [Glycine max]
Length=240

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T+M L VDL+C  CYKKVKK++CK PQIRDQ+Y+E+ N V I VVCC+PE++RDK+C
Sbjct  3    EKVTIMRLKVDLQCHKCYKKVKKILCKFPQIRDQVYDEKNNIVTIAVVCCNPEELRDKIC  62

Query  302  YKGGGVIKSIEIV  340
             KG G IKSIEIV
Sbjct  63   CKGCGTIKSIEIV  75



>ref|XP_004293395.1| PREDICTED: uncharacterized protein LOC101299556 [Fragaria vesca 
subsp. vesca]
Length=180

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = +2

Query  131  TVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKG  310
            T+M L VDL+C  CYKKVKKV+CK PQIRDQ Y E+ N+V I VVCCSPEKIRDKLC KG
Sbjct  2    TIMVLKVDLQCEKCYKKVKKVLCKFPQIRDQTYEEKNNQVIIKVVCCSPEKIRDKLCCKG  61

Query  311  GGVIKSIEI  337
            GG IKSI+I
Sbjct  62   GGAIKSIDI  70



>emb|CDY42537.1| BnaC08g10660D [Brassica napus]
Length=195

 Score = 77.0 bits (188),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = +2

Query  104  LSAMAPEKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEK  283
            ++    EK T+M L VDL C+ CYKKVKKV+CK PQIRDQI++E+ N V I VVCCSPEK
Sbjct  1    MAEKGKEKVTMMKLKVDLDCAKCYKKVKKVLCKFPQIRDQIFDEKSNIVIIKVVCCSPEK  60

Query  284  IRDKLCYKGGGVIKSIEIV  340
            I DKLC KGGG IK+IEI+
Sbjct  61   IMDKLCSKGGGSIKTIEIL  79



>ref|XP_010542187.1| PREDICTED: anther-specific proline-rich protein APG [Tarenaya 
hassleriana]
Length=265

 Score = 77.4 bits (189),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T+M L VDL+CS CY+KVKKV+CK PQIRDQ+++E+ N V I VVCCSPEKI DKLC
Sbjct  7    EKVTMMKLKVDLECSKCYRKVKKVLCKFPQIRDQVFDEKSNTVIIKVVCCSPEKIMDKLC  66

Query  302  YKGGGVIKSIEIV  340
             KGGG IKSIEI+
Sbjct  67   CKGGGSIKSIEIL  79



>ref|XP_007154042.1| hypothetical protein PHAVU_003G086300g [Phaseolus vulgaris]
 gb|ESW26036.1| hypothetical protein PHAVU_003G086300g [Phaseolus vulgaris]
Length=248

 Score = 77.0 bits (188),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T+M L VDL+C  CYKKVKK++CK PQIRDQ+Y+E+ + V ITVVCC+PEK+RDK+C
Sbjct  3    EKVTIMRLKVDLQCHKCYKKVKKILCKFPQIRDQVYDEKHDMVTITVVCCNPEKLRDKIC  62

Query  302  YKGGGVIKSIEIV  340
             KG G IKSIEI+
Sbjct  63   CKGCGTIKSIEIL  75



>ref|XP_006449921.1| hypothetical protein CICLE_v10016401mg [Citrus clementina]
 gb|ESR63161.1| hypothetical protein CICLE_v10016401mg [Citrus clementina]
Length=247

 Score = 77.0 bits (188),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = +2

Query  113  MAPEKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRD  292
            M  +K T M L VDL+CS CYKKVKKV+CK PQI+DQI++E+ N VRI VVCCSPEKIRD
Sbjct  1    MGEKKVTTMVLKVDLQCSKCYKKVKKVLCKFPQIQDQIFDEKTNTVRIKVVCCSPEKIRD  60

Query  293  KLCYKGGGVIKSIEIV  340
            KLC KG G IKSI I+
Sbjct  61   KLCCKGEGSIKSIAIL  76



>ref|XP_006467280.1| PREDICTED: neurofilament heavy polypeptide-like [Citrus sinensis]
Length=255

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = +2

Query  113  MAPEKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRD  292
            M  +K T M L VDL+CS CYKKVKKV+CK PQI+DQI++E+ N VRI VVCCSPEKIRD
Sbjct  1    MGEKKVTTMVLKVDLQCSKCYKKVKKVLCKFPQIQDQIFDEKTNTVRIKVVCCSPEKIRD  60

Query  293  KLCYKGGGVIKSIEIV  340
            KLC KG G IKSI I+
Sbjct  61   KLCCKGEGSIKSIAIL  76



>gb|KDO78536.1| hypothetical protein CISIN_1g025287mg [Citrus sinensis]
Length=255

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = +2

Query  113  MAPEKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRD  292
            M  +K T M L VDL+CS CYKKVKKV+CK PQI+DQI++E+ N VRI VVCCSPEKIRD
Sbjct  1    MGEKKVTTMVLKVDLQCSKCYKKVKKVLCKFPQIQDQIFDEKTNTVRIKVVCCSPEKIRD  60

Query  293  KLCYKGGGVIKSIEIV  340
            KLC KG G IKSI I+
Sbjct  61   KLCCKGEGSIKSIAIL  76



>emb|CDY09699.1| BnaC07g33620D [Brassica napus]
Length=248

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T+M L VDL+C+ CYKKVKKV+CK PQIRDQ+++E+ N V I VVCCSPEKI DKLC
Sbjct  7    EKVTMMKLKVDLECAKCYKKVKKVLCKFPQIRDQVFDEKSNIVIIKVVCCSPEKIMDKLC  66

Query  302  YKGGGVIKSIEIV  340
             KGGG IK+IEIV
Sbjct  67   SKGGGSIKTIEIV  79



>emb|CDY22767.1| BnaA08g05970D [Brassica napus]
Length=253

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T+M L VDL C+ CYKKVKKV+CK PQIRDQI++E+ N V I VVCCSPEKI DKLC
Sbjct  7    EKVTMMKLKVDLDCAKCYKKVKKVLCKFPQIRDQIFDEKSNIVIIKVVCCSPEKIMDKLC  66

Query  302  YKGGGVIKSIEIV  340
             KGGG IK+IEI+
Sbjct  67   SKGGGSIKTIEIL  79



>ref|XP_002870162.1| hypothetical protein ARALYDRAFT_493247 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46421.1| hypothetical protein ARALYDRAFT_493247 [Arabidopsis lyrata subsp. 
lyrata]
Length=244

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T+M L VDL C+ CYKKVKKV+CK PQIRDQ+++E+ N V I VVCCSPEKI DKLC
Sbjct  7    EKVTMMKLKVDLDCAKCYKKVKKVLCKFPQIRDQLFDEKSNIVIIKVVCCSPEKIMDKLC  66

Query  302  YKGGGVIKSIEIV  340
             KGGG IK+IEIV
Sbjct  67   SKGGGSIKTIEIV  79



>ref|XP_008384170.1| PREDICTED: uncharacterized protein LOC103446807 [Malus domestica]
Length=343

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T M L VDL+C  CYKKVKKV+CK PQIRDQ YNE++N+V I VVCC+PEKIRDK+C
Sbjct  5    EKVTTMVLKVDLQCHKCYKKVKKVLCKFPQIRDQKYNEKQNQVVIKVVCCNPEKIRDKIC  64

Query  302  YKGGGVIKSIEI  337
             KGG  IKSI+I
Sbjct  65   CKGGSAIKSIKI  76



>ref|XP_006467281.1| PREDICTED: transcription initiation factor TFIID subunit 3-like 
isoform X1 [Citrus sinensis]
Length=230

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = +2

Query  131  TVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKG  310
            T M L VDL+CS CYKKVKKV+ K PQI+DQIY+E++NKV I VVCC PEK+RDK+C KG
Sbjct  8    TTMVLKVDLQCSKCYKKVKKVLSKFPQIQDQIYDEKQNKVTIKVVCCCPEKMRDKICCKG  67

Query  311  GGVIKSIEI  337
             GVIKSIEI
Sbjct  68   DGVIKSIEI  76



>gb|ACJ83874.1| unknown [Medicago truncatula]
 gb|AFK43923.1| unknown [Medicago truncatula]
Length=168

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            +K  +M L VDL+C  C KKVKK++CK PQIRDQIY+E+   V I VVCCSPEK+RD +C
Sbjct  3    QKVAIMRLKVDLQCRKCCKKVKKILCKYPQIRDQIYDEKNGIVTIRVVCCSPEKVRDNIC  62

Query  302  YKGGGVIKSIEIV  340
             +GGG IKSIEIV
Sbjct  63   CQGGGTIKSIEIV  75



>emb|CDX90529.1| BnaA03g42520D [Brassica napus]
Length=256

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T+M L VDL+C+ CYKKVKKV+CK PQIRDQ+++E+ N V I VVCCSPEKI DKLC
Sbjct  7    EKVTMMKLKVDLECAKCYKKVKKVLCKFPQIRDQLFDEKSNIVIIKVVCCSPEKIMDKLC  66

Query  302  YKGGGVIKSIEIV  340
             KGGG IK+IEIV
Sbjct  67   SKGGGSIKTIEIV  79



>ref|XP_006414360.1| hypothetical protein EUTSA_v10026065mg [Eutrema salsugineum]
 gb|ESQ55813.1| hypothetical protein EUTSA_v10026065mg [Eutrema salsugineum]
Length=251

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T+M L VDL C+ CYKKVKKV+CK PQIRDQ+++E+ N V I VVCCSPEKI DKLC
Sbjct  7    EKVTMMKLKVDLDCAKCYKKVKKVLCKFPQIRDQLFDEKSNVVIIKVVCCSPEKIMDKLC  66

Query  302  YKGGGVIKSIEIV  340
             KGGG IK+IEI+
Sbjct  67   SKGGGSIKTIEII  79



>gb|KEH22674.1| hypothetical protein MTR_7g056413 [Medicago truncatula]
Length=205

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            +K  +M L VDL+C  C KKVKK++CK PQIRDQIY+E+   V I VVCCSPEK+RD +C
Sbjct  3    QKVAIMRLKVDLQCRKCCKKVKKILCKYPQIRDQIYDEKNGIVTIRVVCCSPEKVRDNIC  62

Query  302  YKGGGVIKSIEIV  340
             +GGG IKSIEIV
Sbjct  63   CQGGGTIKSIEIV  75



>gb|AAL38281.1| unknown protein [Arabidopsis thaliana]
 gb|AAM10255.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD93746.1| hypothetical protein [Arabidopsis thaliana]
Length=254

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T+M L VDL C+ CYKKVKKV+CK PQIRDQ+++E+ N V I VVCCSPE+I DKLC
Sbjct  7    EKVTMMKLKVDLDCAKCYKKVKKVLCKFPQIRDQLFDEKSNIVIIKVVCCSPERIMDKLC  66

Query  302  YKGGGVIKSIEIV  340
             KGGG IK+IEIV
Sbjct  67   SKGGGSIKTIEIV  79



>ref|XP_004172606.1| PREDICTED: uncharacterized protein LOC101224516, partial [Cucumis 
sativus]
Length=91

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            +K  VM L VDL+C  CYKKVKKV+CK PQIRDQIY+E++N V I VVCC+PEK+RDK+C
Sbjct  6    KKVVVMMLKVDLQCDRCYKKVKKVLCKFPQIRDQIYDEKQNLVIIKVVCCNPEKLRDKIC  65

Query  302  YKGGGVIKS  328
             KG GVIKS
Sbjct  66   CKGCGVIKS  74



>ref|XP_006284371.1| hypothetical protein CARUB_v10005542mg [Capsella rubella]
 gb|EOA17269.1| hypothetical protein CARUB_v10005542mg [Capsella rubella]
Length=257

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T+M L VDL C+ CYKKVKKV+CK PQIRDQ+++E+ N V I VVCCSPE+I DKLC
Sbjct  7    EKVTMMKLKVDLDCAKCYKKVKKVLCKFPQIRDQLFDEKSNIVIIKVVCCSPERIMDKLC  66

Query  302  YKGGGVIKSIEIV  340
             KGGG IK+IEIV
Sbjct  67   SKGGGSIKTIEIV  79



>ref|XP_004139513.1| PREDICTED: uncharacterized protein LOC101212464 [Cucumis sativus]
 gb|KGN64988.1| hypothetical protein Csa_1G172590 [Cucumis sativus]
Length=286

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            +K  VM L VDL+C  CYKKVKKV+CK PQIRDQIY+E++N V I VVCC+PEK+RDK+C
Sbjct  6    KKVVVMMLKVDLQCDRCYKKVKKVLCKFPQIRDQIYDEKQNLVIIKVVCCNPEKLRDKIC  65

Query  302  YKGGGVIKSIEI  337
             KG GVIKSIEI
Sbjct  66   CKGCGVIKSIEI  77



>ref|XP_008464282.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Cucumis 
melo]
Length=299

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            +K  VM L VDL+C  CYKKVKKV+CK PQIRDQIY+E++N V I VVCC+PEK+RDK+C
Sbjct  6    KKVVVMMLKVDLQCDRCYKKVKKVLCKFPQIRDQIYDEKQNLVIIKVVCCNPEKLRDKIC  65

Query  302  YKGGGVIKSIEI  337
             KG GVIKSIEI
Sbjct  66   CKGCGVIKSIEI  77



>ref|XP_010686629.1| PREDICTED: skin secretory protein xP2 [Beta vulgaris subsp. vulgaris]
Length=272

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T M L VDL C  CY+KVK+ +CK PQIR+Q Y+E+ N V ITVVCCSPEKIRDKLC
Sbjct  7    EKVTRMALKVDLDCDQCYRKVKRTLCKFPQIRNQEYDEKNNTVMITVVCCSPEKIRDKLC  66

Query  302  YKGGGVIKSIEIV  340
             K G  IKSIEI+
Sbjct  67   CKAGKSIKSIEII  79



>ref|NP_974559.5| metal ion binding protein [Arabidopsis thaliana]
 gb|AEE83739.1| metal ion binding protein [Arabidopsis thaliana]
Length=254

 Score = 74.7 bits (182),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T+M L VDL C+ CYKKVKKV+CK PQIRDQ+++E+ N V I VVCCSPE+I DKLC
Sbjct  7    EKVTMMKLKVDLDCAKCYKKVKKVLCKFPQIRDQLFDEKSNIVIIKVVCCSPERIMDKLC  66

Query  302  YKGGGVIKSIEIV  340
             KGGG IK+IEIV
Sbjct  67   SKGGGSIKTIEIV  79



>ref|XP_010449800.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1 isoform X2 [Camelina sativa]
Length=264

 Score = 74.7 bits (182),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T+M L VDL C+ CYKKVKKV+CK PQIRDQ+++E+ N V I VVCCSPE+I DKLC
Sbjct  7    EKVTMMKLKVDLDCAKCYKKVKKVLCKFPQIRDQLFDEKANIVIIKVVCCSPERIMDKLC  66

Query  302  YKGGGVIKSIEIV  340
             KGGG IK+IEIV
Sbjct  67   SKGGGSIKTIEIV  79



>emb|CDY34460.1| BnaC01g21730D [Brassica napus]
Length=269

 Score = 74.7 bits (182),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T+M L VDL C+ CYKKVKKV+CKIPQIRDQ+++E+ N V I VVCCSPE+I DKLC
Sbjct  7    EKVTMMKLKVDLDCAKCYKKVKKVLCKIPQIRDQLFDEKSNIVIIKVVCCSPERIMDKLC  66

Query  302  YKGGGVIKSIEIV  340
             KGGG IK+IEIV
Sbjct  67   SKGGGSIKTIEIV  79



>emb|CDP05626.1| unnamed protein product [Coffea canephora]
Length=221

 Score = 74.3 bits (181),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +2

Query  137  MFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGG  316
            M L+VDL+C SCYKKVKK++CK P+IRDQ+Y+E+ N V ITVVCCSPEKIRDKLC KG  
Sbjct  1    MRLNVDLQCPSCYKKVKKILCKFPEIRDQVYDEKHNLVTITVVCCSPEKIRDKLCCKGDK  60

Query  317  VIKSIEIV  340
            VIKSIEIV
Sbjct  61   VIKSIEIV  68



>emb|CDY32238.1| BnaA01g17460D [Brassica napus]
Length=270

 Score = 74.3 bits (181),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T+M L VDL C+ CYKKVKKV+CKIPQIRDQ+++E+ N V I VVCCSPE+I DKLC
Sbjct  7    EKVTMMKLKVDLDCAKCYKKVKKVLCKIPQIRDQLFDEKSNIVIIKVVCCSPERIMDKLC  66

Query  302  YKGGGVIKSIEIV  340
             KGGG IK+IEIV
Sbjct  67   SKGGGSIKTIEIV  79



>ref|XP_009124518.1| PREDICTED: LOW QUALITY PROTEIN: protein TsetseEP-like [Brassica 
rapa]
Length=263

 Score = 74.3 bits (181),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T+M L VDL C+ CYKKVKKV+CK PQIRDQI++E+ N V I VVCC PEKI DKLC
Sbjct  7    EKVTMMKLKVDLDCAKCYKKVKKVLCKFPQIRDQIFDEKSNIVIIKVVCCXPEKIMDKLC  66

Query  302  YKGGGVIKSIEIV  340
             KGGG IK+IEI+
Sbjct  67   SKGGGSIKTIEIL  79



>ref|XP_004293392.1| PREDICTED: vacuolar protein-sorting protein BRO1-like [Fragaria 
vesca subsp. vesca]
Length=267

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = +2

Query  113  MAPEKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRD  292
            M  +K T+M L VDL+C  CYKKVKKV+CK PQIRDQ Y+E+ N+V + VVCCSPEKIRD
Sbjct  1    MGEKKVTIMVLKVDLQCEKCYKKVKKVLCKFPQIRDQTYDEKNNQVIVKVVCCSPEKIRD  60

Query  293  KLCYKGGGVIKSIEIV  340
            KLC +G G IK I+I+
Sbjct  61   KLCCEGDGAIKRIDIL  76



>ref|XP_007026349.1| Heavy metal transport/detoxification superfamily protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY28971.1| Heavy metal transport/detoxification superfamily protein, putative 
isoform 1 [Theobroma cacao]
Length=115

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +2

Query  113  MAPEKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRD  292
            M  +K T M L VDL+C  CY KVKK++ K PQIRDQ ++E+ N V ITVVCC PEK RD
Sbjct  1    MEEKKVTTMELKVDLQCRRCYNKVKKLLSKFPQIRDQRFDEKANTVTITVVCCCPEKFRD  60

Query  293  KLCYKGGGVIKS  328
            KLC KGGG IK 
Sbjct  61   KLCRKGGGSIKG  72



>ref|XP_007212403.1| hypothetical protein PRUPE_ppa016415mg, partial [Prunus persica]
 gb|EMJ13602.1| hypothetical protein PRUPE_ppa016415mg, partial [Prunus persica]
Length=190

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T+M L VDL+C  CY KVKKV+CKIPQI+DQIY+E++N+V I VVCCSPEKIRD++ 
Sbjct  5    EKETIMVLKVDLQCHKCYMKVKKVLCKIPQIQDQIYDEKQNQVVIKVVCCSPEKIRDRIR  64

Query  302  YKGGGVIKSIEI  337
             KGGG IK I+I
Sbjct  65   CKGGGAIKCIQI  76



>ref|XP_009591790.1| PREDICTED: uncharacterized protein LOC104088756 [Nicotiana tomentosiformis]
Length=154

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 59/77 (77%), Gaps = 2/77 (3%)
 Frame = +2

Query  113  MAPEKT--TVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKI  286
            M  +KT   +M L +D +CS  YKKV+KV+CK PQIRD++Y+E+ N V ITVVCC PE+ 
Sbjct  1    MGGDKTEKVIMVLKIDFQCSCYYKKVEKVLCKFPQIRDEVYDEKANTVTITVVCCDPERF  60

Query  287  RDKLCYKGGGVIKSIEI  337
            RDKLC KG GVIKSIEI
Sbjct  61   RDKLCSKGCGVIKSIEI  77



>ref|XP_010449799.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1 isoform X1 [Camelina sativa]
Length=274

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = +2

Query  113  MAPEKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRD  292
            M+ ++ T+M L VDL C+ CYKKVKKV+CK PQIRDQ+++E+ N V I VVCCSPE+I D
Sbjct  14   MSQKQVTMMKLKVDLDCAKCYKKVKKVLCKFPQIRDQLFDEKANIVIIKVVCCSPERIMD  73

Query  293  KLCYKGGGVIKSIEIV  340
            KLC KGGG IK+IEIV
Sbjct  74   KLCSKGGGSIKTIEIV  89



>gb|KFK26549.1| hypothetical protein AALP_AA8G263000 [Arabis alpina]
Length=240

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T+M L VDL CS CYKKVKKV+CK PQIRDQ+++E+   V I VVCCSPEKI DKLC
Sbjct  7    EKVTMMKLKVDLDCSKCYKKVKKVLCKFPQIRDQLFDEKSGFVIIKVVCCSPEKIMDKLC  66

Query  302  YKGGGVIKSIEIV  340
             KGGG IK+IEI+
Sbjct  67   CKGGGSIKTIEIL  79



>emb|CDY72414.1| BnaCnng77490D [Brassica napus]
Length=175

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = +2

Query  104  LSAMAPEKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEK  283
            ++    +K T+M L VDL C+ CYKKVKKV+CKIPQIRDQ ++E+ N V I VVCCSPE+
Sbjct  1    MAEKGKKKITMMKLKVDLDCAKCYKKVKKVLCKIPQIRDQWFDEKSNIVIIKVVCCSPER  60

Query  284  IRDKLCYKGGGVIKSIEIV  340
            I DKLC KGGG IK+IEI+
Sbjct  61   IMDKLCSKGGGSIKTIEII  79



>ref|XP_009374864.1| PREDICTED: uncharacterized protein LOC103963741 [Pyrus x bretschneideri]
Length=79

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +2

Query  137  MFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGG  316
            M L VDL+C  CYKKVKKV+CK PQIRDQIY+E++N V I VVCC+PEKIRDK+C KGG 
Sbjct  1    MELKVDLQCHKCYKKVKKVLCKFPQIRDQIYDEKQNHVVIKVVCCNPEKIRDKICCKGGN  60

Query  317  VIKSIEI  337
             IK I+I
Sbjct  61   AIKCIKI  67



>emb|CDP04720.1| unnamed protein product [Coffea canephora]
Length=145

 Score = 70.5 bits (171),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +2

Query  137  MFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGG  316
            M L VDL+C SCYKKVKK++CK PQI+DQ+Y+E++N V ITVVCCSPEKIRDKL  KGG 
Sbjct  1    MRLKVDLQCPSCYKKVKKILCKFPQIQDQVYDEKQNLVTITVVCCSPEKIRDKLYCKGGK  60

Query  317  VIKSIEIV  340
            VIK IEIV
Sbjct  61   VIKCIEIV  68



>emb|CDY34454.1| BnaC01g21790D [Brassica napus]
Length=169

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 61/79 (77%), Gaps = 0/79 (0%)
 Frame = +2

Query  104  LSAMAPEKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEK  283
            ++    +K T+M L VDL C+ CYKKVKKV+CKIPQIRDQ ++E+ N V I  VCCSPE+
Sbjct  1    MAEKGKKKVTMMKLKVDLDCAKCYKKVKKVLCKIPQIRDQWFDEKSNIVIIKTVCCSPER  60

Query  284  IRDKLCYKGGGVIKSIEIV  340
            I DKLC KGGG IK+IEI+
Sbjct  61   IMDKLCSKGGGSIKTIEII  79



>ref|XP_004134803.1| PREDICTED: uncharacterized protein LOC101208367 [Cucumis sativus]
Length=184

 Score = 70.5 bits (171),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK   M L VDL+C  CYKKVKKV+ K PQIRDQ+YNE++  V I VVCC+PEKI  K+C
Sbjct  3    EKVVFMMLKVDLECDRCYKKVKKVLAKFPQIRDQVYNEKQGLVIIKVVCCTPEKIMKKIC  62

Query  302  YKGGGVIKSIEI  337
             KG G IKSIEI
Sbjct  63   SKGDGSIKSIEI  74



>ref|XP_004513528.1| PREDICTED: vasodilator-stimulated phosphoprotein-like [Cicer 
arietinum]
Length=210

 Score = 70.9 bits (172),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            +K  +M L VDL+C  C KKVKK++CK  QIRDQ+Y+E+ + V I VVCCSPEK+RD LC
Sbjct  3    QKVAIMKLKVDLQCRKCCKKVKKLLCKYSQIRDQLYDEKNDIVTIRVVCCSPEKLRDNLC  62

Query  302  YKGGGVIKSIEIV  340
              GGG IKSIEIV
Sbjct  63   CAGGGTIKSIEIV  75



>ref|XP_007026350.1| Heavy metal transport/detoxification superfamily protein, putative 
isoform 2 [Theobroma cacao]
 gb|EOY28972.1| Heavy metal transport/detoxification superfamily protein, putative 
isoform 2 [Theobroma cacao]
Length=122

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +2

Query  131  TVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKG  310
            T M L VDL+C  CY KVKK++ K PQIRDQ ++E+ N V ITVVCC PEK RDKLC KG
Sbjct  3    TTMELKVDLQCRRCYNKVKKLLSKFPQIRDQRFDEKANTVTITVVCCCPEKFRDKLCRKG  62

Query  311  GGVIKS  328
            GG IK 
Sbjct  63   GGSIKG  68



>ref|XP_006414359.1| hypothetical protein EUTSA_v10026065mg [Eutrema salsugineum]
 gb|ESQ55812.1| hypothetical protein EUTSA_v10026065mg [Eutrema salsugineum]
Length=241

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = +2

Query  134  VMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGG  313
            +M L VDL C+ CYKKVKKV+CK PQIRDQ+++E+ N V I VVCCSPEKI DKLC KGG
Sbjct  1    MMKLKVDLDCAKCYKKVKKVLCKFPQIRDQLFDEKSNVVIIKVVCCSPEKIMDKLCSKGG  60

Query  314  GVIKSIEIV  340
            G IK+IEI+
Sbjct  61   GSIKTIEII  69



>ref|XP_008440982.1| PREDICTED: protein PXR1-like [Cucumis melo]
Length=238

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK  +M L VDL+C  CYKKVKKV+ K PQIRDQ+YNE++  V I VVCC+PEKI  K+C
Sbjct  3    EKVVLMVLKVDLECHRCYKKVKKVLAKFPQIRDQVYNEKQGFVMIKVVCCTPEKIMKKIC  62

Query  302  YKGGGVIKSIEI  337
             KG G IKSIEI
Sbjct  63   SKGDGSIKSIEI  74



>gb|EYU33837.1| hypothetical protein MIMGU_mgv1a027133mg [Erythranthe guttata]
Length=238

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +2

Query  209  QIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGGVIKSIEI  337
            +IRDQ+Y+E+ N V I VVCCSPEKIRDKLC KGG VIKSIEI
Sbjct  13   KIRDQVYDEKANTVTIIVVCCSPEKIRDKLCCKGGKVIKSIEI  55



>ref|XP_008378227.1| PREDICTED: putative cuticle collagen 155 [Malus domestica]
Length=295

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +2

Query  209  QIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGGVIKSIEIV  340
            +IRDQ+YNE++N+V I VVCCSPEKIRDK+C KGG  IKSIEI+
Sbjct  39   EIRDQVYNEKQNQVVIKVVCCSPEKIRDKICCKGGSAIKSIEIM  82



>emb|CBI18632.3| unnamed protein product [Vitis vinifera]
Length=136

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 57/74 (77%), Gaps = 1/74 (1%)
 Frame = +2

Query  119  PEKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKL  298
            PE TT M L VDL+C  CYKK+KK++CK P+IRDQ + E+EN V I VVCCSP KIRDKL
Sbjct  2    PEVTT-MRLRVDLECDRCYKKIKKLLCKFPEIRDQAFFEKENTVMIKVVCCSPHKIRDKL  60

Query  299  CYKGGGVIKSIEIV  340
              KGG  IKSIEI+
Sbjct  61   ICKGGKTIKSIEII  74



>gb|ABM05953.1| proline-rich protein [Gossypium hirsutum]
 gb|KHG05058.1| Putative callose synthase 6 -like protein [Gossypium arboreum]
Length=182

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T+M L VDL+C  CYKKVK+V+CK PQIRDQIY+E+ N V I VVCC PEK+R K+ 
Sbjct  3    EKVTIMVLKVDLQCRRCYKKVKQVLCKFPQIRDQIYDEKANTVTIKVVCCDPEKMRGKIR  62

Query  302  YKGGGVIKSIEI  337
             KGG  IKSIEI
Sbjct  63   CKGGDSIKSIEI  74



>emb|CDY34453.1| BnaC01g21800D [Brassica napus]
Length=204

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = +2

Query  131  TVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKG  310
            T+M L VDL C+ CYKKVKKV+CKIPQIRDQ ++E+ N V I  VCCSPE+I DKLC KG
Sbjct  39   TMMKLKVDLDCAKCYKKVKKVLCKIPQIRDQWFDEKSNIVIIKTVCCSPERIMDKLCSKG  98

Query  311  GGVIKSIEIV  340
            GG IK+IEI+
Sbjct  99   GGSIKTIEII  108



>ref|XP_004168629.1| PREDICTED: uncharacterized protein LOC101231712 [Cucumis sativus]
Length=234

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK   M L VDL+C  CYKKVKKV+ K PQIRDQ+YNE++  V I VVCC+PEKI  K+C
Sbjct  3    EKVVFMMLKVDLECDRCYKKVKKVLAKFPQIRDQVYNEKQGLVIIKVVCCTPEKIMKKIC  62

Query  302  YKGGGVIKSIEI  337
             KG G IKSIEI
Sbjct  63   SKGDGSIKSIEI  74



>ref|XP_006584100.1| PREDICTED: uncharacterized protein LOC102666282 [Glycine max]
Length=77

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 57/74 (77%), Gaps = 2/74 (3%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiP--QIRDQIYNEEENKVRITVVCCSPEKIRDK  295
            +K  +M L VDL C  CYKKVKK++CK P  +IRDQ+Y+E+ N V I VVCC+PEK+RDK
Sbjct  3    KKVNIMRLKVDLGCHKCYKKVKKILCKFPREKIRDQVYDEKNNIVTIAVVCCNPEKLRDK  62

Query  296  LCYKGGGVIKSIEI  337
            +C KG G IKSIEI
Sbjct  63   ICCKGYGTIKSIEI  76



>gb|KJB69157.1| hypothetical protein B456_011G008600 [Gossypium raimondii]
Length=216

 Score = 67.8 bits (164),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  224  IYNEEENKVRITVVCCSPEKIRDKLCYKGGGVIKSIEI  337
            +Y+E+ N V ITVVCCSPEKIRDKLCYKGGG IKSIE+
Sbjct  1    MYDEKANTVTITVVCCSPEKIRDKLCYKGGGSIKSIEL  38



>gb|KCW75116.1| hypothetical protein EUGRSUZ_E03867 [Eucalyptus grandis]
Length=328

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 60/78 (77%), Gaps = 1/78 (1%)
 Frame = +2

Query  107  SAMAPEKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKI  286
            +AMA EK T M + VDL+C  CYKK+KK++C+ PQIRDQIYNE++N V ITVVCCSPEKI
Sbjct  58   AAMA-EKVTRMVIKVDLQCCRCYKKIKKILCQFPQIRDQIYNEKQNMVLITVVCCSPEKI  116

Query  287  RDKLCYKGGGVIKSIEIV  340
            R  +  KGG  +  +EI+
Sbjct  117  RQMIICKGGETVLGVEIL  134



>ref|XP_010057804.1| PREDICTED: transcription initiation factor TFIID subunit 3-like 
[Eucalyptus grandis]
 gb|KCW75122.1| hypothetical protein EUGRSUZ_E03873 [Eucalyptus grandis]
Length=204

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T M + VDL+CS C KK++KV+C IPQIRD+ Y+E+EN V ITVVCCSPEKI+ K+ 
Sbjct  3    EKVTRMLIKVDLQCSRCIKKIQKVLCGIPQIRDRTYDEKENTVSITVVCCSPEKIKQKII  62

Query  302  YKGGGVIKSIEIV  340
             KGG  + S+EI+
Sbjct  63   CKGGETVLSVEIL  75



>ref|XP_003635154.1| PREDICTED: sulfated surface glycoprotein 185-like [Vitis vinifera]
Length=233

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 57/74 (77%), Gaps = 1/74 (1%)
 Frame = +2

Query  119  PEKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKL  298
            PE TT M L VDL+C  CYKK+KK++CK P+IRDQ + E+EN V I VVCCSP KIRDKL
Sbjct  2    PEVTT-MRLRVDLECDRCYKKIKKLLCKFPEIRDQAFFEKENTVMIKVVCCSPHKIRDKL  60

Query  299  CYKGGGVIKSIEIV  340
              KGG  IKSIEI+
Sbjct  61   ICKGGKTIKSIEII  74



>ref|XP_006446044.1| hypothetical protein CICLE_v10017991mg [Citrus clementina]
 ref|XP_006467206.1| PREDICTED: uncharacterized protein LOC102618654 isoform X1 [Citrus 
sinensis]
 gb|ESR59284.1| hypothetical protein CICLE_v10017991mg [Citrus clementina]
Length=210

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = +2

Query  113  MAPEKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRD  292
            M  +K T M L VDL CS C KKVKKV+CK PQI++Q ++E+ N V I VV CSPE+IRD
Sbjct  1    MGEKKVTKMVLKVDLSCSKCRKKVKKVLCKFPQIQEQSFDEKTNTVTIKVVSCSPEEIRD  60

Query  293  KLCYKGGGVIKSIEIV  340
            KLC KG GVIK+IEI+
Sbjct  61   KLCCKGEGVIKTIEIL  76



>ref|XP_006467207.1| PREDICTED: uncharacterized protein LOC102618654 isoform X2 [Citrus 
sinensis]
Length=209

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T M L VDL CS C KKVKKV+CK PQI++Q ++E+ N V I VV CSPE+IRDKLC
Sbjct  3    EKVTKMVLKVDLSCSKCRKKVKKVLCKFPQIQEQSFDEKTNTVTIKVVSCSPEEIRDKLC  62

Query  302  YKGGGVIKSIEIV  340
             KG GVIK+IEI+
Sbjct  63   CKGEGVIKTIEIL  75



>ref|XP_002269930.2| PREDICTED: sulfated surface glycoprotein 185 isoform X1 [Vitis 
vinifera]
 emb|CBI18630.3| unnamed protein product [Vitis vinifera]
Length=233

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 57/74 (77%), Gaps = 1/74 (1%)
 Frame = +2

Query  119  PEKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKL  298
            PE TT M L VDL+C  CYKK+KK++CK P+IRDQ + E+EN V I VVCCSP KIRDKL
Sbjct  2    PEVTT-MRLRVDLECDRCYKKIKKLLCKFPEIRDQAFFEKENTVMIKVVCCSPHKIRDKL  60

Query  299  CYKGGGVIKSIEIV  340
              KGG  IKSIEI+
Sbjct  61   ICKGGKTIKSIEII  74



>gb|ABK95210.1| unknown [Populus trichocarpa]
Length=207

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = +2

Query  113  MAPEKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRD  292
            MA +K T M + VDL+C  C+KK+KKV+C+IPQI++QIY+++   V ITVVCCSPEKI++
Sbjct  1    MAEKKVTTMVMKVDLECEKCHKKIKKVLCRIPQIQNQIYDKKAGTVTITVVCCSPEKIKE  60

Query  293  KLCYKGGGVIKSIEI  337
            K+  KGG  +KSIEI
Sbjct  61   KIVCKGGEAVKSIEI  75



>ref|XP_009146037.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1 [Brassica rapa]
Length=268

 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T+M L VDL C+ CYKKVKKV+CKIPQIRDQ+++E+ N V I VVCC+  +I DKLC
Sbjct  7    EKVTMMKLKVDLDCAKCYKKVKKVLCKIPQIRDQLFDEKSNIVIIKVVCCTLRRIMDKLC  66

Query  302  YKGGGVIKSIEIV  340
             KGGG IK+IEIV
Sbjct  67   SKGGGSIKTIEIV  79



>ref|XP_006380915.1| hypothetical protein POPTR_0006s02010g [Populus trichocarpa]
 gb|ERP58712.1| hypothetical protein POPTR_0006s02010g [Populus trichocarpa]
Length=244

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = +2

Query  113  MAPEKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRD  292
            MA +K T M + VDL+C  C+KK+KKV+C+IPQI++QIY+++   V ITVVCCSPEKI++
Sbjct  1    MAEKKVTTMVMKVDLECEKCHKKIKKVLCRIPQIQNQIYDKKAGTVTITVVCCSPEKIKE  60

Query  293  KLCYKGGGVIKSIEI  337
            K+  KGG  +KSIEI
Sbjct  61   KIVCKGGEAVKSIEI  75



>gb|KGN49037.1| hypothetical protein Csa_6G511040 [Cucumis sativus]
Length=224

 Score = 65.5 bits (158),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +2

Query  137  MFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGG  316
            M L VDL+C  CYKKVKKV+ K PQIRDQ+YNE++  V I VVCC+PEKI  K+C KG G
Sbjct  1    MMLKVDLECDRCYKKVKKVLAKFPQIRDQVYNEKQGLVIIKVVCCTPEKIMKKICSKGDG  60

Query  317  VIKSIEI  337
             IKSIEI
Sbjct  61   SIKSIEI  67



>gb|KFK35881.1| hypothetical protein AALP_AA4G048900 [Arabis alpina]
Length=175

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T+M L VDL CS CYKKVKK + K PQIRDQ+++E+ N + I VVC  PE++ +KLC
Sbjct  3    EKVTMMKLKVDLDCSKCYKKVKKALRKFPQIRDQLFDEKTNTIIIKVVCYDPERLMNKLC  62

Query  302  YKGGGVIKSIEIV  340
            YKG G IKSI I+
Sbjct  63   YKGDGSIKSIVIL  75



>ref|XP_002894181.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70440.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=177

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +2

Query  206  PQIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGGVIKSIEIV  340
            PQ+RDQ ++EE N V I VVCCSPEK+ DKLC KG G IK IE +
Sbjct  25   PQVRDQKFDEENNTVTIKVVCCSPEKVMDKLCSKGRGAIKLIETI  69



>emb|CAN77897.1| hypothetical protein VITISV_036665 [Vitis vinifera]
Length=100

 Score = 63.5 bits (153),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +2

Query  137  MFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGG  316
            M L VDL+C  CYKK+KK++CK P+IRDQ++ E+EN V I VVCCSP KIRDKL  KGG 
Sbjct  1    MKLGVDLECDRCYKKIKKLLCKFPEIRDQVFFEKENTVMIKVVCCSPLKIRDKLICKGGK  60

Query  317  VIKSIEIV  340
             IK IEI+
Sbjct  61   TIKGIEII  68



>ref|XP_009107183.1| PREDICTED: uncharacterized protein LOC103832845 [Brassica rapa]
Length=174

 Score = 64.7 bits (156),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T+M L+VDL CS CYKK KK I K PQIRD++Y+E+ N + I VVC  PEK+ +KLC
Sbjct  3    EKVTIMKLTVDLACSKCYKKAKKAIRKFPQIRDELYDEKTNTIIIKVVCYDPEKLMNKLC  62

Query  302  YKGGGVIKSIEIV  340
            YKG   IKSI I+
Sbjct  63   YKGDRSIKSIVIL  75



>ref|XP_010057802.1| PREDICTED: chitin-binding lectin 1-like isoform X2 [Eucalyptus 
grandis]
Length=269

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T M + VDL+C  CYKK+KK++C+ PQIRDQIYNE++N V ITVVCCSPEKIR  + 
Sbjct  3    EKVTRMVIKVDLQCCRCYKKIKKILCQFPQIRDQIYNEKQNMVLITVVCCSPEKIRQMII  62

Query  302  YKGGGVIKSIEIV  340
             KGG  +  +EI+
Sbjct  63   CKGGETVLGVEIL  75



>ref|XP_010057800.1| PREDICTED: basic salivary proline-rich protein 1-like isoform 
X1 [Eucalyptus grandis]
Length=297

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T M + VDL+C  CYKK+KK++C+ PQIRDQIYNE++N V ITVVCCSPEKIR  + 
Sbjct  3    EKVTRMVIKVDLQCCRCYKKIKKILCQFPQIRDQIYNEKQNMVLITVVCCSPEKIRQMII  62

Query  302  YKGGGVIKSIEIV  340
             KGG  +  +EI+
Sbjct  63   CKGGETVLGVEIL  75



>ref|XP_010445352.1| PREDICTED: acidic proline-rich protein PRP25-like [Camelina sativa]
Length=198

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  209  QIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGGVIKSIEIV  340
            +IRDQ+++E+ N V I VVCCSPE+I DKLC KGGG IK+IEIV
Sbjct  6    EIRDQLFDEKANIVIIKVVCCSPERIMDKLCSKGGGSIKTIEIV  49



>gb|AAD43158.1|AC007504_13 Hypothetical Protein [Arabidopsis thaliana]
Length=178

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +2

Query  206  PQIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGGVIKSIEIV  340
            PQ+RDQ + EE N V I VVCCSPEK+ DKLC KG G IK IE +
Sbjct  25   PQVRDQKFEEETNTVTIKVVCCSPEKVMDKLCSKGRGAIKLIETI  69



>ref|NP_175367.2| metal ion binding protein [Arabidopsis thaliana]
 gb|AEE32428.1| metal ion binding protein [Arabidopsis thaliana]
Length=189

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +2

Query  206  PQIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGGVIKSIEIV  340
            PQ+RDQ + EE N V I VVCCSPEK+ DKLC KG G IK IE +
Sbjct  36   PQVRDQKFEEETNTVTIKVVCCSPEKVMDKLCSKGRGAIKLIETI  80



>ref|XP_010057798.1| PREDICTED: uncharacterized protein LOC104445595 [Eucalyptus grandis]
 gb|KCW75112.1| hypothetical protein EUGRSUZ_E03863 [Eucalyptus grandis]
Length=184

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T M + VDL+C  CYKK+KK++CK PQIRDQ YNE++N V ITVVCCSPEKIR  + 
Sbjct  3    EKVTKMEIKVDLQCWRCYKKIKKILCKFPQIRDQKYNEKQNTVSITVVCCSPEKIRQMII  62

Query  302  YKGGGVIKSIEI  337
             KGG  +  +EI
Sbjct  63   CKGGETVLGVEI  74



>ref|XP_010434838.1| PREDICTED: predicted GPI-anchored protein 58 isoform X2 [Camelina 
sativa]
Length=224

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  209  QIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGGVIKSIEIV  340
            +IRDQ+++E+ N V I VVCCSPE+I DKLC KGGG IK+IEIV
Sbjct  6    EIRDQLFDEKANIVIIKVVCCSPERIMDKLCSKGGGSIKTIEIV  49



>ref|NP_001118990.4| metal ion binding protein [Arabidopsis thaliana]
 gb|AEE83740.1| metal ion binding protein [Arabidopsis thaliana]
Length=233

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  209  QIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGGVIKSIEIV  340
            +IRDQ+++E+ N V I VVCCSPE+I DKLC KGGG IK+IEIV
Sbjct  15   EIRDQLFDEKSNIVIIKVVCCSPERIMDKLCSKGGGSIKTIEIV  58



>ref|XP_010057795.1| PREDICTED: circumsporozoite protein-like [Eucalyptus grandis]
Length=243

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T M + VDL+CS C KK+KK++CK PQIRD++Y+ + N V ITVVCCSPEKIRDK+ 
Sbjct  3    EKVTEMMVKVDLQCSRCCKKIKKILCKFPQIRDRVYDYKLNAVFITVVCCSPEKIRDKII  62

Query  302  YKGGGVIKSIEI  337
             KGG  +  +EI
Sbjct  63   RKGGDTVLGVEI  74



>gb|KDP32907.1| hypothetical protein JCGZ_13688 [Jatropha curcas]
Length=245

 Score = 63.2 bits (152),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +2

Query  137  MFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGG  316
            M + VDL C  C +K+KKV+CKIPQI+ QIY+E+ N V +TVVCCSPEK++ K+C KGG 
Sbjct  1    MVIKVDLNCEKCNRKIKKVLCKIPQIQSQIYDEKANTVTVTVVCCSPEKVKKKICCKGGE  60

Query  317  VIKSIEIV  340
             +K IEIV
Sbjct  61   SVKGIEIV  68



>ref|XP_011004530.1| PREDICTED: uncharacterized protein LOC105111002 [Populus euphratica]
Length=207

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 59/75 (79%), Gaps = 0/75 (0%)
 Frame = +2

Query  113  MAPEKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRD  292
            MA +K T M + VDL C  C+KK+KKV+C+IPQI+DQIY+++   V ITV+CCSPEKI++
Sbjct  1    MAEKKVTKMVIKVDLGCEKCHKKIKKVLCRIPQIQDQIYDKKAGTVTITVLCCSPEKIKE  60

Query  293  KLCYKGGGVIKSIEI  337
            K+  +GG  +KSIEI
Sbjct  61   KIICEGGEAVKSIEI  75



>gb|KFK34181.1| hypothetical protein AALP_AA5G111100 [Arabis alpina]
Length=160

 Score = 61.6 bits (148),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 53/73 (73%), Gaps = 0/73 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T+M L VDL C  CYKKVKK + K PQIRD++++E+ N + I VVC  PE++ +KLC
Sbjct  3    EKVTMMKLKVDLDCPKCYKKVKKALRKFPQIRDELFDEKSNTIIIKVVCYDPERLMNKLC  62

Query  302  YKGGGVIKSIEIV  340
            YK  G IKSI I+
Sbjct  63   YKADGSIKSIVIL  75



>gb|KDO64832.1| hypothetical protein CISIN_1g046486mg [Citrus sinensis]
Length=202

 Score = 62.0 bits (149),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +2

Query  137  MFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGG  316
            M L VDL CS C KKVKKV+CK PQI++Q ++E+ N V I VV CSPE+IRDKLC KG G
Sbjct  1    MVLKVDLSCSKCRKKVKKVLCKFPQIQEQSFDEKTNTVTIKVVSCSPEEIRDKLCCKGEG  60

Query  317  VIKSIEIV  340
            VIK+IEI+
Sbjct  61   VIKTIEIL  68



>ref|XP_010463316.1| PREDICTED: uncharacterized protein LOC104743984 [Camelina sativa]
Length=185

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +2

Query  206  PQIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGGVIKSIEIV  340
            PQ+RDQ ++E  N V I VVCCSPEK+ DKLC KG G IK IE +
Sbjct  37   PQVRDQKFDEGSNTVTIKVVCCSPEKVMDKLCSKGRGSIKLIETI  81



>ref|XP_006467204.1| PREDICTED: skin secretory protein xP2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006467205.1| PREDICTED: skin secretory protein xP2-like isoform X2 [Citrus 
sinensis]
Length=355

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +2

Query  137  MFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGG  316
            M L V+L+CS CYKKVKKV+CK PQI++Q ++E+ N V I VVCCSPEKIRDKLC KG G
Sbjct  1    MVLKVNLQCSKCYKKVKKVLCKFPQIQEQFFDEKTNTVTIKVVCCSPEKIRDKLCCKGDG  60

Query  317  VIKSIEIV  340
             IK+IEI+
Sbjct  61   SIKTIEIL  68



>ref|XP_010501910.1| PREDICTED: uncharacterized protein LOC104779240 [Camelina sativa]
Length=185

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +2

Query  206  PQIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGGVIKSIEIV  340
            PQ+RDQ ++E  N V I VVCCSPEK+ DKLC KG G IK IE +
Sbjct  37   PQVRDQKFDEGSNTVTIKVVCCSPEKVMDKLCSKGRGSIKLIETI  81



>ref|XP_006393258.1| hypothetical protein EUTSA_v10012208mg [Eutrema salsugineum]
 gb|ESQ30544.1| hypothetical protein EUTSA_v10012208mg [Eutrema salsugineum]
Length=178

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +2

Query  206  PQIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGGVIKSIEIV  340
            PQI+DQ+++++ N V I VVCCSPEK+ ++LC KGGG IK I+ +
Sbjct  33   PQIKDQMFDDKSNTVTIKVVCCSPEKVMEELCKKGGGAIKLIQTI  77



>ref|XP_011004529.1| PREDICTED: neurofilament medium polypeptide-like [Populus euphratica]
Length=270

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 59/75 (79%), Gaps = 0/75 (0%)
 Frame = +2

Query  113  MAPEKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRD  292
            MA +K T M + VDL+C  C+KK+KKV+C+IPQI++Q Y+++  +V ITVVCCSPEKI++
Sbjct  1    MAEKKVTEMVIKVDLECEKCHKKIKKVLCRIPQIQNQTYDKKAGRVTITVVCCSPEKIKE  60

Query  293  KLCYKGGGVIKSIEI  337
            K+  KGG  +K IEI
Sbjct  61   KIICKGGEAVKGIEI  75



>ref|XP_010479376.1| PREDICTED: uncharacterized protein LOC104758247 [Camelina sativa]
Length=190

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +2

Query  206  PQIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGGVIKSIEIV  340
            PQ+RDQ ++E  N V I VVCCSPEK+ DKLC KG G IK IE +
Sbjct  37   PQVRDQKFDEGSNTVTIKVVCCSPEKVMDKLCSKGRGSIKLIETI  81



>gb|KJB57880.1| hypothetical protein B456_009G184500 [Gossypium raimondii]
Length=164

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +2

Query  137  MFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGG  316
            M L+VDL+C  CY KVKKV+C+ P+IRDQ ++E+ N V I VVCC+PEK+RDKL  KGG 
Sbjct  1    MVLTVDLRCRRCYLKVKKVLCEFPEIRDQTFDEKANTVTIIVVCCNPEKVRDKLRCKGGF  60

Query  317  VIKSIEI  337
             I+SIEI
Sbjct  61   SIESIEI  67



>ref|XP_010087650.1| hypothetical protein L484_010601 [Morus notabilis]
 gb|EXB29543.1| hypothetical protein L484_010601 [Morus notabilis]
Length=214

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = +2

Query  131  TVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKG  310
            T M L VDL+C  CYKKVKK++CK PQI+DQ+Y+E++N V I VVCCSPEKI+ K+  KG
Sbjct  9    TTMVLKVDLQCWRCYKKVKKILCKFPQIQDQVYDEKQNTVTIRVVCCSPEKIKRKIICKG  68

Query  311  GGVIKSIEI  337
            G  IKSI++
Sbjct  69   GESIKSIDV  77



>gb|EPS71651.1| hypothetical protein M569_03110, partial [Genlisea aurea]
Length=238

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +2

Query  209  QIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGGVIKSIEIV  340
            +IRDQ+++E   +V ITV CC P++IRDKLC +GG VIKSI IV
Sbjct  1    EIRDQLFDETSGRVTITVWCCDPDRIRDKLCCRGGNVIKSIAIV  44



>ref|XP_007026348.1| Uncharacterized protein TCM_030423 [Theobroma cacao]
 gb|EOY28970.1| Uncharacterized protein TCM_030423 [Theobroma cacao]
Length=161

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = +2

Query  101  QLSAMAPEKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPE  280
            Q   M  +K T M L VDL+C  CY KVKKV+ K+PQIRDQ ++++ N V ITVV C  E
Sbjct  81   QAETMEEKKVTTMELKVDLQCRRCYNKVKKVLSKLPQIRDQRFDKKANTVTITVVSCCLE  140

Query  281  KIRDKLCYKGGG  316
            ++RDKL YKGGG
Sbjct  141  QLRDKLYYKGGG  152



>ref|XP_011004527.1| PREDICTED: uncharacterized protein LOC105110998 isoform X4 [Populus 
euphratica]
Length=190

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 58/84 (69%), Gaps = 1/84 (1%)
 Frame = +2

Query  89   SARSQLSAMAPEKTTVMFLSV-DLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVV  265
            S +S    MA  K T M + V DL C  C+KK+K V+C IPQI++QIY+++EN V ITVV
Sbjct  9    SDQSIHKTMAETKITTMEIKVVDLGCEKCHKKIKTVLCAIPQIQNQIYDKKENTVTITVV  68

Query  266  CCSPEKIRDKLCYKGGGVIKSIEI  337
            CC PEKI+ K+  KGG  +K +EI
Sbjct  69   CCCPEKIKKKIYCKGGRTVKCVEI  92



>ref|XP_010057796.1| PREDICTED: uncharacterized protein LOC104445592 [Eucalyptus grandis]
 gb|KCW75111.1| hypothetical protein EUGRSUZ_E03862 [Eucalyptus grandis]
Length=354

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T M + VD++C  CY+K+KKV+CK PQ++DQIY+E++N V ITVVCCSPEK+R  + 
Sbjct  3    EKVTRMLIKVDMQCPRCYRKIKKVLCKFPQVKDQIYDEKQNTVLITVVCCSPEKVRQMII  62

Query  302  YKGGGVIKSIEIV  340
             +GG  + SIEI+
Sbjct  63   CEGGETVHSIEIL  75



>emb|CBI25755.3| unnamed protein product [Vitis vinifera]
Length=160

 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +2

Query  137  MFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGG  316
            M L VDL C  CY+K+KK++CK P+I+DQ + E+E+ VRI VVCC PEKIR KL  KGG 
Sbjct  1    MVLKVDLGCKRCYRKIKKLLCKFPEIQDQTFIEKEDTVRIKVVCCCPEKIRTKLICKGGH  60

Query  317  VIKSIEIV  340
             IKSIE++
Sbjct  61   SIKSIEVI  68



>ref|XP_011004528.1| PREDICTED: uncharacterized protein LOC105110999 [Populus euphratica]
Length=203

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = +2

Query  113  MAPEKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRD  292
            MA +K T M + VDL+C   +KK+KKV+C+ PQ ++Q Y+++   V ITVVCCSPEKI++
Sbjct  1    MAEKKVTEMVIKVDLECEKSHKKIKKVLCRFPQNQNQTYDKKAGTVTITVVCCSPEKIKE  60

Query  293  KLCYKGGGVIKSIEI  337
            K+  KGG  +KSIEI
Sbjct  61   KIICKGGEAVKSIEI  75



>gb|KJB57879.1| hypothetical protein B456_009G184400 [Gossypium raimondii]
Length=174

 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 54/72 (75%), Gaps = 1/72 (1%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T M L VDL+C  CYKKVK+V+CK PQI+DQIY+E+ N V I VVCC PEK+R K+ 
Sbjct  3    EKVT-MVLKVDLQCRRCYKKVKQVLCKFPQIQDQIYDEKANTVTIKVVCCDPEKLRGKIR  61

Query  302  YKGGGVIKSIEI  337
             KGG  IK IEI
Sbjct  62   CKGGYSIKCIEI  73



>ref|NP_175520.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAG50537.1|AC079828_8 proline-rich protein, putative [Arabidopsis thaliana]
 gb|AAK59602.1| putative proline-rich protein [Arabidopsis thaliana]
 gb|AAL33774.1| putative proline-rich protein [Arabidopsis thaliana]
 gb|AEE32621.1| uncharacterized protein AT1G51090 [Arabidopsis thaliana]
Length=171

 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 53/73 (73%), Gaps = 0/73 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK  +M L VDL CS CYKKVKK I K PQI D++++E+ N + I VVC  PE++ +KLC
Sbjct  3    EKVVMMKLKVDLNCSKCYKKVKKAIRKFPQITDELFDEKSNTIIIKVVCYDPERLMNKLC  62

Query  302  YKGGGVIKSIEIV  340
            YKG G IKSI I+
Sbjct  63   YKGDGSIKSIVIL  75



>ref|XP_010646272.1| PREDICTED: uncharacterized protein LOC104878151 [Vitis vinifera]
 ref|XP_010646273.1| PREDICTED: uncharacterized protein LOC104878151 [Vitis vinifera]
Length=185

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +2

Query  137  MFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGG  316
            M L VDL C  CY+K+KK++CK P+I+DQ + E+E+ VRI VVCC PEKIR KL  KGG 
Sbjct  1    MVLKVDLGCKRCYRKIKKLLCKFPEIQDQTFIEKEDTVRIKVVCCCPEKIRTKLICKGGH  60

Query  317  VIKSIEIV  340
             IKSIE++
Sbjct  61   SIKSIEVI  68



>gb|ABK95097.1| unknown [Populus trichocarpa]
 gb|ABK95808.1| unknown [Populus trichocarpa]
Length=206

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T M + VDL+C  C KK+KKV+CKIPQI +QIY+ +   V ITVV C PEKI++K+C
Sbjct  3    EKVTTMVIRVDLECKKCRKKIKKVLCKIPQIHNQIYDTKACTVTITVVSCCPEKIKNKIC  62

Query  302  YKGGGVIKSIEI  337
             KGG  +K IEI
Sbjct  63   CKGGKAVKCIEI  74



>ref|XP_006306406.1| hypothetical protein CARUB_v10012321mg [Capsella rubella]
 gb|EOA39304.1| hypothetical protein CARUB_v10012321mg [Capsella rubella]
Length=180

 Score = 58.9 bits (141),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  209  QIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGGVIKSIEIV  340
            Q+RD  ++EE N V I VVCCSPEK+ DKLC KG G IK IE +
Sbjct  37   QVRDIKFDEESNTVTIKVVCCSPEKVMDKLCSKGRGAIKLIETI  80



>ref|XP_002322503.1| heavy-metal-associated domain-containing family protein [Populus 
trichocarpa]
 gb|EEF04264.1| heavy-metal-associated domain-containing family protein [Populus 
trichocarpa]
Length=206

 Score = 59.3 bits (142),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T M + VDL+C  C KK+KKV+CKIPQI +QIY+ +   V ITVV C PEKI++K+C
Sbjct  3    EKVTTMVIRVDLECKKCRKKIKKVLCKIPQIHNQIYDTKACTVTITVVSCCPEKIKNKIC  62

Query  302  YKGGGVIKSIEI  337
             KGG  +K IEI
Sbjct  63   CKGGKAVKCIEI  74



>gb|ABK94919.1| unknown [Populus trichocarpa]
Length=206

 Score = 59.3 bits (142),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T M + VDL+C  C KK+KKV+CKIPQI +QIY+ +   V ITVV C PEKI++K+C
Sbjct  3    EKVTTMVIRVDLECKKCRKKIKKVLCKIPQIHNQIYDTKACTVTITVVSCCPEKIKNKIC  62

Query  302  YKGGGVIKSIEI  337
             KGG  +K IEI
Sbjct  63   CKGGKAVKCIEI  74



>ref|XP_011004523.1| PREDICTED: sperm mitochondrial-associated cysteine-rich protein-like 
[Populus euphratica]
Length=192

 Score = 58.9 bits (141),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 56/76 (74%), Gaps = 1/76 (1%)
 Frame = +2

Query  113  MAPEKTTVMFLSV-DLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIR  289
            MA  K T M + V DL C  C+KK+KKV+C IPQI++QIY+++ NKV ITVVCC PEKI+
Sbjct  1    MAETKITTMEIKVVDLGCEKCHKKIKKVLCAIPQIQNQIYDKKANKVTITVVCCCPEKIK  60

Query  290  DKLCYKGGGVIKSIEI  337
             ++  KGG  +K IEI
Sbjct  61   KEIYCKGGKAVKCIEI  76



>ref|XP_011010370.1| PREDICTED: uncharacterized protein LOC105115225 [Populus euphratica]
Length=142

 Score = 58.2 bits (139),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 55/76 (72%), Gaps = 1/76 (1%)
 Frame = +2

Query  113  MAPEKTTVMFLSV-DLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIR  289
            MA  K T M + V DL C  C+KK+K+V+C IPQI++Q Y+++EN V ITVVCC PEKI+
Sbjct  1    MAETKVTTMVIKVVDLGCEKCHKKIKRVLCDIPQIQNQTYDKKENTVTITVVCCCPEKIK  60

Query  290  DKLCYKGGGVIKSIEI  337
             K+  KGG  +K +EI
Sbjct  61   KKIYSKGGPTVKCVEI  76



>emb|CDY51248.1| BnaC03g77720D [Brassica napus]
Length=164

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +2

Query  137  MFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGG  316
            M L+VDL CS CYKK KK I K PQIRD++Y+E+ N + I VVC  PEK+ +KLCYKG  
Sbjct  1    MKLTVDLACSKCYKKAKKAIRKFPQIRDELYDEKTNTIIIKVVCYDPEKLMNKLCYKGDR  60

Query  317  VIKSIEIV  340
             IKSI I+
Sbjct  61   SIKSIVIL  68



>ref|XP_011014663.1| PREDICTED: anthrax toxin receptor-like [Populus euphratica]
Length=175

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 55/76 (72%), Gaps = 1/76 (1%)
 Frame = +2

Query  113  MAPEKTTVMFLSV-DLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIR  289
            MA  K T M + V DL C  C+KK+K+V+C IPQI++Q Y+++EN V ITVVCC PEKI+
Sbjct  1    MAETKVTTMVIKVVDLGCEKCHKKIKRVLCDIPQIQNQTYDKKENTVTITVVCCCPEKIK  60

Query  290  DKLCYKGGGVIKSIEI  337
             K+  KGG  +K +EI
Sbjct  61   KKIYCKGGPTVKCVEI  76



>emb|CDY46563.1| BnaA08g02020D [Brassica napus]
Length=167

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +2

Query  137  MFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGG  316
            M L+VDL CS CYKK KK I K PQIRD++Y+E+ N + I VVC  PEK+ +KLCYKG  
Sbjct  1    MKLTVDLACSKCYKKAKKAIRKFPQIRDELYDEKTNTIIIKVVCYDPEKLMNKLCYKGDR  60

Query  317  VIKSIEIV  340
             IKSI I+
Sbjct  61   SIKSIVIL  68



>ref|XP_011004526.1| PREDICTED: keratinocyte proline-rich protein-like isoform X3 
[Populus euphratica]
Length=204

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 54/75 (72%), Gaps = 0/75 (0%)
 Frame = +2

Query  113  MAPEKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRD  292
            M   + T M + VDL C  C+KK+K+V+C IPQI++QIY+++ N V ITVVCC PEKI+ 
Sbjct  1    MVETEVTTMVIKVDLGCEKCHKKIKRVLCAIPQIQNQIYDKKANTVTITVVCCCPEKIKT  60

Query  293  KLCYKGGGVIKSIEI  337
            K+  KGG  +K IEI
Sbjct  61   KIYCKGGEAVKCIEI  75



>ref|XP_011004531.1| PREDICTED: 104 kDa microneme/rhoptry antigen-like [Populus euphratica]
Length=214

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = +2

Query  113  MAPEKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRD  292
            MA ++ T M + V L+C  C+KK KKV+C+IPQI++QIY+++   V ITVVCCSPEKI++
Sbjct  1    MAEKQVTEMVIKVALECEKCHKKSKKVLCRIPQIQNQIYDKKAGTVTITVVCCSPEKIKE  60

Query  293  KLCYKGGGVIKSIEI  337
            K+  KGG  ++SIEI
Sbjct  61   KIICKGGEAVQSIEI  75



>ref|XP_006380916.1| hypothetical protein POPTR_0006s02010g [Populus trichocarpa]
 gb|ERP58713.1| hypothetical protein POPTR_0006s02010g [Populus trichocarpa]
Length=236

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +2

Query  137  MFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGG  316
            M + VDL+C  C+KK+KKV+C+IPQI++QIY+++   V ITVVCCSPEKI++K+  KGG 
Sbjct  1    MVMKVDLECEKCHKKIKKVLCRIPQIQNQIYDKKAGTVTITVVCCSPEKIKEKIVCKGGE  60

Query  317  VIKSIEI  337
             +KSIEI
Sbjct  61   AVKSIEI  67



>ref|XP_002891615.1| hypothetical protein ARALYDRAFT_892070 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67874.1| hypothetical protein ARALYDRAFT_892070 [Arabidopsis lyrata subsp. 
lyrata]
Length=172

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +2

Query  113  MAPEKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRD  292
            MA +   +M L VDL CS CYKKVKK + K PQI D++++E+ N + I VVC  PE++ +
Sbjct  1    MAEKVVVMMKLKVDLNCSKCYKKVKKALRKFPQITDELFDEKSNTIIIKVVCYDPERLMN  60

Query  293  KLCYKGGGVIKSIEIV  340
            KLCYKG G IKSI I+
Sbjct  61   KLCYKGDGSIKSIVIL  76



>emb|CBI25759.3| unnamed protein product [Vitis vinifera]
Length=107

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = +2

Query  128  TTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLCYK  307
             T+M L VDL C  C KK++K+ICKIP+I++  ++E++N V I VVCC PEKI+ KL  K
Sbjct  4    CTIMVLKVDLGCERCCKKIRKLICKIPEIKEYAFHEKDNAVMIKVVCCCPEKIKTKLICK  63

Query  308  GGGVIKSIEI  337
            GG +I SIE+
Sbjct  64   GGKIIHSIEV  73



>ref|XP_011010372.1| PREDICTED: anthrax toxin receptor-like isoform X2 [Populus euphratica]
Length=192

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 55/76 (72%), Gaps = 1/76 (1%)
 Frame = +2

Query  113  MAPEKTTVMFLSV-DLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIR  289
            MA  K T M + V DL C  C+KK+K+V+C IPQI++Q Y+++EN V ITVVCC PEKI+
Sbjct  1    MAETKVTTMVIKVVDLGCEKCHKKIKRVLCDIPQIQNQTYDKKENTVTITVVCCCPEKIK  60

Query  290  DKLCYKGGGVIKSIEI  337
             K+  KGG  +K +EI
Sbjct  61   KKIYCKGGPTVKCVEI  76



>ref|XP_010052969.1| PREDICTED: uncharacterized protein LOC104441514 [Eucalyptus grandis]
 gb|KCW77125.1| hypothetical protein EUGRSUZ_D01467 [Eucalyptus grandis]
Length=196

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK   M + VDL C  CYKK+KKV+CK P+IRDQIY+E++N+V I+VV C PE+I +K+ 
Sbjct  3    EKKVTMVMRVDLGCYRCYKKIKKVMCKFPEIRDQIYDEKQNRVLISVVSCCPERILEKIA  62

Query  302  YKGGGVIKSIEIV  340
             KGG  ++SI IV
Sbjct  63   SKGGKTVESIGIV  75



>ref|XP_011004525.1| PREDICTED: uncharacterized protein LOC105110998 isoform X2 [Populus 
euphratica]
Length=206

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 57/84 (68%), Gaps = 1/84 (1%)
 Frame = +2

Query  89   SARSQLSAMAPEKTTVMFLSV-DLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVV  265
            S +S    MA  K T M + V DL C  C+KK+K V+C IPQI++Q Y+++EN V ITVV
Sbjct  9    SDQSIHKTMAETKITTMEIKVVDLGCEKCHKKIKTVLCAIPQIQNQTYDKKENTVTITVV  68

Query  266  CCSPEKIRDKLCYKGGGVIKSIEI  337
            CC PEKI+ K+  KGG  +K +EI
Sbjct  69   CCCPEKIKKKIYCKGGRTVKCVEI  92



>ref|XP_011010371.1| PREDICTED: anthrax toxin receptor-like isoform X1 [Populus euphratica]
 ref|XP_011010373.1| PREDICTED: anthrax toxin receptor-like isoform X3 [Populus euphratica]
Length=208

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 55/76 (72%), Gaps = 1/76 (1%)
 Frame = +2

Query  113  MAPEKTTVMFLSV-DLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIR  289
            MA  K T M + V DL C  C+KK+K+V+C IPQI++Q Y+++EN V ITVVCC PEKI+
Sbjct  1    MAETKVTTMVIKVVDLGCEKCHKKIKRVLCDIPQIQNQTYDKKENTVTITVVCCCPEKIK  60

Query  290  DKLCYKGGGVIKSIEI  337
             K+  KGG  +K +EI
Sbjct  61   KKIYCKGGPTVKCVEI  76



>ref|XP_009148212.1| PREDICTED: dnaJ homolog subfamily B member 6 [Brassica rapa]
Length=194

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 32/42 (76%), Gaps = 1/42 (2%)
 Frame = +2

Query  209  QIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGGVIKSIE  334
            QIRDQ +++ E  V I VVCCSPEK+ DKLC KGGG IK IE
Sbjct  37   QIRDQRFDDNET-VTIKVVCCSPEKVADKLCKKGGGAIKKIE  77



>ref|XP_006393083.1| hypothetical protein EUTSA_v10011834mg [Eutrema salsugineum]
 gb|ESQ30369.1| hypothetical protein EUTSA_v10011834mg [Eutrema salsugineum]
Length=163

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            +K  +M L VDL C  CYKKVKK + K PQI D++++E+ N V I VVC +PEK+ +KLC
Sbjct  3    QKVLMMKLKVDLDCPKCYKKVKKALHKFPQITDELFDEKSNTVIIKVVCYNPEKLMNKLC  62

Query  302  YKGGGVIKSIEIV  340
            YK  G IKSI I+
Sbjct  63   YKADGSIKSIVIL  75



>ref|XP_011004524.1| PREDICTED: latent-transforming growth factor beta-binding protein 
4-like isoform X1 [Populus euphratica]
Length=221

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 57/84 (68%), Gaps = 1/84 (1%)
 Frame = +2

Query  89   SARSQLSAMAPEKTTVMFLSV-DLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVV  265
            S +S    MA  K T M + V DL C  C+KK+K V+C IPQI++QIY+++ N V ITVV
Sbjct  9    SDQSIHKTMAETKITTMEIKVVDLGCEKCHKKIKTVLCAIPQIQNQIYDKKANTVTITVV  68

Query  266  CCSPEKIRDKLCYKGGGVIKSIEI  337
            CC PEKI+ K+  KGG  +K IEI
Sbjct  69   CCCPEKIKTKIYCKGGEAVKCIEI  92



>emb|CDY32237.1| BnaA01g17470D [Brassica napus]
Length=221

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  209  QIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGGVIKS  328
            +IRDQ ++E+ N V I VVCCSPE+I DKLC KGGG IK+
Sbjct  40   EIRDQWFDEKSNIVVIKVVCCSPERIMDKLCSKGGGSIKT  79



>ref|XP_006380919.1| hypothetical protein POPTR_0006s02030g [Populus trichocarpa]
 gb|ERP58716.1| hypothetical protein POPTR_0006s02030g [Populus trichocarpa]
Length=147

 Score = 55.5 bits (132),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +2

Query  206  PQIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGGVIKSIEI  337
            PQI++Q Y+++EN V ITVVCC PEKI+ K+  KGG  +K +EI
Sbjct  25   PQIQNQTYDKKENTVTITVVCCCPEKIKKKIYCKGGRTVKCVEI  68



>ref|XP_006380911.1| hypothetical protein POPTR_0006s01980g [Populus trichocarpa]
 gb|ERP58708.1| hypothetical protein POPTR_0006s01980g [Populus trichocarpa]
Length=181

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = +2

Query  128  TTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLCYK  307
            TT++   VDL C  C+KK+KKV+C IPQI++QIY+++ N V I+VVCC PEKI+ K+  K
Sbjct  7    TTMVIKVVDLGCEKCHKKIKKVLCGIPQIQNQIYDKKANTVTISVVCCCPEKIKKKIYCK  66

Query  308  GGGVIKSIEI  337
            GG  +K IEI
Sbjct  67   GGEAVKCIEI  76



>emb|CDY48866.1| BnaA06g03160D [Brassica napus]
Length=210

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 1/42 (2%)
 Frame = +2

Query  209  QIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGGVIKSIE  334
            QIRDQ +++ E  V I VVCCSPEK+ D+LC KGGG IK IE
Sbjct  37   QIRDQRFDDNET-VTIKVVCCSPEKVADELCKKGGGAIKKIE  77



>ref|XP_010039454.1| PREDICTED: uncharacterized protein LOC104428151 [Eucalyptus grandis]
Length=166

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 56/73 (77%), Gaps = 1/73 (1%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T M + VDL+C  CYKK+KKV+CK P+IRDQ+Y+E++N+V I VV C PE+I  K+ 
Sbjct  3    EKVT-MVIRVDLQCYRCYKKIKKVMCKFPEIRDQMYDEKQNRVIIKVVSCCPERILKKIA  61

Query  302  YKGGGVIKSIEIV  340
             KGG  ++SIEIV
Sbjct  62   SKGGKTVESIEIV  74



>ref|XP_010646271.1| PREDICTED: uncharacterized protein LOC104878150 [Vitis vinifera]
Length=129

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +2

Query  206  PQIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGGVIKSIEIV  340
            P+IRDQ +NE+++ V I VVCC+PEKIR KL  KG  +I  IE++
Sbjct  31   PEIRDQTFNEKDDTVIIKVVCCNPEKIRTKLMCKGCKIITCIEVI  75



>gb|KDO64836.1| hypothetical protein CISIN_1g030989mg [Citrus sinensis]
Length=168

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +2

Query  212  IRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGGVIKSIEIV  340
            I+DQ+++E+ N V I VV CSPE IRDKL  KG G IKSIEI+
Sbjct  3    IQDQLFDEKTNTVTIKVVSCSPENIRDKLSCKGEGSIKSIEIL  45



>ref|XP_010479564.1| PREDICTED: LOW QUALITY PROTEIN: cathelicidin-3-like [Camelina 
sativa]
Length=168

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +2

Query  113  MAPEKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRD  292
            MA +   +M L VDL C  CYKK KK I K PQI D++++E+ N + I VVC  PE++ +
Sbjct  1    MADKMVVMMKLKVDLNCPKCYKKAKKAIRKFPQITDEMFDEKSNTILIKVVCYDPERLMN  60

Query  293  KLCYKGGGVIKSIEIV  340
            KLC KG G IKSI I+
Sbjct  61   KLCSKGDGSIKSIVIL  76



>emb|CDY60306.1| BnaUnng00670D [Brassica napus]
Length=190

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  209  QIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGGVIKSIE  334
            QI+DQ +++ E  V I VVCCSPEK+ DKLC  GGG IK IE
Sbjct  37   QIKDQRFDDNET-VTIKVVCCSPEKVADKLCKNGGGAIKKIE  77



>ref|XP_006380910.1| hypothetical protein POPTR_0006s01980g [Populus trichocarpa]
 gb|ERP58707.1| hypothetical protein POPTR_0006s01980g [Populus trichocarpa]
Length=173

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +2

Query  206  PQIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGGVIKSIEI  337
            PQI++QIY+++ N V I+VVCC PEKI+ K+  KGG  +K IEI
Sbjct  25   PQIQNQIYDKKANTVTISVVCCCPEKIKKKIYCKGGEAVKCIEI  68



>ref|XP_003635040.1| PREDICTED: uncharacterized protein LOC100852467 isoform X1 [Vitis 
vinifera]
Length=215

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +2

Query  125  KTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLCY  304
            + T+M L VDL C  C KK++K+ICKIP+I++  ++E++N V I VVCC PEKI+ KL  
Sbjct  3    ECTIMVLKVDLGCERCCKKIRKLICKIPEIKEYAFHEKDNAVMIKVVCCCPEKIKTKLIC  62

Query  305  KGGGVIKSIEI  337
            KGG +I SIE+
Sbjct  63   KGGKIIHSIEV  73



>ref|XP_010087653.1| hypothetical protein L484_010605 [Morus notabilis]
 gb|EXB29546.1| hypothetical protein L484_010605 [Morus notabilis]
Length=209

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +2

Query  209  QIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGGVIKSIEI  337
            QI+DQ+Y+E+ N V I VVCCSPEKI+ K+  KGG  IKSI I
Sbjct  31   QIQDQVYDEKNNTVTIKVVCCSPEKIKQKIICKGGDTIKSIVI  73



>ref|XP_010057803.1| PREDICTED: uncharacterized protein LOC104445598 [Eucalyptus grandis]
 gb|KCW75120.1| hypothetical protein EUGRSUZ_E03871 [Eucalyptus grandis]
Length=114

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +2

Query  209  QIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGGVIKSIEIV  340
             IRD+IYNE++N V I+V CCSPEKI+ K+  KGG  ++S+EI+
Sbjct  31   HIRDRIYNEKQNTVLISV-CCSPEKIKRKIICKGGKTVQSVEIL  73



>ref|XP_010057799.1| PREDICTED: uncharacterized protein LOC104445596 [Eucalyptus grandis]
Length=222

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            E+ T M + VDL+C  C KK+KK++C+IPQ++D I++E++NKV+I VV C PEK+R K+C
Sbjct  3    EQVTEMVIKVDLQCCRCSKKIKKILCEIPQVKDLIFDEKQNKVKIKVVGCDPEKVRQKIC  62

Query  302  YKGGGVIKSIEIV  340
             KG   I  ++I+
Sbjct  63   CKGRDFILGVDII  75



>ref|XP_010501952.1| PREDICTED: embryonal Fyn-associated substrate-like [Camelina 
sativa]
Length=201

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +2

Query  113  MAPEKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRD  292
            MA +   +M L VDL C  CYKK KK I K PQI D++++E+ N + I VVC  PE++ +
Sbjct  1    MADKMVVMMKLKVDLNCPKCYKKAKKAIRKFPQITDEMFDEKSNTILIKVVCYDPERLMN  60

Query  293  KLCYKGGGVIKSIEIV  340
            KLC KG G IKSI I+
Sbjct  61   KLCSKGDGSIKSIVIL  76



>ref|XP_009136759.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1 [Brassica rapa]
Length=252

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T+M L VDL+C+ CYKKVKKV+CK PQIRDQ+++E+ N V       +  +I DKLC
Sbjct  7    EKVTMMKLKVDLECAKCYKKVKKVLCKFPQIRDQLFDEKSNIVSSRWFAAALRRIMDKLC  66

Query  302  YKGGGVIKSIEIV  340
             KGGG IK+IEIV
Sbjct  67   SKGGGSIKTIEIV  79



>emb|CAN60751.1| hypothetical protein VITISV_044288 [Vitis vinifera]
Length=633

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = +2

Query  131  TVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKG  310
            T+M L VDL C  C KK++K+ICKIP+I++  ++E++N V I VVCC PEKI+ KL  KG
Sbjct  437  TIMVLKVDLGCERCCKKIRKLICKIPEIKEYAFHEKDNAVMIKVVCCCPEKIKTKLICKG  496

Query  311  GGVIKSIEI  337
            G +I SIE+
Sbjct  497  GKIIHSIEV  505



>ref|XP_010087652.1| hypothetical protein L484_010604 [Morus notabilis]
 gb|EXB29545.1| hypothetical protein L484_010604 [Morus notabilis]
Length=325

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 54/71 (76%), Gaps = 1/71 (1%)
 Frame = +2

Query  128  TTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVV-CCSPEKIRDKLCY  304
             T+M L V+L+C  CY+KVKKV+C  PQI+DQ+Y+E++N V I VV CC PEK++ K+  
Sbjct  4    ATIMVLKVNLQCHECYRKVKKVLCSFPQIQDQVYDEKQNTVTIKVVCCCDPEKMKQKILC  63

Query  305  KGGGVIKSIEI  337
            KG  VIKSIEI
Sbjct  64   KGKAVIKSIEI  74



>ref|XP_006380914.1| hypothetical protein POPTR_0006s02000g [Populus trichocarpa]
 gb|ERP58711.1| hypothetical protein POPTR_0006s02000g [Populus trichocarpa]
Length=197

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  113  MAPEKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRD  292
            MA +K T+M + VDL+C  C+KK+KKV+C+IPQI++QIY+++   V ITVVCCSPEKI++
Sbjct  1    MAEKKVTIMVIKVDLECKKCHKKIKKVLCRIPQIQNQIYDKKAGTVTITVVCCSPEKIKE  60

Query  293  KL  298
            K+
Sbjct  61   KI  62



>emb|CBI35729.3| unnamed protein product [Vitis vinifera]
Length=108

 Score = 52.0 bits (123),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +2

Query  206  PQIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGGVIKSIEIV  340
            P+IRDQ +NE+++ V I VVCC+PEKIR +L  KG  +I  IE++
Sbjct  25   PEIRDQTFNEKDDTVIIKVVCCNPEKIRKELMCKGRDIIIRIEVI  69



>ref|XP_010052967.1| PREDICTED: uncharacterized protein LOC104441509 [Eucalyptus grandis]
Length=169

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T M + VDL+C  CYKK+KKV+CK P+I+DQ+Y+E++N V I VV C PE+I  K+ 
Sbjct  3    EKVT-MVIRVDLQCYRCYKKIKKVMCKFPEIQDQMYDEKQNTVTIKVVSCCPERILKKIA  61

Query  302  YKGGGVIKSIEIV  340
             KGG  ++SIEIV
Sbjct  62   SKGGKTVESIEIV  74



>ref|XP_010252760.1| PREDICTED: extensin-like [Nelumbo nucifera]
Length=233

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 49/72 (68%), Gaps = 1/72 (1%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK + M L VDL C  CYKK+KK + K P+IRDQI++E++NKV IT   C P K+  KLC
Sbjct  3    EKVSTMVLHVDLGCPRCYKKIKKALSKFPEIRDQIFDEKQNKVTITGYFC-PHKLAKKLC  61

Query  302  YKGGGVIKSIEI  337
             K G  I+S EI
Sbjct  62   CKAGKSIRSYEI  73



>ref|XP_006380926.1| hypothetical protein POPTR_0006s02060g [Populus trichocarpa]
 gb|ERP58723.1| hypothetical protein POPTR_0006s02060g [Populus trichocarpa]
Length=185

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +2

Query  206  PQIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGGVIKSIEI  337
            PQI++Q Y+++ N V ITVVCC PEKI+ K+  KGG  +K +EI
Sbjct  25   PQIQNQTYDKKANTVTITVVCCCPEKIKKKIYSKGGRTVKCVEI  68



>ref|XP_010042953.1| PREDICTED: cyclic nucleotide-gated cation channel beta-1-like, 
partial [Eucalyptus grandis]
Length=190

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +2

Query  206  PQIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGGVIKSIEIV  340
            P+IRDQ Y+E++N+V I+VV C PE+I +K+  KGG  ++SI+IV
Sbjct  24   PEIRDQRYDEKQNRVLISVVSCCPERILEKIASKGGKTVESIKIV  68



>gb|KCW75114.1| hypothetical protein EUGRSUZ_E03865 [Eucalyptus grandis]
Length=359

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +2

Query  125  KTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLCY  304
            + T M + VDL+C  CYKK++K++C+IPQ++D+I++E++NKV+I VV C PEK+R K+C 
Sbjct  3    QVTEMMIKVDLQCCRCYKKIRKILCEIPQVKDRIFDEKQNKVKIKVVGCDPEKVRQKICC  62

Query  305  KGGGVIKSIEIV  340
            KG   I  ++I+
Sbjct  63   KGRDFILGVDII  74



>ref|XP_010647322.1| PREDICTED: acrosin-like [Vitis vinifera]
Length=157

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +2

Query  206  PQIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGGVIKSIEIV  340
            P+IRDQ +NE+++ V I VVCC+PEKIR +L  KG  +I  IE++
Sbjct  31   PEIRDQTFNEKDDTVIIKVVCCNPEKIRKELMCKGRDIIIRIEVI  75



>ref|XP_006380918.1| hypothetical protein POPTR_0006s02030g [Populus trichocarpa]
 gb|ERP58715.1| hypothetical protein POPTR_0006s02030g [Populus trichocarpa]
Length=144

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +2

Query  209  QIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGGVIKSIEI  337
            +I++Q Y+++EN V ITVVCC PEKI+ K+  KGG  +K +EI
Sbjct  23   EIQNQTYDKKENTVTITVVCCCPEKIKKKIYCKGGRTVKCVEI  65



>ref|XP_002308818.2| hypothetical protein POPTR_0006s02080g [Populus trichocarpa]
 gb|EEE92341.2| hypothetical protein POPTR_0006s02080g [Populus trichocarpa]
Length=143

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +2

Query  128  TTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLCYK  307
            TT+    VDL C  C+KK+K+V+C IPQI++Q Y E+EN V ITVV C PEKI+ K+  K
Sbjct  7    TTMEIKVVDLGCEKCHKKIKRVLCAIPQIQNQEYVEKENTVTITVVGCCPEKIKKKIYCK  66

Query  308  GGGVIKSIEIV  340
            GG  +K IEI+
Sbjct  67   GGPTVKCIEII  77



>ref|XP_010646276.1| PREDICTED: sulfated surface glycoprotein 185-like isoform X2 
[Vitis vinifera]
Length=209

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +2

Query  137  MFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGG  316
            M L VDL C  C KK++K+ICKIP+I++  ++E++N V I VVCC PEKI+ KL  KGG 
Sbjct  1    MVLKVDLGCERCCKKIRKLICKIPEIKEYAFHEKDNAVMIKVVCCCPEKIKTKLICKGGK  60

Query  317  VIKSIEI  337
            +I SIE+
Sbjct  61   IIHSIEV  67



>ref|XP_006380925.1| hypothetical protein POPTR_0006s02050g [Populus trichocarpa]
 gb|ERP58722.1| hypothetical protein POPTR_0006s02050g [Populus trichocarpa]
Length=165

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = +2

Query  128  TTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLCYK  307
            TT++   VDL C  C+KK+KKV+C IPQI++Q Y+++EN V ITVV C PEKI+ K+  K
Sbjct  4    TTMVIKVVDLGCEKCHKKIKKVLCGIPQIQNQTYDKKENTVTITVVGCCPEKIKKKIYSK  63

Query  308  GGGVIKSIEI  337
            GG  +K +EI
Sbjct  64   GGRTVKCVEI  73



>ref|XP_006380920.1| hypothetical protein POPTR_0006s02030g [Populus trichocarpa]
 gb|ERP58717.1| hypothetical protein POPTR_0006s02030g [Populus trichocarpa]
Length=149

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +2

Query  209  QIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGGVIKSIEI  337
            +I++Q Y+++EN V ITVVCC PEKI+ K+  KGG  +K +EI
Sbjct  28   EIQNQTYDKKENTVTITVVCCCPEKIKKKIYCKGGRTVKCVEI  70



>ref|XP_006380928.1| hypothetical protein POPTR_0006s02090g [Populus trichocarpa]
 gb|ERP58725.1| hypothetical protein POPTR_0006s02090g [Populus trichocarpa]
Length=174

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = +2

Query  128  TTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLCYK  307
            TT++   VDL C  C+KK+KKV+C IPQI++Q Y+++EN V ITVV C PEKI+ K+  K
Sbjct  7    TTMVIKVVDLGCEKCHKKIKKVLCGIPQIQNQTYDKKENTVTITVVGCCPEKIKKKIYSK  66

Query  308  GGGVIKSIEI  337
            GG  +K +EI
Sbjct  67   GGRTVKCVEI  76



>ref|XP_006380917.1| hypothetical protein POPTR_0006s02020g [Populus trichocarpa]
 gb|ERP58714.1| hypothetical protein POPTR_0006s02020g [Populus trichocarpa]
Length=186

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 53/76 (70%), Gaps = 1/76 (1%)
 Frame = +2

Query  113  MAPEKTTVMFLSV-DLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIR  289
            M  +K T M + V DL C  C+KK+K+V+C IPQI++Q Y++++N V ITVVCC PEKI 
Sbjct  1    MVEKKVTTMVIKVVDLGCEKCHKKIKRVLCAIPQIQNQTYDKKKNTVTITVVCCCPEKIM  60

Query  290  DKLCYKGGGVIKSIEI  337
             K+  KGG  +K I I
Sbjct  61   KKIYCKGGRTVKCIVI  76



>emb|CBI25758.3| unnamed protein product [Vitis vinifera]
Length=95

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  206  PQIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGGVI  322
            P+IRDQ +NE+++ V I VVCC+PEKIR KL  KG  +I
Sbjct  25   PEIRDQTFNEKDDTVIIKVVCCNPEKIRTKLMCKGCKII  63



>ref|XP_010647603.1| PREDICTED: uncharacterized protein LOC104878696 [Vitis vinifera]
Length=175

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  206  PQIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGGVIKSIEIV  340
            P+IRDQ + E+E+ V I VVC  PE IR KL YKG   IKSIE++
Sbjct  31   PEIRDQTFIEKEDTVIIKVVCSYPEMIRTKLFYKGSDTIKSIEVI  75



>ref|XP_011040171.1| PREDICTED: sulfated surface glycoprotein 185-like [Populus euphratica]
Length=201

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            EK T M + VDL+C  C KK+KKV+CKIP+I +QIY+ +   V ITVV C PE+I+ K+ 
Sbjct  3    EKVTTMVIRVDLECKKCRKKIKKVLCKIPEIHNQIYDTKACTVTITVVSCCPEEIKKKIW  62

Query  302  YKGGGVIKSIEI  337
             KGG  +K IEI
Sbjct  63   CKGGKAVKGIEI  74



>ref|XP_007026356.1| Uncharacterized protein TCM_030429 [Theobroma cacao]
 gb|EOY28978.1| Uncharacterized protein TCM_030429 [Theobroma cacao]
Length=278

 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +2

Query  137  MFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGG  316
            M L VDL+C  CYKKVKKV+CK P+IRDQ Y+++ N V I+VV  +PE IR K+C K G 
Sbjct  1    MVLKVDLQCYRCYKKVKKVLCKFPEIRDQKYDDKANTVTISVVSRNPESIRSKICDKAGC  60

Query  317  VIKSIEI  337
             IKSIEI
Sbjct  61   CIKSIEI  67



>ref|XP_006380908.1| hypothetical protein POPTR_0006s01980g [Populus trichocarpa]
 gb|ERP58705.1| hypothetical protein POPTR_0006s01980g [Populus trichocarpa]
Length=165

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +2

Query  209  QIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGGVIKSIEI  337
            +I++QIY+++ N V I+VVCC PEKI+ K+  KGG  +K IEI
Sbjct  18   EIQNQIYDKKANTVTISVVCCCPEKIKKKIYCKGGEAVKCIEI  60



>ref|XP_010270224.1| PREDICTED: cornifin-B-like [Nelumbo nucifera]
Length=217

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            +K + + L VDL C  CYKK+KK +CK P+IRDQ+++E++NKV I    C P+K   KLC
Sbjct  3    QKVSTIVLEVDLGCPHCYKKIKKTLCKFPEIRDQVFDEKQNKVTIIGYLCCPDKFIRKLC  62

Query  302  YKGGGVIKSIEI  337
             K G  IKS EI
Sbjct  63   CKAGKCIKSYEI  74



>ref|XP_006380909.1| hypothetical protein POPTR_0006s01980g [Populus trichocarpa]
 gb|ERP58706.1| hypothetical protein POPTR_0006s01980g [Populus trichocarpa]
Length=170

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +2

Query  209  QIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGGVIKSIEI  337
            +I++QIY+++ N V I+VVCC PEKI+ K+  KGG  +K IEI
Sbjct  23   EIQNQIYDKKANTVTISVVCCCPEKIKKKIYCKGGEAVKCIEI  65



>ref|XP_002522884.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39484.1| conserved hypothetical protein [Ricinus communis]
Length=274

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = +2

Query  113  MAPEKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRD  292
            MA +K T+M + VDL C  C KK+KK++C IPQI++QIY+E+ N V ITVVCCSPEKI+ 
Sbjct  1    MADKKVTIMVIKVDLGCEKCKKKIKKILCNIPQIQNQIYDEKANTVTITVVCCSPEKIKK  60

Query  293  KLCYKGGGVIKSIEI  337
            K+C KGG  IK IEI
Sbjct  61   KICCKGGDTIKGIEI  75



>gb|KCW75117.1| hypothetical protein EUGRSUZ_E03868 [Eucalyptus grandis]
Length=225

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +2

Query  137  MFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGG  316
            M + VDL+C  CYKK+KK++C+IPQ++D  ++E++N V+I VV C PE +R K+C KGG 
Sbjct  1    MAIKVDLQCRRCYKKIKKILCEIPQVKDTTFDEKQNTVKIKVVGCDPEMVRRKICCKGGD  60

Query  317  VIKSIEIV  340
            +I SI I+
Sbjct  61   IILSINII  68



>ref|XP_006380930.1| hypothetical protein POPTR_0006s02130g [Populus trichocarpa]
 gb|ERP58727.1| hypothetical protein POPTR_0006s02130g [Populus trichocarpa]
Length=187

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 53/76 (70%), Gaps = 1/76 (1%)
 Frame = +2

Query  113  MAPEKTTVMFLSV-DLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIR  289
            M   K T M + V DL C  C+KK+K+V+C IPQI++Q Y+++EN V ITVV C PEKI+
Sbjct  1    MVETKVTEMVIKVVDLGCEKCHKKIKRVLCAIPQIQNQTYDKKENTVTITVVGCCPEKIK  60

Query  290  DKLCYKGGGVIKSIEI  337
             K+  KGG  +K +EI
Sbjct  61   KKIYCKGGRTVKCVEI  76



>ref|XP_006380929.1| hypothetical protein POPTR_0006s02110g [Populus trichocarpa]
 gb|ERP58726.1| hypothetical protein POPTR_0006s02110g [Populus trichocarpa]
Length=199

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +2

Query  206  PQIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGGVIKSIEI  337
            PQI++QIY++++N V+ITVV C PEKI+ K+  KGG  +K I I
Sbjct  33   PQIQNQIYDKKKNTVKITVVGCCPEKIKKKIYCKGGPTVKCIVI  76



>gb|KDP35494.1| hypothetical protein JCGZ_08932 [Jatropha curcas]
Length=186

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +2

Query  137  MFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGG  316
            M + VDL C  C KK+KK++CKIPQI++Q+ +E+   V ITVVCCSPEKI+ K+   GG 
Sbjct  1    MVIKVDLDCERCRKKIKKILCKIPQIQNQVIDEKAKTVTITVVCCSPEKIKKKIFRMGGA  60

Query  317  VIKSIEIV  340
             ++ IEI+
Sbjct  61   SVECIEIL  68



>gb|KCW77121.1| hypothetical protein EUGRSUZ_D014612, partial [Eucalyptus grandis]
Length=138

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +2

Query  212  IRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGGVIKSIEIV  340
            I+DQ+Y+E++N V I VV C PE+I  K+  KGG  ++SIEIV
Sbjct  1    IQDQMYDEKQNTVTIKVVSCCPERILKKIASKGGKTVESIEIV  43



>ref|XP_010042466.1| PREDICTED: sodium/potassium/calcium exchanger 1-like, partial 
[Eucalyptus grandis]
Length=187

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +2

Query  212  IRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGGVIKSIEIV  340
            IRDQ Y+E++N+V I+VV C PE+I +K+  KGG  ++SI+IV
Sbjct  1    IRDQRYDEKQNRVLISVVSCCPERILEKIASKGGKTVESIKIV  43



>ref|XP_011010374.1| PREDICTED: uncharacterized protein LOC105115227 [Populus euphratica]
Length=179

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +2

Query  128  TTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLCYK  307
            TT++   VDL C  C+KK+K+V+C IPQI++Q Y+ ++N V ITVV C PEKI+ K+  K
Sbjct  7    TTMVIKVVDLGCEKCHKKIKRVLCDIPQIQNQTYDTKKNTVTITVVGCCPEKIKKKIYCK  66

Query  308  GGGVIKSIEIV  340
            GG  +K +EI+
Sbjct  67   GGRTVKCVEIL  77



>gb|KDP35497.1| hypothetical protein JCGZ_08935 [Jatropha curcas]
Length=185

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = +2

Query  137  MFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGG  316
            M + VDL C  C +K+KK++CKIPQI +Q+ +E+   V +TVVCCSPEKI+ K+   GG 
Sbjct  1    MVIKVDLDCERCRQKIKKILCKIPQIENQVIDEKAKTVTVTVVCCSPEKIKKKILRMGGA  60

Query  317  VIKSIEIV  340
             ++ IEI+
Sbjct  61   SVECIEIL  68



>gb|KJB57881.1| hypothetical protein B456_009G184600 [Gossypium raimondii]
Length=154

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = +2

Query  209  QIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGGVIKSIEI  337
              R  I  E ++     VVCC+PEK+RDKL  KGGG IKSIEI
Sbjct  15   NTRPDIPREGQHGDHHGVVCCNPEKLRDKLWCKGGGSIKSIEI  57



>ref|XP_006380906.1| hypothetical protein POPTR_0006s01940g [Populus trichocarpa]
 gb|ERP58703.1| hypothetical protein POPTR_0006s01940g [Populus trichocarpa]
Length=103

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +2

Query  113  MAPEKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRD  292
            M   K T M + VDL C  C+KK+KKV+C IPQI++Q ++++ N V ITVVCC PEKI  
Sbjct  1    MVETKVTTMVIKVDLGCEKCHKKIKKVLCGIPQIQNQTFDKKANTVTITVVCCCPEKIMK  60

Query  293  KL  298
            K+
Sbjct  61   KI  62



>gb|KCW75121.1| hypothetical protein EUGRSUZ_E03872 [Eucalyptus grandis]
Length=277

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = +2

Query  122  EKTTVMFLSVDLkcsscykkvkkvickiPQIRDQIYNEEENKVRITVVCCSPEKIRDKLC  301
            E+ T M + VDL+C  CYKK++K++  IPQ++D  ++E++N V+I VV C P+K+R K+C
Sbjct  3    EQVTEMVIKVDLQCCRCYKKIRKILSDIPQVKDPTFDEKKNTVKIKVVGCDPKKVRQKIC  62

Query  302  YKGGGVIKSIEIV  340
             KG   I  I+++
Sbjct  63   CKGKDFILGIDVL  75



>ref|XP_006380907.1| hypothetical protein POPTR_0006s01960g [Populus trichocarpa]
 gb|ERP58704.1| hypothetical protein POPTR_0006s01960g [Populus trichocarpa]
Length=176

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +2

Query  209  QIRDQIYNEEENKVRITVVCCSPEKIRDKLCYKGGGVIKSIEI  337
            QI++QIY+++EN V IT+V C PEKI+ K+  KGG  +K IEI
Sbjct  26   QIQNQIYDKKENTVTITLVGCCPEKIKTKIYCKGGEAVKCIEI  68



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 802174409370