BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001F18

Length=547
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009382381.1|  PREDICTED: remorin-like                          72.0    2e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009408139.1|  PREDICTED: remorin                               68.9    2e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009778200.1|  PREDICTED: remorin-like isoform X2               68.6    4e-11   Nicotiana sylvestris
ref|XP_009778199.1|  PREDICTED: remorin-like isoform X1               68.6    4e-11   Nicotiana sylvestris
emb|CDP05208.1|  unnamed protein product                              67.4    8e-11   Coffea canephora [robusta coffee]
ref|XP_011084412.1|  PREDICTED: remorin-like                          66.6    1e-10   Sesamum indicum [beniseed]
ref|XP_010934733.1|  PREDICTED: remorin                               66.6    2e-10   Elaeis guineensis
ref|XP_009590953.1|  PREDICTED: remorin-like                          66.6    2e-10   Nicotiana tomentosiformis
ref|XP_006827693.1|  hypothetical protein AMTR_s00009p00257810        66.2    2e-10   Amborella trichopoda
ref|XP_002267609.1|  PREDICTED: remorin                               66.2    2e-10   Vitis vinifera
ref|NP_001274989.1|  remorin                                          65.9    3e-10   Solanum tuberosum [potatoes]
ref|XP_003580217.1|  PREDICTED: remorin-like                          65.9    3e-10   Brachypodium distachyon [annual false brome]
ref|XP_009340014.1|  PREDICTED: remorin-like                          65.9    3e-10   Pyrus x bretschneideri [bai li]
ref|XP_003638357.1|  Remorin                                          65.5    4e-10   
ref|XP_008806887.1|  PREDICTED: remorin                               66.2    4e-10   Phoenix dactylifera
gb|KHG20032.1|  Remorin                                               64.7    7e-10   Gossypium arboreum [tree cotton]
ref|XP_008376569.1|  PREDICTED: remorin-like                          64.7    8e-10   
ref|XP_009371326.1|  PREDICTED: remorin-like                          64.3    9e-10   Pyrus x bretschneideri [bai li]
gb|KJB37243.1|  hypothetical protein B456_006G197800                  64.3    9e-10   Gossypium raimondii
gb|KJB23871.1|  hypothetical protein B456_004G118800                  64.3    1e-09   Gossypium raimondii
ref|XP_010107439.1|  hypothetical protein L484_015780                 64.3    1e-09   Morus notabilis
ref|XP_008377354.1|  PREDICTED: remorin-like isoform X2               64.3    1e-09   Malus domestica [apple tree]
gb|KJB23872.1|  hypothetical protein B456_004G118800                  63.9    1e-09   Gossypium raimondii
ref|XP_002448229.1|  hypothetical protein SORBIDRAFT_06g023630        64.3    1e-09   Sorghum bicolor [broomcorn]
gb|KJB23873.1|  hypothetical protein B456_004G118800                  63.9    1e-09   Gossypium raimondii
ref|XP_008465865.1|  PREDICTED: remorin                               63.9    1e-09   Cucumis melo [Oriental melon]
ref|NP_001053409.1|  Os04g0533300                                     63.9    1e-09   
gb|KHG21181.1|  Remorin                                               63.5    2e-09   Gossypium arboreum [tree cotton]
gb|AGB07445.1|  remorin                                               63.5    2e-09   Morus indica
ref|XP_009349347.1|  PREDICTED: remorin-like                          63.5    2e-09   Pyrus x bretschneideri [bai li]
gb|AII99828.1|  remorin 1                                             63.5    2e-09   Nicotiana tabacum [American tobacco]
ref|XP_009770981.1|  PREDICTED: remorin-like                          62.8    2e-09   Nicotiana sylvestris
ref|NP_001159012.1|  remorin                                          63.2    3e-09   Zea mays [maize]
ref|XP_008794544.1|  PREDICTED: remorin-like                          62.4    4e-09   Phoenix dactylifera
ref|NP_001274955.1|  putative remorin a3b4                            62.4    5e-09   Solanum tuberosum [potatoes]
ref|NP_197764.1|  Remorin family protein                              62.0    5e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002322467.1|  remorin family protein                           62.0    6e-09   Populus trichocarpa [western balsam poplar]
ref|XP_004148376.1|  PREDICTED: remorin-like                          61.6    6e-09   
ref|NP_974824.1|  Remorin family protein                              62.0    6e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006421909.1|  hypothetical protein CICLE_v10005899mg           62.0    7e-09   Citrus clementina [clementine]
ref|NP_001234231.1|  remorin 1                                        61.6    7e-09   Solanum lycopersicum
ref|XP_004165762.1|  PREDICTED: remorin-like                          61.6    8e-09   
ref|XP_007152285.1|  hypothetical protein PHAVU_004G116700g           61.6    8e-09   Phaseolus vulgaris [French bean]
gb|AAM63910.1|  remorin                                               61.6    9e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004240737.1|  PREDICTED: remorin                               61.2    1e-08   Solanum lycopersicum
emb|CDY69344.1|  BnaAnng30100D                                        60.5    1e-08   Brassica napus [oilseed rape]
ref|XP_002511833.1|  Remorin, putative                                60.8    1e-08   Ricinus communis
gb|EYU25090.1|  hypothetical protein MIMGU_mgv1a014261mg              60.8    1e-08   Erythranthe guttata [common monkey flower]
ref|XP_006490378.1|  PREDICTED: remorin-like                          61.2    1e-08   Citrus sinensis [apfelsine]
gb|EYU25089.1|  hypothetical protein MIMGU_mgv1a014261mg              60.8    1e-08   Erythranthe guttata [common monkey flower]
ref|XP_006363315.1|  PREDICTED: remorin                               60.8    1e-08   
gb|KDP22286.1|  hypothetical protein JCGZ_26117                       60.8    1e-08   Jatropha curcas
gb|KJB23874.1|  hypothetical protein B456_004G118800                  60.8    2e-08   Gossypium raimondii
ref|XP_007038675.1|  Remorin family protein                           62.8    2e-08   
gb|AGR88905.1|  remorin 1                                             60.8    2e-08   Datisca glomerata
ref|NP_001275297.1|  putative remorin a4-e8                           60.5    2e-08   Solanum tuberosum [potatoes]
ref|XP_011023368.1|  PREDICTED: remorin-like                          60.5    2e-08   Populus euphratica
ref|XP_008439225.1|  PREDICTED: remorin-like                          60.5    2e-08   Cucumis melo [Oriental melon]
ref|XP_009141722.1|  PREDICTED: remorin-like isoform X1               60.5    2e-08   Brassica rapa
emb|CDX87157.1|  BnaC09g04720D                                        60.5    2e-08   
ref|XP_009141736.1|  PREDICTED: remorin-like isoform X2               60.5    2e-08   Brassica rapa
gb|KJB23875.1|  hypothetical protein B456_004G118800                  60.1    2e-08   Gossypium raimondii
ref|NP_001236279.1|  uncharacterized protein LOC100305501             60.1    2e-08   Glycine max [soybeans]
ref|XP_006652568.1|  PREDICTED: remorin-like                          60.1    3e-08   Oryza brachyantha
ref|XP_006394639.1|  hypothetical protein EUTSA_v10004940mg           60.1    3e-08   Eutrema salsugineum [saltwater cress]
emb|CAD29780.1|  putative remorin 1 protein                           60.1    3e-08   Oryza sativa [red rice]
ref|XP_009150904.1|  PREDICTED: remorin-like                          60.1    3e-08   Brassica rapa
dbj|BAJ90231.1|  predicted protein                                    60.1    4e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010519484.1|  PREDICTED: remorin-like isoform X1               59.7    4e-08   Tarenaya hassleriana [spider flower]
ref|XP_011048713.1|  PREDICTED: remorin isoform X2                    59.7    4e-08   Populus euphratica
gb|EMT30253.1|  hypothetical protein F775_30825                       60.1    4e-08   
ref|XP_002302576.1|  DNA-binding family protein                       59.7    4e-08   Populus trichocarpa [western balsam poplar]
ref|XP_011048714.1|  PREDICTED: remorin isoform X3                    59.7    4e-08   Populus euphratica
ref|XP_011048712.1|  PREDICTED: remorin isoform X1                    59.3    5e-08   Populus euphratica
ref|XP_010421184.1|  PREDICTED: remorin-like                          59.7    5e-08   Camelina sativa [gold-of-pleasure]
ref|XP_006288585.1|  hypothetical protein CARUB_v10001880mg           59.7    5e-08   Capsella rubella
ref|XP_011076174.1|  PREDICTED: remorin-like                          59.3    5e-08   Sesamum indicum [beniseed]
ref|XP_009409422.1|  PREDICTED: remorin-like                          59.3    5e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010550763.1|  PREDICTED: remorin-like isoform X2               59.3    6e-08   Tarenaya hassleriana [spider flower]
ref|XP_010550762.1|  PREDICTED: remorin-like isoform X1               59.3    6e-08   Tarenaya hassleriana [spider flower]
ref|XP_003556104.1|  PREDICTED: remorin-like                          59.3    6e-08   Glycine max [soybeans]
gb|AFK45936.1|  unknown                                               59.3    6e-08   Lotus japonicus
ref|XP_010454663.1|  PREDICTED: remorin-like                          59.3    6e-08   Camelina sativa [gold-of-pleasure]
gb|AFK41243.1|  unknown                                               59.3    7e-08   Lotus japonicus
ref|XP_007218390.1|  hypothetical protein PRUPE_ppa011367mg           59.3    7e-08   Prunus persica
ref|XP_008234255.1|  PREDICTED: remorin-like                          59.3    7e-08   Prunus mume [ume]
ref|XP_002320784.1|  DNA-binding family protein                       58.5    1e-07   Populus trichocarpa [western balsam poplar]
ref|XP_011035931.1|  PREDICTED: remorin                               58.5    1e-07   Populus euphratica
gb|KDO60012.1|  hypothetical protein CISIN_1g028549mg                 58.5    1e-07   Citrus sinensis [apfelsine]
ref|XP_008661880.1|  PREDICTED: remorin isoform X1                    58.2    1e-07   Zea mays [maize]
ref|XP_008438060.1|  PREDICTED: uncharacterized protein At3g61260     58.2    1e-07   Cucumis melo [Oriental melon]
ref|XP_010055168.1|  PREDICTED: remorin-like                          57.8    1e-07   Eucalyptus grandis [rose gum]
ref|XP_002874146.1|  hypothetical protein ARALYDRAFT_489237           57.8    2e-07   
gb|KDP28652.1|  hypothetical protein JCGZ_14423                       57.4    2e-07   Jatropha curcas
ref|XP_011030102.1|  PREDICTED: remorin-like isoform X1               57.4    3e-07   Populus euphratica
ref|XP_011030103.1|  PREDICTED: remorin-like isoform X2               57.4    3e-07   Populus euphratica
ref|XP_004510806.1|  PREDICTED: remorin-like                          57.0    3e-07   Cicer arietinum [garbanzo]
ref|NP_001147227.1|  remorin                                          57.0    4e-07   Zea mays [maize]
ref|XP_010493498.1|  PREDICTED: remorin-like                          57.0    4e-07   
gb|EYU19543.1|  hypothetical protein MIMGU_mgv1a014270mg              56.6    4e-07   Erythranthe guttata [common monkey flower]
ref|XP_002510796.1|  Remorin, putative                                56.2    5e-07   
gb|ABK23302.1|  unknown                                               56.6    5e-07   Picea sitchensis
ref|XP_007143402.1|  hypothetical protein PHAVU_007G069500g           56.2    6e-07   Phaseolus vulgaris [French bean]
ref|XP_004140777.1|  PREDICTED: remorin-like                          56.6    6e-07   Cucumis sativus [cucumbers]
ref|XP_010273101.1|  PREDICTED: remorin-like                          56.2    7e-07   Nelumbo nucifera [Indian lotus]
ref|XP_007135038.1|  hypothetical protein PHAVU_010G096300g           56.2    8e-07   Phaseolus vulgaris [French bean]
ref|XP_004133871.1|  PREDICTED: uncharacterized protein At3g61260...  55.8    8e-07   Cucumis sativus [cucumbers]
ref|XP_002318224.2|  remorin family protein                           55.8    9e-07   Populus trichocarpa [western balsam poplar]
gb|KDO86097.1|  hypothetical protein CISIN_1g028704mg                 55.5    9e-07   Citrus sinensis [apfelsine]
ref|XP_011091944.1|  PREDICTED: remorin-like                          55.5    1e-06   Sesamum indicum [beniseed]
ref|XP_006445087.1|  hypothetical protein CICLE_v10022286mg           55.8    1e-06   Citrus clementina [clementine]
ref|XP_010519485.1|  PREDICTED: remorin-like isoform X2               55.5    1e-06   Tarenaya hassleriana [spider flower]
ref|NP_001151703.1|  LOC100285339                                     55.5    1e-06   
tpg|DAA42886.1|  TPA: remorin                                         55.5    1e-06   
ref|XP_010544719.1|  PREDICTED: remorin-like isoform X1               55.1    1e-06   Tarenaya hassleriana [spider flower]
gb|AEK94319.1|  remorin                                               55.5    1e-06   Pyrus x bretschneideri [bai li]
ref|XP_010544720.1|  PREDICTED: remorin-like isoform X2               55.1    1e-06   Tarenaya hassleriana [spider flower]
ref|XP_003528866.1|  PREDICTED: remorin-like                          55.5    1e-06   Glycine max [soybeans]
ref|XP_009615469.1|  PREDICTED: remorin-like                          55.5    2e-06   Nicotiana tomentosiformis
ref|XP_002304484.1|  hypothetical protein POPTR_0003s12450g           55.1    2e-06   Populus trichocarpa [western balsam poplar]
ref|XP_009757254.1|  PREDICTED: remorin-like                          53.9    2e-06   Nicotiana sylvestris
ref|XP_010061086.1|  PREDICTED: remorin-like isoform X2               56.2    2e-06   Eucalyptus grandis [rose gum]
ref|XP_010061093.1|  PREDICTED: remorin-like isoform X3               55.8    2e-06   
ref|XP_010061098.1|  PREDICTED: remorin-like isoform X4               55.8    2e-06   Eucalyptus grandis [rose gum]
gb|KCW90710.1|  hypothetical protein EUGRSUZ_A02793                   55.8    2e-06   Eucalyptus grandis [rose gum]
ref|XP_010061078.1|  PREDICTED: remorin-like isoform X1               55.8    2e-06   
ref|XP_006404199.1|  hypothetical protein EUTSA_v10011156mg           54.7    2e-06   Eutrema salsugineum [saltwater cress]
ref|XP_008336972.1|  PREDICTED: LOW QUALITY PROTEIN: remorin-like     55.5    2e-06   
ref|XP_007218451.1|  hypothetical protein PRUPE_ppa011776mg           54.7    2e-06   Prunus persica
ref|XP_008232793.1|  PREDICTED: remorin                               54.7    3e-06   Prunus mume [ume]
ref|XP_004170221.1|  PREDICTED: remorin-like                          53.9    3e-06   
gb|KCW90714.1|  hypothetical protein EUGRSUZ_A02795                   53.5    3e-06   Eucalyptus grandis [rose gum]
ref|XP_009587316.1|  PREDICTED: remorin-like                          53.9    3e-06   Nicotiana tomentosiformis
ref|NP_001235181.1|  uncharacterized protein LOC100305679             53.9    3e-06   Glycine max [soybeans]
gb|KFK37371.1|  hypothetical protein AALP_AA4G248100                  54.3    3e-06   Arabis alpina [alpine rockcress]
emb|CDX80385.1|  BnaC07g30590D                                        55.5    4e-06   
ref|XP_007051855.1|  Remorin family protein                           53.9    4e-06   
ref|XP_004306803.1|  PREDICTED: remorin-like                          53.9    5e-06   Fragaria vesca subsp. vesca
ref|XP_009149781.1|  PREDICTED: remorin                               53.5    5e-06   Brassica rapa
ref|XP_010061111.1|  PREDICTED: remorin-like                          53.9    5e-06   Eucalyptus grandis [rose gum]
gb|EYU32085.1|  hypothetical protein MIMGU_mgv1a014760mg              53.5    5e-06   Erythranthe guttata [common monkey flower]
ref|XP_004496578.1|  PREDICTED: remorin-like                          53.9    6e-06   Cicer arietinum [garbanzo]
gb|EPS59685.1|  hypothetical protein M569_15119                       52.8    6e-06   Genlisea aurea
ref|XP_004986023.1|  PREDICTED: remorin-like                          53.5    6e-06   Setaria italica
emb|CDP08838.1|  unnamed protein product                              53.1    7e-06   Coffea canephora [robusta coffee]
gb|AFK39071.1|  unknown                                               53.1    8e-06   Lotus japonicus
gb|AFK42693.1|  unknown                                               53.1    9e-06   Lotus japonicus
ref|XP_010061121.1|  PREDICTED: remorin-like                          53.1    9e-06   Eucalyptus grandis [rose gum]
ref|XP_008376024.1|  PREDICTED: remorin-like                          53.1    9e-06   Malus domestica [apple tree]
gb|KHG12669.1|  Remorin                                               53.1    1e-05   Gossypium arboreum [tree cotton]
ref|XP_010667563.1|  PREDICTED: remorin-like                          53.1    1e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004976344.1|  PREDICTED: remorin-like                          53.1    1e-05   Setaria italica
ref|XP_006402501.1|  hypothetical protein EUTSA_v10006246mg           52.8    1e-05   Eutrema salsugineum [saltwater cress]
ref|XP_008377346.1|  PREDICTED: remorin-like isoform X1               53.1    2e-05   Malus domestica [apple tree]
ref|XP_010905109.1|  PREDICTED: remorin-like                          52.4    2e-05   Elaeis guineensis
gb|AGG82489.1|  remorin 2                                             52.4    2e-05   Datisca glomerata
ref|NP_001048576.1|  Os02g0824500                                     52.0    2e-05   
gb|AFN53683.1|  hypothetical protein                                  53.5    2e-05   Linum usitatissimum
gb|EEC74277.1|  hypothetical protein OsI_09516                        52.0    2e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_009794056.1|  PREDICTED: remorin-like                          51.6    2e-05   Nicotiana sylvestris
ref|XP_010053688.1|  PREDICTED: remorin-like                          51.6    2e-05   Eucalyptus grandis [rose gum]
ref|XP_003521134.1|  PREDICTED: remorin-like                          52.0    2e-05   Glycine max [soybeans]
ref|XP_006358926.1|  PREDICTED: remorin-like                          52.0    2e-05   Solanum tuberosum [potatoes]
ref|XP_009629650.1|  PREDICTED: remorin-like                          51.2    2e-05   Nicotiana tomentosiformis
ref|XP_010676488.1|  PREDICTED: remorin                               52.0    3e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009779197.1|  PREDICTED: remorin-like                          51.2    3e-05   Nicotiana sylvestris
gb|EPS60307.1|  hypothetical protein M569_14497                       51.6    3e-05   Genlisea aurea
ref|XP_011022731.1|  PREDICTED: remorin-like                          51.6    3e-05   Populus euphratica
ref|XP_003534573.1|  PREDICTED: remorin-like                          51.2    4e-05   Glycine max [soybeans]
gb|KHN29375.1|  Remorin                                               51.2    4e-05   Glycine soja [wild soybean]
ref|XP_004492710.1|  PREDICTED: uncharacterized protein At3g61260...  51.2    4e-05   Cicer arietinum [garbanzo]
ref|XP_008794187.1|  PREDICTED: remorin-like isoform X2               51.2    5e-05   Phoenix dactylifera
ref|XP_006649253.1|  PREDICTED: remorin-like                          50.4    6e-05   Oryza brachyantha
gb|KDO60014.1|  hypothetical protein CISIN_1g028549mg                 50.8    7e-05   Citrus sinensis [apfelsine]
ref|NP_001048722.1|  Os03g0111200                                     50.4    7e-05   
ref|XP_010055616.1|  PREDICTED: remorin-like                          50.8    9e-05   Eucalyptus grandis [rose gum]
ref|XP_010503539.1|  PREDICTED: remorin-like                          50.1    9e-05   Camelina sativa [gold-of-pleasure]
gb|EPS69897.1|  hypothetical protein M569_04866                       50.1    9e-05   Genlisea aurea
ref|XP_010412645.1|  PREDICTED: remorin-like                          50.1    1e-04   Camelina sativa [gold-of-pleasure]
ref|XP_008794186.1|  PREDICTED: remorin-like isoform X1               50.4    1e-04   Phoenix dactylifera
ref|XP_010089139.1|  Pollen-specific protein SF3                      50.8    1e-04   
emb|CAN75437.1|  hypothetical protein VITISV_000833                   50.1    2e-04   Vitis vinifera
ref|XP_002882035.1|  hypothetical protein ARALYDRAFT_483720           49.7    2e-04   
ref|NP_182106.1|  Remorin family protein                              49.7    2e-04   Arabidopsis thaliana [mouse-ear cress]
gb|AAA57124.1|  DNA-binding protein                                   49.7    2e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006573768.1|  PREDICTED: remorin-like isoform X2               49.3    2e-04   
ref|XP_003516694.1|  PREDICTED: remorin-like isoform X1               49.3    2e-04   Glycine max [soybeans]
ref|XP_002270914.1|  PREDICTED: uncharacterized protein At3g61260     49.3    2e-04   Vitis vinifera
gb|AFK49332.1|  unknown                                               49.3    2e-04   Medicago truncatula
ref|XP_009766651.1|  PREDICTED: remorin-like                          49.3    3e-04   Nicotiana sylvestris
ref|XP_010426396.1|  PREDICTED: remorin-like                          48.9    3e-04   
ref|XP_006345628.1|  PREDICTED: remorin-like                          48.5    3e-04   
emb|CDY18898.1|  BnaC04g04520D                                        49.3    3e-04   Brassica napus [oilseed rape]
emb|CDY71834.1|  BnaAnng38930D                                        48.9    3e-04   Brassica napus [oilseed rape]
ref|XP_006339544.1|  PREDICTED: remorin-like                          48.5    3e-04   Solanum tuberosum [potatoes]
gb|AFK34355.1|  unknown                                               48.9    3e-04   Medicago truncatula
gb|KEH18895.1|  carboxy-terminal region remorin                       48.9    3e-04   Medicago truncatula
gb|EMT11441.1|  hypothetical protein F775_30732                       48.5    4e-04   
ref|XP_008238894.1|  PREDICTED: remorin                               48.9    4e-04   Prunus mume [ume]
gb|KJB49418.1|  hypothetical protein B456_008G118300                  47.8    4e-04   Gossypium raimondii
ref|XP_009627101.1|  PREDICTED: remorin-like                          48.5    4e-04   Nicotiana tomentosiformis
gb|KJB41294.1|  hypothetical protein B456_007G097700                  48.5    5e-04   Gossypium raimondii
ref|XP_002465999.1|  hypothetical protein SORBIDRAFT_01g049810        48.1    5e-04   Sorghum bicolor [broomcorn]
ref|XP_003574160.1|  PREDICTED: remorin-like                          48.1    5e-04   Brachypodium distachyon [annual false brome]
ref|XP_009383123.1|  PREDICTED: remorin-like                          48.1    5e-04   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS51879.1|  hypothetical protein TRIUR3_21382                     48.1    5e-04   Triticum urartu
ref|XP_010908427.1|  PREDICTED: remorin-like isoform X2               48.5    5e-04   Elaeis guineensis
ref|XP_010512460.1|  PREDICTED: uncharacterized protein At3g61260...  48.5    6e-04   Camelina sativa [gold-of-pleasure]
ref|XP_002877638.1|  remorin family protein                           47.8    7e-04   Arabidopsis lyrata subsp. lyrata
ref|XP_006291850.1|  hypothetical protein CARUB_v10018025mg           48.1    7e-04   Capsella rubella
gb|EPS61469.1|  hypothetical protein M569_13328                       47.0    8e-04   Genlisea aurea
ref|XP_004308093.1|  PREDICTED: remorin-like isoform X3               48.1    8e-04   Fragaria vesca subsp. vesca
ref|XP_004308092.1|  PREDICTED: remorin-like isoform X1               48.1    8e-04   Fragaria vesca subsp. vesca
ref|XP_011470377.1|  PREDICTED: remorin-like isoform X2               48.1    8e-04   Fragaria vesca subsp. vesca
ref|NP_191685.1|  remorin family protein                              48.1    8e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010469049.1|  PREDICTED: uncharacterized protein At3g61260...  48.1    9e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010523734.1|  PREDICTED: uncharacterized protein At3g61260     47.8    0.001   Tarenaya hassleriana [spider flower]



>ref|XP_009382381.1| PREDICTED: remorin-like [Musa acuminata subsp. malaccensis]
Length=196

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 84/110 (76%), Gaps = 3/110 (3%)
 Frame = +3

Query  216  DDSKALvvvenkapepepveekkeGGSIDRDVVLARVATEKKHSLIkaweeseksksenk  395
            DDSKAL  V+              GGSIDRD VLARV TEK+ S+IKAWEE+EK+K++NK
Sbjct  47   DDSKALATVDTTEAAATKKTS---GGSIDRDAVLARVETEKRESMIKAWEENEKTKAQNK  103

Query  396  aqkkLSEVSSWENkkkasieaelkkieekleVQKAEYIEKMKNKIAMLHK  545
            A KK++ +++WEN KKA++EAELK  EE LE +KAEY+EKMKNKIAMLHK
Sbjct  104  AAKKMASITAWENSKKAALEAELKMKEEALEKKKAEYVEKMKNKIAMLHK  153



>ref|XP_009408139.1| PREDICTED: remorin [Musa acuminata subsp. malaccensis]
Length=171

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 89/110 (81%), Gaps = 4/110 (4%)
 Frame = +3

Query  216  DDSKALvvvenkapepepveekkeGGSIDRDVVLARVATEKKHSLIkaweeseksksenk  395
            DDSKAL VVE  A +         G SIDRDV LA+V TEKK SLIKAWEESEK+K+ENK
Sbjct  23   DDSKALAVVEKSASQETKSV----GSSIDRDVALAQVETEKKLSLIKAWEESEKTKAENK  78

Query  396  aqkkLSEVSSWENkkkasieaelkkieekleVQKAEYIEKMKNKIAMLHK  545
            +QKKLS ++SWEN KKA++EAELKKIEEK+E QKAEY EKMKNKIAM+HK
Sbjct  79   SQKKLSAITSWENSKKATLEAELKKIEEKIENQKAEYAEKMKNKIAMIHK  128



>ref|XP_009778200.1| PREDICTED: remorin-like isoform X2 [Nicotiana sylvestris]
Length=204

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GSIDRD VLARVATEK+ SLIKAWEESEKSK+ENKAQKK+S +++WEN KKA++EAELKK
Sbjct  79   GSIDRDAVLARVATEKRLSLIKAWEESEKSKAENKAQKKVSAIAAWENSKKANLEAELKK  138

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            +EE+LE +KAEYIEKMKNKIA+LHK
Sbjct  139  MEEQLEKKKAEYIEKMKNKIALLHK  163



>ref|XP_009778199.1| PREDICTED: remorin-like isoform X1 [Nicotiana sylvestris]
Length=207

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GSIDRD VLARVATEK+ SLIKAWEESEKSK+ENKAQKK+S +++WEN KKA++EAELKK
Sbjct  82   GSIDRDAVLARVATEKRLSLIKAWEESEKSKAENKAQKKVSAIAAWENSKKANLEAELKK  141

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            +EE+LE +KAEYIEKMKNKIA+LHK
Sbjct  142  MEEQLEKKKAEYIEKMKNKIALLHK  166



>emb|CDP05208.1| unnamed protein product [Coffea canephora]
Length=203

 Score = 67.4 bits (163),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GSI+RD VLARVATEK+ SLIKAWEESEKSK+ENKAQKK+S + SWEN KKASIEAEL+K
Sbjct  78   GSINRDAVLARVATEKRLSLIKAWEESEKSKAENKAQKKISAIGSWENSKKASIEAELRK  137

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEEKLE QKAEY+EKMKNKIA LHK
Sbjct  138  IEEKLEKQKAEYVEKMKNKIAALHK  162



>ref|XP_011084412.1| PREDICTED: remorin-like [Sesamum indicum]
Length=192

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GSIDRD VLARVATEK+ SLIKAWEESEKSK+ENKAQKK+S +++WEN KKAS+EAELKK
Sbjct  67   GSIDRDAVLARVATEKRLSLIKAWEESEKSKAENKAQKKISAIAAWENSKKASLEAELKK  126

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEE+LE +KAEYIEKMKNK+A++HK
Sbjct  127  IEEQLEKKKAEYIEKMKNKVALVHK  151



>ref|XP_010934733.1| PREDICTED: remorin [Elaeis guineensis]
Length=195

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
             GS +RD VLARVATEKK SLIKAWEESEK+K+ENKAQKK+S + SWEN KKA++EAELK
Sbjct  67   AGSTNRDAVLARVATEKKMSLIKAWEESEKTKAENKAQKKMSSIVSWENTKKAAVEAELK  126

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
            KIEE LE++KAEY EKMKNKIAM+HK
Sbjct  127  KIEEALEMKKAEYSEKMKNKIAMIHK  152



>ref|XP_009590953.1| PREDICTED: remorin-like [Nicotiana tomentosiformis]
Length=205

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GSIDRD VLARVAT+K+ SLIKAWEESEKSK+ENKAQKK+S + +WEN KKA++EAELKK
Sbjct  80   GSIDRDAVLARVATQKRLSLIKAWEESEKSKAENKAQKKVSAIGAWENSKKANLEAELKK  139

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            +EE+LE +KAEYIEKMKNKIA+LHK
Sbjct  140  MEEQLEKKKAEYIEKMKNKIALLHK  164



>ref|XP_006827693.1| hypothetical protein AMTR_s00009p00257810 [Amborella trichopoda]
 gb|ERM95109.1| hypothetical protein AMTR_s00009p00257810 [Amborella trichopoda]
Length=187

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
            GGSIDRD VLA+V +EK+ SLI+AWEESEK+K+ENK  KKLS + SWEN KKA++EAEL+
Sbjct  59   GGSIDRDAVLAKVESEKRMSLIRAWEESEKTKAENKCYKKLSSIGSWENSKKAAVEAELR  118

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
            KIEEKLE QKAEY EKMKNKIA++HK
Sbjct  119  KIEEKLERQKAEYAEKMKNKIALIHK  144



>ref|XP_002267609.1| PREDICTED: remorin [Vitis vinifera]
 emb|CAN73187.1| hypothetical protein VITISV_041529 [Vitis vinifera]
 emb|CBI22753.3| unnamed protein product [Vitis vinifera]
Length=196

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
            GGS++RD VLARVATEK+ SLI+AWEESEK K+ENKAQKKLS   +WEN +KAS+EAELK
Sbjct  70   GGSVNRDTVLARVATEKRLSLIRAWEESEKCKAENKAQKKLSATEAWENSQKASVEAELK  129

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
            KIEE LE +KAEY+EKMKNKIA++HK
Sbjct  130  KIEENLERKKAEYVEKMKNKIAIIHK  155



>ref|NP_001274989.1| remorin [Solanum tuberosum]
 sp|P93788.1|REMO_SOLTU RecName: Full=Remorin; AltName: Full=pp34 [Solanum tuberosum]
 gb|AAB49425.1| remorin [Solanum tuberosum]
Length=198

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 96/110 (87%), Gaps = 3/110 (3%)
 Frame = +3

Query  216  DDSKALvvvenkapepepveekkeGGSIDRDVVLARVATEKKHSLIkaweeseksksenk  395
            DDSKALVVVE KAPEP   +++   GSIDRD VLARVATEK+ SLIKAWEESEKSK+ENK
Sbjct  51   DDSKALVVVETKAPEPADEKKE---GSIDRDAVLARVATEKRVSLIKAWEESEKSKAENK  107

Query  396  aqkkLSEVSSWENkkkasieaelkkieekleVQKAEYIEKMKNKIAMLHK  545
            AQKK+S + +WEN KKA++EAELKK+EE+LE +KAEY EKMKNKIA+LHK
Sbjct  108  AQKKVSAIGAWENSKKANLEAELKKMEEQLEKKKAEYTEKMKNKIALLHK  157



>ref|XP_003580217.1| PREDICTED: remorin-like [Brachypodium distachyon]
Length=207

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = +3

Query  216  DDSKALvvvenkapepepveekkeGGSIDRDVVLARVATEKKHSLIkaweeseksksenk  395
            DDSKALVVVE  A E    E+   GGS DRD+ LARV TEK++SLIKAWEE+EK+K+ENK
Sbjct  55   DDSKALVVVEKVADEKPADEKAAHGGSNDRDIALARVETEKRNSLIKAWEENEKTKAENK  114

Query  396  aqkkLSEVSSWENkkkasieaelkkieekleVQKAEYIEKMKNKIAMLHK  545
            A KK+S + SWEN KKA+IEA+L+KIEE+LE +KAEY EKMKNK AM+HK
Sbjct  115  AAKKVSAILSWENTKKANIEAQLRKIEEQLEKKKAEYAEKMKNKAAMIHK  164



>ref|XP_009340014.1| PREDICTED: remorin-like [Pyrus x bretschneideri]
Length=211

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +3

Query  294  SIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkki  473
            S+DRDVVLARVATEKK SLI+AWEESEKSK+ENKA KKLS + SWEN KKA++EAELKKI
Sbjct  85   SVDRDVVLARVATEKKLSLIRAWEESEKSKAENKAHKKLSAIGSWENTKKANVEAELKKI  144

Query  474  eekleVQKAEYIEKMKNKIAMLHK  545
            EE+LE +KAEY+E+MKNKIA++HK
Sbjct  145  EEQLEKKKAEYVEQMKNKIALIHK  168



>ref|XP_003638357.1| Remorin [Medicago truncatula]
 gb|AFK36180.1| unknown [Medicago truncatula]
 gb|KEH43717.1| carboxy-terminal region remorin [Medicago truncatula]
Length=209

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
            GGSIDRD VL RVATEK+ SLIKAWEESEKSK+ENKAQ++LS +++WEN KKA+ EAEL+
Sbjct  83   GGSIDRDAVLTRVATEKRLSLIKAWEESEKSKAENKAQRRLSTITAWENSKKAAKEAELR  142

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
            K+EE+LE +K EY EK+KNKIA LHK
Sbjct  143  KLEEQLEKKKGEYAEKLKNKIAALHK  168



>ref|XP_008806887.1| PREDICTED: remorin [Phoenix dactylifera]
Length=277

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
             GS DRD VLARVATEK+ SLIKAWEESEK+K+ENK+QKK+S ++SWEN KKA++EAEL+
Sbjct  149  AGSADRDAVLARVATEKRISLIKAWEESEKTKAENKSQKKMSSIASWENTKKAAVEAELR  208

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
            KIEE LE++KAEY EKMKNKIAM+HK
Sbjct  209  KIEEALEMKKAEYAEKMKNKIAMIHK  234



>gb|KHG20032.1| Remorin [Gossypium arboreum]
Length=187

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
             ++DRD VLARVATEK+ SLIKAWEE+E+SK+ENKA KKLS + +WEN KKA++EAELKK
Sbjct  62   STVDRDTVLARVATEKRISLIKAWEETERSKAENKAHKKLSSIEAWENSKKAALEAELKK  121

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEEKLE QKAEY+EKMKNKIA++HK
Sbjct  122  IEEKLEKQKAEYVEKMKNKIALIHK  146



>ref|XP_008376569.1| PREDICTED: remorin-like [Malus domestica]
 ref|XP_008376570.1| PREDICTED: remorin-like [Malus domestica]
 ref|XP_008376572.1| PREDICTED: remorin-like [Malus domestica]
Length=211

 Score = 64.7 bits (156),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GSI+RD VLA+VATEK+ SLI+AWEESEKS+++NKAQKKLS + SWEN +KA +EAELKK
Sbjct  86   GSINRDAVLAKVATEKRLSLIRAWEESEKSRAQNKAQKKLSAIGSWENTRKAIVEAELKK  145

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEEKLE QKAEY+E+MKNKIA++HK
Sbjct  146  IEEKLEKQKAEYMEQMKNKIALIHK  170



>ref|XP_009371326.1| PREDICTED: remorin-like [Pyrus x bretschneideri]
Length=213

 Score = 64.3 bits (155),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS++RD VLA+VATEK+ SLI+AWEESEKSK+ENKAQKKLS + SWEN +KA +EAELKK
Sbjct  86   GSVNRDAVLAKVATEKRLSLIRAWEESEKSKAENKAQKKLSAIGSWENTRKAIVEAELKK  145

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEEKLE QKAEY+E+MKNKIA++HK
Sbjct  146  IEEKLEKQKAEYVEQMKNKIALIHK  170



>gb|KJB37243.1| hypothetical protein B456_006G197800 [Gossypium raimondii]
Length=187

 Score = 64.3 bits (155),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
             ++DRD VLARVATEK+ SLIKAWEESE+SK+ENKA KKLS + +WEN KKA++EAELKK
Sbjct  62   STVDRDAVLARVATEKRISLIKAWEESERSKAENKAHKKLSSIEAWENSKKAALEAELKK  121

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEEKLE QKAEY+EKMKNKIA++HK
Sbjct  122  IEEKLEKQKAEYVEKMKNKIALIHK  146



>gb|KJB23871.1| hypothetical protein B456_004G118800 [Gossypium raimondii]
Length=194

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +3

Query  294  SIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkki  473
            S+DRD VLARVATEK+ SLI AWEESEKSK+ENKAQKKLS +++WEN KKA+IEAELK+I
Sbjct  70   SVDRDAVLARVATEKRISLINAWEESEKSKAENKAQKKLSSIAAWENTKKAAIEAELKRI  129

Query  474  eekleVQKAEYIEKMKNKIAMLHK  545
            EEKLE QKAEY+EKMKNK A++HK
Sbjct  130  EEKLEKQKAEYVEKMKNKAALIHK  153



>ref|XP_010107439.1| hypothetical protein L484_015780 [Morus notabilis]
 gb|EXC15977.1| hypothetical protein L484_015780 [Morus notabilis]
Length=199

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GSI+RD VLARVATEK+ SLI+AWEESEKSK+EN+A K +S V +WEN KKAS+EA+LKK
Sbjct  74   GSINRDAVLARVATEKRLSLIRAWEESEKSKAENRAHKNISSVGAWENSKKASVEAQLKK  133

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEE LE +KAEY+EKMKNKIA++HK
Sbjct  134  IEENLEKKKAEYVEKMKNKIALIHK  158



>ref|XP_008377354.1| PREDICTED: remorin-like isoform X2 [Malus domestica]
Length=211

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +3

Query  294  SIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkki  473
            S+DRD VLARVATEKK SLI+AWEESEKSK+ENKA KKLS + SWEN KKA++EAELKKI
Sbjct  85   SVDRDAVLARVATEKKLSLIRAWEESEKSKAENKAHKKLSAIGSWENTKKATVEAELKKI  144

Query  474  eekleVQKAEYIEKMKNKIAMLHK  545
            EE+LE +KAEY+E+MKNKIA++HK
Sbjct  145  EEQLEKKKAEYVEQMKNKIALIHK  168



>gb|KJB23872.1| hypothetical protein B456_004G118800 [Gossypium raimondii]
Length=191

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +3

Query  294  SIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkki  473
            S+DRD VLARVATEK+ SLI AWEESEKSK+ENKAQKKLS +++WEN KKA+IEAELK+I
Sbjct  67   SVDRDAVLARVATEKRISLINAWEESEKSKAENKAQKKLSSIAAWENTKKAAIEAELKRI  126

Query  474  eekleVQKAEYIEKMKNKIAMLHK  545
            EEKLE QKAEY+EKMKNK A++HK
Sbjct  127  EEKLEKQKAEYVEKMKNKAALIHK  150



>ref|XP_002448229.1| hypothetical protein SORBIDRAFT_06g023630 [Sorghum bicolor]
 gb|EES12557.1| hypothetical protein SORBIDRAFT_06g023630 [Sorghum bicolor]
Length=212

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 89/112 (79%), Gaps = 2/112 (2%)
 Frame = +3

Query  216  DDSKALv--vvenkapepepveekkeGGSIDRDVVLARVATEKKHSLIkaweesekskse  389
            DDSKAL         P PE    +K+GGS DRD+ LARV TEK++SLIKAWEE+EK+K+E
Sbjct  58   DDSKALAIVEKVADEPAPEKPAAEKQGGSNDRDLALARVETEKRNSLIKAWEENEKTKAE  117

Query  390  nkaqkkLSEVSSWENkkkasieaelkkieekleVQKAEYIEKMKNKIAMLHK  545
            NKA KK+S + SWEN KKA+IEA+LKKIEE+LE +KAEY EKMKNK+AM+HK
Sbjct  118  NKAAKKVSAILSWENTKKANIEAQLKKIEEQLEKKKAEYAEKMKNKVAMIHK  169



>gb|KJB23873.1| hypothetical protein B456_004G118800 [Gossypium raimondii]
Length=188

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +3

Query  294  SIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkki  473
            S+DRD VLARVATEK+ SLI AWEESEKSK+ENKAQKKLS +++WEN KKA+IEAELK+I
Sbjct  64   SVDRDAVLARVATEKRISLINAWEESEKSKAENKAQKKLSSIAAWENTKKAAIEAELKRI  123

Query  474  eekleVQKAEYIEKMKNKIAMLHK  545
            EEKLE QKAEY+EKMKNK A++HK
Sbjct  124  EEKLEKQKAEYVEKMKNKAALIHK  147



>ref|XP_008465865.1| PREDICTED: remorin [Cucumis melo]
Length=193

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS++RD VLA+VATEK+ SLIKAWEESEKSK+ENKA KKLS V++WEN KKAS+EAELKK
Sbjct  66   GSVNRDAVLAKVATEKRLSLIKAWEESEKSKAENKAHKKLSSVAAWENSKKASVEAELKK  125

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEE LE +K EYIEKMKNKIA+LHK
Sbjct  126  IEESLEKKKGEYIEKMKNKIALLHK  150



>ref|NP_001053409.1| Os04g0533300 [Oryza sativa Japonica Group]
 emb|CAE04574.1| OSJNBb0039L24.13 [Oryza sativa Japonica Group]
 dbj|BAF15323.1| Os04g0533300 [Oryza sativa Japonica Group]
 gb|EAY94960.1| hypothetical protein OsI_16768 [Oryza sativa Indica Group]
 gb|EAZ31446.1| hypothetical protein OsJ_15583 [Oryza sativa Japonica Group]
 dbj|BAG96338.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89383.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97622.1| unnamed protein product [Oryza sativa Japonica Group]
Length=206

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 91/110 (83%), Gaps = 1/110 (1%)
 Frame = +3

Query  216  DDSKALvvvenkapepepveekkeGGSIDRDVVLARVATEKKHSLIkaweeseksksenk  395
            DDSKAL +VE  A EP   +  + GGS DRDV LARV TEK++SLIKAWEE+EK+K+ENK
Sbjct  55   DDSKALAIVEKVADEPPAEKPAQ-GGSNDRDVALARVETEKRNSLIKAWEENEKTKAENK  113

Query  396  aqkkLSEVSSWENkkkasieaelkkieekleVQKAEYIEKMKNKIAMLHK  545
            A KKLS + SWEN KKA+IEA+LKKIEE+LE +KAEY EKMKNK+A++HK
Sbjct  114  ASKKLSAILSWENTKKANIEAQLKKIEEQLEKKKAEYAEKMKNKVAIVHK  163



>gb|KHG21181.1| Remorin [Gossypium arboreum]
Length=191

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +3

Query  294  SIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkki  473
            S+DRD VLARVATEK+ SLI AWEESEKSK+ENKAQKKLS +++WEN KKA+IEAELK+I
Sbjct  67   SVDRDAVLARVATEKRISLINAWEESEKSKAENKAQKKLSSIAAWENTKKAAIEAELKRI  126

Query  474  eekleVQKAEYIEKMKNKIAMLHK  545
            EEKL+ QKAEY+EKMKNK A++HK
Sbjct  127  EEKLDKQKAEYVEKMKNKAALIHK  150



>gb|AGB07445.1| remorin [Morus indica]
Length=199

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GSI+RD VLARVATEK+ SLI+AWEESEKSK+ENKA K +S + +WEN KKAS+EA+LKK
Sbjct  74   GSINRDAVLARVATEKRLSLIRAWEESEKSKAENKAHKNVSSIGAWENSKKASVEAQLKK  133

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
             EE LE +KAEY+EKMKNKIA++HK
Sbjct  134  FEENLEKKKAEYVEKMKNKIALIHK  158



>ref|XP_009349347.1| PREDICTED: remorin-like [Pyrus x bretschneideri]
Length=213

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS++RD VLA+VATEK  SLI+AWEESEKSK+ENKAQKKLS + SWEN +KA +EAELKK
Sbjct  86   GSVNRDAVLAKVATEKSLSLIRAWEESEKSKAENKAQKKLSAIGSWENTRKAIVEAELKK  145

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
             EEKLE QKAEY+E+MKNKIA++HK
Sbjct  146  FEEKLEKQKAEYVEQMKNKIALIHK  170



>gb|AII99828.1| remorin 1 [Nicotiana tabacum]
Length=205

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GSID D VLARVAT+K+ SLIKAWEESEKSK+ENKAQKK+S + +WEN KKA++EAELKK
Sbjct  80   GSIDTDAVLARVATQKRLSLIKAWEESEKSKAENKAQKKVSAIGAWENSKKANLEAELKK  139

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            +EE+LE +KAEYIEKMKNKIA+LHK
Sbjct  140  MEEQLEKKKAEYIEKMKNKIALLHK  164



>ref|XP_009770981.1| PREDICTED: remorin-like [Nicotiana sylvestris]
Length=178

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GSIDRD  LAR  TEK+ SLIKAWEESEKSK+ENKAQ+K SE+ +WEN KKAS+EAELK+
Sbjct  52   GSIDRDATLARFTTEKRLSLIKAWEESEKSKAENKAQRKQSEILAWENSKKASLEAELKR  111

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEE+L  +KAEYIEKMKNKIA+LHK
Sbjct  112  IEEQLLKKKAEYIEKMKNKIALLHK  136



>ref|NP_001159012.1| remorin [Zea mays]
 gb|ACF88153.1| unknown [Zea mays]
 gb|ACG36146.1| remorin [Zea mays]
 tpg|DAA36691.1| TPA: Remorin isoform 1 [Zea mays]
 tpg|DAA36692.1| TPA: Remorin isoform 2 [Zea mays]
Length=199

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
            GGS DRD+ LARV TEK++SLIKAWEE+EK+K+ENKA KK+S + SWEN KKA+IEAELK
Sbjct  71   GGSNDRDLALARVETEKRNSLIKAWEENEKTKAENKAAKKVSAILSWENTKKANIEAELK  130

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
            KIEE+LE +KAEY EKMKNK+AM+HK
Sbjct  131  KIEEQLEKKKAEYAEKMKNKVAMIHK  156



>ref|XP_008794544.1| PREDICTED: remorin-like [Phoenix dactylifera]
Length=192

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
            GGS +RD  LARV TEK+ SLI+AWEE+EK+K+ENKA KK+S +++WEN  KA++EAELK
Sbjct  64   GGSTERDAQLARVETEKRMSLIRAWEENEKAKAENKAAKKMSSITAWENSTKAAMEAELK  123

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
              EE LE +KAEY EKMKNK+AMLHK
Sbjct  124  AKEEALEKKKAEYAEKMKNKVAMLHK  149



>ref|NP_001274955.1| putative remorin a3b4 [Solanum tuberosum]
 gb|ACB28484.1| putative remorin a3b4 [Solanum tuberosum]
Length=199

 Score = 62.4 bits (150),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GSIDRD  LAR+ TEK+ SLIKAWEESEKSK+ENKAQKK SE+ +WEN KKAS+EAELK+
Sbjct  73   GSIDRDATLARLTTEKRLSLIKAWEESEKSKAENKAQKKRSEILAWENSKKASLEAELKR  132

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
             EE+L  +KAEYIEK+KNKIA+LHK
Sbjct  133  TEEQLLKKKAEYIEKLKNKIALLHK  157



>ref|NP_197764.1| Remorin family protein [Arabidopsis thaliana]
 gb|AAK62451.1|AF387006_1 Unknown protein [Arabidopsis thaliana]
 dbj|BAB10048.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAN15335.1| Unknown protein [Arabidopsis thaliana]
 gb|AED93207.1| Remorin family protein [Arabidopsis thaliana]
Length=202

 Score = 62.0 bits (149),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS++RD VLARV TEK+ SLIKAWEE+EK K ENKA+KKLS + SWEN KKA++EAELKK
Sbjct  77   GSVNRDAVLARVETEKRMSLIKAWEEAEKCKVENKAEKKLSSIGSWENNKKAAVEAELKK  136

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            +EE+LE +KAEY+E+MKNKIA +HK
Sbjct  137  MEEQLEKKKAEYVEQMKNKIAQIHK  161



>ref|XP_002322467.1| remorin family protein [Populus trichocarpa]
 gb|EEF06594.1| remorin family protein [Populus trichocarpa]
Length=201

 Score = 62.0 bits (149),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS++RD VLARVATEK+ SL+KAWEESEKSK+ENKA KKLS ++SWEN KKAS+EAEL K
Sbjct  76   GSVNRDAVLARVATEKRISLVKAWEESEKSKAENKAHKKLSSIASWENSKKASVEAELMK  135

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEE+LE +KAE +EKMKNKIAM+HK
Sbjct  136  IEEQLEKKKAECMEKMKNKIAMIHK  160



>ref|XP_004148376.1| PREDICTED: remorin-like [Cucumis sativus]
Length=157

 Score = 61.6 bits (148),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS++RD VLA+VATEK+ SL+KAWEESEKSK+ENKA KKLS V++WEN +KAS+EA+LKK
Sbjct  30   GSVNRDAVLAKVATEKRLSLVKAWEESEKSKAENKAHKKLSSVAAWENSQKASVEADLKK  89

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEE LE +KA+YIE+MKNKIA+LHK
Sbjct  90   IEESLEKKKAKYIEQMKNKIALLHK  114



>ref|NP_974824.1| Remorin family protein [Arabidopsis thaliana]
 gb|AED93208.1| Remorin family protein [Arabidopsis thaliana]
Length=201

 Score = 62.0 bits (149),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS++RD VLARV TEK+ SLIKAWEE+EK K ENKA+KKLS + SWEN KKA++EAELKK
Sbjct  76   GSVNRDAVLARVETEKRMSLIKAWEEAEKCKVENKAEKKLSSIGSWENNKKAAVEAELKK  135

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            +EE+LE +KAEY+E+MKNKIA +HK
Sbjct  136  MEEQLEKKKAEYVEQMKNKIAQIHK  160



>ref|XP_006421909.1| hypothetical protein CICLE_v10005899mg [Citrus clementina]
 gb|ESR35149.1| hypothetical protein CICLE_v10005899mg [Citrus clementina]
 gb|KDO60013.1| hypothetical protein CISIN_1g028549mg [Citrus sinensis]
Length=206

 Score = 62.0 bits (149),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +3

Query  216  DDSKALvvvenkapepepveekkeGGSIDRDVVLARVATEKKHSLIkaweeseksksenk  395
            ++SKAL VV+       P  EK   GS++RD VLARV TEK+ SLI+AWEESEKS++ENK
Sbjct  54   EESKALAVVDKAPEAEPPAGEKSTEGSVNRDAVLARVETEKRISLIRAWEESEKSQAENK  113

Query  396  aqkkLSEVSSWENkkkasieaelkkieekleVQKAEYIEKMKNKIAMLHK  545
            A KKLS + SWEN +KA++EAELKKIEE+LE +KAEY+EKMKNK+A++HK
Sbjct  114  AHKKLSSIVSWENSRKAAVEAELKKIEEQLEKKKAEYVEKMKNKMALIHK  163



>ref|NP_001234231.1| remorin 1 [Solanum lycopersicum]
 gb|AAD28506.1|AF123265_1 remorin 1 [Solanum lycopersicum]
Length=197

 Score = 61.6 bits (148),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GSIDRD VLARVATEK+ SLIKAWEESEKSK+ENKAQKK+S + +WEN KKA++E+ELKK
Sbjct  72   GSIDRDAVLARVATEKRLSLIKAWEESEKSKAENKAQKKVSAIGAWENSKKANLESELKK  131

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            +EE+LE +KA Y EKMKNKIA+LHK
Sbjct  132  MEEQLEKKKAIYTEKMKNKIALLHK  156



>ref|XP_004165762.1| PREDICTED: remorin-like [Cucumis sativus]
 gb|KGN60481.1| hypothetical protein Csa_3G915100 [Cucumis sativus]
Length=189

 Score = 61.6 bits (148),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS++RD VLA+VATEK+ SL+KAWEESEKSK+ENKA KKLS V++WEN +KAS+EA+LKK
Sbjct  62   GSVNRDAVLAKVATEKRLSLVKAWEESEKSKAENKAHKKLSSVAAWENSQKASVEADLKK  121

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEE LE +KA+YIE+MKNKIA+LHK
Sbjct  122  IEESLEKKKAKYIEQMKNKIALLHK  146



>ref|XP_007152285.1| hypothetical protein PHAVU_004G116700g [Phaseolus vulgaris]
 gb|ESW24279.1| hypothetical protein PHAVU_004G116700g [Phaseolus vulgaris]
Length=205

 Score = 61.6 bits (148),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS++RD VLARVATEK+ SLIKAWEESEKSK+ENKA KKLS +S+WEN KKAS+EAELKK
Sbjct  80   GSVNRDAVLARVATEKRLSLIKAWEESEKSKAENKAHKKLSAISAWENSKKASVEAELKK  139

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEE+LE +KAEY EK+KNKIA +HK
Sbjct  140  IEEQLEKKKAEYAEKIKNKIATIHK  164



>gb|AAM63910.1| remorin [Arabidopsis thaliana]
Length=202

 Score = 61.6 bits (148),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS++RD VLARV TEK+ SLIKAWEE+EK K ENKA+KKLS + SWEN KKA++EAELKK
Sbjct  77   GSVNRDAVLARVETEKRMSLIKAWEEAEKCKVENKAEKKLSSIGSWENNKKAAVEAELKK  136

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            +EE LE +KAEY+E+MKNKIA +HK
Sbjct  137  MEEHLEKKKAEYVEQMKNKIAQIHK  161



>ref|XP_004240737.1| PREDICTED: remorin [Solanum lycopersicum]
Length=185

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GSIDRD  LAR+ TEK+ SLIKAWEESEK+K+ENKAQKK++E+ +WEN KKAS+EAELK+
Sbjct  59   GSIDRDATLARLTTEKRLSLIKAWEESEKAKAENKAQKKIAEILAWENSKKASLEAELKR  118

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
             EE+L  +KAEYIEK+KNKIA++HK
Sbjct  119  TEEQLLKKKAEYIEKLKNKIALVHK  143



>emb|CDY69344.1| BnaAnng30100D, partial [Brassica napus]
Length=130

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GSI+RD VLARV TEK+ SLIKAWEE+EK K ENKA+KKLS + SWEN KKA++EAELKK
Sbjct  5    GSINRDAVLARVETEKRMSLIKAWEEAEKCKVENKAEKKLSSIESWENNKKAAVEAELKK  64

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEE+LE +KAEY+E MKNKIA +HK
Sbjct  65   IEEQLEKKKAEYVELMKNKIAQIHK  89



>ref|XP_002511833.1| Remorin, putative [Ricinus communis]
 gb|EEF50502.1| Remorin, putative [Ricinus communis]
Length=188

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 86/110 (78%), Gaps = 3/110 (3%)
 Frame = +3

Query  216  DDSKALvvvenkapepepveekkeGGSIDRDVVLARVATEKKHSLIkaweeseksksenk  395
            DDSKAL VVE              GGS+DRD+ LA V  EK++S IKAWE+SEKSK+ENK
Sbjct  41   DDSKALAVVEKVPESGPKKTS---GGSLDRDIALAEVEKEKRNSFIKAWEDSEKSKAENK  97

Query  396  aqkkLSEVSSWENkkkasieaelkkieekleVQKAEYIEKMKNKIAMLHK  545
            AQKKLS V++WEN KKA++EA+L+KIEE+LE +KAEY EKMKNK+A++HK
Sbjct  98   AQKKLSSVTAWENSKKAALEAKLRKIEEQLEKKKAEYAEKMKNKVALVHK  147



>gb|EYU25090.1| hypothetical protein MIMGU_mgv1a014261mg [Erythranthe guttata]
Length=194

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GSI+RD VL+RVATEK+ SLIKAWEESEKSK+ENKAQKK+S + +WEN +KA++EAELKK
Sbjct  69   GSINRDAVLSRVATEKRMSLIKAWEESEKSKAENKAQKKVSAIGAWENSRKATLEAELKK  128

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEE+LE++KA+YIEK+KNK+A +HK
Sbjct  129  IEEQLEIKKAQYIEKLKNKVAYVHK  153



>ref|XP_006490378.1| PREDICTED: remorin-like [Citrus sinensis]
Length=207

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS++RD VLARV TEK+ SLI+AWEESEKS++ENKA KKLS + SWEN +KA++EAELKK
Sbjct  80   GSVNRDAVLARVETEKRISLIRAWEESEKSQAENKAHKKLSSIVSWENSRKAAVEAELKK  139

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEE+LE +KAEY+EKMKNK+A++HK
Sbjct  140  IEEQLEKKKAEYVEKMKNKMALIHK  164



>gb|EYU25089.1| hypothetical protein MIMGU_mgv1a014261mg [Erythranthe guttata]
Length=195

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GSI+RD VL+RVATEK+ SLIKAWEESEKSK+ENKAQKK+S + +WEN +KA++EAELKK
Sbjct  70   GSINRDAVLSRVATEKRMSLIKAWEESEKSKAENKAQKKVSAIGAWENSRKATLEAELKK  129

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEE+LE++KA+YIEK+KNK+A +HK
Sbjct  130  IEEQLEIKKAQYIEKLKNKVAYVHK  154



>ref|XP_006363315.1| PREDICTED: remorin [Solanum tuberosum]
Length=185

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GSIDRD  LAR+ TEK+ SLIKAWEESEKSK+ENKAQKK SE+ +WEN KKAS+EAELK+
Sbjct  59   GSIDRDATLARLTTEKRLSLIKAWEESEKSKAENKAQKKRSEILAWENSKKASLEAELKR  118

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
             EE+L  +KAEYIEK+KNKIA++HK
Sbjct  119  TEEQLLKKKAEYIEKLKNKIALVHK  143



>gb|KDP22286.1| hypothetical protein JCGZ_26117 [Jatropha curcas]
Length=203

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS++RD VLARV T+K+ SLI+AWEESEKSK+ENKA KKLS + SWEN KKA +EAELK+
Sbjct  78   GSVNRDAVLARVETQKRLSLIRAWEESEKSKAENKAHKKLSAIVSWENSKKALVEAELKQ  137

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEEKLE QKAEY EKMKNKIA++HK
Sbjct  138  IEEKLEKQKAEYAEKMKNKIALIHK  162



>gb|KJB23874.1| hypothetical protein B456_004G118800 [Gossypium raimondii]
Length=192

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 69/85 (81%), Gaps = 1/85 (1%)
 Frame = +3

Query  294  SIDRDVVLARVATEKKHSLIka-weeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            S+DRD VLARVATEK+ SLI A  E  +     N+AQKKLS +++WEN KKA+IEAELK+
Sbjct  67   SVDRDAVLARVATEKRISLINAWEESEKSKAENNRAQKKLSSIAAWENTKKAAIEAELKR  126

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEEKLE QKAEY+EKMKNK A++HK
Sbjct  127  IEEKLEKQKAEYVEKMKNKAALIHK  151



>ref|XP_007038675.1| Remorin family protein [Theobroma cacao]
 gb|EOY23176.1| Remorin family protein [Theobroma cacao]
Length=408

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS++RD VLARV T+K+ SLIKAWEESEKSK+ENKA KKLS +++WEN +KA++EAELKK
Sbjct  283  GSVNRDAVLARVETQKRVSLIKAWEESEKSKAENKAYKKLSSIAAWENSRKAALEAELKK  342

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEEKLE QKAEY+EKMKNK+A++HK
Sbjct  343  IEEKLEKQKAEYVEKMKNKVALIHK  367



>gb|AGR88905.1| remorin 1 [Datisca glomerata]
Length=202

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS++RD VLARVATEK+ SLIKAWEESEKSK+ENKA KKLS + +WEN +KAS+EAELKK
Sbjct  75   GSVNRDAVLARVATEKRMSLIKAWEESEKSKAENKAHKKLSAIVAWENSRKASVEAELKK  134

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEE+LE +KAEY+EK KNKIA +HK
Sbjct  135  IEEQLEKKKAEYVEKQKNKIAQIHK  159



>ref|NP_001275297.1| putative remorin a4-e8 [Solanum tuberosum]
 gb|ABU49728.1| putative remorin a4-e8 [Solanum tuberosum]
Length=196

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GSIDRD  LAR+ TEK+ SLIKAWEESEKSK+ENKAQKK SE+ +WEN KKAS+EAELK+
Sbjct  70   GSIDRDATLARLTTEKRLSLIKAWEESEKSKAENKAQKKRSEILAWENSKKASLEAELKR  129

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
             EE+L  +KAEYIEK+KNKIA++HK
Sbjct  130  TEEQLLKKKAEYIEKLKNKIALVHK  154



>ref|XP_011023368.1| PREDICTED: remorin-like [Populus euphratica]
Length=196

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
            GGSIDRDV LA +  EK+ S IKAWE+SEKSK+ENK+QKKLS V++WEN KKA++EA+L+
Sbjct  70   GGSIDRDVALADLEKEKRLSFIKAWEDSEKSKAENKSQKKLSAVAAWENSKKAALEAKLR  129

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
            KIEEKLE QKAEY EKMKNKIA++HK
Sbjct  130  KIEEKLEKQKAEYAEKMKNKIALIHK  155



>ref|XP_008439225.1| PREDICTED: remorin-like [Cucumis melo]
Length=202

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GSI+RD VLARVATEK+ SLIKAWEESEKSK+EN+A KKLS + SWEN KKA++EAELK+
Sbjct  75   GSINRDAVLARVATEKRLSLIKAWEESEKSKAENRAHKKLSAIGSWENSKKAAVEAELKQ  134

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEEKLE +K EYIEKMKNKIA++HK
Sbjct  135  IEEKLEKKKGEYIEKMKNKIALIHK  159



>ref|XP_009141722.1| PREDICTED: remorin-like isoform X1 [Brassica rapa]
 ref|XP_009141730.1| PREDICTED: remorin-like isoform X1 [Brassica rapa]
Length=197

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GSI+RD VLARV TEK+ SLIKAWEE+EK K ENKA+KKLS + SWEN KKA++EAELKK
Sbjct  72   GSINRDAVLARVETEKRMSLIKAWEEAEKCKVENKAEKKLSSIESWENNKKAAVEAELKK  131

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEE+LE +KAEY+E MKNKIA +HK
Sbjct  132  IEEQLEKKKAEYVELMKNKIAQIHK  156



>emb|CDX87157.1| BnaC09g04720D [Brassica napus]
Length=194

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GSI+RD VLARV TEK+ SLIKAWEE+EK K ENKA+KKLS + SWEN KKA++EAELKK
Sbjct  69   GSINRDAVLARVETEKRMSLIKAWEEAEKCKVENKAEKKLSSIESWENNKKAAVEAELKK  128

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEE+LE +KAEY+E MKNKIA +HK
Sbjct  129  IEEQLEKKKAEYVELMKNKIAQIHK  153



>ref|XP_009141736.1| PREDICTED: remorin-like isoform X2 [Brassica rapa]
Length=196

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GSI+RD VLARV TEK+ SLIKAWEE+EK K ENKA+KKLS + SWEN KKA++EAELKK
Sbjct  71   GSINRDAVLARVETEKRMSLIKAWEEAEKCKVENKAEKKLSSIESWENNKKAAVEAELKK  130

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEE+LE +KAEY+E MKNKIA +HK
Sbjct  131  IEEQLEKKKAEYVELMKNKIAQIHK  155



>gb|KJB23875.1| hypothetical protein B456_004G118800 [Gossypium raimondii]
Length=192

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 76/85 (89%), Gaps = 1/85 (1%)
 Frame = +3

Query  294  SIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk-  470
            S+DRD VLARVATEK+ SLI AWEESEKSK+ENKAQKKLS +++WEN KKA+IEAELK+ 
Sbjct  67   SVDRDAVLARVATEKRISLINAWEESEKSKAENKAQKKLSSIAAWENTKKAAIEAELKRI  126

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
             +EKLE QKAEY+EKMKNK A++HK
Sbjct  127  EQEKLEKQKAEYVEKMKNKAALIHK  151



>ref|NP_001236279.1| uncharacterized protein LOC100305501 [Glycine max]
 gb|ACU13201.1| unknown [Glycine max]
 gb|KHN21737.1| Remorin [Glycine soja]
Length=194

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS++RD VLARVATEK+ SLIKAWEESEKSK++NK+ KKLS +S+WEN KKA+ EAEL+K
Sbjct  69   GSVNRDAVLARVATEKRLSLIKAWEESEKSKADNKSHKKLSAISAWENSKKAAAEAELRK  128

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEE+LE +KAEY EK+KNKIA +H+
Sbjct  129  IEEQLEKKKAEYGEKLKNKIATIHR  153



>ref|XP_006652568.1| PREDICTED: remorin-like [Oryza brachyantha]
Length=202

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 91/110 (83%), Gaps = 1/110 (1%)
 Frame = +3

Query  216  DDSKALvvvenkapepepveekkeGGSIDRDVVLARVATEKKHSLIkaweeseksksenk  395
            DDSKAL +VE  A EP   +  K GGS DRD+ LA+V +EK++SLIKAWEE+EK+K+ENK
Sbjct  51   DDSKALAIVEKVADEPPAEKPAK-GGSNDRDIALAKVESEKRNSLIKAWEENEKTKAENK  109

Query  396  aqkkLSEVSSWENkkkasieaelkkieekleVQKAEYIEKMKNKIAMLHK  545
            A KKLS + SWEN KKA+IEAELKKIEE+LE +KAEY EKMKNK+A++HK
Sbjct  110  ASKKLSAILSWENTKKANIEAELKKIEEQLEKKKAEYAEKMKNKVAIVHK  159



>ref|XP_006394639.1| hypothetical protein EUTSA_v10004940mg [Eutrema salsugineum]
 gb|ESQ31925.1| hypothetical protein EUTSA_v10004940mg [Eutrema salsugineum]
Length=202

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS++RD VLARV TEK+ SLIKAWEE+EK K ENKA+KKLS + SWEN KKA++EAELKK
Sbjct  77   GSVNRDAVLARVETEKRMSLIKAWEEAEKCKVENKAEKKLSSIGSWENNKKAAVEAELKK  136

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            +EE+LE +KAEY+E MKNKIA +HK
Sbjct  137  MEEQLEKKKAEYVELMKNKIAQIHK  161



>emb|CAD29780.1| putative remorin 1 protein [Oryza sativa]
Length=195

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 89/109 (82%), Gaps = 1/109 (1%)
 Frame = +3

Query  216  DDSKALvvvenkapepepveekkeGGSIDRDVVLARVATEKKHSLIkaweeseksksenk  395
            DDSKAL +VE  A EP   +  + GGS DRDV LARV TEK++SLIKAWEE+EK+K+ENK
Sbjct  55   DDSKALAIVEKVADEPPAEKPAQ-GGSNDRDVALARVETEKRNSLIKAWEENEKTKAENK  113

Query  396  aqkkLSEVSSWENkkkasieaelkkieekleVQKAEYIEKMKNKIAMLH  542
            A KKLS + SWEN KKA+IEA+LKKIEE+LE +KAEY EKM NK+A++H
Sbjct  114  ASKKLSAILSWENTKKANIEAQLKKIEEQLEKKKAEYSEKMXNKVAIVH  162



>ref|XP_009150904.1| PREDICTED: remorin-like [Brassica rapa]
 emb|CDX88048.1| BnaA06g26390D [Brassica napus]
Length=205

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS++RD VLARV TEK+ SLIKAWEE+EK K ENKA+KKLS + SWEN KKA++EAELKK
Sbjct  80   GSVNRDAVLARVETEKRMSLIKAWEEAEKCKVENKAEKKLSSIGSWENNKKAAVEAELKK  139

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            +EE+LE +KAEY+E MKNKIA +HK
Sbjct  140  MEEQLEKKKAEYVELMKNKIAQIHK  164



>dbj|BAJ90231.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93224.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=211

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
            GGS DRD+ LARV +EK++SLIKAWEE+EK+K+ENKA KK+S + SWEN KKA+IEA+LK
Sbjct  83   GGSNDRDLALARVESEKRNSLIKAWEENEKTKAENKATKKVSAILSWENTKKANIEAQLK  142

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
            KIEE+LE +KAEY EKMKNK AM+HK
Sbjct  143  KIEEQLEKKKAEYAEKMKNKAAMIHK  168



>ref|XP_010519484.1| PREDICTED: remorin-like isoform X1 [Tarenaya hassleriana]
Length=188

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
            G S+DRD VLARV TEK+ SLIKAWEE+EKSK +NKAQKKLS + +WEN KKAS+EA+LK
Sbjct  62   GSSVDRDAVLARVETEKRMSLIKAWEEAEKSKVDNKAQKKLSAIGAWENSKKASVEADLK  121

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
            KIEE+LE QKAEY EKMKNKIA + +
Sbjct  122  KIEEQLEKQKAEYAEKMKNKIAEIQR  147



>ref|XP_011048713.1| PREDICTED: remorin isoform X2 [Populus euphratica]
Length=197

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
             S++RD VLARVATEK+ SL+KAWEESEKSK+ENKA +KLS ++SWEN KKAS+EAEL K
Sbjct  72   SSVNRDAVLARVATEKRISLVKAWEESEKSKAENKAHRKLSSITSWENSKKASVEAELMK  131

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEE+LE +KAE +EKMKNKIAM+HK
Sbjct  132  IEEQLEKKKAECMEKMKNKIAMIHK  156



>gb|EMT30253.1| hypothetical protein F775_30825 [Aegilops tauschii]
Length=214

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
            GGS DRD+ LARV +EK++SLIKAWEE+EK+K+ENKA KK+S + SWEN KKA+IEA+LK
Sbjct  86   GGSNDRDLALARVESEKRNSLIKAWEENEKTKAENKATKKVSAILSWENTKKANIEAQLK  145

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
            KIEE+LE +KAEY EKMKNK AM+HK
Sbjct  146  KIEEQLEKKKAEYAEKMKNKAAMIHK  171



>ref|XP_002302576.1| DNA-binding family protein [Populus trichocarpa]
 gb|ABK92585.1| unknown [Populus trichocarpa]
 gb|EEE81849.1| DNA-binding family protein [Populus trichocarpa]
Length=196

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
            GGSIDRDV LA +  EK+ S IKAWE+SEK+K+ENK+QK  S V++WEN KKA++EA+L+
Sbjct  70   GGSIDRDVALADLEKEKRLSFIKAWEDSEKTKAENKSQKNFSAVAAWENSKKAALEAKLR  129

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
            K+EEKLE QKAEY EKMKNKIA++HK
Sbjct  130  KMEEKLEKQKAEYAEKMKNKIALIHK  155



>ref|XP_011048714.1| PREDICTED: remorin isoform X3 [Populus euphratica]
Length=193

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
             S++RD VLARVATEK+ SL+KAWEESEKSK+ENKA +KLS ++SWEN KKAS+EAEL K
Sbjct  68   SSVNRDAVLARVATEKRISLVKAWEESEKSKAENKAHRKLSSITSWENSKKASVEAELMK  127

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEE+LE +KAE +EKMKNKIAM+HK
Sbjct  128  IEEQLEKKKAECMEKMKNKIAMIHK  152



>ref|XP_011048712.1| PREDICTED: remorin isoform X1 [Populus euphratica]
Length=198

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
             S++RD VLARVATEK+ SL+KAWEESEKSK+ENKA +KLS ++SWEN KKAS+EAEL K
Sbjct  73   SSVNRDAVLARVATEKRISLVKAWEESEKSKAENKAHRKLSSITSWENSKKASVEAELMK  132

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEE+LE +KAE +EKMKNKIAM+HK
Sbjct  133  IEEQLEKKKAECMEKMKNKIAMIHK  157



>ref|XP_010421184.1| PREDICTED: remorin-like [Camelina sativa]
Length=214

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS++RD VLARV TEK+ SLIKAWEE+EK K ENKA+KKLS + SWEN KKA++EAELKK
Sbjct  89   GSVNRDAVLARVETEKRMSLIKAWEEAEKCKIENKAEKKLSSIGSWENNKKAAVEAELKK  148

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            +EE+LE +KAEY+E MKNKIA +HK
Sbjct  149  MEEQLEKKKAEYVELMKNKIAQIHK  173



>ref|XP_006288585.1| hypothetical protein CARUB_v10001880mg [Capsella rubella]
 gb|EOA21483.1| hypothetical protein CARUB_v10001880mg [Capsella rubella]
Length=230

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS++RD VLARV TEK+ SLIKAWEE+EK K ENKA+KKLS + SWEN KKA++EAELKK
Sbjct  105  GSVNRDAVLARVETEKRMSLIKAWEEAEKCKVENKAEKKLSSIGSWENNKKAAVEAELKK  164

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            +EE+LE +KAEY+E MKNKIA +HK
Sbjct  165  MEEQLEKKKAEYVEVMKNKIAQIHK  189



>ref|XP_011076174.1| PREDICTED: remorin-like [Sesamum indicum]
Length=195

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GSI+RD VLARVATEK+ SLIKAWEESEKSK+ENKAQ K+S +++WEN KKAS+EAELKK
Sbjct  70   GSINRDAVLARVATEKRLSLIKAWEESEKSKAENKAQMKVSAIAAWENSKKASLEAELKK  129

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEE+LE +KA+YIE MKN++A++HK
Sbjct  130  IEEQLEKKKAKYIETMKNRVALIHK  154



>ref|XP_009409422.1| PREDICTED: remorin-like [Musa acuminata subsp. malaccensis]
Length=192

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 85/110 (77%), Gaps = 3/110 (3%)
 Frame = +3

Query  216  DDSKALvvvenkapepepveekkeGGSIDRDVVLARVATEKKHSLIkaweeseksksenk  395
            DDSKAL +VE     P        GGS +RD VLAR+ TEK+ SLIKAWEE+EK+K+ENK
Sbjct  43   DDSKALAIVEKVEDPPAEKSS---GGSTERDAVLARLETEKRLSLIKAWEENEKTKAENK  99

Query  396  aqkkLSEVSSWENkkkasieaelkkieekleVQKAEYIEKMKNKIAMLHK  545
            A KKLS + +WEN KKA++EAEL++ EE+LE +KAEY EKMKNK+A+LHK
Sbjct  100  AVKKLSSILAWENTKKAAVEAELRRKEEELEKRKAEYAEKMKNKVALLHK  149



>ref|XP_010550763.1| PREDICTED: remorin-like isoform X2 [Tarenaya hassleriana]
Length=197

 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
            GGS++RD VLARV TEK+ SLIKAWEE+EK K ENKA + LS + +WEN KKAS+EAELK
Sbjct  71   GGSVERDAVLARVETEKRMSLIKAWEEAEKCKVENKAHRNLSAIGAWENSKKASVEAELK  130

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
            KIEE+LE +KAEY EKMKN+IA +H+
Sbjct  131  KIEEQLEKKKAEYREKMKNRIAEIHR  156



>ref|XP_010550762.1| PREDICTED: remorin-like isoform X1 [Tarenaya hassleriana]
Length=198

 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
            GGS++RD VLARV TEK+ SLIKAWEE+EK K ENKA + LS + +WEN KKAS+EAELK
Sbjct  72   GGSVERDAVLARVETEKRMSLIKAWEEAEKCKVENKAHRNLSAIGAWENSKKASVEAELK  131

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
            KIEE+LE +KAEY EKMKN+IA +H+
Sbjct  132  KIEEQLEKKKAEYREKMKNRIAEIHR  157



>ref|XP_003556104.1| PREDICTED: remorin-like [Glycine max]
 gb|KHN26658.1| Remorin [Glycine soja]
Length=197

 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS++RD VLARVATEK+ SLIKAWEESEKSKSENK+ KKLS +S+WEN  KA+ EAEL+K
Sbjct  72   GSVNRDAVLARVATEKRLSLIKAWEESEKSKSENKSHKKLSVISAWENSMKAAAEAELRK  131

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEE+LE +KAEY EK+KNKIA +H+
Sbjct  132  IEEQLEKKKAEYGEKLKNKIATIHR  156



>gb|AFK45936.1| unknown [Lotus japonicus]
Length=215

 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GSI+RD VL RVATEK+ SLIKAWEESEKS ++NKA KKLS++S+WEN K A+ E EL+K
Sbjct  90   GSINRDAVLTRVATEKRLSLIKAWEESEKSIADNKAHKKLSDISAWENSKIAAKEVELRK  149

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEE LE +KA Y+EK+KNKIAM+H+
Sbjct  150  IEENLEKKKAVYVEKLKNKIAMVHR  174



>ref|XP_010454663.1| PREDICTED: remorin-like [Camelina sativa]
Length=216

 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS++RD VLARV TEK+ SLIKAWEE+EK K ENKA+KKLS + SWEN KKA++EAELKK
Sbjct  91   GSVNRDAVLARVETEKRLSLIKAWEEAEKCKVENKAEKKLSSIGSWENNKKAAVEAELKK  150

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            +EE+LE +KAEY+E MKNKIA +HK
Sbjct  151  MEEQLEKKKAEYVEVMKNKIAQIHK  175



>gb|AFK41243.1| unknown [Lotus japonicus]
Length=215

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GSI+RD VL RVATEK+ SLIKAWEESEKS ++NKA KKLS++S+WEN K A+ E EL+K
Sbjct  90   GSINRDAVLTRVATEKRLSLIKAWEESEKSIADNKAHKKLSDISAWENSKIAAKEVELRK  149

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEE LE +KA Y+EK+KNKIAM+H+
Sbjct  150  IEENLEKKKAVYVEKLKNKIAMVHR  174



>ref|XP_007218390.1| hypothetical protein PRUPE_ppa011367mg [Prunus persica]
 gb|EMJ19589.1| hypothetical protein PRUPE_ppa011367mg [Prunus persica]
Length=214

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS++RD VLARVATEK+ SLI+AWEESEKSK+ENKA KKLS V SWEN KKA++EAELKK
Sbjct  87   GSVNRDAVLARVATEKRLSLIRAWEESEKSKAENKAHKKLSAVGSWENTKKATVEAELKK  146

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEEKLE +KAEY+E+MKNKIA++HK
Sbjct  147  IEEKLEKKKAEYVEQMKNKIALIHK  171



>ref|XP_008234255.1| PREDICTED: remorin-like [Prunus mume]
Length=212

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS++RD VLARVATEK+ SLI+AWEESEKSK+ENKA KKLS V SWEN KKA++EAELKK
Sbjct  85   GSVNRDAVLARVATEKRLSLIRAWEESEKSKAENKAHKKLSAVGSWENTKKATVEAELKK  144

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEEKLE +KAEY+E+MKNKIA++HK
Sbjct  145  IEEKLEKKKAEYVEQMKNKIALIHK  169



>ref|XP_002320784.1| DNA-binding family protein [Populus trichocarpa]
 gb|EEE99099.1| DNA-binding family protein [Populus trichocarpa]
Length=193

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
            GGSIDRD+ LA +  EK+ S IKAWE+SEK+K+ENK+QKKLS V +WEN KKA++EA L+
Sbjct  67   GGSIDRDIALADLEKEKRLSFIKAWEDSEKTKAENKSQKKLSAVVAWENSKKAALEATLR  126

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
            K+EEKLE QKAEY EKMKNK+A++HK
Sbjct  127  KMEEKLEKQKAEYAEKMKNKVALIHK  152



>ref|XP_011035931.1| PREDICTED: remorin [Populus euphratica]
Length=193

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
            GGSIDRD+ LA +  EK+ S IKAWE+SEK+K+ENK+QKKLS V +WEN KKA++EA L+
Sbjct  67   GGSIDRDIALADLEKEKRLSFIKAWEDSEKTKAENKSQKKLSAVVAWENSKKAALEATLR  126

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
            K+EEKLE QKAEY EKMKNK+A++HK
Sbjct  127  KMEEKLEKQKAEYAEKMKNKVALIHK  152



>gb|KDO60012.1| hypothetical protein CISIN_1g028549mg [Citrus sinensis]
Length=207

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 81/111 (73%), Gaps = 1/111 (1%)
 Frame = +3

Query  216  DDSKALvvvenkapepepveekkeGGSIDRDVVLARVATEKKHSLIka-weeseksksen  392
            ++SKAL VV+       P  EK   GS++RD VLARV TEK+ SLI+A  E  +     N
Sbjct  54   EESKALAVVDKAPEAEPPAGEKSTEGSVNRDAVLARVETEKRISLIRAWEESEKSQAENN  113

Query  393  kaqkkLSEVSSWENkkkasieaelkkieekleVQKAEYIEKMKNKIAMLHK  545
            +A KKLS + SWEN +KA++EAELKKIEE+LE +KAEY+EKMKNK+A++HK
Sbjct  114  RAHKKLSSIVSWENSRKAAVEAELKKIEEQLEKKKAEYVEKMKNKMALIHK  164



>ref|XP_008661880.1| PREDICTED: remorin isoform X1 [Zea mays]
Length=200

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 94/110 (85%), Gaps = 1/110 (1%)
 Frame = +3

Query  216  DDSKALvvvenkapepepveekkeGGSIDRDVVLARVATEKKHSLIkaweeseksksenk  395
            DDSKAL +VENK+   +P+ EK+ G SI RD+ LARV TEK++SLIKAWE++EK+K++NK
Sbjct  49   DDSKALAIVENKSTPEKPIAEKQGGSSI-RDLALARVETEKRNSLIKAWEDNEKAKADNK  107

Query  396  aqkkLSEVSSWENkkkasieaelkkieekleVQKAEYIEKMKNKIAMLHK  545
            A KK+S + SWEN KKA+IEAE+KKIEE+LE +KAEY EKMKNK+AM+H+
Sbjct  108  ATKKVSVILSWENTKKANIEAEMKKIEEQLEKKKAEYAEKMKNKVAMIHR  157



>ref|XP_008438060.1| PREDICTED: uncharacterized protein At3g61260 [Cucumis melo]
Length=183

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
            GGSIDRD+ LA V  EK+ S IKAWE+SEKSK+ENKAQKKLS V +WEN KKA++EA+LK
Sbjct  57   GGSIDRDIALAEVEKEKRFSFIKAWEDSEKSKAENKAQKKLSSVLAWENSKKANLEAKLK  116

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
            KIEE LE +KAEY EKMKNK+A++HK
Sbjct  117  KIEEDLEKKKAEYGEKMKNKVALIHK  142



>ref|XP_010055168.1| PREDICTED: remorin-like [Eucalyptus grandis]
 gb|KCW71646.1| hypothetical protein EUGRSUZ_E00174 [Eucalyptus grandis]
Length=186

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
            GGSIDRD+ LA V  EK+ S IKAWE+SEK+K+ENKAQKKLS V+SWEN KKA+ EA+L+
Sbjct  60   GGSIDRDIALAEVEKEKRMSFIKAWEDSEKTKAENKAQKKLSAVTSWENSKKAAAEAKLR  119

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
            K+EE LE +KA+Y E+MKNK++++HK
Sbjct  120  KMEEVLEKKKAQYAEQMKNKVSLIHK  145



>ref|XP_002874146.1| hypothetical protein ARALYDRAFT_489237 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50405.1| hypothetical protein ARALYDRAFT_489237 [Arabidopsis lyrata subsp. 
lyrata]
Length=210

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS+ RD VLARV TEK+ SLIKAWEE+EK K ENKA+KKLS + SWEN KKA++EAELKK
Sbjct  85   GSVHRDAVLARVETEKRMSLIKAWEEAEKCKVENKAEKKLSSIGSWENNKKAAVEAELKK  144

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            +EE LE +KAEY+E MKNKIA +HK
Sbjct  145  MEEHLEKKKAEYVELMKNKIAQIHK  169



>gb|KDP28652.1| hypothetical protein JCGZ_14423 [Jatropha curcas]
Length=194

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
            GGS+DRD+ LA V  EK++S IKAWE+SEKSK+ENKAQKK S V +WEN KKA++EA+L+
Sbjct  68   GGSLDRDIALAEVEKEKRNSFIKAWEDSEKSKAENKAQKKKSAVEAWENSKKAALEAKLR  127

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
            KIEE+LE +KAEY EKMKNKIA++HK
Sbjct  128  KIEEQLEKKKAEYAEKMKNKIALVHK  153



>ref|XP_011030102.1| PREDICTED: remorin-like isoform X1 [Populus euphratica]
Length=205

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS++RD VLARV TEK+ SLIKAWEESEKSK+ENKA KKLS ++SWEN KKAS+EAELKK
Sbjct  78   GSVNRDAVLARVVTEKRISLIKAWEESEKSKAENKAHKKLSSIASWENSKKASVEAELKK  137

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEEKLE +KAEY+EKMKNKIA++HK
Sbjct  138  IEEKLEKKKAEYVEKMKNKIAVIHK  162



>ref|XP_011030103.1| PREDICTED: remorin-like isoform X2 [Populus euphratica]
Length=204

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS++RD VLARV TEK+ SLIKAWEESEKSK+ENKA KKLS ++SWEN KKAS+EAELKK
Sbjct  77   GSVNRDAVLARVVTEKRISLIKAWEESEKSKAENKAHKKLSSIASWENSKKASVEAELKK  136

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEEKLE +KAEY+EKMKNKIA++HK
Sbjct  137  IEEKLEKKKAEYVEKMKNKIAVIHK  161



>ref|XP_004510806.1| PREDICTED: remorin-like [Cicer arietinum]
Length=194

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
            GGS+DRD+ LA +  EK+ S +KAWEESEK+K+ NKAQK+LS V++WEN KKA+IEA+L+
Sbjct  68   GGSLDRDIALAEIEKEKRLSNVKAWEESEKTKANNKAQKQLSSVAAWENSKKAAIEAQLR  127

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
            KIEE+LE +KAEY EKMKNKIAM+HK
Sbjct  128  KIEEQLEKKKAEYGEKMKNKIAMVHK  153



>ref|NP_001147227.1| remorin [Zea mays]
 gb|ACG26230.1| remorin [Zea mays]
 gb|AFW58967.1| remorin [Zea mays]
Length=202

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 88/111 (79%), Gaps = 1/111 (1%)
 Frame = +3

Query  216  DDSKALvvvenkapepepve-ekkeGGSIDRDVVLARVATEKKHSLIkaweeseksksen  392
            DDSKAL +VE            +K+GGS  RD+ LARV TEK++SLIKAWE++EK+K++N
Sbjct  49   DDSKALAIVEIADKSTPEKPIAEKQGGSSIRDLALARVETEKRNSLIKAWEDNEKAKADN  108

Query  393  kaqkkLSEVSSWENkkkasieaelkkieekleVQKAEYIEKMKNKIAMLHK  545
            KA KK+S + SWEN KKA+IEAE+KKIEE+LE +KAEY EKMKNK+AM+H+
Sbjct  109  KATKKVSVILSWENTKKANIEAEMKKIEEQLEKKKAEYAEKMKNKVAMIHR  159



>ref|XP_010493498.1| PREDICTED: remorin-like [Camelina sativa]
Length=206

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS++RD VLARV  EK+ SLIKAWEE+EK K ENKA+KKLS + SWEN KKA++EAELKK
Sbjct  81   GSVNRDAVLARVEIEKRMSLIKAWEEAEKCKVENKAEKKLSSIGSWENNKKAAVEAELKK  140

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            +EE+LE +KAEY+E MKNKIA +HK
Sbjct  141  MEEQLEKKKAEYVELMKNKIAQIHK  165



>gb|EYU19543.1| hypothetical protein MIMGU_mgv1a014270mg [Erythranthe guttata]
Length=195

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +3

Query  300  DRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkkiee  479
            DRDVVLARVATEK+ SLI+AWEESEKSK+ENKAQKK+S V++WEN KKA+IEAELKKIEE
Sbjct  73   DRDVVLARVATEKRLSLIQAWEESEKSKAENKAQKKVSAVAAWENSKKANIEAELKKIEE  132

Query  480  kleVQKAEYIEKMKNKIAMLHK  545
            KLE +KAEY+EKMKNK+AM+HK
Sbjct  133  KLEKKKAEYVEKMKNKVAMVHK  154



>ref|XP_002510796.1| Remorin, putative [Ricinus communis]
 gb|EEF51398.1| Remorin, putative [Ricinus communis]
Length=182

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 87/110 (79%), Gaps = 6/110 (5%)
 Frame = +3

Query  216  DDSKALvvvenkapepepveekkeGGSIDRDVVLARVATEKKHSLIkaweeseksksenk  395
            DDSKALV VE    E          GS++RD VLARV TEK+ SLI+AWEESEKSK+ENK
Sbjct  38   DDSKALVAVEKSVEEKSTE------GSVNRDAVLARVETEKRVSLIRAWEESEKSKAENK  91

Query  396  aqkkLSEVSSWENkkkasieaelkkieekleVQKAEYIEKMKNKIAMLHK  545
            A KKLS + SWEN KKAS+EAELK++EEKLE +KAEY+EKMKNKIA++HK
Sbjct  92   AHKKLSAIVSWENSKKASVEAELKQMEEKLEKKKAEYVEKMKNKIALIHK  141



>gb|ABK23302.1| unknown [Picea sitchensis]
Length=197

 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
            GGS+DRD  L +V TEK+ +L+KAWEE+EK+K+ENK  K +S +++WEN KK+S E  +K
Sbjct  69   GGSLDRDAFLVKVNTEKRLALVKAWEENEKAKAENKYYKSVSTITAWENTKKSSAETRMK  128

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
            + EEKLE QKA Y+EKMKN+IA++HK
Sbjct  129  RAEEKLEKQKAAYVEKMKNEIAIIHK  154



>ref|XP_007143402.1| hypothetical protein PHAVU_007G069500g [Phaseolus vulgaris]
 gb|ESW15396.1| hypothetical protein PHAVU_007G069500g [Phaseolus vulgaris]
Length=198

 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +3

Query  294  SIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkki  473
            S++RD VLARVATEK+ SLIKAWEESEKSK+ENKA K +S +S+WEN KKA+ EAEL+KI
Sbjct  74   SVNRDAVLARVATEKRLSLIKAWEESEKSKAENKAHKNISAISAWENSKKAATEAELRKI  133

Query  474  eekleVQKAEYIEKMKNKIAMLHK  545
            EE+LE +KAEY EK+KNKIA +H+
Sbjct  134  EEQLEKKKAEYGEKLKNKIATIHR  157



>ref|XP_004140777.1| PREDICTED: remorin-like [Cucumis sativus]
 gb|KGN57372.1| hypothetical protein Csa_3G182080 [Cucumis sativus]
Length=203

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GSI+RD VLARVATEK+ SLIKAWEESEKSK+EN+A KKLS + SWEN KKA++EAELK+
Sbjct  78   GSINRDAVLARVATEKRLSLIKAWEESEKSKAENRAHKKLSAIGSWENSKKAAVEAELKQ  137

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEEK E +K E+IEKMKNKIA +HK
Sbjct  138  IEEKFEKKKGEHIEKMKNKIASIHK  162



>ref|XP_010273101.1| PREDICTED: remorin-like [Nelumbo nucifera]
Length=194

 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS DRD+VLARV  EK  SLIKAWEESEK+K+ NKA KKLS + SWEN KKAS+EA+L+K
Sbjct  69   GSADRDIVLARVEKEKTLSLIKAWEESEKAKAGNKADKKLSAIGSWENSKKASVEAQLRK  128

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            +EE+ E +KA Y EKMKNKIA +HK
Sbjct  129  VEEQYEKKKAGYAEKMKNKIAQVHK  153



>ref|XP_007135038.1| hypothetical protein PHAVU_010G096300g [Phaseolus vulgaris]
 gb|AGV54511.1| remorin family protein [Phaseolus vulgaris]
 gb|ESW07032.1| hypothetical protein PHAVU_010G096300g [Phaseolus vulgaris]
Length=198

 Score = 56.2 bits (134),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
            GGS+DRD+ LA +  EK+ S +KAWEESEKSK+ENKAQK LS V++WEN KKA++EA+L+
Sbjct  72   GGSLDRDIALAEIEKEKRFSNVKAWEESEKSKAENKAQKHLSAVAAWENSKKAALEAQLR  131

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
            KIEE+LE +KAEY EKMKNKIA++HK
Sbjct  132  KIEEQLEKKKAEYGEKMKNKIALVHK  157



>ref|XP_004133871.1| PREDICTED: uncharacterized protein At3g61260-like [Cucumis sativus]
 ref|XP_004155821.1| PREDICTED: uncharacterized protein At3g61260-like [Cucumis sativus]
 gb|KGN56525.1| hypothetical protein Csa_3G122490 [Cucumis sativus]
Length=183

 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
            GGSIDRD+ LA V  EK+ S IKAWE+SEKSK+ENKAQKKLS V +WEN KKA++EA+LK
Sbjct  57   GGSIDRDIALAEVEKEKRFSFIKAWEDSEKSKAENKAQKKLSSVLAWENSKKANLEAKLK  116

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
            KIEE LE +KAEY EKMKNK+ ++HK
Sbjct  117  KIEEDLEKKKAEYGEKMKNKVVLIHK  142



>ref|XP_002318224.2| remorin family protein [Populus trichocarpa]
 gb|EEE96444.2| remorin family protein [Populus trichocarpa]
Length=204

 Score = 55.8 bits (133),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS++RD VLARV TEK+ SLIKAWEESEKSK+ENKA KK+S ++SWEN KKAS+EAELKK
Sbjct  77   GSVNRDAVLARVVTEKRISLIKAWEESEKSKAENKAHKKISSIASWENSKKASVEAELKK  136

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEEKLE +KAEY+EKMKNKIA++HK
Sbjct  137  IEEKLEKKKAEYVEKMKNKIAVIHK  161



>gb|KDO86097.1| hypothetical protein CISIN_1g028704mg [Citrus sinensis]
Length=167

 Score = 55.5 bits (132),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
             GS DRDV LA V  EK+ S IKAWEESEK+K+ENKAQKKLS V++WEN KKAS+EA+LK
Sbjct  41   SGSHDRDVALAEVEKEKRESFIKAWEESEKTKAENKAQKKLSAVAAWENSKKASLEAKLK  100

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
            KIEE+LE +KAEY EKMKNK+A++HK
Sbjct  101  KIEEQLERKKAEYAEKMKNKVALVHK  126



>ref|XP_011091944.1| PREDICTED: remorin-like [Sesamum indicum]
Length=186

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS+DRDV LA++  EK+ S IKAWEESEK+K ENKAQKKL++V++WEN KKAS+E++LKK
Sbjct  59   GSLDRDVALAKLEDEKRLSFIKAWEESEKTKVENKAQKKLADVAAWENSKKASLESQLKK  118

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEE+LE +KAEY EKMKNK+A++HK
Sbjct  119  IEEQLEKKKAEYAEKMKNKVALVHK  143



>ref|XP_006445087.1| hypothetical protein CICLE_v10022286mg [Citrus clementina]
 ref|XP_006491065.1| PREDICTED: remorin-like isoform X1 [Citrus sinensis]
 gb|ESR58327.1| hypothetical protein CICLE_v10022286mg [Citrus clementina]
 gb|KDO86096.1| hypothetical protein CISIN_1g028704mg [Citrus sinensis]
Length=205

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
             GS DRDV LA V  EK+ S IKAWEESEK+K+ENKAQKKLS V++WEN KKAS+EA+LK
Sbjct  79   SGSHDRDVALAEVEKEKRESFIKAWEESEKTKAENKAQKKLSAVAAWENSKKASLEAKLK  138

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
            KIEE+LE +KAEY EKMKNK+A++HK
Sbjct  139  KIEEQLERKKAEYAEKMKNKVALVHK  164



>ref|XP_010519485.1| PREDICTED: remorin-like isoform X2 [Tarenaya hassleriana]
Length=186

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 71/86 (83%), Gaps = 2/86 (2%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
            G S+DRD VLARV TEK+ SLIKAWEE+EKSK +NKAQKKLS + +WEN KKAS+EA+LK
Sbjct  62   GSSVDRDAVLARVETEKRMSLIKAWEEAEKSKVDNKAQKKLSAIGAWENSKKASVEADLK  121

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
            KIE +   QKAEY EKMKNKIA + +
Sbjct  122  KIELEK--QKAEYAEKMKNKIAEIQR  145



>ref|NP_001151703.1| LOC100285339 [Zea mays]
 gb|ACG44049.1| remorin [Zea mays]
Length=182

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 82/110 (75%), Gaps = 0/110 (0%)
 Frame = +3

Query  216  DDSKALvvvenkapepepveekkeGGSIDRDVVLARVATEKKHSLIkaweeseksksenk  395
            DDSKA+V +  K            GGS +RD  LA++ +EK+ SLI AWEES+K++++N+
Sbjct  30   DDSKAIVALVVKDAAAGKPSTAIIGGSTERDAYLAKIVSEKRLSLITAWEESQKARADNR  89

Query  396  aqkkLSEVSSWENkkkasieaelkkieekleVQKAEYIEKMKNKIAMLHK  545
            A KKL+ ++SWEN KKA +EAEL+KIEE+L+ +KA Y EK+KNK+AMLH+
Sbjct  90   AAKKLAFITSWENAKKAEMEAELRKIEEQLQKKKAAYEEKLKNKLAMLHR  139



>tpg|DAA42886.1| TPA: remorin [Zea mays]
Length=183

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 82/110 (75%), Gaps = 0/110 (0%)
 Frame = +3

Query  216  DDSKALvvvenkapepepveekkeGGSIDRDVVLARVATEKKHSLIkaweeseksksenk  395
            DDSKA+V +  K            GGS +RD  LA++ +EK+ SLI AWEES+K++++N+
Sbjct  31   DDSKAIVALVVKDAAAGKPSTAIIGGSTERDAYLAKIVSEKRLSLITAWEESQKARADNR  90

Query  396  aqkkLSEVSSWENkkkasieaelkkieekleVQKAEYIEKMKNKIAMLHK  545
            A KKL+ ++SWEN KKA +EAEL+KIEE+L+ +KA Y EK+KNK+AMLH+
Sbjct  91   AAKKLAFITSWENAKKAEMEAELRKIEEQLQKKKAAYEEKLKNKLAMLHR  140



>ref|XP_010544719.1| PREDICTED: remorin-like isoform X1 [Tarenaya hassleriana]
Length=175

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 85/110 (77%), Gaps = 2/110 (2%)
 Frame = +3

Query  216  DDSKALvvvenkapepepveekkeGGSIDRDVVLARVATEKKHSLIkaweeseksksenk  395
            DDSKAL V+E      +       GGSIDRDVVLA +  EK+ S IKAWE+SEK+K+ENK
Sbjct  27   DDSKALAVIEKPEEPEQKKSSS--GGSIDRDVVLADLEKEKRLSFIKAWEDSEKTKAENK  84

Query  396  aqkkLSEVSSWENkkkasieaelkkieekleVQKAEYIEKMKNKIAMLHK  545
            AQKK+S V +WEN KKA+IEAELKKIEE+LE +KAEY E+MKNK+A +HK
Sbjct  85   AQKKISAVLAWENSKKAAIEAELKKIEEQLEKKKAEYGERMKNKVAAIHK  134



>gb|AEK94319.1| remorin [Pyrus x bretschneideri]
Length=198

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
            GGSIDRD+ LA++  EK  S ++AWEESEK+K+ENKAQKKLS+V++WE+ +KA++EA+L+
Sbjct  72   GGSIDRDIALAQLEKEKSMSFVRAWEESEKAKAENKAQKKLSDVTAWESSRKAAVEAKLR  131

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
             IEE+LE +KA+Y EKM+NK+A+LHK
Sbjct  132  SIEEQLEKKKAQYAEKMQNKVALLHK  157



>ref|XP_010544720.1| PREDICTED: remorin-like isoform X2 [Tarenaya hassleriana]
Length=175

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 85/110 (77%), Gaps = 2/110 (2%)
 Frame = +3

Query  216  DDSKALvvvenkapepepveekkeGGSIDRDVVLARVATEKKHSLIkaweeseksksenk  395
            DDSKAL V+E      +       GGSIDRDVVLA +  EK+ S IKAWE+SEK+K+ENK
Sbjct  27   DDSKALAVIEKPEEPEQKKSSS--GGSIDRDVVLADLEKEKRLSFIKAWEDSEKTKAENK  84

Query  396  aqkkLSEVSSWENkkkasieaelkkieekleVQKAEYIEKMKNKIAMLHK  545
            AQKK+S V +WEN KKA+IEAELKKIEE+LE +KAEY E+MKNK+A +HK
Sbjct  85   AQKKISAVLAWENSKKAAIEAELKKIEEQLEKKKAEYGERMKNKVAAIHK  134



>ref|XP_003528866.1| PREDICTED: remorin-like [Glycine max]
Length=198

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
            GGS+DRD+ LA +  EK+ S +KAWEESEKSK+ENKAQK+LS V++WEN KKA++EA+L+
Sbjct  72   GGSLDRDIALAEIEKEKRLSNVKAWEESEKSKAENKAQKQLSAVAAWENSKKAALEAQLR  131

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
            KIEE+LE +KAEY EKMKNKIA++HK
Sbjct  132  KIEEQLEKKKAEYGEKMKNKIALVHK  157



>ref|XP_009615469.1| PREDICTED: remorin-like [Nicotiana tomentosiformis]
Length=201

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS+DRDV LA++ TEK+ S +KAWEESEKSK +NKAQKKLS V+ WEN +KA +EA+ KK
Sbjct  76   GSLDRDVALAQLETEKRSSFVKAWEESEKSKVDNKAQKKLSAVARWENTRKAKLEAKPKK  135

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            +EE+LE +KAEY EK+KNK+A++HK
Sbjct  136  LEEQLEHKKAEYAEKIKNKVALIHK  160



>ref|XP_002304484.1| hypothetical protein POPTR_0003s12450g [Populus trichocarpa]
 gb|EEE79463.1| hypothetical protein POPTR_0003s12450g [Populus trichocarpa]
Length=189

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
            GGS +RD++L+RV TEK+++LIKAW E+EK+K ENKA KKLS + SWE  KK S+EA++ 
Sbjct  61   GGSNNRDIILSRVETEKRYALIKAWVENEKAKVENKAHKKLSAIGSWETTKKVSVEAKIM  120

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
            K EEKLE +KAEY EKMKNK A LHK
Sbjct  121  KFEEKLERKKAEYEEKMKNKAAELHK  146



>ref|XP_009757254.1| PREDICTED: remorin-like [Nicotiana sylvestris]
Length=132

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS+DRDV LA++ TEK+ S +KAWEESEKSK +NKAQKKLS V+ WEN +KA  EA+LKK
Sbjct  7    GSLDRDVALAQLETEKRSSFVKAWEESEKSKVDNKAQKKLSAVARWENTQKAKFEAKLKK  66

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            +EE+LE +KA+Y EK+KNK+A++HK
Sbjct  67   LEEQLEHKKADYAEKIKNKVALIHK  91



>ref|XP_010061086.1| PREDICTED: remorin-like isoform X2 [Eucalyptus grandis]
 gb|KCW90709.1| hypothetical protein EUGRSUZ_A02793 [Eucalyptus grandis]
Length=274

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS  RD  LARV TEKK SLI+AWEESEK K+ENKA KKLS + +WEN KKAS+EAELKK
Sbjct  149  GSGHRDRELARVETEKKMSLIRAWEESEKCKAENKAHKKLSAIGAWENSKKASVEAELKK  208

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEEKLE QKAEY+EKMKNKIA  HK
Sbjct  209  IEEKLEKQKAEYVEKMKNKIAAFHK  233



>ref|XP_010061093.1| PREDICTED: remorin-like isoform X3 [Eucalyptus grandis]
 gb|KCW90708.1| hypothetical protein EUGRSUZ_A02793 [Eucalyptus grandis]
Length=265

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS  RD  LARV TEKK SLI+AWEESEK K+ENKA KKLS + +WEN KKAS+EAELKK
Sbjct  140  GSGHRDRELARVETEKKMSLIRAWEESEKCKAENKAHKKLSAIGAWENSKKASVEAELKK  199

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEEKLE QKAEY+EKMKNKIA  HK
Sbjct  200  IEEKLEKQKAEYVEKMKNKIAAFHK  224



>ref|XP_010061098.1| PREDICTED: remorin-like isoform X4 [Eucalyptus grandis]
 gb|KCW90711.1| hypothetical protein EUGRSUZ_A02793 [Eucalyptus grandis]
Length=264

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS  RD  LARV TEKK SLI+AWEESEK K+ENKA KKLS + +WEN KKAS+EAELKK
Sbjct  139  GSGHRDRELARVETEKKMSLIRAWEESEKCKAENKAHKKLSAIGAWENSKKASVEAELKK  198

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEEKLE QKAEY+EKMKNKIA  HK
Sbjct  199  IEEKLEKQKAEYVEKMKNKIAAFHK  223



>gb|KCW90710.1| hypothetical protein EUGRSUZ_A02793 [Eucalyptus grandis]
Length=265

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS  RD  LARV TEKK SLI+AWEESEK K+ENKA KKLS + +WEN KKAS+EAELKK
Sbjct  140  GSGHRDRELARVETEKKMSLIRAWEESEKCKAENKAHKKLSAIGAWENSKKASVEAELKK  199

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEEKLE QKAEY+EKMKNKIA  HK
Sbjct  200  IEEKLEKQKAEYVEKMKNKIAAFHK  224



>ref|XP_010061078.1| PREDICTED: remorin-like isoform X1 [Eucalyptus grandis]
Length=275

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS  RD  LARV TEKK SLI+AWEESEK K+ENKA KKLS + +WEN KKAS+EAELKK
Sbjct  150  GSGHRDRELARVETEKKMSLIRAWEESEKCKAENKAHKKLSAIGAWENSKKASVEAELKK  209

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEEKLE QKAEY+EKMKNKIA  HK
Sbjct  210  IEEKLEKQKAEYVEKMKNKIAAFHK  234



>ref|XP_006404199.1| hypothetical protein EUTSA_v10011156mg [Eutrema salsugineum]
 gb|ESQ45652.1| hypothetical protein EUTSA_v10011156mg [Eutrema salsugineum]
Length=176

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS+ RD VL R+ TEK+ SLIKAWEE+EKSK ENKAQKKLS V +WEN KKAS+EAELKK
Sbjct  51   GSVYRDAVLTRLETEKRISLIKAWEEAEKSKVENKAQKKLSSVGAWENSKKASVEAELKK  110

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEE+L  +KAEY E+MKNKIA +HK
Sbjct  111  IEEQLIKKKAEYTEQMKNKIAQIHK  135



>ref|XP_008336972.1| PREDICTED: LOW QUALITY PROTEIN: remorin-like [Malus domestica]
 ref|XP_008362621.1| PREDICTED: LOW QUALITY PROTEIN: remorin-like [Malus domestica]
Length=240

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
            GGSIDRD+ LA++  EK  S I+AWEESEK+K+ENKAQKKLS+V++WE+ +KA++EA+L+
Sbjct  72   GGSIDRDIALAQLEKEKSMSFIRAWEESEKAKAENKAQKKLSDVTAWESSRKAAVEAKLR  131

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
             IEE+LE +KA+Y EKM+NK+A+LHK
Sbjct  132  SIEEQLEKKKAQYAEKMQNKVALLHK  157



>ref|XP_007218451.1| hypothetical protein PRUPE_ppa011776mg [Prunus persica]
 gb|EMJ19650.1| hypothetical protein PRUPE_ppa011776mg [Prunus persica]
Length=197

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
            GGSIDRDV L+ +  EK  S I+AWEESEK+K+ENKAQKKLS++++WEN +KA+ EA+L+
Sbjct  71   GGSIDRDVALSHLEKEKSLSFIRAWEESEKAKAENKAQKKLSDITAWENSRKAAAEAKLR  130

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
            ++EEKLE +K +Y EKMKN++A+LHK
Sbjct  131  RMEEKLEKKKTQYAEKMKNQVALLHK  156



>ref|XP_008232793.1| PREDICTED: remorin [Prunus mume]
Length=198

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
            GGSIDRDV L+ +  EK  S I+AWEESEK+K+ENKAQKKLS++++WEN +KA+ EA+L+
Sbjct  72   GGSIDRDVALSHLEKEKSLSFIRAWEESEKAKAENKAQKKLSDITAWENSRKAAAEAKLR  131

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
             +EEKLE +K +Y EKMKN++A+LHK
Sbjct  132  SMEEKLEKKKTQYAEKMKNQVALLHK  157



>ref|XP_004170221.1| PREDICTED: remorin-like [Cucumis sativus]
Length=142

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +3

Query  297  IDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkkie  476
            I+RD VLARVATEK+ SLIKAWEESEKSK+EN+A KKLS + SWEN KKA++EAELK++E
Sbjct  19   INRDAVLARVATEKRLSLIKAWEESEKSKAENRAHKKLSAIGSWENSKKAAVEAELKQME  78

Query  477  ekleVQKAEYIEKMKNKIAMLHK  545
            EK E +K E+IEKMKNKIA++HK
Sbjct  79   EKFEKKKGEHIEKMKNKIALIHK  101



>gb|KCW90714.1| hypothetical protein EUGRSUZ_A02795 [Eucalyptus grandis]
Length=134

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS  R   LARV TEK  SLI+AWEESEK ++ENKA KKLS + +WEN+K AS EAE+KK
Sbjct  9    GSSHRGRELARVETEKTRSLIRAWEESEKCRAENKAYKKLSAIEAWENRKIASTEAEMKK  68

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEE LE++KAEY+EKMKNKIA+ HK
Sbjct  69   IEEMLEIEKAEYVEKMKNKIALYHK  93



>ref|XP_009587316.1| PREDICTED: remorin-like [Nicotiana tomentosiformis]
 gb|AII99827.1| remorin 2 [Nicotiana tabacum]
Length=174

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 83/110 (75%), Gaps = 3/110 (3%)
 Frame = +3

Query  216  DDSKALvvvenkapepepveekkeGGSIDRDVVLARVATEKKHSLIkaweeseksksenk  395
            DDSKAL  V     +      K   GS+DRD+ LA + TEK++S IKAWEESEKSK EN+
Sbjct  25   DDSKALATVPPPKTDSSTKSSK---GSLDRDIALAHLETEKRNSYIKAWEESEKSKVENR  81

Query  396  aqkkLSEVSSWENkkkasieaelkkieekleVQKAEYIEKMKNKIAMLHK  545
            AQKKLS V +WEN KKA++EA+LKK+EE+LE +KAEY EK+KN++A +HK
Sbjct  82   AQKKLSAVGTWENTKKANLEAKLKKLEEQLEEKKAEYAEKIKNRVASVHK  131



>ref|NP_001235181.1| uncharacterized protein LOC100305679 [Glycine max]
 gb|ACU13488.1| unknown [Glycine max]
 gb|KHM99397.1| Remorin [Glycine soja]
Length=183

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GSIDRD+ LA V  EKK S +KAWEESEK+K+EN+AQK LS +++WEN KKA++EAELKK
Sbjct  58   GSIDRDIALAEVEKEKKLSYVKAWEESEKAKAENRAQKHLSAIAAWENSKKAALEAELKK  117

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            +EE+LE +KAEY EKMKNK+A++HK
Sbjct  118  LEEQLEKKKAEYGEKMKNKVALVHK  142



>gb|KFK37371.1| hypothetical protein AALP_AA4G248100 [Arabis alpina]
Length=200

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
             GS+DRDV+LA +  EKK S IKAWEESEK+K+ENKAQKK+S+V +WEN KKA  EA+L+
Sbjct  74   SGSVDRDVILADLEKEKKSSFIKAWEESEKAKAENKAQKKISDVLAWENTKKAETEAQLR  133

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
            K+EEKLE +KAEY EKMKNK+A +HK
Sbjct  134  KMEEKLERKKAEYGEKMKNKVAAIHK  159



>emb|CDX80385.1| BnaC07g30590D [Brassica napus]
Length=388

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS++RD VLARV TEK+ SLIKAWEE+EK K ENKA+KKLS + SWEN KKA++EAELKK
Sbjct  80   GSVNRDAVLARVETEKRMSLIKAWEEAEKCKVENKAEKKLSSIGSWENNKKAAVEAELKK  139

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            +EE+LE +KAE +E MKNKIA +HK
Sbjct  140  MEEQLEKKKAENVELMKNKIAQIHK  164



>ref|XP_007051855.1| Remorin family protein [Theobroma cacao]
 gb|EOX96012.1| Remorin family protein [Theobroma cacao]
Length=192

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 82/110 (75%), Gaps = 3/110 (3%)
 Frame = +3

Query  216  DDSKALvvvenkapepepveekkeGGSIDRDVVLARVATEKKHSLIkaweeseksksenk  395
            DDSKAL VVE              GGS DRD+ LA V  EK+ S ++AWE+SEK+K+ENK
Sbjct  45   DDSKALAVVEKAPEPAPKKIS---GGSHDRDIALAEVEKEKRLSFVRAWEDSEKTKAENK  101

Query  396  aqkkLSEVSSWENkkkasieaelkkieekleVQKAEYIEKMKNKIAMLHK  545
            AQKKLS + +WEN KKA++EA+L+KIEE+LE +KAEY E MKNK+A+LHK
Sbjct  102  AQKKLSSIVAWENSKKAALEAKLRKIEEQLEKKKAEYAENMKNKVALLHK  151



>ref|XP_004306803.1| PREDICTED: remorin-like [Fragaria vesca subsp. vesca]
Length=196

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 84/110 (76%), Gaps = 1/110 (1%)
 Frame = +3

Query  216  DDSKALvvvenkapepepveekkeGGSIDRDVVLARVATEKKHSLIkaweeseksksenk  395
            DDSKAL VVE +       ++   GGS DRDV LA +  EK  S ++AWE+SEK K+ENK
Sbjct  47   DDSKALAVVEPEKVPETIAKKPS-GGSHDRDVALANLEKEKSMSFVRAWEDSEKDKAENK  105

Query  396  aqkkLSEVSSWENkkkasieaelkkieekleVQKAEYIEKMKNKIAMLHK  545
            A+K+LS V++WEN KKA+IEA+L+ +EEKLE +KA+Y EKMKN+IA+LHK
Sbjct  106  AEKRLSTVTAWENTKKAAIEAKLRSMEEKLEKKKAQYAEKMKNQIALLHK  155



>ref|XP_009149781.1| PREDICTED: remorin [Brassica rapa]
Length=175

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS++RD VLA++ TEK+ SLIKAWEE+EKSK ENKAQKKLS V +WEN KKAS EAELKK
Sbjct  50   GSVNRDDVLAKLETEKRMSLIKAWEEAEKSKVENKAQKKLSSVGAWENSKKASAEAELKK  109

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEE+L  +KAEY E+MKNKI  +HK
Sbjct  110  IEEQLIKKKAEYAEQMKNKIVQIHK  134



>ref|XP_010061111.1| PREDICTED: remorin-like [Eucalyptus grandis]
 gb|KCW90713.1| hypothetical protein EUGRSUZ_A02794 [Eucalyptus grandis]
Length=202

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS+ RD  L RV TEK+ SLI+AWEESEKS++ENKA KKLS + +WEN+K AS+EAELKK
Sbjct  75   GSVHRDRELDRVETEKRMSLIRAWEESEKSRAENKAHKKLSAIEAWENRKIASVEAELKK  134

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEEKLE +KAEY+EKMKNKIA+ HK
Sbjct  135  IEEKLEREKAEYVEKMKNKIALYHK  159



>gb|EYU32085.1| hypothetical protein MIMGU_mgv1a014760mg [Erythranthe guttata]
Length=179

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS+DR V  A++  +K+ S +KAWEESEK+K ENKAQKKLSEVS+WEN KKAS+E++LKK
Sbjct  53   GSLDRGVAFAKLEDDKRLSFVKAWEESEKTKVENKAQKKLSEVSAWENSKKASLESDLKK  112

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEE++E +KAEY EKMKNKIA++HK
Sbjct  113  IEEQVEKKKAEYAEKMKNKIALIHK  137



>ref|XP_004496578.1| PREDICTED: remorin-like [Cicer arietinum]
Length=219

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GSI+RD VL RVATEK+ SLIKAWEESEKSK+ENKA +KLS + +WEN KKA+ EAEL+K
Sbjct  94   GSINRDAVLERVATEKRLSLIKAWEESEKSKAENKAHRKLSTILAWENSKKAATEAELRK  153

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            +EEKLE +K EY EKMKNKIA LHK
Sbjct  154  LEEKLEKKKGEYAEKMKNKIAALHK  178



>gb|EPS59685.1| hypothetical protein M569_15119, partial [Genlisea aurea]
Length=137

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS+DRD+ LA+V  +K+ S IKAWE+SEK+K++NKA+KKLSEV+SWEN K+A++E +LK 
Sbjct  12   GSLDRDIALAKVDDDKRLSFIKAWEDSEKTKAQNKAEKKLSEVNSWENSKRAALEGKLKT  71

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
             +E+LE +KA Y EK+KNK+A++HK
Sbjct  72   FDEELEKKKAGYAEKVKNKLAIIHK  96



>ref|XP_004986023.1| PREDICTED: remorin-like [Setaria italica]
Length=187

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
            GGS +RD  LA++ +EK+ +LI AWEESEK+++EN+A KKL+ ++SWEN KKA +EAELK
Sbjct  59   GGSTERDAYLAKIVSEKRLTLITAWEESEKARAENRAAKKLAYITSWENAKKAEMEAELK  118

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
            KIEE+LE +KA Y EK+KNK+AMLHK
Sbjct  119  KIEEQLEKKKAAYEEKLKNKLAMLHK  144



>emb|CDP08838.1| unnamed protein product [Coffea canephora]
Length=181

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS+D+DV LA V  EK+ S IKAWEESEK+K+ENKAQKKLSEVSSWEN KKA+IEA+LKK
Sbjct  55   GSVDKDVALAEVENEKRLSFIKAWEESEKTKAENKAQKKLSEVSSWENTKKAAIEAKLKK  114

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEE+LE +KA+Y E +KNKIA +HK
Sbjct  115  IEEQLEKKKADYGETIKNKIAEIHK  139



>gb|AFK39071.1| unknown [Lotus japonicus]
Length=187

 Score = 53.1 bits (126),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 88/110 (80%), Gaps = 2/110 (2%)
 Frame = +3

Query  216  DDSKALvvvenkapepepveekkeGGSIDRDVVLARVATEKKHSLIkaweeseksksenk  395
            DDSKALVVV  K P PE     K  GS+DRDV LA +  EK+ S +KAWEESEKSK+ENK
Sbjct  38   DDSKALVVVPEKTPVPENKPSSK--GSLDRDVALAELEKEKRLSYVKAWEESEKSKTENK  95

Query  396  aqkkLSEVSSWENkkkasieaelkkieekleVQKAEYIEKMKNKIAMLHK  545
            AQK LS+V +WEN KKA++EA+L+KIEE+LE +KAEY EKMKNKIA++HK
Sbjct  96   AQKNLSDVVAWENSKKAALEAQLRKIEERLEKKKAEYGEKMKNKIALVHK  145



>gb|AFK42693.1| unknown [Lotus japonicus]
Length=194

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
            GGS+DRD  LARV TEK+ +LIKAWEESE++K+EN+A KK S V  WE  +KASIEAELK
Sbjct  66   GGSVDRDAALARVVTEKRLALIKAWEESERTKAENRAYKKQSAVGLWEESRKASIEAELK  125

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
            KIEE LE +KAEY EKMKNKIA +H+
Sbjct  126  KIEENLERKKAEYAEKMKNKIAEIHQ  151



>ref|XP_010061121.1| PREDICTED: remorin-like [Eucalyptus grandis]
Length=201

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS  R   LARV TEK  SLI+AWEESEK ++ENKA KKLS + +WEN+K AS EAE+KK
Sbjct  76   GSSHRGRELARVETEKTRSLIRAWEESEKCRAENKAYKKLSAIEAWENRKIASTEAEMKK  135

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEE LE++KAEY+EKMKNKIA+ HK
Sbjct  136  IEEMLEIEKAEYVEKMKNKIALYHK  160



>ref|XP_008376024.1| PREDICTED: remorin-like [Malus domestica]
Length=204

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
            GGSIDRD+ LA +  EK  S I+AWEESEK+K+ENKAQKKLS+V++WE+ +KA++EA+L+
Sbjct  78   GGSIDRDIALAGLEKEKSMSFIRAWEESEKTKAENKAQKKLSDVTAWESSRKAAVEAKLR  137

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
             IEE+LE +KA+Y EKMKNK+A+L K
Sbjct  138  SIEEQLEKKKAQYAEKMKNKVALLQK  163



>gb|KHG12669.1| Remorin [Gossypium arboreum]
Length=190

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
            GGS DRD+ LA V   K+ S IKAWEESEK+K+ENK+QKKLS + +WEN KKAS+EA+LK
Sbjct  64   GGSHDRDIALAEVEKAKRLSFIKAWEESEKTKAENKSQKKLSAIVAWENSKKASLEAKLK  123

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
            KIEE+LE +KAEY EKMKNK+A+LHK
Sbjct  124  KIEEQLEKKKAEYAEKMKNKVALLHK  149



>ref|XP_010667563.1| PREDICTED: remorin-like [Beta vulgaris subsp. vulgaris]
Length=210

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS+ RD  LARV TEK+ SLIKAWEESEK K+ENKA KK++ + +WEN KKAS+EAELKK
Sbjct  85   GSVGRDAQLARVQTEKRISLIKAWEESEKCKAENKAHKKIAAIEAWENSKKASLEAELKK  144

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEE LE +KAEY EKMKNK+AM HK
Sbjct  145  IEESLEKKKAEYAEKMKNKVAMTHK  169



>ref|XP_004976344.1| PREDICTED: remorin-like [Setaria italica]
Length=212

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 87/112 (78%), Gaps = 2/112 (2%)
 Frame = +3

Query  216  DDSKALv--vvenkapepepveekkeGGSIDRDVVLARVATEKKHSLIkaweesekskse  389
            DDSKAL         P  E    +K+G S DRD+ LARV TEK++SLIKAWEE+EK+K+E
Sbjct  58   DDSKALAIVEKVADEPAAEKPAAEKQGSSNDRDLALARVETEKRNSLIKAWEENEKTKAE  117

Query  390  nkaqkkLSEVSSWENkkkasieaelkkieekleVQKAEYIEKMKNKIAMLHK  545
            NKA KK+S + SWEN KKA+IEA+LKKIEE+LE +KAEY EKMKNK+A++HK
Sbjct  118  NKAAKKISAILSWENTKKANIEAQLKKIEEELEKKKAEYAEKMKNKVAIIHK  169



>ref|XP_006402501.1| hypothetical protein EUTSA_v10006246mg [Eutrema salsugineum]
 gb|ESQ43954.1| hypothetical protein EUTSA_v10006246mg [Eutrema salsugineum]
Length=197

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 84/110 (76%), Gaps = 3/110 (3%)
 Frame = +3

Query  216  DDSKALvvvenkapepepveekkeGGSIDRDVVLARVATEKKHSLIkaweeseksksenk  395
            DDSKAL VVE               GS+DRDV LA ++ EKK S +KAWE+SEKSK+ENK
Sbjct  50   DDSKALAVVEKPVEPETKKSS---SGSLDRDVKLADLSKEKKMSFVKAWEDSEKSKAENK  106

Query  396  aqkkLSEVSSWENkkkasieaelkkieekleVQKAEYIEKMKNKIAMLHK  545
            A+KK+S+V +WEN KKA++EA+LKKIEE+LE +KAEY EKMKNK+A +HK
Sbjct  107  AEKKISDVLAWENSKKAAVEAQLKKIEEQLEKKKAEYAEKMKNKVAAIHK  156



>ref|XP_008377346.1| PREDICTED: remorin-like isoform X1 [Malus domestica]
Length=229

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 77/102 (75%), Gaps = 18/102 (18%)
 Frame = +3

Query  294  SIDRDVVLARVATEKKHSLIkaweeseksksenk------------------aqkkLSEV  419
            S+DRD VLARVATEKK SLI+AWEESEKSK+ENK                  A KKLS +
Sbjct  85   SVDRDAVLARVATEKKLSLIRAWEESEKSKAENKLENPPHVRGRKVHVFAIRAHKKLSAI  144

Query  420  SSWENkkkasieaelkkieekleVQKAEYIEKMKNKIAMLHK  545
             SWEN KKA++EAELKKIEE+LE +KAEY+E+MKNKIA++HK
Sbjct  145  GSWENTKKATVEAELKKIEEQLEKKKAEYVEQMKNKIALIHK  186



>ref|XP_010905109.1| PREDICTED: remorin-like [Elaeis guineensis]
Length=192

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
            GGS +RD  LARV TEK+ SLI+AWEE+E++K+ENKA KK+S +++WEN KKA++EAELK
Sbjct  64   GGSTERDAQLARVETEKRMSLIRAWEENERAKAENKAAKKMSSITAWENSKKAAMEAELK  123

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
              EE+LE +KAEY E+MKNK+AM+HK
Sbjct  124  AKEEELEKKKAEYAEQMKNKMAMVHK  149



>gb|AGG82489.1| remorin 2 [Datisca glomerata]
Length=187

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
            GGSIDRD VLARV TEK+ +LIKAWEESEK+++ENKA KKLS + SWEN+KKAS+EA+L+
Sbjct  59   GGSIDRDAVLARVETEKRLALIKAWEESEKTRAENKAFKKLSAIDSWENRKKASVEAQLR  118

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
            KIEEKLE +KAEY E+MKNK+  +HK
Sbjct  119  KIEEKLEKKKAEYGEQMKNKMVEVHK  144



>ref|NP_001048576.1| Os02g0824500 [Oryza sativa Japonica Group]
 dbj|BAD22865.1| putative DNA-binding protein [Oryza sativa Japonica Group]
 dbj|BAF10490.1| Os02g0824500 [Oryza sativa Japonica Group]
 dbj|BAG99202.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58077.1| hypothetical protein OsJ_08942 [Oryza sativa Japonica Group]
Length=179

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS+DRD +LA V  E+K S+IKAWEESEKSK+ENKAQKK+S + SWEN +KA+IEA+L+ 
Sbjct  52   GSVDRDAILANVELERKLSMIKAWEESEKSKAENKAQKKMSSILSWENTRKAAIEAKLRT  111

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
             EEKLE +KAEY EKM+N++A +HK
Sbjct  112  QEEKLERKKAEYAEKMRNQVAAIHK  136



>gb|AFN53683.1| hypothetical protein [Linum usitatissimum]
Length=422

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS++RD+ LARV TEK+ S IKAWEESEKSK+ENKA KK+S + SWEN KKA++EA+L++
Sbjct  295  GSVNRDLELARVETEKRLSFIKAWEESEKSKAENKAHKKVSAIESWENSKKAAVEAQLRQ  354

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
             EEKLE QKAEY EKMKNKIA +HK
Sbjct  355  YEEKLEKQKAEYAEKMKNKIAEIHK  379



>gb|EEC74277.1| hypothetical protein OsI_09516 [Oryza sativa Indica Group]
Length=179

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS+DRD +LA V  E+K S+IKAWEESEKSK+ENKAQKK+S + SWEN +KA+IEA+L+ 
Sbjct  52   GSVDRDAILANVELERKLSMIKAWEESEKSKAENKAQKKMSSILSWENTRKAAIEAKLRT  111

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
             EEKLE +KAEY EKM+N++A +HK
Sbjct  112  QEEKLERKKAEYAEKMRNQVAAIHK  136



>ref|XP_009794056.1| PREDICTED: remorin-like [Nicotiana sylvestris]
Length=176

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS+DRD+ LA + TEK++S IKAWEESEKSK EN+AQKK S V +WEN KKA++EA+LKK
Sbjct  49   GSLDRDIALAHLETEKRNSYIKAWEESEKSKVENRAQKKFSAVGTWENTKKANLEAKLKK  108

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            +EE+L+ +KAEY EK+KN++A +HK
Sbjct  109  LEEQLKEKKAEYAEKIKNRVAAVHK  133



>ref|XP_010053688.1| PREDICTED: remorin-like [Eucalyptus grandis]
Length=162

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS DRD+ LA+V  EKK + IKAWEESEK+K++NKAQKK+S V+SWEN KKA+ EA+L+K
Sbjct  37   GSADRDLALAKVEKEKKLTFIKAWEESEKTKADNKAQKKMSIVTSWENSKKATKEADLRK  96

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
             EE LE +KAE+ EKMKNK+A++HK
Sbjct  97   TEEGLEKKKAEHGEKMKNKVALIHK  121



>ref|XP_003521134.1| PREDICTED: remorin-like [Glycine max]
Length=200

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
            GGS+DRD+ LA +  EK+ S +KAWEESEKSK+ENKA+K LS V++WEN K A++EA+L+
Sbjct  74   GGSLDRDIALAEIEKEKRLSNVKAWEESEKSKAENKAEKHLSAVAAWENSKIAALEAQLR  133

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
            KIEE++E +KAEY EKMKNKI ++HK
Sbjct  134  KIEEQMEKKKAEYGEKMKNKIVLVHK  159



>ref|XP_006358926.1| PREDICTED: remorin-like [Solanum tuberosum]
Length=190

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
            GGS D D  LA+V +EK+ +LIKAWE++EK+K+ENKA KKLS V SWEN KKA+IEAEL+
Sbjct  62   GGSKDTDTALAKVESEKRLALIKAWEDNEKTKTENKALKKLSAVGSWENTKKATIEAELR  121

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
            +I+E+LE +KAEY EKMKNK+A +H+
Sbjct  122  QIQEELEKKKAEYAEKMKNKMAEIHR  147



>ref|XP_009629650.1| PREDICTED: remorin-like [Nicotiana tomentosiformis]
Length=153

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS+DRD  LA++  +KK + IKAWEESEKS+ +NKAQKKLS+V++WEN KKA +EA+LKK
Sbjct  27   GSLDRDTALAQLNNDKKSAFIKAWEESEKSRVDNKAQKKLSKVAAWENSKKAHLEAKLKK  86

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            +EE+LE +KAEY EKMKN+ A++HK
Sbjct  87   LEERLEQKKAEYAEKMKNRAALIHK  111



>ref|XP_010676488.1| PREDICTED: remorin [Beta vulgaris subsp. vulgaris]
Length=196

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 89/109 (82%), Gaps = 0/109 (0%)
 Frame = +3

Query  219  DSKALvvvenkapepepveekkeGGSIDRDVVLARVATEKKHSLIkaweeseksksenka  398
            D KA+V V   AP PEP ++K  GGS+DRD+V A V  EK  +L+KAWEESEKSK+ENKA
Sbjct  47   DEKAIVPVTTPAPAPEPEKKKALGGSLDRDIVFANVEKEKTVALVKAWEESEKSKAENKA  106

Query  399  qkkLSEVSSWENkkkasieaelkkieekleVQKAEYIEKMKNKIAMLHK  545
             KKLS+V+SWEN KKA+IEA+L+KIEEKLE +KAEY EKMKNK+A +HK
Sbjct  107  CKKLSDVTSWENSKKANIEAQLRKIEEKLEKKKAEYAEKMKNKVAEVHK  155



>ref|XP_009779197.1| PREDICTED: remorin-like [Nicotiana sylvestris]
Length=153

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS+DRD  LA++  +KK + IKAWEESEKS+ +NKAQKKLS+V++WEN KKA +EA+LKK
Sbjct  27   GSLDRDTALAQLNNDKKSAFIKAWEESEKSRVDNKAQKKLSKVAAWENSKKAHLEAKLKK  86

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            +EE+LE +KAEY EKMKN+ A++HK
Sbjct  87   LEERLEQKKAEYAEKMKNRAALIHK  111



>gb|EPS60307.1| hypothetical protein M569_14497 [Genlisea aurea]
Length=194

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +3

Query  294  SIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkki  473
            S DRD+VLARVATEK+ SLIKAWEESEKSK+ENKAQKK S V +WEN KKA +EAELKKI
Sbjct  70   STDRDIVLARVATEKRLSLIKAWEESEKSKAENKAQKKKSAVGAWENSKKAKLEAELKKI  129

Query  474  eekleVQKAEYIEKMKNKIAMLHK  545
            EE+ E +KAEY+EK++NK+A++HK
Sbjct  130  EEEFEKKKAEYVEKIRNKVALVHK  153



>ref|XP_011022731.1| PREDICTED: remorin-like [Populus euphratica]
Length=189

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
            G S +RD +L+RV TEK+++LIKAW E+EK+K ENKA KKLS + SWE  KK S+EA++ 
Sbjct  61   GESSNRDAILSRVETEKRYALIKAWVENEKAKVENKAHKKLSAIGSWETTKKVSVEAKIM  120

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
            K EEKLE +KAEY EKMKNK A LHK
Sbjct  121  KFEEKLERKKAEYAEKMKNKAAELHK  146



>ref|XP_003534573.1| PREDICTED: remorin-like [Glycine max]
Length=183

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GSIDRD+ LA V  EKK S +KAWEESEK+K+EN+AQK+LS +++WEN KKA++EAELKK
Sbjct  58   GSIDRDIALAEVEKEKKLSYVKAWEESEKAKAENRAQKQLSAIAAWENSKKATLEAELKK  117

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEE+LE +KAE+ E+MKNK+A++HK
Sbjct  118  IEEQLEKKKAEHGERMKNKVALVHK  142



>gb|KHN29375.1| Remorin [Glycine soja]
Length=183

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GSIDRD+ LA V  EKK S +KAWEESEK+K+EN+AQK+LS +++WEN KKA++EAELKK
Sbjct  58   GSIDRDIALAEVEKEKKLSYVKAWEESEKAKAENRAQKQLSAIAAWENSKKATLEAELKK  117

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEE+LE +KAE+ E+MKNK+A++HK
Sbjct  118  IEEQLEKKKAEHGERMKNKVALVHK  142



>ref|XP_004492710.1| PREDICTED: uncharacterized protein At3g61260-like [Cicer arietinum]
Length=185

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS+DRDV LA VA EKK S +KAWEESEK K++NKAQK  S +++WEN KKA++EAELKK
Sbjct  59   GSLDRDVALAEVAKEKKLSYVKAWEESEKVKADNKAQKHFSSIAAWENSKKAALEAELKK  118

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEE LE +KA+Y E+MKNKIA++HK
Sbjct  119  IEEHLERKKAQYGEEMKNKIAIIHK  143



>ref|XP_008794187.1| PREDICTED: remorin-like isoform X2 [Phoenix dactylifera]
Length=193

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 81/110 (74%), Gaps = 3/110 (3%)
 Frame = +3

Query  216  DDSKALvvvenkapepepveekkeGGSIDRDVVLARVATEKKHSLIkaweeseksksenk  395
            DDSKAL VVE  A  P        GGS +R  +LAR+ TEK+ SLIKAWEE+EK K ENK
Sbjct  44   DDSKALAVVEMVADTPTEKST---GGSTERVAILARLETEKRISLIKAWEENEKVKVENK  100

Query  396  aqkkLSEVSSWENkkkasieaelkkieekleVQKAEYIEKMKNKIAMLHK  545
            A K++S +++WEN K A++EAELK  EE+LE  KAEY EKMKNK+AM+HK
Sbjct  101  AVKQMSSITAWENSKMAAMEAELKAKEEELEKMKAEYAEKMKNKVAMIHK  150



>ref|XP_006649253.1| PREDICTED: remorin-like [Oryza brachyantha]
Length=174

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
            GGS +RD  LA++ +EK+  LI AWEESEK+++EN+A KKLS ++SWEN KKA +EAELK
Sbjct  46   GGSAERDAYLAKIVSEKRLVLINAWEESEKARAENRAAKKLSYITSWENAKKAEMEAELK  105

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
            +IEE+LE +KA Y EK+KNK+A+LHK
Sbjct  106  RIEEQLEKKKAAYEEKLKNKLALLHK  131



>gb|KDO60014.1| hypothetical protein CISIN_1g028549mg [Citrus sinensis]
Length=192

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 75/110 (68%), Gaps = 14/110 (13%)
 Frame = +3

Query  216  DDSKALvvvenkapepepveekkeGGSIDRDVVLARVATEKKHSLIkaweeseksksenk  395
            ++SKAL VV+       P  EK   GS++RD VLARV TEK+ SLI+AWEE         
Sbjct  54   EESKALAVVDKAPEAEPPAGEKSTEGSVNRDAVLARVETEKRISLIRAWEE---------  104

Query  396  aqkkLSEVSSWENkkkasieaelkkieekleVQKAEYIEKMKNKIAMLHK  545
                 SE S  EN +KA++EAELKKIEE+LE +KAEY+EKMKNK+A++HK
Sbjct  105  -----SEKSQAENNRKAAVEAELKKIEEQLEKKKAEYVEKMKNKMALIHK  149



>ref|NP_001048722.1| Os03g0111200 [Oryza sativa Japonica Group]
 gb|ABF93596.1| Remorin, C-terminal region family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF10636.1| Os03g0111200 [Oryza sativa Japonica Group]
 gb|EAY88244.1| hypothetical protein OsI_09695 [Oryza sativa Indica Group]
 gb|EAZ25323.1| hypothetical protein OsJ_09134 [Oryza sativa Japonica Group]
 dbj|BAG87426.1| unnamed protein product [Oryza sativa Japonica Group]
Length=175

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
            GGS +RD  LA++ +EK+  LI AWEESEK+++EN+A KKLS ++SWEN KKA +EAELK
Sbjct  47   GGSAERDAYLAKIVSEKRLVLINAWEESEKARAENRAAKKLSYITSWENAKKAEMEAELK  106

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
            +IE++LE +KA Y EK+KNK+A+LHK
Sbjct  107  RIEQELEKKKAAYEEKLKNKLALLHK  132



>ref|XP_010055616.1| PREDICTED: remorin-like [Eucalyptus grandis]
 gb|KCW72127.1| hypothetical protein EUGRSUZ_E00569 [Eucalyptus grandis]
Length=204

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
            GGSIDRD VLARV TEK+ +LIKAWEESEK+K +NK  KK S + +WEN K+A+IEAELK
Sbjct  76   GGSIDRDAVLARVETEKRLALIKAWEESEKTKVDNKTYKKFSGIGAWENTKRAAIEAELK  135

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
            KIEEKLE +KAEY E MKNKI  +HK
Sbjct  136  KIEEKLEKKKAEYAEMMKNKIVEIHK  161



>ref|XP_010503539.1| PREDICTED: remorin-like [Camelina sativa]
Length=175

 Score = 50.1 bits (118),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS+ RD VL R+  +K+ SLIKAWEE+EKSK ENKAQKKLS V +WEN KKAS+EAELKK
Sbjct  50   GSVHRDAVLVRLEQDKRISLIKAWEEAEKSKVENKAQKKLSYVGAWENSKKASVEAELKK  109

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEE+L  +KAEY EKMKNKIA +HK
Sbjct  110  IEEQLLKKKAEYAEKMKNKIARIHK  134



>gb|EPS69897.1| hypothetical protein M569_04866 [Genlisea aurea]
Length=170

 Score = 50.1 bits (118),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
            G S++RD  LARV TEK+ S I+AWEESEK+K+ENKAQKKLS +  WE+ K+AS+EAELK
Sbjct  44   GSSVNRDAALARVTTEKRLSFIRAWEESEKAKAENKAQKKLSAIGVWEDSKRASLEAELK  103

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
            K+EE+LE +K+ Y+EK+KNKIA++HK
Sbjct  104  KLEEQLEKKKSGYLEKVKNKIALIHK  129



>ref|XP_010412645.1| PREDICTED: remorin-like [Camelina sativa]
Length=186

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS+ RD VL R+  +K+ SLIKAWEE+EKSK ENKAQKKLS V +WEN KKAS+EAELKK
Sbjct  61   GSVHRDAVLVRLEQDKRISLIKAWEEAEKSKVENKAQKKLSYVGAWENSKKASVEAELKK  120

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEE+L  +KAEY EKMKNKIA +HK
Sbjct  121  IEEQLLKKKAEYAEKMKNKIARIHK  145



>ref|XP_008794186.1| PREDICTED: remorin-like isoform X1 [Phoenix dactylifera]
Length=208

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
            GGS +R  +LAR+ TEK+ SLIKAWEE+EK K ENKA K++S +++WEN K A++EAELK
Sbjct  80   GGSTERVAILARLETEKRISLIKAWEENEKVKVENKAVKQMSSITAWENSKMAAMEAELK  139

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
              EE+LE  KAEY EKMKNK+AM+HK
Sbjct  140  AKEEELEKMKAEYAEKMKNKVAMIHK  165



>ref|XP_010089139.1| Pollen-specific protein SF3 [Morus notabilis]
 gb|EXB37386.1| Pollen-specific protein SF3 [Morus notabilis]
Length=421

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  297  IDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkkie  476
            +DRD VLA+V TEK+ +LIKAWEESEK+KSENKA KK S V +WEN K+A++EAEL+ IE
Sbjct  89   VDRDAVLAQVETEKRLALIKAWEESEKTKSENKAYKKFSAVGAWENSKRAAVEAELRAIE  148

Query  477  ekleVQKAEYIEKMKNKIAMLHK  545
            EKLE ++AEY EKMKNK+A +HK
Sbjct  149  EKLEKKRAEYTEKMKNKVAEVHK  171



>emb|CAN75437.1| hypothetical protein VITISV_000833 [Vitis vinifera]
Length=196

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
            GGS +RDV LA +  EK+ S I+AWEESEKSK +NKAQKKLS+V +WEN KKA++EA LK
Sbjct  68   GGSFERDVALANLEKEKQLSFIRAWEESEKSKVDNKAQKKLSDVCAWENSKKAAVEAXLK  127

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
            KIEE+LE +KAEY EKMKNK+A++HK
Sbjct  128  KIEEELEKKKAEYAEKMKNKVALIHK  153



>ref|XP_002882035.1| hypothetical protein ARALYDRAFT_483720 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58294.1| hypothetical protein ARALYDRAFT_483720 [Arabidopsis lyrata subsp. 
lyrata]
Length=190

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS DRDV+LA +  EKK S IKAWEESEKSK+EN+AQKK+S+V +WEN KKA++EA+L+K
Sbjct  65   GSADRDVILADLEKEKKTSFIKAWEESEKSKAENRAQKKISDVHAWENTKKAAVEAQLRK  124

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEEKLE +KA+Y EKMKNK+A +HK
Sbjct  125  IEEKLEKKKAQYGEKMKNKVAAIHK  149



>ref|NP_182106.1| Remorin family protein [Arabidopsis thaliana]
 sp|O80837.1|REMO_ARATH RecName: Full=Remorin; AltName: Full=DNA-binding protein [Arabidopsis 
thaliana]
 gb|AAC28542.1| remorin [Arabidopsis thaliana]
 gb|AAK76670.1| putative remorin protein [Arabidopsis thaliana]
 gb|AAL85060.1| putative remorin protein [Arabidopsis thaliana]
 gb|AEC10605.1| Remorin family protein [Arabidopsis thaliana]
Length=190

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS DRDV+LA +  EKK S IKAWEESEKSK+EN+AQKK+S+V +WEN KKA++EA+L+K
Sbjct  65   GSADRDVILADLEKEKKTSFIKAWEESEKSKAENRAQKKISDVHAWENSKKAAVEAQLRK  124

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEEKLE +KA+Y EKMKNK+A +HK
Sbjct  125  IEEKLEKKKAQYGEKMKNKVAAIHK  149



>gb|AAA57124.1| DNA-binding protein [Arabidopsis thaliana]
Length=190

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS DRDV+LA +  EKK S IKAWEESEKSK+EN+AQKK+S+V +WEN KKA++EA+L+K
Sbjct  65   GSADRDVILADLEKEKKTSFIKAWEESEKSKAENRAQKKISDVHAWENSKKAAVEAQLRK  124

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEEKLE +KA+Y EKMKNK+A +HK
Sbjct  125  IEEKLEKKKAQYGEKMKNKVAAIHK  149



>ref|XP_006573768.1| PREDICTED: remorin-like isoform X2 [Glycine max]
Length=188

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +3

Query  294  SIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkki  473
            S+D+D +LARV TEK+ +L+KAWEESEK+K+EN+A K+LS V  WE+ KKAS+EA+LKKI
Sbjct  62   SLDKDAMLARVVTEKRLALVKAWEESEKTKAENRAYKRLSAVGFWEDSKKASVEAQLKKI  121

Query  474  eekleVQKAEYIEKMKNKIAMLH  542
            EE LE +KAEY+EKMKNK+A +H
Sbjct  122  EENLEKKKAEYVEKMKNKVAKIH  144



>ref|XP_003516694.1| PREDICTED: remorin-like isoform X1 [Glycine max]
Length=191

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +3

Query  294  SIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkki  473
            S+D+D +LARV TEK+ +L+KAWEESEK+K+EN+A K+LS V  WE+ KKAS+EA+LKKI
Sbjct  65   SLDKDAMLARVVTEKRLALVKAWEESEKTKAENRAYKRLSAVGFWEDSKKASVEAQLKKI  124

Query  474  eekleVQKAEYIEKMKNKIAMLH  542
            EE LE +KAEY+EKMKNK+A +H
Sbjct  125  EENLEKKKAEYVEKMKNKVAKIH  147



>ref|XP_002270914.1| PREDICTED: uncharacterized protein At3g61260 [Vitis vinifera]
 emb|CBI40326.3| unnamed protein product [Vitis vinifera]
Length=196

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
            GGS +RDV LA +  EK+ S I+AWEESEKSK +NKAQKKLS+V +WEN KKA++EA LK
Sbjct  68   GGSFERDVALANLEKEKQLSFIRAWEESEKSKVDNKAQKKLSDVCAWENSKKAAVEANLK  127

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
            KIEE+LE +KAEY EKMKNK+A++HK
Sbjct  128  KIEEELEKKKAEYAEKMKNKVALIHK  153



>gb|AFK49332.1| unknown [Medicago truncatula]
Length=181

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
              S+DRD+ LA +  EK+ S +KAWE+S+K+K+ENKAQK+LS V++WEN KKA++EA+L+
Sbjct  74   NASLDRDIALAEIGKEKRLSNVKAWEDSKKTKAENKAQKQLSTVAAWENSKKAALEAQLR  133

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
            KIEE+LE +KAEY EK+KNK+AM+HK
Sbjct  134  KIEEQLEKKKAEYGEKIKNKVAMVHK  159



>ref|XP_009766651.1| PREDICTED: remorin-like [Nicotiana sylvestris]
Length=198

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
            G S DRD  L +V +EK+ +LIKAWE++EK+K++NKA KKLS V +WEN KKA+IE ELK
Sbjct  71   GNSNDRDAALVKVESEKRLALIKAWEDNEKAKADNKAFKKLSAVGAWENTKKATIEFELK  130

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
            +IEE+LE +KAEY EKMKNK+A++H+
Sbjct  131  QIEEELERKKAEYAEKMKNKMAVIHR  156



>ref|XP_010426396.1| PREDICTED: remorin-like [Camelina sativa]
Length=176

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS+ RD VL R+   K+ SLIKAWEE+EKSK ENKAQKKLS V +WEN KKAS+EAELKK
Sbjct  51   GSVHRDAVLVRLEQGKRISLIKAWEEAEKSKVENKAQKKLSYVGAWENSKKASVEAELKK  110

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEE+L  +KAEY EKMKNKIA +HK
Sbjct  111  IEEQLLKKKAEYAEKMKNKIARIHK  135



>ref|XP_006345628.1| PREDICTED: remorin-like [Solanum tuberosum]
Length=146

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS++RD  LA++  +KK + +KAWEESEKSK +NKAQKKLS+V++WENK+KA ++A+LKK
Sbjct  20   GSVERDTALAQLNNDKKSAFVKAWEESEKSKVDNKAQKKLSKVAAWENKQKAHLDAKLKK  79

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            +E +LE +KAEY EKMKNK A++HK
Sbjct  80   LEVRLEQKKAEYAEKMKNKEALVHK  104



>emb|CDY18898.1| BnaC04g04520D [Brassica napus]
Length=192

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS+DRDV+LA +  EKK S IKAWEESEKSK+ENKAQKK+S+V +WEN KKA+ EA+L K
Sbjct  67   GSVDRDVILADLEKEKKSSFIKAWEESEKSKAENKAQKKISDVLAWENSKKAATEAQLSK  126

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEEKLE +KA Y EKMKNK+A +HK
Sbjct  127  IEEKLEKKKAVYGEKMKNKVAAIHK  151



>emb|CDY71834.1| BnaAnng38930D [Brassica napus]
Length=176

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 72/86 (84%), Gaps = 1/86 (1%)
 Frame = +3

Query  291  GSIDR-DVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
            GS++R D VLA++ TEK+ SLIKAWEE+EKSK ENKAQKKLS V +WEN KKAS EAELK
Sbjct  50   GSVNREDDVLAKLETEKRMSLIKAWEEAEKSKVENKAQKKLSSVGAWENSKKASAEAELK  109

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
            KIEE+L  +KAEY E+MKNKI  +HK
Sbjct  110  KIEEQLIKKKAEYAEQMKNKIVQIHK  135



>ref|XP_006339544.1| PREDICTED: remorin-like [Solanum tuberosum]
Length=174

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +3

Query  297  IDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkkie  476
            +DRDV LA + TEKK+S IKAWEESEKSK  NKA+KKLS V +WEN KKA+IEA+LKK+E
Sbjct  50   LDRDVALAHLETEKKNSYIKAWEESEKSKVNNKAEKKLSSVGTWENTKKANIEAKLKKLE  109

Query  477  ekleVQKAEYIEKMKNKIAMLH  542
            E+LE +KAEY EK+KN++A +H
Sbjct  110  EQLEQKKAEYAEKIKNRVAAVH  131



>gb|AFK34355.1| unknown [Medicago truncatula]
Length=200

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
              S+DRD+ LA +  EK+ S +KAWE+SEK+K+ENKAQK+LS V++WEN KKA++EA+L+
Sbjct  74   NASLDRDIALAEIGKEKRLSNVKAWEDSEKTKAENKAQKQLSTVAAWENSKKAALEAQLR  133

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
            KIEE+LE +KAEY EK+KNK+AM+HK
Sbjct  134  KIEEQLEKKKAEYGEKIKNKVAMVHK  159



>gb|KEH18895.1| carboxy-terminal region remorin [Medicago truncatula]
Length=200

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
              S+DRD+ LA +  EK+ S +KAWE+SEK+K+ENKAQK+LS V++WEN KKA++EA+L+
Sbjct  74   NASLDRDIALAEIGKEKRLSNVKAWEDSEKTKAENKAQKQLSTVAAWENSKKAALEAQLR  133

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
            KIEE+LE +KAEY EK+KNK+AM+HK
Sbjct  134  KIEEQLEKKKAEYGEKIKNKVAMVHK  159



>gb|EMT11441.1| hypothetical protein F775_30732 [Aegilops tauschii]
Length=177

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
            GGS +RD +L RVATEK+ SLIKAWEE+EK+K+ENKA K L++++SWEN K A +EAELK
Sbjct  50   GGSHERDALLTRVATEKRISLIKAWEENEKAKAENKAVKLLADITSWENSKAAELEAELK  109

Query  468  kieekleVQKAEYIEKMKNKIAMLH  542
            K++E+LE +KA  +EK+KN  A +H
Sbjct  110  KMQEQLEKKKARCVEKLKNSAATVH  134



>ref|XP_008238894.1| PREDICTED: remorin [Prunus mume]
Length=223

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
            GGS +RD + A++ TEK+ +LIKAWEESEK+K+ENKA +++S V  WE+ KK S+EAELK
Sbjct  88   GGSTERDALYAQIETEKRLALIKAWEESEKTKAENKAYRRMSTVELWEDSKKTSVEAELK  147

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
            KIEEK E +KAEY EKMKNK+A +HK
Sbjct  148  KIEEKFERKKAEYAEKMKNKVAEIHK  173



>gb|KJB49418.1| hypothetical protein B456_008G118300 [Gossypium raimondii]
Length=142

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS DRDV LA +  EKK S IKAWE+SEK+K+ENKAQKKLS + +WEN KKA++EA+LKK
Sbjct  17   GSHDRDVALADLEKEKKLSFIKAWEDSEKTKAENKAQKKLSAIVAWENSKKAALEAKLKK  76

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEE+LE +KAEY E MKNK+A +HK
Sbjct  77   IEEQLEKKKAEYAETMKNKVASIHK  101



>ref|XP_009627101.1| PREDICTED: remorin-like [Nicotiana tomentosiformis]
Length=198

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
            GGS DRD  L +V +EK+ +LIKAWE++EK+K++NKA KKLS V +WE+ KKA+IE ELK
Sbjct  71   GGSKDRDAALMKVESEKRLALIKAWEDNEKTKADNKAFKKLSAVGAWESSKKATIEFELK  130

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
            +IEE+ E +KAEY EKMKNK+A++H+
Sbjct  131  QIEEEFERKKAEYEEKMKNKMAVIHR  156



>gb|KJB41294.1| hypothetical protein B456_007G097700 [Gossypium raimondii]
Length=190

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
            GGS DRD+ LA V   K+ S IKAWEESEK+K+ENK+QKKLS + +WEN KKAS+EA+LK
Sbjct  64   GGSHDRDISLAEVEKAKRLSFIKAWEESEKTKAENKSQKKLSAIVAWENSKKASLEAKLK  123

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
            KIEE+LE +KAE  EKMKNK+A+LHK
Sbjct  124  KIEEQLEKKKAECAEKMKNKVALLHK  149



>ref|XP_002465999.1| hypothetical protein SORBIDRAFT_01g049810 [Sorghum bicolor]
 gb|EER92997.1| hypothetical protein SORBIDRAFT_01g049810 [Sorghum bicolor]
Length=181

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 66/86 (77%), Gaps = 4/86 (5%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
            GGS +RD  LA++ +EK+ +LI AWEE  ++++  K    L+ ++SWEN KKA +EAELK
Sbjct  57   GGSTERDAYLAKIVSEKRLTLITAWEERAENRAAKK----LAFITSWENAKKAEMEAELK  112

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
            KIEE+LE +KA Y EK+KNK+AMLHK
Sbjct  113  KIEEQLEKKKAAYEEKLKNKLAMLHK  138



>ref|XP_003574160.1| PREDICTED: remorin-like [Brachypodium distachyon]
 ref|XP_010234886.1| PREDICTED: remorin-like [Brachypodium distachyon]
Length=174

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS +RD  LARVATEK+ SLI+AWEE+EK+K++NKA K ++++SSWE  K A +EAEL+K
Sbjct  49   GSHERDAFLARVATEKRMSLIRAWEENEKAKADNKAAKLVADISSWEKSKAAQLEAELRK  108

Query  471  ieekleVQKAEYIEKMKNKIAMLH  542
            ++E+LE +KA+Y EK+KN +A +H
Sbjct  109  MQEQLERKKAQYAEKLKNSVASVH  132



>ref|XP_009383123.1| PREDICTED: remorin-like [Musa acuminata subsp. malaccensis]
Length=180

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
            GGS DRD +LA+V  +K+ SLI+AW   EK+K++NKAQ+K+S + SWEN K A+IEAE+K
Sbjct  49   GGSADRDALLAQVENDKRISLIRAWSAGEKTKADNKAQRKMSSILSWENTKMATIEAEIK  108

Query  468  kieekleVQKAEYIEKMKNKIAMLHK  545
            K EE+LE +KA+  EK KNKIAM+HK
Sbjct  109  KNEERLEKKKADSEEKAKNKIAMIHK  134



>gb|EMS51879.1| hypothetical protein TRIUR3_21382 [Triticum urartu]
Length=177

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +3

Query  288  GGSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelk  467
            GGS +RD +L RVATEK+ SLIKAWEE+EK+K+ENKA K L++++SWEN K A +EAELK
Sbjct  50   GGSHERDALLTRVATEKRISLIKAWEENEKAKAENKAVKLLADITSWENSKAAELEAELK  109

Query  468  kieekleVQKAEYIEKMKNKIAMLH  542
            KI+E+LE +KA  +EK+KN  A +H
Sbjct  110  KIQEQLEKKKARCVEKLKNSAATVH  134



>ref|XP_010908427.1| PREDICTED: remorin-like isoform X2 [Elaeis guineensis]
Length=193

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 80/110 (73%), Gaps = 3/110 (3%)
 Frame = +3

Query  216  DDSKALvvvenkapepepveekkeGGSIDRDVVLARVATEKKHSLIkaweeseksksenk  395
            DDSKAL VVE  A  P        GGS +R   L R+ TEK+ SLI+AWEE+EK K ENK
Sbjct  44   DDSKALDVVEKVADTPTEKSR---GGSTERVAQLTRLETEKRMSLIRAWEENEKVKVENK  100

Query  396  aqkkLSEVSSWENkkkasieaelkkieekleVQKAEYIEKMKNKIAMLHK  545
            A K++S +++WEN KKA+ EAELK  EE+LE +KAEY EKMKNK+AM+HK
Sbjct  101  AAKQMSSITAWENSKKAATEAELKAKEEELEKKKAEYAEKMKNKVAMIHK  150



>ref|XP_010512460.1| PREDICTED: uncharacterized protein At3g61260-like [Camelina sativa]
Length=216

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 83/110 (75%), Gaps = 3/110 (3%)
 Frame = +3

Query  216  DDSKALvvvenkapepepveekkeGGSIDRDVVLARVATEKKHSLIkaweeseksksenk  395
            DDSKAL VVE                S+DRDV LA ++ EK+ S ++AWE+SEKSK+ENK
Sbjct  69   DDSKALTVVEKPIEPEPTKSS---SASLDRDVKLADLSNEKRLSFVRAWEDSEKSKAENK  125

Query  396  aqkkLSEVSSWENkkkasieaelkkieekleVQKAEYIEKMKNKIAMLHK  545
            A+KK+S+V +WEN KKA++EA+LKKIEE+LE +KAEY E+MKNK+A +HK
Sbjct  126  AEKKISDVLAWENSKKAAVEAQLKKIEEQLEKKKAEYAERMKNKVAAIHK  175



>ref|XP_002877638.1| remorin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53897.1| remorin family protein [Arabidopsis lyrata subsp. lyrata]
Length=175

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS+ RD VL R+  +K+ SLIKAWEE+EKSK ENKAQKKLS V +WEN KKA +EAELK 
Sbjct  50   GSVHRDAVLVRLEQDKRISLIKAWEEAEKSKVENKAQKKLSSVGAWENSKKACVEAELKM  109

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            IEE+L  +KA Y E+MKNKIA +HK
Sbjct  110  IEEQLLKKKARYTEQMKNKIAQIHK  134



>ref|XP_006291850.1| hypothetical protein CARUB_v10018025mg [Capsella rubella]
 gb|EOA24748.1| hypothetical protein CARUB_v10018025mg [Capsella rubella]
Length=208

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 87/110 (79%), Gaps = 2/110 (2%)
 Frame = +3

Query  216  DDSKALvvvenkapepepveekkeGGSIDRDVVLARVATEKKHSLIkaweeseksksenk  395
            DDSKAL VVE    EP P +      S+DRDV LA ++ EK+ S ++AWE+SEKSK+ENK
Sbjct  60   DDSKALAVVEQPVEEPAPTKSS--SASLDRDVKLADLSKEKRLSFVRAWEDSEKSKAENK  117

Query  396  aqkkLSEVSSWENkkkasieaelkkieekleVQKAEYIEKMKNKIAMLHK  545
            A+KK+S+V +WEN KKA++EA+LKKIEE+LE +KAEY E+MKNK+A +HK
Sbjct  118  AEKKISDVLAWENSKKAAVEAQLKKIEEQLEKKKAEYAERMKNKVAAIHK  167



>gb|EPS61469.1| hypothetical protein M569_13328, partial [Genlisea aurea]
Length=131

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  GSIDRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkk  470
            GS++RD VL+RV T KK S I+AWEE+E +K++NKAQ+KL+ +  WEN KKAS+EAELKK
Sbjct  6    GSVNRDAVLSRVVTLKKLSFIRAWEENENAKAQNKAQRKLAAIGVWENSKKASLEAELKK  65

Query  471  ieekleVQKAEYIEKMKNKIAMLHK  545
            +EE+LE ++AE++EK+ N+IA +HK
Sbjct  66   LEEQLEKKRAEFLEKLNNQIAQIHK  90



>ref|XP_004308093.1| PREDICTED: remorin-like isoform X3 [Fragaria vesca subsp. vesca]
Length=197

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +3

Query  300  DRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkkiee  479
            DRD VLARV TEKK SLI AWEESEKSK ENKA KKLS V SWEN KKAS+EAELK IEE
Sbjct  75   DRDAVLARVETEKKISLINAWEESEKSKVENKAHKKLSVVGSWENTKKASVEAELKIIEE  134

Query  480  kleVQKAEYIEKMKNKIAMLHK  545
            KLE +KAE +E+MKNKIA++HK
Sbjct  135  KLEKKKAEAVEQMKNKIALIHK  156



>ref|XP_004308092.1| PREDICTED: remorin-like isoform X1 [Fragaria vesca subsp. vesca]
Length=203

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +3

Query  300  DRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkkiee  479
            DRD VLARV TEKK SLI AWEESEKSK ENKA KKLS V SWEN KKAS+EAELK IEE
Sbjct  81   DRDAVLARVETEKKISLINAWEESEKSKVENKAHKKLSVVGSWENTKKASVEAELKIIEE  140

Query  480  kleVQKAEYIEKMKNKIAMLHK  545
            KLE +KAE +E+MKNKIA++HK
Sbjct  141  KLEKKKAEAVEQMKNKIALIHK  162



>ref|XP_011470377.1| PREDICTED: remorin-like isoform X2 [Fragaria vesca subsp. vesca]
Length=198

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +3

Query  300  DRDVVLARVATEKKHSLIkaweeseksksenkaqkkLSEVSSWENkkkasieaelkkiee  479
            DRD VLARV TEKK SLI AWEESEKSK ENKA KKLS V SWEN KKAS+EAELK IEE
Sbjct  76   DRDAVLARVETEKKISLINAWEESEKSKVENKAHKKLSVVGSWENTKKASVEAELKIIEE  135

Query  480  kleVQKAEYIEKMKNKIAMLHK  545
            KLE +KAE +E+MKNKIA++HK
Sbjct  136  KLEKKKAEAVEQMKNKIALIHK  157



>ref|NP_191685.1| remorin family protein [Arabidopsis thaliana]
 sp|Q9M2D8.1|Y3126_ARATH RecName: Full=Uncharacterized protein At3g61260 [Arabidopsis 
thaliana]
 gb|AAK44161.1|AF370346_1 putative DNA-binding protein [Arabidopsis thaliana]
 emb|CAB71056.1| putative DNA-binding protein [Arabidopsis thaliana]
 gb|AAL34151.1| putative DNA-binding protein [Arabidopsis thaliana]
 gb|AAM65607.1| putative DNA-binding protein [Arabidopsis thaliana]
 gb|AEE80180.1| remorin family protein [Arabidopsis thaliana]
Length=212

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 87/110 (79%), Gaps = 2/110 (2%)
 Frame = +3

Query  216  DDSKALvvvenkapepepveekkeGGSIDRDVVLARVATEKKHSLIkaweeseksksenk  395
            DDSKAL VVE    EP P +      S+DRDV LA ++ EK+ S ++AWEESEKSK+ENK
Sbjct  64   DDSKALTVVEKPVEEPAPAKPA--SASLDRDVKLADLSKEKRLSFVRAWEESEKSKAENK  121

Query  396  aqkkLSEVSSWENkkkasieaelkkieekleVQKAEYIEKMKNKIAMLHK  545
            A+KK+++V +WEN KKA++EA+LKKIEE+LE +KAEY E+MKNK+A +HK
Sbjct  122  AEKKIADVHAWENSKKAAVEAQLKKIEEQLEKKKAEYAERMKNKVAAIHK  171



>ref|XP_010469049.1| PREDICTED: uncharacterized protein At3g61260-like [Camelina sativa]
Length=213

 Score = 48.1 bits (113),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 83/110 (75%), Gaps = 3/110 (3%)
 Frame = +3

Query  216  DDSKALvvvenkapepepveekkeGGSIDRDVVLARVATEKKHSLIkaweeseksksenk  395
            DDSKAL VVE                S+DRDV LA ++ EK+ S ++AWE+SEKSK+ENK
Sbjct  66   DDSKALTVVEKPIEPEPTKSS---SASLDRDVKLADLSKEKRLSFVRAWEDSEKSKAENK  122

Query  396  aqkkLSEVSSWENkkkasieaelkkieekleVQKAEYIEKMKNKIAMLHK  545
            A+KK+S+V +WEN KKA++EA+LKKIEE+LE +KAEY E+MKNK+A +HK
Sbjct  123  AEKKISDVLAWENSKKAAVEAQLKKIEEQLEKKKAEYAERMKNKVAAIHK  172



>ref|XP_010523734.1| PREDICTED: uncharacterized protein At3g61260 [Tarenaya hassleriana]
Length=201

 Score = 47.8 bits (112),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 81/110 (74%), Gaps = 5/110 (5%)
 Frame = +3

Query  216  DDSKALvvvenkapepepveekkeGGSIDRDVVLARVATEKKHSLIkaweeseksksenk  395
            DDSKAL V+E                S+DRDV LA +  EK+ S I+AWE++EK+K+ENK
Sbjct  56   DDSKALTVIEKPVEPEPKK-----SSSMDRDVALADLEKEKRLSFIRAWEDNEKTKAENK  110

Query  396  aqkkLSEVSSWENkkkasieaelkkieekleVQKAEYIEKMKNKIAMLHK  545
            AQKK S+V +WEN KKA+IEAELKKIEE+LE +KAEY EKMKNK+A +HK
Sbjct  111  AQKKTSDVLAWENSKKAAIEAELKKIEEQLEKKKAEYAEKMKNKVAAIHK  160



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 592801777335