BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001F17

Length=524
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006366869.1|  PREDICTED: serine/threonine protein phosphat...    214   4e-63   Solanum tuberosum [potatoes]
ref|XP_009797723.1|  PREDICTED: serine/threonine protein phosphat...    213   9e-63   Nicotiana sylvestris
emb|CDP21530.1|  unnamed protein product                                196   2e-56   Coffea canephora [robusta coffee]
ref|XP_004251590.1|  PREDICTED: serine/threonine protein phosphat...    193   3e-55   Solanum lycopersicum
ref|XP_009630828.1|  PREDICTED: serine/threonine protein phosphat...    184   9e-52   Nicotiana tomentosiformis
ref|XP_007013281.1|  Serine/threonine protein phosphatase 2A 57 k...    167   8e-46   Theobroma cacao [chocolate]
gb|KDP32329.1|  hypothetical protein JCGZ_13254                         167   2e-45   Jatropha curcas
ref|XP_007013280.1|  Serine/threonine protein phosphatase 2A 57 k...    167   2e-45   
ref|XP_010656380.1|  PREDICTED: serine/threonine protein phosphat...    164   3e-44   
gb|KJB54144.1|  hypothetical protein B456_009G022600                    163   4e-44   Gossypium raimondii
gb|KHG08948.1|  Serine/threonine phosphatase 2A 57 kDa regulatory...    161   3e-43   Gossypium arboreum [tree cotton]
gb|KJB64864.1|  hypothetical protein B456_010G068400                    160   5e-43   Gossypium raimondii
ref|XP_002515563.1|  protein phosphatase 2a, regulatory subunit, ...    160   5e-43   
ref|XP_011010867.1|  PREDICTED: serine/threonine protein phosphat...    156   2e-41   Populus euphratica
ref|XP_002324961.1|  hypothetical protein POPTR_0018s06320g             156   2e-41   Populus trichocarpa [western balsam poplar]
ref|XP_003524519.1|  PREDICTED: serine/threonine protein phosphat...    155   4e-41   Glycine max [soybeans]
gb|KHG22084.1|  Serine/threonine phosphatase 2A 57 kDa regulatory...    154   7e-41   Gossypium arboreum [tree cotton]
gb|KEH32096.1|  protein phosphatase 2A regulatory B subunit famil...    152   1e-40   Medicago truncatula
ref|XP_010249885.1|  PREDICTED: serine/threonine protein phosphat...    154   1e-40   Nelumbo nucifera [Indian lotus]
gb|AFK37737.1|  unknown                                                 152   3e-40   Medicago truncatula
ref|XP_003609196.1|  Serine/threonine protein phosphatase 2A 57 k...    152   3e-40   Medicago truncatula
ref|XP_004508562.1|  PREDICTED: serine/threonine protein phosphat...    152   3e-40   Cicer arietinum [garbanzo]
ref|XP_003549794.1|  PREDICTED: serine/threonine protein phosphat...    151   1e-39   Glycine max [soybeans]
ref|XP_006451050.1|  hypothetical protein CICLE_v10007952mg             150   3e-39   Citrus clementina [clementine]
ref|XP_007155131.1|  hypothetical protein PHAVU_003G176100g             149   7e-39   Phaseolus vulgaris [French bean]
ref|XP_010098941.1|  Serine/threonine protein phosphatase 2A 57 k...    149   2e-38   
ref|XP_010254226.1|  PREDICTED: serine/threonine protein phosphat...    146   5e-38   Nelumbo nucifera [Indian lotus]
gb|KCW82763.1|  hypothetical protein EUGRSUZ_C04140                     144   8e-38   Eucalyptus grandis [rose gum]
gb|KJB83138.1|  hypothetical protein B456_013G231300                    144   2e-37   Gossypium raimondii
ref|XP_010049936.1|  PREDICTED: serine/threonine protein phosphat...    144   3e-37   Eucalyptus grandis [rose gum]
gb|KDO80420.1|  hypothetical protein CISIN_1g009349mg                   143   3e-37   Citrus sinensis [apfelsine]
ref|XP_006451049.1|  hypothetical protein CICLE_v10007952mg             144   5e-37   Citrus clementina [clementine]
ref|XP_007138335.1|  hypothetical protein PHAVU_009G200100g             143   5e-37   Phaseolus vulgaris [French bean]
ref|XP_008337354.1|  PREDICTED: serine/threonine protein phosphat...    141   4e-36   
ref|XP_009374054.1|  PREDICTED: serine/threonine protein phosphat...    139   1e-35   Pyrus x bretschneideri [bai li]
ref|XP_007204385.1|  hypothetical protein PRUPE_ppa004572mg             139   2e-35   Prunus persica
ref|XP_008242686.1|  PREDICTED: serine/threonine protein phosphat...    139   2e-35   Prunus mume [ume]
ref|XP_009371422.1|  PREDICTED: serine/threonine protein phosphat...    137   1e-34   Pyrus x bretschneideri [bai li]
ref|XP_008386225.1|  PREDICTED: serine/threonine protein phosphat...    136   2e-34   
ref|XP_009385620.1|  PREDICTED: serine/threonine protein phosphat...    136   3e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004287389.1|  PREDICTED: serine/threonine protein phosphat...    135   3e-34   Fragaria vesca subsp. vesca
ref|XP_009389489.1|  PREDICTED: serine/threonine protein phosphat...    134   1e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008458023.1|  PREDICTED: serine/threonine protein phosphat...    131   1e-32   Cucumis melo [Oriental melon]
ref|XP_004163599.1|  PREDICTED: serine/threonine protein phosphat...    131   1e-32   
ref|XP_004139334.1|  PREDICTED: serine/threonine protein phosphat...    131   1e-32   Cucumis sativus [cucumbers]
ref|XP_010925115.1|  PREDICTED: serine/threonine protein phosphat...    128   1e-31   Elaeis guineensis
ref|XP_010913433.1|  PREDICTED: serine/threonine protein phosphat...    127   4e-31   Elaeis guineensis
ref|XP_009407446.1|  PREDICTED: serine/threonine protein phosphat...    127   4e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006654758.1|  PREDICTED: serine/threonine protein phosphat...    127   4e-31   Oryza brachyantha
ref|XP_008811587.1|  PREDICTED: serine/threonine protein phosphat...    126   8e-31   Phoenix dactylifera
ref|XP_009415355.1|  PREDICTED: serine/threonine protein phosphat...    125   1e-30   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAY98962.1|  hypothetical protein OsI_20919                          125   1e-30   Oryza sativa Indica Group [Indian rice]
emb|CAC85920.1|  protein phosphatase 2A B'kappa subunit                 125   1e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010533199.1|  PREDICTED: serine/threonine protein phosphat...    125   2e-30   Tarenaya hassleriana [spider flower]
gb|KDP32288.1|  hypothetical protein JCGZ_13213                         125   2e-30   Jatropha curcas
ref|XP_003567932.1|  PREDICTED: serine/threonine protein phosphat...    124   6e-30   Brachypodium distachyon [annual false brome]
ref|XP_007013747.1|  Phosphatase 2A regulatory B subunit family p...    123   8e-30   
ref|XP_006394804.1|  hypothetical protein EUTSA_v10004060mg             122   1e-29   Eutrema salsugineum [saltwater cress]
ref|XP_002458327.1|  hypothetical protein SORBIDRAFT_03g031350          121   4e-29   Sorghum bicolor [broomcorn]
gb|KFK27832.1|  hypothetical protein AALP_AA8G435800                    120   8e-29   Arabis alpina [alpine rockcress]
ref|XP_007223260.1|  hypothetical protein PRUPE_ppa004440mg             120   9e-29   Prunus persica
ref|XP_009377509.1|  PREDICTED: serine/threonine protein phosphat...    120   1e-28   
ref|XP_009372941.1|  PREDICTED: serine/threonine protein phosphat...    120   1e-28   Pyrus x bretschneideri [bai li]
gb|KJB27047.1|  hypothetical protein B456_004G274600                    119   1e-28   Gossypium raimondii
ref|XP_009377393.1|  PREDICTED: serine/threonine protein phosphat...    120   1e-28   Pyrus x bretschneideri [bai li]
ref|XP_008383627.1|  PREDICTED: serine/threonine protein phosphat...    120   2e-28   
gb|KCW80467.1|  hypothetical protein EUGRSUZ_C018111                    119   2e-28   Eucalyptus grandis [rose gum]
ref|NP_001056272.1|  Os05g0555100                                       119   2e-28   
ref|XP_004138753.1|  PREDICTED: serine/threonine protein phosphat...    119   2e-28   Cucumis sativus [cucumbers]
gb|KJB27048.1|  hypothetical protein B456_004G274600                    119   2e-28   Gossypium raimondii
ref|XP_010048263.1|  PREDICTED: serine/threonine protein phosphat...    119   3e-28   Eucalyptus grandis [rose gum]
ref|XP_002440213.1|  hypothetical protein SORBIDRAFT_09g027870          119   3e-28   Sorghum bicolor [broomcorn]
gb|ACN30940.1|  unknown                                                 119   3e-28   Zea mays [maize]
ref|NP_001148974.1|  transposon protein                                 119   4e-28   
ref|XP_008647861.1|  PREDICTED: transposon protein isoform X1           119   4e-28   
ref|XP_008809266.1|  PREDICTED: serine/threonine protein phosphat...    118   4e-28   Phoenix dactylifera
ref|XP_010493808.1|  PREDICTED: serine/threonine protein phosphat...    118   5e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010456709.1|  PREDICTED: serine/threonine protein phosphat...    117   6e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010421407.1|  PREDICTED: serine/threonine protein phosphat...    118   7e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010541630.1|  PREDICTED: serine/threonine protein phosphat...    117   1e-27   
ref|XP_004969559.1|  PREDICTED: serine/threonine protein phosphat...    116   2e-27   Setaria italica
ref|XP_006287577.1|  hypothetical protein CARUB_v10000786mg             116   3e-27   Capsella rubella
gb|KJB07811.1|  hypothetical protein B456_001G045700                    116   3e-27   Gossypium raimondii
gb|KHG19967.1|  Serine/threonine phosphatase 2A 57 kDa regulatory...    116   3e-27   Gossypium arboreum [tree cotton]
ref|XP_002516615.1|  protein phosphatase 2a, regulatory subunit, ...    116   3e-27   Ricinus communis
ref|XP_008445128.1|  PREDICTED: serine/threonine protein phosphat...    116   4e-27   Cucumis melo [Oriental melon]
ref|NP_197933.1|  protein phosphatase 2A regulatory B subunit           115   5e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008394018.1|  PREDICTED: serine/threonine protein phosphat...    115   5e-27   
ref|XP_002308635.2|  hypothetical protein POPTR_0006s26320g             114   8e-27   
ref|XP_010109039.1|  Serine/threonine protein phosphatase 2A 57 k...    116   8e-27   
gb|AFW81037.1|  hypothetical protein ZEAMMB73_275381                    114   1e-26   
emb|CDY54903.1|  BnaC02g48620D                                          114   1e-26   Brassica napus [oilseed rape]
ref|XP_002874266.1|  hypothetical protein ARALYDRAFT_489409             114   2e-26   
ref|XP_011019731.1|  PREDICTED: serine/threonine protein phosphat...    114   2e-26   Populus euphratica
ref|XP_004961286.1|  PREDICTED: serine/threonine protein phosphat...    114   2e-26   Setaria italica
ref|XP_006476190.1|  PREDICTED: serine/threonine protein phosphat...    114   2e-26   
ref|XP_006476191.1|  PREDICTED: serine/threonine protein phosphat...    113   4e-26   Citrus sinensis [apfelsine]
ref|XP_006450560.1|  hypothetical protein CICLE_v10008015mg             113   5e-26   Citrus clementina [clementine]
emb|CDX88186.1|  BnaA06g27770D                                          112   5e-26   
emb|CDX80521.1|  BnaC07g29230D                                          112   5e-26   
ref|XP_008785874.1|  PREDICTED: serine/threonine protein phosphat...    113   5e-26   Phoenix dactylifera
ref|XP_004498632.1|  PREDICTED: serine/threonine protein phosphat...    112   6e-26   Cicer arietinum [garbanzo]
ref|XP_009151080.1|  PREDICTED: serine/threonine protein phosphat...    112   6e-26   Brassica rapa
ref|XP_007161261.1|  hypothetical protein PHAVU_001G055500g             112   1e-25   Phaseolus vulgaris [French bean]
ref|XP_003544625.1|  PREDICTED: serine/threonine protein phosphat...    112   1e-25   Glycine max [soybeans]
emb|CDY05497.1|  BnaA02g31940D                                          111   1e-25   
ref|XP_009129957.1|  PREDICTED: serine/threonine protein phosphat...    111   1e-25   Brassica rapa
ref|XP_010670759.1|  PREDICTED: serine/threonine protein phosphat...    111   2e-25   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011026522.1|  PREDICTED: serine/threonine protein phosphat...    111   2e-25   Populus euphratica
ref|XP_003588682.1|  Serine/threonine protein phosphatase 2A 57 k...    109   7e-25   Medicago truncatula
ref|XP_008785883.1|  PREDICTED: serine/threonine protein phosphat...    108   1e-24   Phoenix dactylifera
ref|XP_004292963.1|  PREDICTED: serine/threonine protein phosphat...    108   3e-24   Fragaria vesca subsp. vesca
emb|CDP18419.1|  unnamed protein product                                108   3e-24   Coffea canephora [robusta coffee]
dbj|BAK03510.1|  predicted protein                                      107   4e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EYU21914.1|  hypothetical protein MIMGU_mgv1a005231mg                105   2e-23   Erythranthe guttata [common monkey flower]
ref|XP_011087131.1|  PREDICTED: serine/threonine protein phosphat...    105   3e-23   Sesamum indicum [beniseed]
ref|XP_011081886.1|  PREDICTED: serine/threonine protein phosphat...    103   1e-22   Sesamum indicum [beniseed]
gb|EYU29254.1|  hypothetical protein MIMGU_mgv1a005961mg                102   2e-22   Erythranthe guttata [common monkey flower]
ref|XP_004241801.1|  PREDICTED: serine/threonine protein phosphat...    102   2e-22   
ref|XP_006353657.1|  PREDICTED: serine/threonine protein phosphat...    100   1e-21   Solanum tuberosum [potatoes]
ref|XP_009619322.1|  PREDICTED: serine/threonine protein phosphat...    100   1e-21   Nicotiana tomentosiformis
ref|XP_009798807.1|  PREDICTED: serine/threonine protein phosphat...    100   2e-21   Nicotiana sylvestris
ref|XP_010925297.1|  PREDICTED: serine/threonine protein phosphat...    100   2e-21   Elaeis guineensis
ref|XP_002284526.1|  PREDICTED: serine/threonine protein phosphat...    100   2e-21   Vitis vinifera
ref|NP_001146050.1|  uncharacterized protein LOC100279581             99.8    3e-21   Zea mays [maize]
ref|XP_003550157.1|  PREDICTED: serine/threonine protein phosphat...  99.4    4e-21   Glycine max [soybeans]
gb|EPS62004.1|  hypothetical protein M569_12788                       97.1    2e-20   Genlisea aurea
ref|XP_007137075.1|  hypothetical protein PHAVU_009G097600g           96.7    4e-20   Phaseolus vulgaris [French bean]
gb|KJB40702.1|  hypothetical protein B456_007G074200                  96.7    5e-20   Gossypium raimondii
ref|XP_003603467.1|  Serine/threonine protein phosphatase 2A 57 k...  95.9    8e-20   Medicago truncatula
gb|KHG13833.1|  Serine/threonine phosphatase 2A 59 kDa regulatory...  95.1    2e-19   Gossypium arboreum [tree cotton]
ref|XP_002448078.1|  hypothetical protein SORBIDRAFT_06g020625        93.6    2e-19   
gb|EPS71240.1|  hypothetical protein M569_03516                       94.0    3e-19   Genlisea aurea
gb|EPS70113.1|  hypothetical protein M569_04647                       90.5    5e-18   Genlisea aurea
ref|XP_004976008.1|  PREDICTED: serine/threonine protein phosphat...  90.9    6e-18   Setaria italica
ref|XP_004501280.1|  PREDICTED: serine/threonine protein phosphat...  90.5    6e-18   
ref|XP_011021363.1|  PREDICTED: serine/threonine protein phosphat...  89.4    2e-17   Populus euphratica
gb|KHN10390.1|  Serine/threonine protein phosphatase 2A 57 kDa re...  88.6    2e-17   Glycine soja [wild soybean]
ref|XP_011042316.1|  PREDICTED: serine/threonine protein phosphat...  89.4    2e-17   Populus euphratica
ref|XP_008669249.1|  PREDICTED: serine/threonine protein phosphat...  88.2    5e-17   Zea mays [maize]
ref|NP_001183245.1|  hypothetical protein                             87.8    5e-17   Zea mays [maize]
ref|XP_003522642.1|  PREDICTED: serine/threonine protein phosphat...  87.8    6e-17   Glycine max [soybeans]
gb|KJB11611.1|  hypothetical protein B456_001G268200                  86.3    1e-16   Gossypium raimondii
ref|XP_003526435.1|  PREDICTED: serine/threonine protein phosphat...  87.0    1e-16   Glycine max [soybeans]
ref|NP_001053130.1|  Os04g0485100                                     87.0    1e-16   
gb|KJB11609.1|  hypothetical protein B456_001G268200                  87.0    1e-16   Gossypium raimondii
ref|XP_007031732.1|  Serine/threonine protein phosphatase 2A 59 k...  86.7    2e-16   
ref|XP_002314559.1|  serine/threonine protein phosphatase 2A regu...  86.3    2e-16   Populus trichocarpa [western balsam poplar]
emb|CDP16651.1|  unnamed protein product                              86.3    2e-16   Coffea canephora [robusta coffee]
emb|CDY38628.1|  BnaA05g19590D                                        86.3    2e-16   Brassica napus [oilseed rape]
ref|XP_004169443.1|  PREDICTED: serine/threonine protein phosphat...  86.3    2e-16   
ref|XP_008797311.1|  PREDICTED: serine/threonine protein phosphat...  86.3    2e-16   Phoenix dactylifera
ref|XP_007031734.1|  Serine/threonine protein phosphatase 2A 59 k...  85.1    3e-16   
ref|XP_006447169.1|  hypothetical protein CICLE_v10014898mg           85.9    3e-16   
emb|CAC09487.2|  H0811E11.3                                           85.9    3e-16   Oryza sativa [red rice]
ref|XP_010551033.1|  PREDICTED: serine/threonine protein phosphat...  85.9    3e-16   
ref|XP_006830091.1|  hypothetical protein AMTR_s00123p00060730        85.9    4e-16   Amborella trichopoda
ref|XP_008441374.1|  PREDICTED: serine/threonine protein phosphat...  85.5    4e-16   Cucumis melo [Oriental melon]
gb|KGN45729.1|  hypothetical protein Csa_6G008600                     85.5    4e-16   Cucumis sativus [cucumbers]
ref|XP_004138464.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...  85.5    4e-16   
ref|XP_002311732.2|  hypothetical protein POPTR_0008s18020g           84.3    5e-16   
emb|CBI27539.3|  unnamed protein product                              84.7    6e-16   Vitis vinifera
ref|XP_009371715.1|  PREDICTED: serine/threonine protein phosphat...  85.1    6e-16   Pyrus x bretschneideri [bai li]
ref|XP_009370310.1|  PREDICTED: serine/threonine protein phosphat...  84.7    6e-16   
ref|XP_010244149.1|  PREDICTED: serine/threonine protein phosphat...  85.1    7e-16   Nelumbo nucifera [Indian lotus]
ref|XP_010660818.1|  PREDICTED: serine/threonine protein phosphat...  84.0    7e-16   
ref|XP_002266932.1|  PREDICTED: serine/threonine protein phosphat...  84.3    1e-15   Vitis vinifera
ref|XP_009145466.1|  PREDICTED: serine/threonine protein phosphat...  84.3    1e-15   Brassica rapa
ref|NP_172803.1|  protein phosphatase 2A B'theta                      84.3    1e-15   Arabidopsis thaliana [mouse-ear cress]
gb|AAM61625.1|  B regulatory subunit of protein phosphatase 2A, p...  84.0    1e-15   Arabidopsis thaliana [mouse-ear cress]
gb|KDO52091.1|  hypothetical protein CISIN_1g0107851mg                83.2    1e-15   Citrus sinensis [apfelsine]
ref|XP_011097329.1|  PREDICTED: serine/threonine protein phosphat...  84.3    1e-15   Sesamum indicum [beniseed]
ref|XP_011029624.1|  PREDICTED: serine/threonine protein phosphat...  83.6    2e-15   Populus euphratica
ref|XP_006438131.1|  hypothetical protein CICLE_v10031285mg           83.6    2e-15   Citrus clementina [clementine]
gb|KDO52090.1|  hypothetical protein CISIN_1g0107851mg                82.8    2e-15   Citrus sinensis [apfelsine]
gb|KDO82045.1|  hypothetical protein CISIN_1g010504mg                 83.6    2e-15   Citrus sinensis [apfelsine]
ref|XP_006469972.1|  PREDICTED: serine/threonine protein phosphat...  83.6    2e-15   Citrus sinensis [apfelsine]
ref|XP_006417120.1|  hypothetical protein EUTSA_v10007450mg           83.2    2e-15   Eutrema salsugineum [saltwater cress]
ref|XP_010089442.1|  Serine/threonine protein phosphatase 2A 59 k...  83.6    2e-15   Morus notabilis
gb|KHG26982.1|  Serine/threonine phosphatase 2A 59 kDa regulatory...  83.2    2e-15   Gossypium arboreum [tree cotton]
gb|KJB33914.1|  hypothetical protein B456_006G038500                  82.8    2e-15   Gossypium raimondii
ref|XP_006652431.1|  PREDICTED: serine/threonine protein phosphat...  83.2    2e-15   Oryza brachyantha
ref|XP_004231808.1|  PREDICTED: serine/threonine protein phosphat...  83.2    3e-15   Solanum lycopersicum
ref|XP_004239176.1|  PREDICTED: serine/threonine protein phosphat...  83.2    3e-15   Solanum lycopersicum
ref|XP_002301608.1|  serine/threonine protein phosphatase 2A regu...  83.2    3e-15   
emb|CDY44320.1|  BnaC05g30730D                                        82.8    3e-15   Brassica napus [oilseed rape]
ref|XP_007222861.1|  hypothetical protein PRUPE_ppa004258mg           83.2    3e-15   Prunus persica
ref|XP_008379151.1|  PREDICTED: serine/threonine protein phosphat...  82.8    3e-15   
ref|XP_006852143.1|  hypothetical protein AMTR_s00049p00063500        83.2    3e-15   Amborella trichopoda
ref|XP_008230444.1|  PREDICTED: serine/threonine protein phosphat...  82.8    4e-15   Prunus mume [ume]
ref|XP_007215087.1|  hypothetical protein PRUPE_ppa004318mg           82.4    4e-15   Prunus persica
gb|KJB33915.1|  hypothetical protein B456_006G038500                  82.4    5e-15   Gossypium raimondii
ref|XP_004304704.1|  PREDICTED: serine/threonine protein phosphat...  82.4    5e-15   Fragaria vesca subsp. vesca
ref|XP_010531427.1|  PREDICTED: serine/threonine protein phosphat...  82.4    5e-15   Tarenaya hassleriana [spider flower]
gb|KDP30791.1|  hypothetical protein JCGZ_13734                       82.4    5e-15   Jatropha curcas
ref|XP_009148646.1|  PREDICTED: serine/threonine protein phosphat...  82.0    7e-15   Brassica rapa
ref|XP_008340161.1|  PREDICTED: serine/threonine protein phosphat...  82.0    7e-15   
ref|XP_006447619.1|  hypothetical protein CICLE_v10014856mg           82.0    7e-15   Citrus clementina [clementine]
emb|CAN66032.1|  hypothetical protein VITISV_019650                   82.0    7e-15   Vitis vinifera
ref|XP_002314558.1|  hypothetical protein POPTR_0010s06450g           81.6    8e-15   Populus trichocarpa [western balsam poplar]
ref|XP_006338659.1|  PREDICTED: serine/threonine protein phosphat...  81.3    1e-14   Solanum tuberosum [potatoes]
gb|AHE76186.1|  protein phosphatase 2a                                81.3    1e-14   Chrysanthemum indicum
ref|XP_002890006.1|  hypothetical protein ARALYDRAFT_471504           81.3    1e-14   
gb|KHF99622.1|  Serine/threonine phosphatase 2A 59 kDa regulatory...  81.3    1e-14   Gossypium arboreum [tree cotton]
emb|CBI28848.3|  unnamed protein product                              80.9    1e-14   Vitis vinifera
ref|XP_008222034.1|  PREDICTED: serine/threonine protein phosphat...  80.9    1e-14   Prunus mume [ume]
ref|XP_009590023.1|  PREDICTED: serine/threonine protein phosphat...  80.9    1e-14   Nicotiana tomentosiformis
ref|XP_002870241.1|  hypothetical protein ARALYDRAFT_329973           81.6    1e-14   
ref|XP_010111637.1|  Serine/threonine protein phosphatase 2A 59 k...  80.9    2e-14   Morus notabilis
ref|XP_009402720.1|  PREDICTED: serine/threonine protein phosphat...  80.9    2e-14   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS71994.1|  hypothetical protein M569_02763                       80.1    2e-14   Genlisea aurea
ref|XP_002969377.1|  hypothetical protein SELMODRAFT_267276           80.5    2e-14   
ref|XP_002970708.1|  hypothetical protein SELMODRAFT_171686           80.5    2e-14   
ref|XP_006307325.1|  hypothetical protein CARUB_v10008945mg           80.5    2e-14   Capsella rubella
ref|XP_011470807.1|  PREDICTED: serine/threonine protein phosphat...  80.5    2e-14   Fragaria vesca subsp. vesca
ref|XP_007222857.1|  hypothetical protein PRUPE_ppa004253mg           80.5    2e-14   Prunus persica
ref|XP_011021368.1|  PREDICTED: serine/threonine protein phosphat...  80.5    2e-14   Populus euphratica
ref|XP_002514975.1|  protein phosphatase 2a, regulatory subunit, ...  80.5    2e-14   Ricinus communis
gb|KHG16605.1|  Serine/threonine phosphatase 2A 59 kDa regulatory...  79.7    2e-14   Gossypium arboreum [tree cotton]
ref|XP_009772668.1|  PREDICTED: serine/threonine protein phosphat...  80.5    2e-14   Nicotiana sylvestris
ref|XP_010250854.1|  PREDICTED: serine/threonine protein phosphat...  80.5    2e-14   Nelumbo nucifera [Indian lotus]
ref|XP_008222035.1|  PREDICTED: serine/threonine protein phosphat...  80.5    2e-14   Prunus mume [ume]
ref|XP_006341761.1|  PREDICTED: serine/threonine protein phosphat...  80.1    2e-14   Solanum tuberosum [potatoes]
emb|CDX98102.1|  BnaA06g08530D                                        80.1    3e-14   
ref|XP_010025360.1|  PREDICTED: serine/threonine protein phosphat...  80.5    3e-14   Eucalyptus grandis [rose gum]
ref|XP_006414514.1|  hypothetical protein EUTSA_v10024939mg           80.1    3e-14   Eutrema salsugineum [saltwater cress]
ref|XP_002514974.1|  protein phosphatase 2a, regulatory subunit, ...  80.1    3e-14   
ref|XP_008340163.1|  PREDICTED: serine/threonine protein phosphat...  80.1    3e-14   
ref|XP_006484025.1|  PREDICTED: serine/threonine protein phosphat...  80.1    3e-14   
ref|XP_006438130.1|  hypothetical protein CICLE_v10031228mg           80.1    3e-14   Citrus clementina [clementine]
ref|XP_004142950.1|  PREDICTED: serine/threonine protein phosphat...  80.1    3e-14   Cucumis sativus [cucumbers]
gb|KCW62001.1|  hypothetical protein EUGRSUZ_H04680                   80.1    3e-14   Eucalyptus grandis [rose gum]
ref|XP_010657226.1|  PREDICTED: serine/threonine protein phosphat...  80.1    3e-14   Vitis vinifera
gb|KDP26745.1|  hypothetical protein JCGZ_17903                       80.1    3e-14   Jatropha curcas
ref|XP_010228176.1|  PREDICTED: serine/threonine protein phosphat...  79.7    3e-14   Brachypodium distachyon [annual false brome]
ref|XP_009359306.1|  PREDICTED: serine/threonine protein phosphat...  80.1    3e-14   Pyrus x bretschneideri [bai li]
ref|XP_011047218.1|  PREDICTED: serine/threonine protein phosphat...  80.1    4e-14   Populus euphratica
ref|XP_003601378.1|  Serine/threonine protein phosphatase 2A 59 k...  79.7    4e-14   Medicago truncatula
ref|XP_010228178.1|  PREDICTED: serine/threonine protein phosphat...  79.3    4e-14   
ref|XP_009412705.1|  PREDICTED: serine/threonine protein phosphat...  79.7    4e-14   
ref|NP_001059361.1|  Os07g0274800                                     79.7    4e-14   
gb|AFW58632.1|  hypothetical protein ZEAMMB73_760675                  79.3    4e-14   
ref|XP_006287591.1|  hypothetical protein CARUB_v10000801mg           79.3    4e-14   Capsella rubella
gb|AGT16585.1|  hypothetical protein SHCRBa_109_M04_F_40              79.7    4e-14   Saccharum hybrid cultivar R570
gb|EYU44814.1|  hypothetical protein MIMGU_mgv1a004709mg              79.7    5e-14   Erythranthe guttata [common monkey flower]
ref|XP_010248839.1|  PREDICTED: serine/threonine protein phosphat...  79.3    5e-14   Nelumbo nucifera [Indian lotus]
gb|EPS59388.1|  hypothetical protein M569_15419                       79.3    5e-14   Genlisea aurea
ref|XP_009412704.1|  PREDICTED: serine/threonine protein phosphat...  79.3    5e-14   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY30030.1|  BnaC05g09900D                                        79.3    6e-14   Brassica napus [oilseed rape]
ref|NP_001146165.1|  hypothetical protein                             79.0    6e-14   Zea mays [maize]
ref|XP_002466111.1|  hypothetical protein SORBIDRAFT_01g001550        79.3    6e-14   
ref|XP_010044751.1|  PREDICTED: serine/threonine protein phosphat...  79.0    8e-14   
ref|XP_004981072.1|  PREDICTED: serine/threonine protein phosphat...  79.0    8e-14   Setaria italica
ref|XP_009780032.1|  PREDICTED: serine/threonine protein phosphat...  78.6    9e-14   Nicotiana sylvestris
ref|XP_009606776.1|  PREDICTED: serine/threonine protein phosphat...  78.6    9e-14   Nicotiana tomentosiformis
ref|XP_006657611.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...  78.6    9e-14   
emb|CDY13605.1|  BnaA06g33180D                                        78.6    9e-14   Brassica napus [oilseed rape]
ref|XP_008649345.1|  PREDICTED: protein phosphatase 2A regulatory...  78.6    1e-13   
ref|NP_001105904.1|  protein phosphatase 2A regulatory subunit B'     78.6    1e-13   
ref|XP_010458797.1|  PREDICTED: serine/threonine protein phosphat...  78.6    1e-13   Camelina sativa [gold-of-pleasure]
ref|XP_008648421.1|  PREDICTED: serine/threonine protein phosphat...  78.6    1e-13   Zea mays [maize]
ref|XP_003580003.1|  PREDICTED: serine/threonine protein phosphat...  78.6    1e-13   Brachypodium distachyon [annual false brome]
ref|XP_010476343.1|  PREDICTED: serine/threonine protein phosphat...  78.6    1e-13   Camelina sativa [gold-of-pleasure]
emb|CDX83578.1|  BnaC07g23180D                                        78.2    1e-13   
gb|KJB31018.1|  hypothetical protein B456_005G172800                  78.6    1e-13   Gossypium raimondii
gb|AFW74402.1|  hypothetical protein ZEAMMB73_323247                  78.6    1e-13   
gb|KHG03259.1|  Serine/threonine phosphatase 2A 59 kDa regulatory...  77.8    1e-13   Gossypium arboreum [tree cotton]
ref|XP_009129571.1|  PREDICTED: serine/threonine protein phosphat...  78.2    1e-13   Brassica rapa
ref|XP_006395602.1|  hypothetical protein EUTSA_v10004020mg           78.2    1e-13   Eutrema salsugineum [saltwater cress]
ref|XP_009152091.1|  PREDICTED: serine/threonine protein phosphat...  78.2    1e-13   
ref|XP_006386782.1|  hypothetical protein POPTR_0002s21550g           78.2    1e-13   Populus trichocarpa [western balsam poplar]
ref|XP_010252513.1|  PREDICTED: serine/threonine protein phosphat...  78.2    1e-13   
ref|XP_007141624.1|  hypothetical protein PHAVU_008G211700g           78.2    1e-13   Phaseolus vulgaris [French bean]
ref|XP_009359296.1|  PREDICTED: serine/threonine protein phosphat...  78.2    2e-13   Pyrus x bretschneideri [bai li]
ref|XP_003555155.1|  PREDICTED: serine/threonine protein phosphat...  78.2    2e-13   Glycine max [soybeans]
ref|XP_010440316.1|  PREDICTED: serine/threonine protein phosphat...  77.8    2e-13   Camelina sativa [gold-of-pleasure]
ref|XP_009414678.1|  PREDICTED: serine/threonine protein phosphat...  77.8    2e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010440315.1|  PREDICTED: serine/threonine protein phosphat...  77.8    2e-13   Camelina sativa [gold-of-pleasure]
gb|EMT15241.1|  Serine/threonine protein phosphatase 2A 59 kDa re...  77.8    2e-13   
emb|CBI40091.3|  unnamed protein product                              77.4    2e-13   
ref|NP_001051871.1|  Os03g0844500                                     77.8    2e-13   
ref|XP_010660814.1|  PREDICTED: serine/threonine protein phosphat...  77.4    2e-13   
emb|CDY40986.1|  BnaA02g27760D                                        78.6    2e-13   
ref|XP_010932304.1|  PREDICTED: serine/threonine protein phosphat...  77.4    2e-13   
ref|XP_010554220.1|  PREDICTED: serine/threonine protein phosphat...  77.4    2e-13   
ref|XP_010486565.1|  PREDICTED: serine/threonine protein phosphat...  77.4    2e-13   
gb|KDP26746.1|  hypothetical protein JCGZ_17904                       77.4    2e-13   
gb|KJB78043.1|  hypothetical protein B456_012G174400                  77.4    2e-13   
ref|XP_003524485.1|  PREDICTED: serine/threonine protein phosphat...  77.4    3e-13   
ref|XP_010537569.1|  PREDICTED: serine/threonine protein phosphat...  77.4    3e-13   
ref|XP_008444411.1|  PREDICTED: serine/threonine protein phosphat...  77.4    3e-13   
gb|KDP46344.1|  hypothetical protein JCGZ_10184                       77.4    3e-13   
emb|CDY48287.1|  BnaC01g31410D                                        77.0    3e-13   
ref|XP_003553878.1|  PREDICTED: serine/threonine protein phosphat...  77.4    3e-13   
ref|XP_007044972.1|  Serine/threonine protein phosphatase 2A 59 k...  77.0    3e-13   
emb|CAB10320.1|  phosphatase like protein                             77.8    3e-13   
ref|XP_009411828.1|  PREDICTED: serine/threonine protein phosphat...  77.0    3e-13   
ref|XP_009411830.1|  PREDICTED: serine/threonine protein phosphat...  77.0    3e-13   
ref|XP_001767940.1|  predicted protein                                76.6    4e-13   
ref|XP_001768015.1|  predicted protein                                76.6    4e-13   
ref|XP_009411832.1|  PREDICTED: serine/threonine protein phosphat...  77.0    4e-13   
ref|XP_009620794.1|  PREDICTED: serine/threonine protein phosphat...  77.0    4e-13   
ref|XP_006375538.1|  hypothetical protein POPTR_0014s15530g           76.3    4e-13   
ref|XP_001766428.1|  predicted protein                                76.6    4e-13   
gb|KHG18630.1|  Serine/threonine phosphatase 2A 59 kDa regulatory...  77.0    4e-13   
emb|CDX99733.1|  BnaC02g35870D                                        77.4    4e-13   
gb|KJB10684.1|  hypothetical protein B456_001G216400                  77.0    4e-13   
ref|XP_010660823.1|  PREDICTED: serine/threonine protein phosphat...  76.6    4e-13   
ref|NP_001154648.1|  protein phosphatase 2A regulatory subunit B'...  76.6    4e-13   
ref|NP_189231.1|  protein phosphatase 2A regulatory subunit B' eta    76.6    4e-13   
ref|XP_002311731.1|  hypothetical protein POPTR_0008s18010g           76.6    5e-13   
ref|NP_195967.1|  protein phosphatase 2A B' alpha                     76.6    5e-13   
ref|XP_011098818.1|  PREDICTED: serine/threonine protein phosphat...  76.6    5e-13   
ref|NP_001154647.1|  protein phosphatase 2A regulatory subunit B'...  76.6    5e-13   
gb|EPS70490.1|  protein phosphatase 2a                                76.6    5e-13   
gb|KJB42861.1|  hypothetical protein B456_007G171000                  76.6    5e-13   
emb|CDP13292.1|  unnamed protein product                              76.6    5e-13   
dbj|BAK05777.1|  predicted protein                                    76.3    5e-13   
ref|XP_009786927.1|  PREDICTED: serine/threonine protein phosphat...  76.6    5e-13   
dbj|BAJ97460.1|  predicted protein                                    76.3    5e-13   
gb|KHN30494.1|  Serine/threonine protein phosphatase 2A 59 kDa re...  76.3    6e-13   
ref|XP_009418105.1|  PREDICTED: serine/threonine protein phosphat...  76.3    6e-13   
ref|XP_011457446.1|  PREDICTED: serine/threonine protein phosphat...  76.3    6e-13   
ref|XP_011029625.1|  PREDICTED: serine/threonine protein phosphat...  76.3    7e-13   
emb|CDY22925.1|  BnaA01g18630D                                        75.9    7e-13   
ref|XP_009147392.1|  PREDICTED: serine/threonine protein phosphat...  75.9    7e-13   
ref|XP_010497141.1|  PREDICTED: serine/threonine protein phosphat...  75.9    7e-13   
ref|XP_001766093.1|  predicted protein                                75.9    8e-13   
ref|XP_010317069.1|  PREDICTED: serine/threonine protein phosphat...  75.9    8e-13   
ref|XP_010449943.1|  PREDICTED: serine/threonine protein phosphat...  75.9    8e-13   
gb|EYU34778.1|  hypothetical protein MIMGU_mgv1a004809mg              75.9    8e-13   
ref|XP_010423705.1|  PREDICTED: serine/threonine protein phosphat...  75.5    9e-13   
ref|XP_001782778.1|  predicted protein                                75.5    1e-12   
ref|XP_010490830.1|  PREDICTED: serine/threonine protein phosphat...  75.5    1e-12   
ref|XP_009377048.1|  PREDICTED: serine/threonine protein phosphat...  75.5    1e-12   
ref|NP_567464.1|  protein phosphatase 2A B'gamma                      75.5    1e-12   
gb|AAM10385.1|  AT4g15410/dl3750w                                     75.5    1e-12   
ref|XP_008230000.1|  PREDICTED: serine/threonine protein phosphat...  75.5    1e-12   
ref|XP_010514230.1|  PREDICTED: serine/threonine protein phosphat...  75.5    1e-12   
ref|XP_010514232.1|  PREDICTED: serine/threonine protein phosphat...  75.5    1e-12   
ref|XP_011098814.1|  PREDICTED: serine/threonine protein phosphat...  75.5    1e-12   
gb|EMS66139.1|  Serine/threonine protein phosphatase 2A 59 kDa re...  75.5    1e-12   
ref|XP_006650885.1|  PREDICTED: serine/threonine protein phosphat...  75.1    1e-12   
gb|EMT26962.1|  Serine/threonine protein phosphatase 2A 59 kDa re...  75.1    1e-12   
ref|XP_006283548.1|  hypothetical protein CARUB_v10004601mg           75.1    1e-12   
ref|XP_002871036.1|  hypothetical protein ARALYDRAFT_487124           75.1    2e-12   
ref|XP_010907768.1|  PREDICTED: serine/threonine protein phosphat...  74.7    2e-12   
ref|XP_001774044.1|  predicted protein                                75.1    2e-12   
ref|XP_006357177.1|  PREDICTED: serine/threonine protein phosphat...  75.1    2e-12   
ref|XP_011005899.1|  PREDICTED: serine/threonine protein phosphat...  75.1    2e-12   
ref|XP_010907766.1|  PREDICTED: serine/threonine protein phosphat...  75.1    2e-12   
ref|XP_008364197.1|  PREDICTED: serine/threonine protein phosphat...  74.7    2e-12   
ref|XP_009365093.1|  PREDICTED: serine/threonine protein phosphat...  75.1    2e-12   
ref|XP_002875297.1|  hypothetical protein ARALYDRAFT_904782           74.7    2e-12   
ref|XP_010907764.1|  PREDICTED: serine/threonine protein phosphat...  74.7    2e-12   
ref|XP_007217254.1|  hypothetical protein PRUPE_ppa003902mg           74.7    2e-12   
ref|XP_010434994.1|  PREDICTED: serine/threonine protein phosphat...  74.7    2e-12   
ref|XP_010029046.1|  PREDICTED: serine/threonine protein phosphat...  74.7    2e-12   
ref|XP_010556177.1|  PREDICTED: serine/threonine protein phosphat...  74.7    2e-12   
ref|XP_008799952.1|  PREDICTED: serine/threonine protein phosphat...  74.7    2e-12   
ref|XP_006428448.1|  hypothetical protein CICLE_v10011941mg           73.9    2e-12   
ref|XP_010932088.1|  PREDICTED: serine/threonine protein phosphat...  73.9    2e-12   
ref|XP_010932086.1|  PREDICTED: serine/threonine protein phosphat...  74.3    2e-12   
ref|XP_003545564.1|  PREDICTED: serine/threonine protein phosphat...  74.7    2e-12   
ref|XP_004243528.1|  PREDICTED: serine/threonine protein phosphat...  74.3    3e-12   
ref|XP_006604586.1|  PREDICTED: serine/threonine protein phosphat...  74.3    3e-12   
gb|KHN38476.1|  Serine/threonine protein phosphatase 2A 59 kDa re...  74.3    3e-12   
ref|XP_003519459.1|  PREDICTED: serine/threonine protein phosphat...  74.3    3e-12   
ref|XP_010932087.1|  PREDICTED: serine/threonine protein phosphat...  73.9    3e-12   
ref|XP_002444972.1|  hypothetical protein SORBIDRAFT_07g002150        74.3    3e-12   
gb|KDO40519.1|  hypothetical protein CISIN_1g011191mg                 74.3    3e-12   
ref|XP_006406248.1|  hypothetical protein EUTSA_v10020525mg           74.3    3e-12   
ref|XP_002459695.1|  hypothetical protein SORBIDRAFT_02g008950        74.3    3e-12   
ref|XP_003553562.1|  PREDICTED: serine/threonine protein phosphat...  73.9    3e-12   
ref|XP_010100283.1|  Serine/threonine protein phosphatase 2A 59 k...  74.3    3e-12   
ref|XP_006491669.1|  PREDICTED: serine/threonine protein phosphat...  73.9    3e-12   
ref|XP_006299224.1|  hypothetical protein CARUB_v10015373mg           73.2    3e-12   
ref|XP_006297503.1|  hypothetical protein CARUB_v10013525mg           73.9    3e-12   
ref|XP_008387532.1|  PREDICTED: serine/threonine protein phosphat...  73.9    4e-12   
ref|XP_002323997.1|  serine/threonine protein phosphatase 2A regu...  73.9    4e-12   
ref|XP_010502490.1|  PREDICTED: serine/threonine protein phosphat...  73.9    4e-12   
ref|XP_008363215.1|  PREDICTED: serine/threonine protein phosphat...  73.9    4e-12   
ref|XP_003535186.1|  PREDICTED: serine/threonine protein phosphat...  73.6    4e-12   
ref|XP_010100284.1|  Serine/threonine protein phosphatase 2A 59 k...  73.9    4e-12   
ref|XP_010425263.1|  PREDICTED: serine/threonine protein phosphat...  73.9    4e-12   
ref|XP_002882642.1|  hypothetical protein ARALYDRAFT_478311           73.6    4e-12   
gb|KIZ01362.1|  Serine/threonine protein phosphatase 2A regulator...  70.1    4e-12   
ref|XP_003521415.1|  PREDICTED: serine/threonine protein phosphat...  73.6    4e-12   
ref|XP_002525315.1|  protein phosphatase 2a, regulatory subunit, ...  73.9    4e-12   
ref|XP_010452229.1|  PREDICTED: serine/threonine protein phosphat...  73.6    4e-12   
emb|CDY41574.1|  BnaC05g43110D                                        73.6    5e-12   
ref|XP_009625334.1|  PREDICTED: serine/threonine protein phosphat...  73.6    5e-12   
dbj|BAB02360.1|  protein phosphatase 2A B' regulatory subunit         73.6    5e-12   
ref|XP_004310036.1|  PREDICTED: serine/threonine protein phosphat...  73.6    5e-12   
ref|XP_006299096.1|  hypothetical protein CARUB_v10015234mg           73.6    5e-12   
ref|XP_010495328.1|  PREDICTED: serine/threonine protein phosphat...  73.6    5e-12   
ref|XP_010098803.1|  Serine/threonine protein phosphatase 2A 57 k...  73.6    5e-12   
ref|XP_010682883.1|  PREDICTED: serine/threonine protein phosphat...  73.6    6e-12   
gb|EYU44815.1|  hypothetical protein MIMGU_mgv1a005633mg              73.2    6e-12   
ref|XP_004502031.1|  PREDICTED: serine/threonine protein phosphat...  73.2    6e-12   
ref|XP_008351065.1|  PREDICTED: serine/threonine protein phosphat...  72.8    6e-12   
ref|XP_011010241.1|  PREDICTED: serine/threonine protein phosphat...  73.2    7e-12   
ref|XP_011012347.1|  PREDICTED: serine/threonine protein phosphat...  73.2    7e-12   
gb|KHM99097.1|  Serine/threonine protein phosphatase 2A 59 kDa re...  73.2    7e-12   
ref|XP_011071183.1|  PREDICTED: serine/threonine protein phosphat...  73.2    7e-12   
ref|XP_008389801.1|  PREDICTED: serine/threonine protein phosphat...  72.8    8e-12   
ref|XP_007044975.1|  Phosphatase 2A regulatory B subunit family p...  72.8    8e-12   
ref|XP_003542561.1|  PREDICTED: serine/threonine protein phosphat...  72.8    9e-12   
emb|CDX90593.1|  BnaA03g41880D                                        72.4    1e-11   
ref|XP_003573322.1|  PREDICTED: serine/threonine protein phosphat...  72.8    1e-11   
ref|XP_010464647.1|  PREDICTED: serine/threonine protein phosphat...  72.4    1e-11   
ref|XP_010682885.1|  PREDICTED: serine/threonine protein phosphat...  72.4    1e-11   
ref|XP_006398799.1|  hypothetical protein EUTSA_v10013349mg           72.0    1e-11   
ref|XP_001758786.1|  predicted protein                                72.4    1e-11   
ref|XP_008379655.1|  PREDICTED: serine/threonine protein phosphat...  72.0    1e-11   
ref|XP_007151564.1|  hypothetical protein PHAVU_004G057400g           72.0    2e-11   
ref|XP_010510456.1|  PREDICTED: serine/threonine protein phosphat...  72.0    2e-11   
ref|XP_009370979.1|  PREDICTED: serine/threonine protein phosphat...  71.2    2e-11   
ref|NP_187599.1|  serine/threonine protein phosphatase 2A regulat...  71.6    2e-11   
ref|XP_010234950.1|  PREDICTED: serine/threonine protein phosphat...  71.6    2e-11   
emb|CDY09766.1|  BnaC07g32950D                                        71.6    2e-11   
ref|XP_010543448.1|  PREDICTED: serine/threonine protein phosphat...  71.6    2e-11   
ref|XP_006407628.1|  hypothetical protein EUTSA_v10020593mg           71.2    3e-11   
ref|XP_010478286.1|  PREDICTED: serine/threonine protein phosphat...  71.2    3e-11   
ref|XP_007162788.1|  hypothetical protein PHAVU_001G180600g           71.2    3e-11   
ref|XP_002885457.1|  protein phosphatase 2A B                         71.2    3e-11   
ref|XP_006293086.1|  hypothetical protein CARUB_v10019373mg           71.2    3e-11   
ref|NP_001169040.1|  hypothetical protein                             71.2    3e-11   
ref|XP_009135039.1|  PREDICTED: serine/threonine protein phosphat...  71.2    3e-11   
ref|XP_002956177.1|  hypothetical protein VOLCADRAFT_107119           70.9    3e-11   
ref|XP_010466418.1|  PREDICTED: serine/threonine protein phosphat...  70.9    4e-11   
ref|XP_008389803.1|  PREDICTED: serine/threonine protein phosphat...  70.9    4e-11   
ref|XP_009358742.1|  PREDICTED: serine/threonine protein phosphat...  70.9    4e-11   
ref|XP_009762457.1|  PREDICTED: serine/threonine protein phosphat...  70.9    4e-11   
ref|XP_009762455.1|  PREDICTED: serine/threonine protein phosphat...  70.9    4e-11   
gb|KFK38377.1|  hypothetical protein AALP_AA3G106000                  70.9    4e-11   
emb|CDY07942.1|  BnaC03g35810D                                        70.9    4e-11   
ref|XP_010927329.1|  PREDICTED: serine/threonine protein phosphat...  70.9    4e-11   
ref|XP_001693445.1|  PP2A-widerborst subunit                          70.9    4e-11   
ref|XP_004156272.1|  PREDICTED: serine/threonine protein phosphat...  70.1    5e-11   
ref|XP_007049146.1|  Phosphatase 2A regulatory B subunit family p...  70.9    5e-11   
ref|XP_009762462.1|  PREDICTED: serine/threonine protein phosphat...  70.5    5e-11   
ref|XP_004143280.1|  PREDICTED: serine/threonine protein phosphat...  70.5    5e-11   
ref|XP_008462494.1|  PREDICTED: serine/threonine protein phosphat...  70.5    5e-11   
ref|XP_009385575.1|  PREDICTED: serine/threonine protein phosphat...  70.5    5e-11   
ref|XP_011086721.1|  PREDICTED: serine/threonine protein phosphat...  70.5    5e-11   
ref|XP_002519463.1|  protein phosphatase 2a, regulatory subunit, ...  70.5    5e-11   
ref|XP_002323499.1|  serine/threonine protein phosphatase 2A regu...  70.5    5e-11   
ref|XP_008350950.1|  PREDICTED: serine/threonine protein phosphat...  70.5    5e-11   
ref|XP_007027455.1|  Phosphatase 2A regulatory B subunit family p...  70.5    6e-11   
tpg|DAA39803.1|  TPA: hypothetical protein ZEAMMB73_878468            70.5    6e-11   
ref|XP_004515912.1|  PREDICTED: serine/threonine protein phosphat...  70.1    6e-11   
ref|XP_007163719.1|  hypothetical protein PHAVU_001G258400g           70.1    7e-11   
ref|XP_002973626.1|  hypothetical protein SELMODRAFT_149261           69.7    8e-11   
ref|XP_006357949.1|  PREDICTED: serine/threonine protein phosphat...  70.1    8e-11   
ref|XP_003601840.1|  Serine/threonine protein phosphatase 2A 59 k...  69.7    9e-11   
ref|XP_003551893.1|  PREDICTED: serine/threonine protein phosphat...  69.7    9e-11   
ref|XP_005852026.1|  hypothetical protein CHLNCDRAFT_55925            69.3    1e-10   
ref|XP_011006622.1|  PREDICTED: serine/threonine protein phosphat...  69.7    1e-10   
ref|XP_010653990.1|  PREDICTED: serine/threonine protein phosphat...  68.9    1e-10   
ref|XP_006659077.1|  PREDICTED: serine/threonine protein phosphat...  69.3    1e-10   
ref|XP_002268629.1|  PREDICTED: serine/threonine protein phosphat...  69.3    1e-10   
ref|XP_006297394.1|  hypothetical protein CARUB_v10013418mg           69.3    1e-10   
emb|CDX73997.1|  BnaA03g30500D                                        69.3    1e-10   
gb|EMS53921.1|  Serine/threonine protein phosphatase 2A 59 kDa re...  69.3    1e-10   
ref|XP_004972977.1|  PREDICTED: serine/threonine protein phosphat...  69.3    1e-10   
gb|KDP29180.1|  hypothetical protein JCGZ_16569                       69.3    1e-10   
ref|NP_188802.1|  protein phosphatase 2A B'zeta                       69.3    2e-10   
gb|EMT31243.1|  Serine/threonine protein phosphatase 2A 59 kDa re...  68.9    2e-10   
ref|XP_011468144.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...  68.9    2e-10   
ref|XP_010488186.1|  PREDICTED: serine/threonine protein phosphat...  68.9    2e-10   
ref|XP_004489571.1|  PREDICTED: serine/threonine protein phosphat...  68.9    2e-10   
ref|XP_008795966.1|  PREDICTED: serine/threonine protein phosphat...  68.9    2e-10   
gb|KFK24801.1|  hypothetical protein AALP_AA8G026900                  68.9    2e-10   
ref|XP_010548887.1|  PREDICTED: serine/threonine protein phosphat...  68.6    2e-10   
ref|XP_006838709.1|  hypothetical protein AMTR_s00002p00250530        68.6    2e-10   
ref|XP_010267227.1|  PREDICTED: serine/threonine protein phosphat...  68.6    2e-10   
ref|XP_004502334.1|  PREDICTED: serine/threonine protein phosphat...  68.6    2e-10   
gb|KHN44403.1|  Serine/threonine protein phosphatase 2A 59 kDa re...  68.6    2e-10   
ref|XP_003538573.1|  PREDICTED: serine/threonine protein phosphat...  68.6    2e-10   
ref|XP_008241387.1|  PREDICTED: serine/threonine protein phosphat...  68.6    3e-10   
ref|XP_007201959.1|  hypothetical protein PRUPE_ppa004682mg           68.6    3e-10   
ref|XP_004494078.1|  PREDICTED: serine/threonine protein phosphat...  68.2    3e-10   
gb|KEH25427.1|  protein phosphatase 2A regulatory B subunit famil...  67.8    3e-10   
gb|KIY95657.1|  Serine/threonine protein phosphatase 2A regulator...  68.2    4e-10   
gb|KEH25426.1|  protein phosphatase 2A regulatory B subunit famil...  67.8    5e-10   
ref|XP_011018792.1|  PREDICTED: serine/threonine protein phosphat...  67.4    5e-10   
gb|KJB36484.1|  hypothetical protein B456_006G161400                  67.0    5e-10   
ref|XP_006381385.1|  hypothetical protein POPTR_0006s12420g           67.4    6e-10   
ref|XP_010558192.1|  PREDICTED: serine/threonine protein phosphat...  67.4    6e-10   
gb|KJB36483.1|  hypothetical protein B456_006G161400                  67.4    6e-10   
gb|EYU34040.1|  hypothetical protein MIMGU_mgv1a004567mg              67.4    6e-10   
ref|XP_010940226.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...  67.0    7e-10   
ref|XP_009137092.1|  PREDICTED: serine/threonine protein phosphat...  67.8    7e-10   
ref|XP_008812431.1|  PREDICTED: serine/threonine protein phosphat...  67.0    8e-10   
gb|EYU38570.1|  hypothetical protein MIMGU_mgv1a005237mg              66.6    9e-10   
ref|XP_010935325.1|  PREDICTED: serine/threonine protein phosphat...  66.6    1e-09   
ref|XP_004955944.1|  PREDICTED: serine/threonine protein phosphat...  66.2    1e-09   
ref|XP_002962142.1|  hypothetical protein SELMODRAFT_63731            66.2    1e-09   
ref|XP_004955943.1|  PREDICTED: serine/threonine protein phosphat...  66.2    1e-09   



>ref|XP_006366869.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Solanum tuberosum]
Length=506

 Score =   214 bits (544),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 129/145 (89%), Gaps = 2/145 (1%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            MLKQILAK+PRKS K D+ DSSG+  NSCN+ +N GNG+QFTNSC VI NRLNVVKR+S+
Sbjct  1    MLKQILAKLPRKSSKCDTFDSSGS--NSCNNTSNLGNGIQFTNSCTVIANRLNVVKRMST  58

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            AIFPASIV+GGES++PH+ FKDVSN EKQ L VSKLNLCC++YDF DPDK++AEKDLKRQ
Sbjct  59   AIFPASIVSGGESVAPHVPFKDVSNAEKQSLFVSKLNLCCTIYDFNDPDKDSAEKDLKRQ  118

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
            VLLELN+FVASGS + TESAIAAVC
Sbjct  119  VLLELNEFVASGSARFTESAIAAVC  143



>ref|XP_009797723.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Nicotiana sylvestris]
Length=507

 Score =   213 bits (541),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 125/145 (86%), Gaps = 2/145 (1%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            MLKQILAK+PRKS K DS D+SG+  NSCN+ TNSGNG+ FTNSC VI  RLNVVKR+S+
Sbjct  1    MLKQILAKLPRKSSKCDSFDTSGS--NSCNNTTNSGNGIPFTNSCTVIATRLNVVKRMST  58

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            AIFP SIVAG ES++PH+ FKDVSNGEKQ L +SKLNLCCS+YDF DPDK+  EKDLKRQ
Sbjct  59   AIFPTSIVAGNESVAPHVPFKDVSNGEKQSLFISKLNLCCSIYDFNDPDKDLTEKDLKRQ  118

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
            VLLELNDFVASGS + TESAIAAVC
Sbjct  119  VLLELNDFVASGSARFTESAIAAVC  143



>emb|CDP21530.1| unnamed protein product [Coffea canephora]
Length=519

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 121/152 (80%), Gaps = 2/152 (1%)
 Frame = +2

Query  68   IHWSFATMLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLN  247
            + W  ATMLKQILAK+PRK LKSDSL S G+  +SCN   NS NG+QFTN+C+VI +RLN
Sbjct  7    VDWRPATMLKQILAKLPRKPLKSDSLTSVGS--DSCNTSPNSDNGIQFTNTCSVISSRLN  64

Query  248  VVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAA  427
            VVKR S AIFPASI+AGG+ + PH+ FKDV N +KQ L VSKLNLCC VYDF DP KN  
Sbjct  65   VVKRKSWAIFPASIIAGGDLVEPHVPFKDVPNADKQSLFVSKLNLCCLVYDFSDPGKNTK  124

Query  428  EKDLKRQVLLELNDFVASGSVKCTESAIAAVC  523
            EKDLK Q+LLEL DFVASGS K TESAIAA+C
Sbjct  125  EKDLKHQILLELGDFVASGSAKFTESAIAAIC  156



>ref|XP_004251590.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Solanum lycopersicum]
 ref|XP_010313712.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Solanum lycopersicum]
 ref|XP_010313713.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Solanum lycopersicum]
 ref|XP_010313714.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Solanum lycopersicum]
 ref|XP_010313715.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Solanum lycopersicum]
Length=506

 Score =   193 bits (490),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 126/145 (87%), Gaps = 2/145 (1%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            MLKQILAK+PRKS K D+ DSSG+  ++    +N GNG+QFTNSC VI NRLNVVKR+S+
Sbjct  1    MLKQILAKLPRKSSKCDTFDSSGSNSSNNT--SNLGNGIQFTNSCTVIANRLNVVKRMST  58

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            AIFPASIVAGGES++PH+ FKDVSN EKQ L VSKLNLCC++YDF DPDK++AEKDLKRQ
Sbjct  59   AIFPASIVAGGESVAPHVPFKDVSNAEKQSLFVSKLNLCCTIYDFNDPDKDSAEKDLKRQ  118

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
            VLLELN+FVASGS + TESAIAAVC
Sbjct  119  VLLELNEFVASGSARFTESAIAAVC  143



>ref|XP_009630828.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Nicotiana tomentosiformis]
 ref|XP_009630829.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Nicotiana tomentosiformis]
Length=507

 Score =   184 bits (466),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 123/145 (85%), Gaps = 2/145 (1%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            MLKQILAK+PRKS K DS D+SG+   + N  TNSGNG+ F NSC VI  RLNVVKR+S+
Sbjct  1    MLKQILAKLPRKSSKCDSFDTSGSNSCNNN--TNSGNGIPFANSCTVIATRLNVVKRMST  58

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            AIFP SIVAGGES++PH+ FKDVSN EKQ L VSKLNLCCS+YDF DPDK++AEKDLKRQ
Sbjct  59   AIFPTSIVAGGESVAPHIPFKDVSNAEKQSLFVSKLNLCCSIYDFNDPDKDSAEKDLKRQ  118

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
            VLLELNDFVASGS + TE+AIAAVC
Sbjct  119  VLLELNDFVASGSARFTETAIAAVC  143



>ref|XP_007013281.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform 2 [Theobroma cacao]
 gb|EOY30900.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform 2 [Theobroma cacao]
Length=506

 Score =   167 bits (424),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 116/145 (80%), Gaps = 2/145 (1%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            MLKQIL+K+PRKS KSDSLDS+G   +S N  +NSGNG+Q TN  N I +RL+VVKRVSS
Sbjct  1    MLKQILSKLPRKSQKSDSLDSAGI--DSGNQTSNSGNGVQCTNIGNSISSRLSVVKRVSS  58

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPASI+AG E++ P+L FKDVSN +KQ L +SKLNLCC V DF DPDK  AE+DLKRQ
Sbjct  59   AVFPASIMAGVEAVEPNLSFKDVSNPQKQNLFISKLNLCCEVSDFSDPDKTNAEQDLKRQ  118

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
             L+EL DFV+SGS K  E AIAA+C
Sbjct  119  TLIELVDFVSSGSAKFNEPAIAAMC  143



>gb|KDP32329.1| hypothetical protein JCGZ_13254 [Jatropha curcas]
Length=503

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 110/145 (76%), Gaps = 5/145 (3%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            MLKQIL+KIPRKS KSD         +S N  TN GNG+  TNS N   +RLNVVKRVSS
Sbjct  1    MLKQILSKIPRKSSKSD-----PLDSDSGNSSTNWGNGIPCTNSGNSFSSRLNVVKRVSS  55

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPASI++G E++ PHL FKDVSN +KQ L VSKLN CC V DF DPDK AA+++LKRQ
Sbjct  56   AVFPASIMSGAEAVEPHLSFKDVSNMQKQNLFVSKLNFCCEVCDFSDPDKLAAQQELKRQ  115

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
             L++L DFV+SGS K TESA+AA+C
Sbjct  116  TLMDLVDFVSSGSAKFTESAMAAMC  140



>ref|XP_007013280.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform 1 [Theobroma cacao]
 gb|EOY30899.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform 1 [Theobroma cacao]
Length=545

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 117/147 (80%), Gaps = 2/147 (1%)
 Frame = +2

Query  83   ATMLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRV  262
            + MLKQIL+K+PRKS KSDSLDS+G   +S N  +NSGNG+Q TN  N I +RL+VVKRV
Sbjct  38   SIMLKQILSKLPRKSQKSDSLDSAGI--DSGNQTSNSGNGVQCTNIGNSISSRLSVVKRV  95

Query  263  SSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLK  442
            SSA+FPASI+AG E++ P+L FKDVSN +KQ L +SKLNLCC V DF DPDK  AE+DLK
Sbjct  96   SSAVFPASIMAGVEAVEPNLSFKDVSNPQKQNLFISKLNLCCEVSDFSDPDKTNAEQDLK  155

Query  443  RQVLLELNDFVASGSVKCTESAIAAVC  523
            RQ L+EL DFV+SGS K  E AIAA+C
Sbjct  156  RQTLIELVDFVSSGSAKFNEPAIAAMC  182



>ref|XP_010656380.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Vitis vinifera]
 ref|XP_010656381.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Vitis vinifera]
 emb|CBI28127.3| unnamed protein product [Vitis vinifera]
Length=534

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 113/157 (72%), Gaps = 10/157 (6%)
 Frame = +2

Query  53   RFDLYIHWSFATMLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVI  232
            RF    HW  ATM+KQIL+K+PRKS KSD+L S+G+     N+ TN G+ +Q +N     
Sbjct  24   RFPSVQHWGIATMIKQILSKLPRKSSKSDTLASAGS---DSNNNTNLGSSIQCSNG----  76

Query  233  VNRLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDP  412
               LNVV+R+SSA+FP+ + AG E++ PHL FKDV N EKQ L VSKLNLCC VY F DP
Sbjct  77   ---LNVVRRMSSAVFPSMVAAGAEAVEPHLSFKDVPNTEKQKLFVSKLNLCCVVYHFNDP  133

Query  413  DKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVC  523
            DK+ AEKD KRQ L+EL DFVASGS K +E+AIAA C
Sbjct  134  DKDQAEKDSKRQALIELVDFVASGSAKFSEAAIAATC  170



>gb|KJB54144.1| hypothetical protein B456_009G022600 [Gossypium raimondii]
 gb|KJB54145.1| hypothetical protein B456_009G022600 [Gossypium raimondii]
Length=507

 Score =   163 bits (413),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 116/145 (80%), Gaps = 2/145 (1%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            MLKQIL+K+PRKS KSDSLDS+G   +S N  +NS NG+Q TN  N I +RL+VVKRVSS
Sbjct  1    MLKQILSKLPRKSQKSDSLDSAGL--DSGNHTSNSSNGVQCTNIGNSITSRLSVVKRVSS  58

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPASI+AG E++ P+L FKDVSN +KQ L +SKLNLCC V DF DP+K ++E+DLKRQ
Sbjct  59   AVFPASIMAGVEAVEPNLSFKDVSNPQKQNLFISKLNLCCEVSDFSDPEKASSEQDLKRQ  118

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
             L+EL DFV+SGS K  E A+AA+C
Sbjct  119  TLIELVDFVSSGSAKFNEPAVAAMC  143



>gb|KHG08948.1| Serine/threonine phosphatase 2A 57 kDa regulatory subunit B' 
iota-like protein [Gossypium arboreum]
Length=507

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 115/145 (79%), Gaps = 2/145 (1%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            MLKQIL+K+PRKS KSDSLDS+G   +S N  +N  NG+Q TN  N I +RL+VVKRVSS
Sbjct  1    MLKQILSKLPRKSQKSDSLDSAGL--DSGNHTSNLSNGVQCTNIGNSITSRLSVVKRVSS  58

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPASI+AG E++ P+L FKDVSN +KQ L +SKLNLCC V DF DP+K ++E+DLKRQ
Sbjct  59   AVFPASIMAGVEAVEPNLSFKDVSNPQKQNLFISKLNLCCEVSDFSDPEKASSEQDLKRQ  118

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
             L+EL DFV+SGS K  E A+AA+C
Sbjct  119  TLIELVDFVSSGSAKFNEPAVAAMC  143



>gb|KJB64864.1| hypothetical protein B456_010G068400 [Gossypium raimondii]
Length=496

 Score =   160 bits (405),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 111/145 (77%), Gaps = 2/145 (1%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            MLKQIL K+PRK  KSD LDSSG+  +S N  +NSGNG+Q TN  N I +RL+VVKRVSS
Sbjct  1    MLKQILIKLPRKLQKSDLLDSSGS--DSGNHTSNSGNGVQCTNIGNSISSRLSVVKRVSS  58

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPASI+ G E++ P+L F DVS  +KQ L +SKLNLCC V DF DPDK +AE+DLK Q
Sbjct  59   AVFPASIMVGVEAVEPYLSFTDVSILQKQSLFISKLNLCCEVSDFSDPDKTSAEQDLKHQ  118

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
             L+EL DFV++GS K  E AIAA+C
Sbjct  119  TLIELVDFVSTGSAKFNEPAIAAMC  143



>ref|XP_002515563.1| protein phosphatase 2a, regulatory subunit, putative [Ricinus 
communis]
 gb|EEF47012.1| protein phosphatase 2a, regulatory subunit, putative [Ricinus 
communis]
Length=543

 Score =   160 bits (406),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 112/146 (77%), Gaps = 3/146 (2%)
 Frame = +2

Query  86   TMLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVS  265
            TMLKQIL+KIPRKS KS+S DS+G +  S N+ +N GNG+  TN  N   +RLNVVKRVS
Sbjct  40   TMLKQILSKIPRKSSKSESFDSAGIE--SGNNSSNWGNGVPCTNGGNSFSSRLNVVKRVS  97

Query  266  SAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKR  445
            SA+FPASI+AG E++ PHL FKDVSN +KQ L +SKLN CC   DF DPDKNAA++DLK 
Sbjct  98   SAVFPASIMAGVEAVEPHLSFKDVSNVQKQSLFISKLNFCCES-DFSDPDKNAAQQDLKG  156

Query  446  QVLLELNDFVASGSVKCTESAIAAVC  523
            Q L+EL DFV+SG  K  E A+AA+C
Sbjct  157  QTLIELVDFVSSGGAKFNEPAMAAMC  182



>ref|XP_011010867.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like, partial [Populus euphratica]
Length=557

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 109/147 (74%), Gaps = 5/147 (3%)
 Frame = +2

Query  83   ATMLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRV  262
              MLKQIL+KIPRK  KSD LDS+G   +  ND T SG     TN  N   +RLNVVKRV
Sbjct  59   TAMLKQILSKIPRKFPKSDPLDSTGI--DCGNDSTCSGPS---TNGGNSFSSRLNVVKRV  113

Query  263  SSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLK  442
            SSA+FPASI+AG E++ PHL FKDVSN +KQ L VSKLNLCC V D  DPDKNA ++DLK
Sbjct  114  SSAVFPASIMAGMEAVDPHLSFKDVSNLQKQNLFVSKLNLCCEVSDCSDPDKNAVQQDLK  173

Query  443  RQVLLELNDFVASGSVKCTESAIAAVC  523
             QVL++L DFV+SGS K TE AIAA+C
Sbjct  174  HQVLIDLVDFVSSGSAKFTEPAIAAIC  200



>ref|XP_002324961.1| hypothetical protein POPTR_0018s06320g [Populus trichocarpa]
 gb|EEF03526.1| hypothetical protein POPTR_0018s06320g [Populus trichocarpa]
Length=497

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 109/145 (75%), Gaps = 5/145 (3%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            MLKQIL+KIPRK  KSD LDS+G   +  ND T SG     TN  N   +RLNVVKRVSS
Sbjct  1    MLKQILSKIPRKFPKSDPLDSTGI--DCGNDSTCSGPP---TNGGNSFSSRLNVVKRVSS  55

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPASI+AG E++ PHL FKDVSN +KQ L VSKLNLCC V D  DPDKNA ++DLK Q
Sbjct  56   AVFPASIMAGMEAVDPHLSFKDVSNLQKQNLFVSKLNLCCEVSDCSDPDKNAVQQDLKHQ  115

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
            VL++L DFV+SGS K TE AIAA+C
Sbjct  116  VLIDLVDFVSSGSAKFTEPAIAAIC  140



>ref|XP_003524519.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X1 [Glycine max]
 ref|XP_006579740.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X2 [Glycine max]
 gb|KHN15139.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform [Glycine soja]
Length=515

 Score =   155 bits (392),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 109/145 (75%), Gaps = 3/145 (2%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            M+KQIL+K+P+K  KSDS DS+ +     ++ T  GN  Q TN  + I ++LNVVKRVSS
Sbjct  1    MIKQILSKLPKKVPKSDSSDSARS---DSSNTTTFGNVFQCTNVGSTISSKLNVVKRVSS  57

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
             +FPAS+ AG E++ P L FKDVSN +KQ L +SKLNLCC +YD  DPDKN AE+DLKRQ
Sbjct  58   VVFPASMSAGVEAVDPGLSFKDVSNTQKQSLFISKLNLCCKLYDMSDPDKNTAEQDLKRQ  117

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
             LLEL DFV+SGSVK TE AIAA+C
Sbjct  118  TLLELVDFVSSGSVKFTEPAIAALC  142



>gb|KHG22084.1| Serine/threonine phosphatase 2A 57 kDa regulatory subunit B' 
iota-like protein [Gossypium arboreum]
Length=496

 Score =   154 bits (389),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 110/145 (76%), Gaps = 2/145 (1%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            MLKQIL K+PRK  KSD LDSSG+  +S N  +N GNG++ TN  N + +RL+VVKRVSS
Sbjct  1    MLKQILIKLPRKLQKSDLLDSSGS--DSGNHTSNLGNGVECTNIGNSMSSRLSVVKRVSS  58

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPASI+ G E++ P+L F DVS  +KQ L +SKLNLCC V DF DPDK +AE+DLK Q
Sbjct  59   AVFPASIMVGVEAVEPNLSFTDVSILQKQSLFISKLNLCCEVSDFSDPDKTSAEQDLKHQ  118

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
             L+EL DFV++GS K  E AIAA+C
Sbjct  119  TLIELVDFVSTGSTKFNEPAIAAMC  143



>gb|KEH32096.1| protein phosphatase 2A regulatory B subunit family protein [Medicago 
truncatula]
Length=391

 Score =   152 bits (383),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 108/145 (74%), Gaps = 2/145 (1%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            M+KQIL+K+P+K  KSDS DS+ +     N  T+ GN  Q TN  + I ++LNVVKRVSS
Sbjct  1    MIKQILSKLPKKLPKSDSSDSAKSDSG--NSTTSFGNVFQCTNVGSTISSKLNVVKRVSS  58

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
             +FPAS+ AG E++ P L FKDVSN +KQ L +SKLNLCC VYD  DPDKN  E+D+KRQ
Sbjct  59   VVFPASMNAGVEAVDPSLSFKDVSNTQKQSLFISKLNLCCKVYDMSDPDKNCTEQDVKRQ  118

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
             LL+L DFV+SGSVK TE AIAA+C
Sbjct  119  TLLDLVDFVSSGSVKFTEPAIAALC  143



>ref|XP_010249885.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Nelumbo nucifera]
Length=503

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 85/145 (59%), Positives = 108/145 (74%), Gaps = 5/145 (3%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            MLKQ L+++PRKS KSD+ D++G+  NS N+   +GNG+Q TNS N    R + VK++SS
Sbjct  1    MLKQFLSRLPRKSAKSDAADTAGS--NSVNNAATTGNGIQRTNSGNASSGRSSAVKKMSS  58

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPAS++AG   I P L FKDV N EKQ L +SKLNLCC V+DF DP+KN AEKDLKRQ
Sbjct  59   AVFPASVIAG---IEPLLSFKDVPNPEKQNLFISKLNLCCVVFDFNDPNKNTAEKDLKRQ  115

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
             L+EL +FV SGS K  E AI+A+C
Sbjct  116  TLIELVEFVGSGSAKFNEPAISAIC  140



>gb|AFK37737.1| unknown [Medicago truncatula]
Length=510

 Score =   152 bits (385),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 108/145 (74%), Gaps = 2/145 (1%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            M+KQIL+K+P+K  KSDS DS+ +     N  T+ GN  Q TN  + I ++LNVVKRVSS
Sbjct  1    MIKQILSKLPKKLPKSDSSDSAKSDSG--NSTTSFGNVFQCTNVGSTISSKLNVVKRVSS  58

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
             +FPAS+ AG E++ P L FKDVSN +KQ L +SKLNLCC VYD  DPDKN  E+D+KRQ
Sbjct  59   VVFPASMNAGVEAVDPSLSFKDVSNTQKQSLFISKLNLCCKVYDMSDPDKNCTEQDVKRQ  118

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
             LL+L DFV+SGSVK TE AIAA+C
Sbjct  119  TLLDLVDFVSSGSVKFTEPAIAALC  143



>ref|XP_003609196.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform [Medicago truncatula]
 gb|AES91393.1| protein phosphatase 2A regulatory B subunit family protein [Medicago 
truncatula]
Length=510

 Score =   152 bits (385),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 108/145 (74%), Gaps = 2/145 (1%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            M+KQIL+K+P+K  KSDS DS+ +     N  T+ GN  Q TN  + I ++LNVVKRVSS
Sbjct  1    MIKQILSKLPKKLPKSDSSDSAKSDSG--NSTTSFGNVFQCTNVGSTISSKLNVVKRVSS  58

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
             +FPAS+ AG E++ P L FKDVSN +KQ L +SKLNLCC VYD  DPDKN  E+D+KRQ
Sbjct  59   VVFPASMNAGVEAVDPSLSFKDVSNTQKQSLFISKLNLCCKVYDMSDPDKNCTEQDVKRQ  118

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
             LL+L DFV+SGSVK TE AIAA+C
Sbjct  119  TLLDLVDFVSSGSVKFTEPAIAALC  143



>ref|XP_004508562.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Cicer arietinum]
Length=511

 Score =   152 bits (385),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 107/145 (74%), Gaps = 2/145 (1%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            M+KQIL+K+P+K  KSDS DS+ +     N  T  GN  Q TN  + I ++LNVVKRVSS
Sbjct  1    MIKQILSKLPKKLPKSDSSDSARSDSG--NSTTTFGNVFQCTNVGSTISSKLNVVKRVSS  58

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
             +FPAS+ AG E++ P L FKDVSN +KQ L +SKLNLCC VYD  DPDKN  E+D+KRQ
Sbjct  59   VVFPASMSAGVEAVDPSLSFKDVSNTQKQNLFISKLNLCCKVYDMSDPDKNCTEQDVKRQ  118

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
             LL+L DFV+SGSVK TE AIAA+C
Sbjct  119  TLLDLVDFVSSGSVKFTEPAIAALC  143



>ref|XP_003549794.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoformX1 [Glycine max]
 ref|XP_006600772.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X2 [Glycine max]
 ref|XP_006600773.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X3 [Glycine max]
Length=514

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 86/145 (59%), Positives = 108/145 (74%), Gaps = 3/145 (2%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            M+KQIL+K+P+K  KSDS DS+ +     ++ T  GN  Q TN  + I ++LNVVKRVSS
Sbjct  1    MIKQILSKLPKKVPKSDSSDSARS---DSSNTTTFGNVFQCTNVGSTISSKLNVVKRVSS  57

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
             +FPAS+ AG E++ P L FKDVSN +KQ L +SKLNLCC VYD  DPDKN  E+DLKR+
Sbjct  58   VVFPASMSAGVEAVDPCLSFKDVSNTQKQSLFISKLNLCCKVYDMSDPDKNTTEQDLKRK  117

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
             LLEL D+V+SGSVK TE AIAA+C
Sbjct  118  TLLELVDYVSSGSVKFTEPAIAALC  142



>ref|XP_006451050.1| hypothetical protein CICLE_v10007952mg [Citrus clementina]
 ref|XP_006475756.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X1 [Citrus sinensis]
 gb|ESR64290.1| hypothetical protein CICLE_v10007952mg [Citrus clementina]
 gb|KDO80417.1| hypothetical protein CISIN_1g009349mg [Citrus sinensis]
Length=537

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 112/152 (74%), Gaps = 4/152 (3%)
 Frame = +2

Query  68   IHWSFATMLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLN  247
            +H  F TMLKQIL+K+PRKS KSD LD   +  N+    +N  NG Q TN  N + +RL+
Sbjct  27   LHSQFPTMLKQILSKLPRKSPKSDQLDEINSGSNN----SNFSNGSQCTNGGNGLSSRLS  82

Query  248  VVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAA  427
            VVKRVSSA+FP+SI+AG E++ PHL FKDVSN +KQ L VSKLNLCC V DF D DK  A
Sbjct  83   VVKRVSSAVFPSSIMAGVEAVEPHLSFKDVSNTQKQNLFVSKLNLCCEVSDFSDSDKVTA  142

Query  428  EKDLKRQVLLELNDFVASGSVKCTESAIAAVC  523
            E+DLKRQ L+EL DFV+SGS K TE AI+ +C
Sbjct  143  EQDLKRQTLIELADFVSSGSAKFTEPAISGMC  174



>ref|XP_007155131.1| hypothetical protein PHAVU_003G176100g [Phaseolus vulgaris]
 ref|XP_007155132.1| hypothetical protein PHAVU_003G176100g [Phaseolus vulgaris]
 gb|ESW27125.1| hypothetical protein PHAVU_003G176100g [Phaseolus vulgaris]
 gb|ESW27126.1| hypothetical protein PHAVU_003G176100g [Phaseolus vulgaris]
Length=509

 Score =   149 bits (375),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 111/145 (77%), Gaps = 3/145 (2%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            M+KQIL+K+P+K  KSDS DSS +  ++    T+ GN  Q TN  + I ++LNVVKRVSS
Sbjct  1    MIKQILSKLPKKVPKSDSSDSSRSDSSNS---TSFGNVFQCTNVGSTISSKLNVVKRVSS  57

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
             +FPAS+ AG E++ P L FKDVSN +KQ L +SKLNLCC +YD  DPDK+++E+DLKRQ
Sbjct  58   VVFPASMSAGVEAVDPCLSFKDVSNTQKQSLFISKLNLCCKIYDMSDPDKSSSEQDLKRQ  117

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
             LLEL DFV+SGSVK TE AIAA+C
Sbjct  118  TLLELVDFVSSGSVKFTEPAIAALC  142



>ref|XP_010098941.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform [Morus notabilis]
 gb|EXB76243.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform [Morus notabilis]
Length=736

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 110/149 (74%), Gaps = 6/149 (4%)
 Frame = +2

Query  77   SFATMLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVK  256
            S ATMLKQIL+K+PRKS KSD LD  GA  +S ++ +  GNG Q T   + + ++LNVVK
Sbjct  220  SIATMLKQILSKLPRKSPKSDLLD--GAGSDSGSNSSKLGNGFQCTIGGSSLSSKLNVVK  277

Query  257  RVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKD  436
            RVSSA+FPASI AG E + PHL FKDVSN +KQ L +SKLNLCC V D+ D    + ++D
Sbjct  278  RVSSAVFPASITAGAEVVEPHLSFKDVSNPQKQNLFISKLNLCCEVVDYND----SVKQD  333

Query  437  LKRQVLLELNDFVASGSVKCTESAIAAVC  523
            LKR  L+EL DFV+SGS K TESAI+A+C
Sbjct  334  LKRDTLIELVDFVSSGSAKLTESAISAMC  362



>ref|XP_010254226.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Nelumbo nucifera]
 ref|XP_010254227.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Nelumbo nucifera]
Length=507

 Score =   146 bits (369),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 108/149 (72%), Gaps = 9/149 (6%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNG----MQFTNSCNVIVNRLNVVK  256
            MLKQ L+++PRKS KSD+ D++G+  NS N+   +GNG    +Q TNS N    R N VK
Sbjct  1    MLKQFLSRLPRKSFKSDAADTAGS--NSGNNTAAAGNGASNGIQRTNSGNAASGRSNAVK  58

Query  257  RVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKD  436
            ++SSA+FPAS+VAG   I P L FKDV N EKQ L +SKLNLCC V+DF DP +++AEKD
Sbjct  59   KMSSAVFPASVVAG---IEPLLSFKDVPNQEKQNLFISKLNLCCVVFDFNDPIQDSAEKD  115

Query  437  LKRQVLLELNDFVASGSVKCTESAIAAVC  523
            LKRQ LLEL +FV SGS +  E AIAAVC
Sbjct  116  LKRQTLLELVEFVGSGSARLNEPAIAAVC  144



>gb|KCW82763.1| hypothetical protein EUGRSUZ_C04140 [Eucalyptus grandis]
Length=405

 Score =   144 bits (364),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 98/145 (68%), Gaps = 6/145 (4%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            MLKQIL KIPRKS K        +Q  + NDP ++ NG Q         +R NVVKRVSS
Sbjct  1    MLKQILNKIPRKSPKG------DSQDTAGNDPGDNSNGFQCMIGGGTFSSRFNVVKRVSS  54

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPAS++ G +++ P + FKDVSN +KQ L VSKLN CC VYDF DPDKN  E + K +
Sbjct  55   AVFPASMMTGLDAVEPFMSFKDVSNSQKQNLFVSKLNFCCKVYDFNDPDKNCTEINSKHE  114

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
            +L+EL +FV+SGS K  E AIAA+C
Sbjct  115  ILVELVEFVSSGSAKFNEMAIAAMC  139



>gb|KJB83138.1| hypothetical protein B456_013G231300 [Gossypium raimondii]
 gb|KJB83139.1| hypothetical protein B456_013G231300 [Gossypium raimondii]
 gb|KJB83140.1| hypothetical protein B456_013G231300 [Gossypium raimondii]
 gb|KJB83141.1| hypothetical protein B456_013G231300 [Gossypium raimondii]
Length=506

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 110/145 (76%), Gaps = 2/145 (1%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            M+KQIL K+PRKS KSDSLDS+G   +S N  +NS +G+Q TN  N I +RL VVKRVSS
Sbjct  1    MIKQILRKLPRKSQKSDSLDSAGN--DSDNHASNSDDGVQCTNFGNKISSRLRVVKRVSS  58

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPASI+AG E++ P+L F +VSN +K  L +SKLNLCC   +  DPDK  AE+DLKR+
Sbjct  59   AVFPASIMAGVEAVEPNLSFNNVSNPQKPNLFISKLNLCCEACNSSDPDKGTAEQDLKRR  118

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
             L+EL DFV+SGS K  E+AIAA+C
Sbjct  119  TLIELVDFVSSGSAKFNEAAIAAMC  143



>ref|XP_010049936.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Eucalyptus grandis]
 gb|KCW82762.1| hypothetical protein EUGRSUZ_C04140 [Eucalyptus grandis]
Length=505

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 98/145 (68%), Gaps = 6/145 (4%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            MLKQIL KIPRKS K        +Q  + NDP ++ NG Q         +R NVVKRVSS
Sbjct  1    MLKQILNKIPRKSPKG------DSQDTAGNDPGDNSNGFQCMIGGGTFSSRFNVVKRVSS  54

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPAS++ G +++ P + FKDVSN +KQ L VSKLN CC VYDF DPDKN  E + K +
Sbjct  55   AVFPASMMTGLDAVEPFMSFKDVSNSQKQNLFVSKLNFCCKVYDFNDPDKNCTEINSKHE  114

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
            +L+EL +FV+SGS K  E AIAA+C
Sbjct  115  ILVELVEFVSSGSAKFNEMAIAAMC  139



>gb|KDO80420.1| hypothetical protein CISIN_1g009349mg [Citrus sinensis]
Length=402

 Score =   143 bits (361),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 106/150 (71%), Gaps = 14/150 (9%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDP-----TNSGNGMQFTNSCNVIVNRLNVV  253
            MLKQIL+K+PRKS KSD LD   +  N+ N       TN GNG+          +RL+VV
Sbjct  1    MLKQILSKLPRKSPKSDQLDEINSGSNNSNFSNGSQCTNGGNGLS---------SRLSVV  51

Query  254  KRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEK  433
            KRVSSA+FP+SI+AG E++ PHL FKDVSN +KQ L VSKLNLCC V DF D DK  AE+
Sbjct  52   KRVSSAVFPSSIMAGVEAVEPHLSFKDVSNTQKQNLFVSKLNLCCEVSDFSDSDKVTAEQ  111

Query  434  DLKRQVLLELNDFVASGSVKCTESAIAAVC  523
            DLKRQ L+EL DFV+SGS K TE AI+ +C
Sbjct  112  DLKRQTLIELADFVSSGSAKFTEPAISGMC  141



>ref|XP_006451049.1| hypothetical protein CICLE_v10007952mg [Citrus clementina]
 ref|XP_006475757.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X2 [Citrus sinensis]
 gb|ESR64289.1| hypothetical protein CICLE_v10007952mg [Citrus clementina]
 gb|KDO80418.1| hypothetical protein CISIN_1g009349mg [Citrus sinensis]
 gb|KDO80419.1| hypothetical protein CISIN_1g009349mg [Citrus sinensis]
Length=504

 Score =   144 bits (362),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 89/145 (61%), Positives = 108/145 (74%), Gaps = 4/145 (3%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            MLKQIL+K+PRKS KSD LD   +  N+    +N  NG Q TN  N + +RL+VVKRVSS
Sbjct  1    MLKQILSKLPRKSPKSDQLDEINSGSNN----SNFSNGSQCTNGGNGLSSRLSVVKRVSS  56

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FP+SI+AG E++ PHL FKDVSN +KQ L VSKLNLCC V DF D DK  AE+DLKRQ
Sbjct  57   AVFPSSIMAGVEAVEPHLSFKDVSNTQKQNLFVSKLNLCCEVSDFSDSDKVTAEQDLKRQ  116

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
             L+EL DFV+SGS K TE AI+ +C
Sbjct  117  TLIELADFVSSGSAKFTEPAISGMC  141



>ref|XP_007138335.1| hypothetical protein PHAVU_009G200100g [Phaseolus vulgaris]
 gb|ESW10329.1| hypothetical protein PHAVU_009G200100g [Phaseolus vulgaris]
Length=506

 Score =   143 bits (361),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 103/145 (71%), Gaps = 3/145 (2%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            MLKQIL+K+P+K  KSD+ D   AQ +S    T   N  Q TN    I N+LN VKRVSS
Sbjct  1    MLKQILSKLPKKVPKSDTSD--SAQSDS-GSATTFANVFQCTNVGVAISNKLNAVKRVSS  57

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPAS+ AG E++ PH+ FKDVSN +K  L +SKLNLCCSVY+   PDKN  E+D+K Q
Sbjct  58   AVFPASLSAGVEAVDPHVSFKDVSNIQKHNLFISKLNLCCSVYNINYPDKNCKEEDVKHQ  117

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
             L+EL DFV+SGS K TE +IAA+C
Sbjct  118  TLVELVDFVSSGSAKFTEPSIAAMC  142



>ref|XP_008337354.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Malus domestica]
Length=502

 Score =   141 bits (355),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 109/145 (75%), Gaps = 6/145 (4%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            MLKQIL+K+PRKS KSDSLDS+G+  +S N+  N G+G Q T   + + ++LNVVKRVSS
Sbjct  1    MLKQILSKLPRKSSKSDSLDSAGS--DSGNNTPNLGSGFQCTIGGSSLTSKLNVVKRVSS  58

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FP+SI AG E++ PHL FK+VSN +K  L +SKLNLCC   D  DP K    +DLKR+
Sbjct  59   AVFPSSIAAGAEAVEPHLSFKEVSNPQKHSLFISKLNLCCEFVDSSDPVK----QDLKRE  114

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
             L+EL D+V+SG+VK TE AI+AVC
Sbjct  115  TLIELVDYVSSGTVKFTEPAISAVC  139



>ref|XP_009374054.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Pyrus x bretschneideri]
Length=502

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 109/145 (75%), Gaps = 6/145 (4%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            MLKQIL+K+PRKS KSDSLDS+G++  S N P N G+G Q T   + + ++LNVVKRVSS
Sbjct  1    MLKQILSKLPRKSSKSDSLDSAGSESGS-NTP-NLGSGFQCTIGGSSLTSKLNVVKRVSS  58

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FP+SI AG E++ PHL FK+VSN +K  L +SKLNLCC   D  DP K    +DLKR+
Sbjct  59   AVFPSSIAAGAEAVEPHLSFKEVSNPQKHSLFISKLNLCCEFVDSSDPVK----QDLKRE  114

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
             L+EL D+V+SG+VK TE AI+A+C
Sbjct  115  TLIELVDYVSSGTVKFTEPAISALC  139



>ref|XP_007204385.1| hypothetical protein PRUPE_ppa004572mg [Prunus persica]
 gb|EMJ05584.1| hypothetical protein PRUPE_ppa004572mg [Prunus persica]
Length=502

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 85/145 (59%), Positives = 107/145 (74%), Gaps = 6/145 (4%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            MLKQIL+K+PRKS KSDSLDS+G+   S N P N GNG Q T   + + ++LNVVKRVSS
Sbjct  1    MLKQILSKLPRKSPKSDSLDSAGSDSGS-NTP-NLGNGFQCTIGGSSLTSKLNVVKRVSS  58

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FP+SI AG E++ PHL FK+VSN +K  L +SKLNLCC   D  DP K    +DLKR+
Sbjct  59   AVFPSSIAAGAEAVEPHLSFKEVSNPQKHNLFISKLNLCCEFIDSSDPVK----QDLKRE  114

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
             L+EL DFV+SGS K +E AI+A+C
Sbjct  115  TLIELVDFVSSGSAKFSEPAISALC  139



>ref|XP_008242686.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Prunus mume]
 ref|XP_008242687.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Prunus mume]
 ref|XP_008242688.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Prunus mume]
Length=502

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 85/145 (59%), Positives = 107/145 (74%), Gaps = 6/145 (4%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            MLKQIL+K+PRKS KSDSLDS+G+   S N P N GNG Q T   + + ++LNVVKRVSS
Sbjct  1    MLKQILSKLPRKSPKSDSLDSAGSDSGS-NTP-NLGNGFQCTIGGSSLTSKLNVVKRVSS  58

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FP+SI AG E++ PHL FK+VSN +K  L +SKLNLCC   D  DP K    +DLKR+
Sbjct  59   AVFPSSIAAGAEAVEPHLSFKEVSNPQKHNLFISKLNLCCEFIDSSDPVK----QDLKRE  114

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
             L+EL DFV+SGS K +E AI+A+C
Sbjct  115  TLIELVDFVSSGSAKFSEPAISALC  139



>ref|XP_009371422.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Pyrus x bretschneideri]
Length=502

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 82/145 (57%), Positives = 108/145 (74%), Gaps = 6/145 (4%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            MLKQIL+K+PRKS KSDSLDS G+  +S ++ +N G+G   T   + + ++LNVVKRVSS
Sbjct  1    MLKQILSKLPRKSSKSDSLDSIGS--DSGSNTSNLGSGFPCTIGGSSLTSKLNVVKRVSS  58

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FP+SI AG E++ PHL FK+VSN +K  L +SKLNLCC   D  DP K    +DLKR+
Sbjct  59   AVFPSSIAAGAEAVEPHLSFKEVSNPQKHNLFISKLNLCCEFVDSSDPVK----QDLKRE  114

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
             L+EL D+V+SG+VK TE AI+AVC
Sbjct  115  TLIELVDYVSSGTVKFTEPAISAVC  139



>ref|XP_008386225.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Malus domestica]
 ref|XP_008343968.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Malus domestica]
 ref|XP_008362926.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Malus domestica]
Length=502

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 107/145 (74%), Gaps = 6/145 (4%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            MLKQIL+K+PRKS K DSLDS G+  +S ++ +N G+G   T   + + ++LNVVKRVSS
Sbjct  1    MLKQILSKLPRKSSKCDSLDSIGS--DSGSNTSNLGSGFPCTIGGSSLTSKLNVVKRVSS  58

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FP+SI AG E++ PHL FK+VSN +K  L +SKLNLCC   D  DP K    +DLKR+
Sbjct  59   AVFPSSIAAGAEAVEPHLSFKEVSNPQKHNLFISKLNLCCEFVDSSDPVK----QDLKRE  114

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
             L+EL D+V+SG+VK TE AI+AVC
Sbjct  115  TLIELVDYVSSGTVKFTEPAISAVC  139



>ref|XP_009385620.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009385621.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Musa acuminata subsp. 
malaccensis]
Length=509

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 101/146 (69%), Gaps = 5/146 (3%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQP-NSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVS  265
            M KQ L+K+PRKS KSD+   S + P N C  P N GN +Q T+S NV+ +R   VKR +
Sbjct  1    MWKQFLSKLPRKSSKSDASSGSDSHPSNDCTGPLN-GNPIQRTSSGNVVPSRSTTVKRTA  59

Query  266  SAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKR  445
            SAIFP+S+V    SI P L FKDV N +KQ L +SKLNLCC V+DF DP+KN+ EKD+KR
Sbjct  60   SAIFPSSVVT---SIEPLLLFKDVPNSQKQNLFISKLNLCCVVFDFSDPNKNSTEKDMKR  116

Query  446  QVLLELNDFVASGSVKCTESAIAAVC  523
            Q LL L D+V +G+ + TE  I+A C
Sbjct  117  QALLGLIDYVDAGASRFTEPMISACC  142



>ref|XP_004287389.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Fragaria vesca subsp. 
vesca]
Length=502

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 97/145 (67%), Gaps = 7/145 (5%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            MLKQIL+K PRK           A  +S N+    G+G Q T   + + ++LNVVKRVSS
Sbjct  1    MLKQILSKFPRKPKSESLD---SAGSDSGNNSPILGSGFQCTIGGSSLTSKLNVVKRVSS  57

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPASI AG E + PHL FK+VSN +KQ L +SKLN+CC + D  DP K    +DLKR+
Sbjct  58   AVFPASIAAGAEVVEPHLSFKEVSNPQKQNLFISKLNVCCEIIDSSDPVK----QDLKRE  113

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
             L+EL DFV+SGS K TE AI+A+C
Sbjct  114  TLIELVDFVSSGSAKFTEPAISAMC  138



>ref|XP_009389489.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Musa acuminata subsp. 
malaccensis]
Length=510

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 102/146 (70%), Gaps = 4/146 (3%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsld-ssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVS  265
            M KQ L+K+PRKS KSD+   ++ + P +    + +GN +Q T+S NV+ +R   VKR +
Sbjct  1    MWKQFLSKLPRKSSKSDASSGTTRSHPINNGTTSMNGNPIQRTSSGNVVPSRSTAVKRTA  60

Query  266  SAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKR  445
            SAIFP+S+V    SI P L FKDV N EKQ L +SKLNLCC V+DF DP+KN+ EKD+KR
Sbjct  61   SAIFPSSVVT---SIEPLLLFKDVPNTEKQNLFISKLNLCCVVFDFSDPNKNSTEKDMKR  117

Query  446  QVLLELNDFVASGSVKCTESAIAAVC  523
            Q LL+L D+V +GS + TE  I+A C
Sbjct  118  QALLDLIDYVDAGSSRFTEPMISASC  143



>ref|XP_008458023.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Cucumis melo]
 ref|XP_008458029.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Cucumis melo]
Length=500

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 103/145 (71%), Gaps = 8/145 (6%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            MLKQIL+K+P+K  KS+++D   A   S N+ +  G+  Q TN  +   ++LNVVKRVSS
Sbjct  1    MLKQILSKLPKKLQKSETVD--SATNESGNNTSRLGHVFQCTNVGSAFSSKLNVVKRVSS  58

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPASI A  E++ PHL FKDV N +KQ L VSKLN CC V+D  D +K    +DLKRQ
Sbjct  59   AVFPASIAA--EAVDPHLSFKDVPNPQKQNLFVSKLNYCCEVFDLNDMEK----QDLKRQ  112

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
            +L+++ DFV SGS K TE+AI++VC
Sbjct  113  MLIDVVDFVTSGSAKFTETAISSVC  137



>ref|XP_004163599.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Cucumis sativus]
Length=500

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 103/145 (71%), Gaps = 8/145 (6%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            MLKQIL+K+P+K  KS+++D   A   S N+ +  G+  Q TN  +   ++LNVVKRVSS
Sbjct  1    MLKQILSKLPKKLQKSETVD--SATNESGNNTSRLGHVFQCTNVGSAFSSKLNVVKRVSS  58

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPASI A  E++ PHL FKDV N +KQ L VSKLN CC V+D  D +K    +DLKRQ
Sbjct  59   AVFPASIAA--EAVDPHLSFKDVPNPQKQNLFVSKLNYCCEVFDLNDMEK----QDLKRQ  112

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
            +L+++ DFV SGS K TE+AI++VC
Sbjct  113  MLIDVVDFVTSGSAKFTETAISSVC  137



>ref|XP_004139334.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Cucumis sativus]
 gb|KGN60641.1| hypothetical protein Csa_2G005870 [Cucumis sativus]
Length=500

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 103/145 (71%), Gaps = 8/145 (6%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            MLKQIL+K+P+K  KSD++D   A   S N+ +  G+  Q TN  +   ++LNVVKRVSS
Sbjct  1    MLKQILSKLPKKLQKSDTVD--SATNESGNNTSRLGHVFQCTNVGSAFSSKLNVVKRVSS  58

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPASI A  E++ PHL FKDV N +KQ L VSKLN CC V+D  D +K    +DLKRQ
Sbjct  59   AVFPASIAA--EAVDPHLSFKDVPNPQKQNLFVSKLNYCCEVFDLNDMEK----QDLKRQ  112

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
            +L+++ DFV SGS K TE+AI++VC
Sbjct  113  MLIDVVDFVTSGSAKFTETAISSVC  137



>ref|XP_010925115.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Elaeis guineensis]
 ref|XP_010925116.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Elaeis guineensis]
Length=509

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 100/146 (68%), Gaps = 6/146 (4%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsl-dssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVS  265
            M KQ L+K+PR+S KSDS  DS+   P S   P  SGN +Q  +S N    R   VKR+S
Sbjct  1    MWKQFLSKLPRRSSKSDSACDSAHNHPGSNASP--SGNSIQRASSGNAGPGRSTTVKRMS  58

Query  266  SAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKR  445
            SA+FP+S+VAG   I P L FKDV N EKQ L++SKLNLC +V+DF DP+KN+AEKD+KR
Sbjct  59   SAVFPSSVVAG---IEPLLSFKDVPNAEKQNLVISKLNLCSAVFDFSDPNKNSAEKDMKR  115

Query  446  QVLLELNDFVASGSVKCTESAIAAVC  523
            Q LL+L  F  SG+ + TE  I+A C
Sbjct  116  QTLLDLVYFFNSGTPRFTEPMISASC  141



>ref|XP_010913433.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Elaeis guineensis]
 ref|XP_010913512.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Elaeis guineensis]
Length=509

 Score =   127 bits (319),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 97/154 (63%), Gaps = 22/154 (14%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSG---------NGMQFTNSCNVIVNR  241
            M KQ L+K+PRK           ++ +S +D T++          N +Q  NS N    R
Sbjct  1    MWKQFLSKLPRK----------SSKLDSVSDSTHNHPGSNASSSGNSIQRANSGNAGPGR  50

Query  242  LNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKN  421
               VKR+SSA+FP+S+VAG   I P L FKD+SN EKQ L +SKLNLC  V+DF DP+KN
Sbjct  51   STTVKRMSSAVFPSSVVAG---IEPLLSFKDISNTEKQNLFISKLNLCSVVFDFSDPNKN  107

Query  422  AAEKDLKRQVLLELNDFVASGSVKCTESAIAAVC  523
            +AEKD+KRQ LL+L DFV SG+ + TE  I+A C
Sbjct  108  SAEKDMKRQALLDLIDFVNSGTSRFTEPMISASC  141



>ref|XP_009407446.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009407448.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Musa acuminata subsp. 
malaccensis]
Length=510

 Score =   127 bits (318),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 98/146 (67%), Gaps = 4/146 (3%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNS-GNGMQFTNSCNVIVNRLNVVKRVS  265
            M KQ L+K+PRKS KSD+   S     S N   ++ GN +Q T+S NV+ +R   VKR +
Sbjct  1    MWKQFLSKLPRKSSKSDASSGSAHSHLSNNGMASANGNPIQRTSSGNVVSSRSATVKRTA  60

Query  266  SAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKR  445
            SAIFP+S+V    SI P L FKDV N EK  L +SK+ LCC V+DF DP+KN AEKD+KR
Sbjct  61   SAIFPSSVVT---SIEPLLLFKDVPNSEKHNLFISKMKLCCVVFDFSDPNKNCAEKDMKR  117

Query  446  QVLLELNDFVASGSVKCTESAIAAVC  523
            Q LL+L D+V +G+ K TE  I+A C
Sbjct  118  QALLDLVDYVDAGTSKFTEPMISASC  143



>ref|XP_006654758.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Oryza brachyantha]
Length=508

 Score =   127 bits (318),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 99/145 (68%), Gaps = 8/145 (6%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVI--VNRLNVVKRV  262
            M K  L+K+PRK+  S   D    Q   C++ T +GN +Q T+SC  I      + +KR+
Sbjct  1    MWKGFLSKLPRKNSSSGRGDLDSGQ---CSNGTANGNPIQRTSSCVSIPSARSTSTIKRM  57

Query  263  SSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLK  442
            SSAIFP+S+VAG   I P + FKDV N EKQ L VSKLNLCC+V+DF DP+K++AEKD+K
Sbjct  58   SSAIFPSSVVAG---IEPLVSFKDVPNSEKQNLFVSKLNLCCAVFDFSDPNKSSAEKDIK  114

Query  443  RQVLLELNDFVASGSVKCTESAIAA  517
            RQ LL+L DFV S + + +E+ IAA
Sbjct  115  RQTLLDLIDFVDSSNSRFSEAVIAA  139



>ref|XP_008811587.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Phoenix dactylifera]
Length=509

 Score =   126 bits (316),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 99/149 (66%), Gaps = 12/149 (8%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNG----MQFTNSCNVIVNRLNVVK  256
            M KQ L+K+PRKS KSD      A  ++ N P ++ +     +Q TNS N    R   VK
Sbjct  1    MWKQFLSKLPRKSSKSDC-----ASDSAHNHPGSNASSSGNSIQRTNSGNAGPGRSTSVK  55

Query  257  RVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKD  436
            R+SSA+FP+S+VAG   I P L FKDVSN EKQ L +SKLNLC  V+DF DP+KN+ EKD
Sbjct  56   RMSSAVFPSSVVAG---IEPLLSFKDVSNTEKQNLFISKLNLCSVVFDFSDPNKNSTEKD  112

Query  437  LKRQVLLELNDFVASGSVKCTESAIAAVC  523
            +KRQ LL+L DFV SG+ + TE  I+A C
Sbjct  113  MKRQALLDLIDFVNSGTSRFTEPMISASC  141



>ref|XP_009415355.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Musa acuminata subsp. 
malaccensis]
Length=510

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/147 (49%), Positives = 96/147 (65%), Gaps = 6/147 (4%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNS--GNGMQFTNSCNVIVNRLNVVKRV  262
            M KQ L+K+P KS +SD+       P   N+ T S  GN +  TNS NV+ +R   +KR 
Sbjct  1    MWKQFLSKLPHKSFQSDASLDLTHLPPG-NNGTGSVNGNSIHRTNSDNVVSSRSTTMKRT  59

Query  263  SSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLK  442
            +SAIFP+++V   E   P L FKDV N EKQ L +SKLN CC V+DF DP+KN+ EKD+K
Sbjct  60   ASAIFPSNVVTSAE---PLLLFKDVPNAEKQNLFISKLNFCCLVFDFSDPNKNSTEKDMK  116

Query  443  RQVLLELNDFVASGSVKCTESAIAAVC  523
            RQVLL+L  +V +G+ + TE  I+A C
Sbjct  117  RQVLLDLIGYVDAGTSRFTEPVISASC  143



>gb|EAY98962.1| hypothetical protein OsI_20919 [Oryza sativa Indica Group]
Length=510

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 101/147 (69%), Gaps = 11/147 (7%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNS--CNDPTNSGNGMQFTNSCNVIVN--RLNVVK  256
            M K  L+K+PRK+  S      GA  +S  C++   +GN +Q T+SC  I +    + +K
Sbjct  1    MWKGFLSKLPRKTSASGR----GADLDSGQCSNGAGNGNPIQRTSSCGSIPSGRSTSTIK  56

Query  257  RVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKD  436
            R+SSAIFP+S+VAG   I P + FKDV N EKQ L VSKLNLCC+V+DF DP+K++AEKD
Sbjct  57   RMSSAIFPSSVVAG---IEPLVSFKDVPNSEKQNLFVSKLNLCCAVFDFSDPNKSSAEKD  113

Query  437  LKRQVLLELNDFVASGSVKCTESAIAA  517
            +KRQ LL+L D+V S S + +E+ IAA
Sbjct  114  IKRQTLLDLIDYVDSSSSRFSEAVIAA  140



>emb|CAC85920.1| protein phosphatase 2A B'kappa subunit [Oryza sativa Japonica 
Group]
 gb|AAT58738.1| protein phosphatase 2A B'kappa subunit [Oryza sativa Japonica 
Group]
Length=510

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 101/147 (69%), Gaps = 11/147 (7%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNS--CNDPTNSGNGMQFTNSCNVIVN--RLNVVK  256
            M K  L+K+PRK+  S      GA  +S  C++   +GN +Q T+SC  I +    + +K
Sbjct  1    MWKGFLSKLPRKTSASGR----GADLDSGQCSNGAGNGNPIQRTSSCGSIPSGRSTSTIK  56

Query  257  RVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKD  436
            R+SSAIFP+S+VAG   I P + FKDV N EKQ L VSKLNLCC+V+DF DP+K++AEKD
Sbjct  57   RMSSAIFPSSVVAG---IEPLVSFKDVPNSEKQNLFVSKLNLCCAVFDFSDPNKSSAEKD  113

Query  437  LKRQVLLELNDFVASGSVKCTESAIAA  517
            +KRQ LL+L D+V S S + +E+ IAA
Sbjct  114  IKRQTLLDLIDYVDSSSSRFSEAVIAA  140



>ref|XP_010533199.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Tarenaya hassleriana]
Length=500

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 98/145 (68%), Gaps = 8/145 (6%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            MLKQ L+K+P+KS + D   +SG   N  N  ++ G   Q TN  NV+ +RL+VVKRVSS
Sbjct  1    MLKQFLSKLPKKSTRIDQFHTSGIDSN--NQSSSHGIATQCTNVGNVLTSRLSVVKRVSS  58

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPASI+ G +S+ P L FKD+S+ ++Q L +SKLN CC      D D  ++E D+KRQ
Sbjct  59   AVFPASIMGGSDSVDPSLSFKDISSPQRQNLFISKLNFCCQ-----DVDSMSSE-DVKRQ  112

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
            VL EL DFV+SG  K +E AIAA C
Sbjct  113  VLAELVDFVSSGLAKFSEQAIAATC  137



>gb|KDP32288.1| hypothetical protein JCGZ_13213 [Jatropha curcas]
Length=498

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 93/145 (64%), Gaps = 12/145 (8%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            MLKQIL+K+PRKS K ++ + +  +  S      S NG          V + N  KR SS
Sbjct  1    MLKQILSKLPRKSSKPEATELTRPESPSIQRSNGSSNGS---------VAKSNGPKRTSS  51

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPAS+VAG E + P   FKDV  GE+  L VSK++LCC  +DF DP KN  EKD+KRQ
Sbjct  52   AVFPASVVAGIEPLVP---FKDVPAGERMNLFVSKVSLCCVTFDFTDPTKNTLEKDVKRQ  108

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
             LLEL DFVASGS+K +E AI A+C
Sbjct  109  TLLELVDFVASGSMKFSEPAILAMC  133



>ref|XP_003567932.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Brachypodium distachyon]
Length=506

 Score =   124 bits (310),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 97/145 (67%), Gaps = 10/145 (7%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIV--NRLNVVKRV  262
            M KQ L+K+PRKS  S   D    Q ++ N     G+ +Q T+SC  I      + +KR+
Sbjct  1    MWKQFLSKLPRKSSGSGRDDFDSGQCSNGN-----GSSIQRTSSCGSIPAGRSTSTIKRM  55

Query  263  SSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLK  442
            SSA+FP+S+VAG   I P + FKDV N EKQ L VSKLNLCC+V+DF DP K++AEKD+K
Sbjct  56   SSAVFPSSVVAG---IEPLVSFKDVPNSEKQNLFVSKLNLCCAVFDFSDPSKSSAEKDIK  112

Query  443  RQVLLELNDFVASGSVKCTESAIAA  517
            RQ LL+L DFV S S + +E+ IAA
Sbjct  113  RQTLLDLVDFVDSSSSRFSEAVIAA  137



>ref|XP_007013747.1| Phosphatase 2A regulatory B subunit family protein [Theobroma 
cacao]
 gb|EOY31366.1| Phosphatase 2A regulatory B subunit family protein [Theobroma 
cacao]
Length=503

 Score =   123 bits (309),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 100/147 (68%), Gaps = 10/147 (7%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQF--TNSCNVIVNRLNVVKRV  262
            ML+Q L+K+PRKS KSDS +   A+ NSC   T +G+  Q   +NS N    R    KR 
Sbjct  1    MLRQFLSKLPRKSGKSDSPEL--ARSNSC---TTAGSTPQTHRSNSLNSGSVRPCAAKRT  55

Query  263  SSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLK  442
            SSA+FPAS+VAG   I P L FKDV N EK  L VSK++LCC  +DF DP K++ EKD+K
Sbjct  56   SSAVFPASVVAG---IEPLLPFKDVPNSEKMNLFVSKVSLCCVTFDFTDPAKSSIEKDVK  112

Query  443  RQVLLELNDFVASGSVKCTESAIAAVC  523
            RQ LLEL DFVASGSV+ +E AI A+C
Sbjct  113  RQTLLELLDFVASGSVRFSEPAILAMC  139



>ref|XP_006394804.1| hypothetical protein EUTSA_v10004060mg [Eutrema salsugineum]
 gb|ESQ32090.1| hypothetical protein EUTSA_v10004060mg [Eutrema salsugineum]
Length=500

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 94/145 (65%), Gaps = 8/145 (6%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            M KQ L+K+PRKS K+DS    G    S + P  S      T   +  V R N  KR+SS
Sbjct  1    MFKQFLSKLPRKSSKADS----GELTRSSSGPVPSPAQRSGTGGGSAPV-RSNSGKRMSS  55

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPAS+VAG E + P   FKDV N EK  L VSK++LCC  +DF DP KN+ EKD+KRQ
Sbjct  56   AVFPASVVAGIEPLVP---FKDVPNSEKLNLFVSKVSLCCVTFDFSDPSKNSIEKDVKRQ  112

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
             LLEL DFVASGSV+ TE AI A+C
Sbjct  113  TLLELLDFVASGSVRFTEPAILAMC  137



>ref|XP_002458327.1| hypothetical protein SORBIDRAFT_03g031350 [Sorghum bicolor]
 gb|EES03447.1| hypothetical protein SORBIDRAFT_03g031350 [Sorghum bicolor]
Length=500

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 71/147 (48%), Positives = 98/147 (67%), Gaps = 6/147 (4%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVI--VNRLNVVKRV  262
            M KQ L K+P+KS  S   D  G+  +   + T +G  +Q T+SC        ++ VKR+
Sbjct  1    MWKQFLTKLPKKSSASGKGDH-GSGSSPGRNATGNGGTIQRTSSCPSAGPARPVSSVKRM  59

Query  263  SSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLK  442
            SSA+FP+S+VAG   I P + FKDV NGEKQ L VSK++LCC V+DF DP+KN+AEKD K
Sbjct  60   SSAVFPSSVVAG---IEPLVSFKDVPNGEKQNLFVSKVSLCCVVFDFSDPNKNSAEKDFK  116

Query  443  RQVLLELNDFVASGSVKCTESAIAAVC  523
            RQ L++L ++V S S + TE+ +AA C
Sbjct  117  RQALVDLMEYVDSASSRFTETMVAACC  143



>gb|KFK27832.1| hypothetical protein AALP_AA8G435800 [Arabis alpina]
Length=502

 Score =   120 bits (302),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 91/145 (63%), Gaps = 6/145 (4%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            M KQ L+K+PRKS K DS + +       + P           S  V   R N  KR+SS
Sbjct  1    MFKQFLSKLPRKSSKPDSNELNRTSSGPVSSPVQRSGASGGGGSGPV---RSNSGKRMSS  57

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPAS+VAG E + P   FKDV + EK  L VSK++LCC  +DF DP KN+ EKD+KRQ
Sbjct  58   AVFPASVVAGIEPLVP---FKDVPSSEKLNLFVSKVSLCCVTFDFSDPSKNSIEKDVKRQ  114

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
             LLEL DFVASGSVK TE AI A+C
Sbjct  115  TLLELLDFVASGSVKFTEPAILAMC  139



>ref|XP_007223260.1| hypothetical protein PRUPE_ppa004440mg [Prunus persica]
 ref|XP_008219855.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Prunus mume]
 gb|EMJ24459.1| hypothetical protein PRUPE_ppa004440mg [Prunus persica]
Length=509

 Score =   120 bits (301),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 99/150 (66%), Gaps = 8/150 (5%)
 Frame = +2

Query  89   MLKQILAKIPRkslks----dsldssGAQPNSCNDPTNSGNGMQFTNSC-NVIVNRLNVV  253
            MLKQ L+K+PRK+LKS    +S  +S  + +S   P+  G G   +N   N+   R N  
Sbjct  1    MLKQFLSKLPRKALKSDERPESPRTSTPRSSSRTGPSGVGGGTPRSNGGGNLGPVRSNGP  60

Query  254  KRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEK  433
            KR+SSA+FPAS+VAG E + P   FKDV   EK  L VSK++LCC  +DF DP KN+ EK
Sbjct  61   KRMSSAVFPASVVAGIEPLVP---FKDVPTSEKMNLFVSKVSLCCVTFDFTDPTKNSIEK  117

Query  434  DLKRQVLLELNDFVASGSVKCTESAIAAVC  523
            D+KRQ LLEL DFVASGS++ +E AI A C
Sbjct  118  DVKRQTLLELVDFVASGSMRFSEPAILATC  147



>ref|XP_009377509.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Pyrus x bretschneideri]
Length=503

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 95/147 (65%), Gaps = 11/147 (7%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCND-PTNSGNGMQFTNSCNVI-VNRLNVVKRV  262
            MLKQ L+K+PRK+LKS        +P+S    P+  G G   +N  N     + N  KR+
Sbjct  1    MLKQFLSKLPRKALKS------DERPDSPRTGPSGLGGGTPRSNGGNSSGPGKANAPKRM  54

Query  263  SSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLK  442
            SSA+FPAS+VAG E + P   FKDV   EK  L VSK++LCC  +DF DP KN+ EKD+K
Sbjct  55   SSAVFPASVVAGIEPLVP---FKDVPTPEKMNLFVSKVSLCCVTFDFTDPSKNSIEKDVK  111

Query  443  RQVLLELNDFVASGSVKCTESAIAAVC  523
            RQ LLEL DFVA+GS++ +E AI A C
Sbjct  112  RQTLLELVDFVATGSMRFSEPAILATC  138



>ref|XP_009372941.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Pyrus x bretschneideri]
Length=512

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 97/150 (65%), Gaps = 8/150 (5%)
 Frame = +2

Query  89   MLKQILAKIPRkslks----dsldssGAQPNSCNDPTNSGNGMQFTNSCNVI-VNRLNVV  253
            MLKQ L+K+PRK+LKS    +S  ++  +  S   P+  G G   +N  N     + N  
Sbjct  1    MLKQFLSKLPRKALKSDERPESPRTNTPRSGSRTGPSGLGGGTPRSNGANSSGPGKANAP  60

Query  254  KRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEK  433
            KR+SSA+FPAS+VAG E + P   FKDV   EK  L VSK++LCC  +DF DP KN+ EK
Sbjct  61   KRMSSAVFPASVVAGIEPLVP---FKDVPTSEKMNLFVSKVSLCCVTFDFTDPTKNSIEK  117

Query  434  DLKRQVLLELNDFVASGSVKCTESAIAAVC  523
            D+KRQ LLEL DFVA+GS++ +E AI A C
Sbjct  118  DVKRQTLLELVDFVATGSMRFSEPAILATC  147



>gb|KJB27047.1| hypothetical protein B456_004G274600 [Gossypium raimondii]
Length=429

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 92/145 (63%), Gaps = 8/145 (6%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            ML+Q L+KIPR    SDS +    +PNS      +G     +NS N    R    KR SS
Sbjct  1    MLRQFLSKIPRSFGNSDSPEL--TRPNSF---MTAGLHTHRSNSFNSGCGRPCATKRTSS  55

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            +IFPAS+VAG   I P L FK+  N EK  L VSK++LCC+ +DF D  KN+ EKD+KRQ
Sbjct  56   SIFPASVVAG---IEPLLPFKNAPNSEKMNLFVSKVSLCCATFDFSDATKNSIEKDVKRQ  112

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
             LLEL DFVASGS++ +E AI A+C
Sbjct  113  TLLELLDFVASGSIRFSEPAILAMC  137



>ref|XP_009377393.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Pyrus x bretschneideri]
 ref|XP_009377396.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Pyrus x bretschneideri]
Length=512

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 97/150 (65%), Gaps = 8/150 (5%)
 Frame = +2

Query  89   MLKQILAKIPRkslks----dsldssGAQPNSCNDPTNSGNGMQFTNSCNVI-VNRLNVV  253
            MLKQ L+K+PRK+LKS    +S  ++  +  S   P+  G G   +N  N     + N  
Sbjct  1    MLKQFLSKLPRKALKSDERPESPRTNTPRSGSRTGPSGLGGGTPRSNGANSSGPGKANAP  60

Query  254  KRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEK  433
            KR+SSA+FPAS+VAG E + P   FKDV   EK  L VSK++LCC  +DF DP KN+ EK
Sbjct  61   KRMSSAVFPASVVAGIEPLVP---FKDVPTSEKMNLFVSKVSLCCVTFDFTDPTKNSIEK  117

Query  434  DLKRQVLLELNDFVASGSVKCTESAIAAVC  523
            D+KRQ LLEL DFVA+GS++ +E AI A C
Sbjct  118  DVKRQTLLELVDFVATGSMRFSEPAILATC  147



>ref|XP_008383627.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Malus domestica]
Length=512

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 95/150 (63%), Gaps = 8/150 (5%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldss----GAQPNSCNDPTNSGNGMQFTNSCNVI-VNRLNVV  253
            MLKQ L+K+PRK+LKSD    S      +  S   P+  G G   +N  N     + N  
Sbjct  1    MLKQFLSKLPRKALKSDERPESPRXNTPRSGSRTGPSGLGGGTPRSNGANSSGPGKANAP  60

Query  254  KRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEK  433
            KR+SSA+FPAS+VAG E + P   FKDV   EK  L VSK++LCC  +DF DP KN+ EK
Sbjct  61   KRMSSAVFPASVVAGIEPLVP---FKDVPTSEKMNLFVSKVSLCCVTFDFTDPTKNSIEK  117

Query  434  DLKRQVLLELNDFVASGSVKCTESAIAAVC  523
            D+KRQ LLEL DFVA+GS++ +E AI A C
Sbjct  118  DVKRQTLLELVDFVATGSMRFSEPAILATC  147



>gb|KCW80467.1| hypothetical protein EUGRSUZ_C018111, partial [Eucalyptus grandis]
Length=386

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 92/145 (63%), Gaps = 6/145 (4%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            MLKQIL+KIPR++ + DS +    QP S   P  +          N    R   ++R SS
Sbjct  1    MLKQILSKIPRRTPRLDSGEL--IQPAS-GSPDGAQKSGGGGGGSNSSSARSGGLRRASS  57

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
             +FPAS++AG E + P   FKDV   EK  LLVSKL+LCC  +DF DP KN  EKD+KRQ
Sbjct  58   VVFPASVIAGIEPLVP---FKDVPASEKMNLLVSKLSLCCVTFDFTDPGKNTMEKDVKRQ  114

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
            +L+E+ DFVASGSV+  ESA+ A+C
Sbjct  115  ILMEILDFVASGSVRFAESAVLAMC  139



>ref|NP_001056272.1| Os05g0555100 [Oryza sativa Japonica Group]
 dbj|BAF18186.1| Os05g0555100, partial [Oryza sativa Japonica Group]
Length=449

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 86/117 (74%), Gaps = 5/117 (4%)
 Frame = +2

Query  173  CNDPTNSGNGMQFTNSCNVIVN--RLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNG  346
            C++   +GN +Q T+SC  I +    + +KR+SSAIFP+S+VAG   I P + FKDV N 
Sbjct  59   CSNGAGNGNPIQRTSSCGSIPSGRSTSTIKRMSSAIFPSSVVAG---IEPLVSFKDVPNS  115

Query  347  EKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAA  517
            EKQ L VSKLNLCC+V+DF DP+K++AEKD+KRQ LL+L D+V S S + +E+ IAA
Sbjct  116  EKQNLFVSKLNLCCAVFDFSDPNKSSAEKDIKRQTLLDLIDYVDSSSSRFSEAVIAA  172



>ref|XP_004138753.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Cucumis sativus]
 ref|XP_004173408.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Cucumis sativus]
 gb|KGN62895.1| Protein phosphatase 2a, regulatory subunit [Cucumis sativus]
Length=515

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 95/151 (63%), Gaps = 11/151 (7%)
 Frame = +2

Query  89   MLKQILAKIPRksl------ksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNV  250
            MLKQIL+K+PRKS       ++    S+ A P   N  T+SG+G   ++       R N 
Sbjct  1    MLKQILSKLPRKSSDSSDSPRTPRSSSNRASPR--NSTTSSGHGTPRSSGGASASGRSNA  58

Query  251  VKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAE  430
             K+ SSA+FPAS+VAG E + P   FKDV + EK  L VSKL+LCC  +DF DP KN+ E
Sbjct  59   TKKTSSAVFPASLVAGIEPLVP---FKDVPSSEKMNLFVSKLSLCCVTFDFTDPSKNSIE  115

Query  431  KDLKRQVLLELNDFVASGSVKCTESAIAAVC  523
            K +KRQ L+EL DFV +G++K  E AI A+C
Sbjct  116  KGVKRQTLIELVDFVGAGTMKFNEPAIHALC  146



>gb|KJB27048.1| hypothetical protein B456_004G274600 [Gossypium raimondii]
Length=501

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 92/145 (63%), Gaps = 8/145 (6%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            ML+Q L+KIPR    SDS +    +PNS      +G     +NS N    R    KR SS
Sbjct  1    MLRQFLSKIPRSFGNSDSPEL--TRPNSF---MTAGLHTHRSNSFNSGCGRPCATKRTSS  55

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            +IFPAS+VAG   I P L FK+  N EK  L VSK++LCC+ +DF D  KN+ EKD+KRQ
Sbjct  56   SIFPASVVAG---IEPLLPFKNAPNSEKMNLFVSKVSLCCATFDFSDATKNSIEKDVKRQ  112

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
             LLEL DFVASGS++ +E AI A+C
Sbjct  113  TLLELLDFVASGSIRFSEPAILAMC  137



>ref|XP_010048263.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Eucalyptus grandis]
Length=504

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 92/145 (63%), Gaps = 6/145 (4%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            MLKQIL+KIPR++ + DS +    QP S   P  +          N    R   ++R SS
Sbjct  1    MLKQILSKIPRRTPRLDSGEL--IQPAS-GSPDGAQKSGGGGGGSNSSSARSGGLRRASS  57

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
             +FPAS++AG E + P   FKDV   EK  LLVSKL+LCC  +DF DP KN  EKD+KRQ
Sbjct  58   VVFPASVIAGIEPLVP---FKDVPASEKMNLLVSKLSLCCVTFDFTDPGKNTMEKDVKRQ  114

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
            +L+E+ DFVASGSV+  ESA+ A+C
Sbjct  115  ILMEILDFVASGSVRFAESAVLAMC  139



>ref|XP_002440213.1| hypothetical protein SORBIDRAFT_09g027870 [Sorghum bicolor]
 gb|EES18643.1| hypothetical protein SORBIDRAFT_09g027870 [Sorghum bicolor]
Length=501

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 96/145 (66%), Gaps = 16/145 (11%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVN--RLNVVKRV  262
            M KQ L+K+PRKS               C++    G G+Q T+SC+ I +    + ++R+
Sbjct  1    MWKQFLSKLPRKSSA-------SGDSGQCSN----GTGIQRTSSCSSIPSGRPASAIRRM  49

Query  263  SSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLK  442
            SSA+FP+S+VAG   I P + FKDV N EKQ L VSKL+LCC V+DF DP+K++ EKD+K
Sbjct  50   SSAVFPSSVVAG---IEPLVSFKDVPNSEKQNLFVSKLSLCCVVFDFSDPNKSSVEKDIK  106

Query  443  RQVLLELNDFVASGSVKCTESAIAA  517
            RQ LL+L +FV S + + +E+AIAA
Sbjct  107  RQALLDLIEFVESTNTRFSEAAIAA  131



>gb|ACN30940.1| unknown [Zea mays]
Length=501

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 96/147 (65%), Gaps = 20/147 (14%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPT--NSGNGMQFTNSCNVIV--NRLNVVK  256
            M KQ+L+K+PR             +  +C D    ++G G+Q T+SC  I      + ++
Sbjct  1    MWKQLLSKLPR-------------KSPACGDSGQCSNGTGIQRTSSCGSIPPGRPASAIR  47

Query  257  RVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKD  436
            R+SSA+FP+S+VAG   I P + FKDV N EKQ L VSKL+LCC V+DF DP+K++ EKD
Sbjct  48   RMSSAVFPSSVVAG---IEPLVSFKDVPNSEKQNLFVSKLSLCCVVFDFSDPNKSSVEKD  104

Query  437  LKRQVLLELNDFVASGSVKCTESAIAA  517
            +KRQ LL+L +FV S + + +E+AIAA
Sbjct  105  IKRQALLDLIEFVESTNARFSEAAIAA  131



>ref|NP_001148974.1| transposon protein [Zea mays]
 gb|ACG33695.1| transposon protein [Zea mays]
Length=501

 Score =   119 bits (297),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 96/147 (65%), Gaps = 20/147 (14%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPT--NSGNGMQFTNSCNVIV--NRLNVVK  256
            M KQ+L+K+PR             +  +C D    ++G G+Q T+SC  I      + ++
Sbjct  1    MWKQLLSKLPR-------------KSPACGDSGQCSNGTGIQRTSSCGSIPPGRPASAIR  47

Query  257  RVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKD  436
            R+SSA+FP+S+VAG   I P + FKDV N EKQ L VSKL+LCC V+DF DP+K++ EKD
Sbjct  48   RMSSAVFPSSVVAG---IEPLVSFKDVPNSEKQNLFVSKLSLCCVVFDFSDPNKSSVEKD  104

Query  437  LKRQVLLELNDFVASGSVKCTESAIAA  517
            +KRQ LL+L +FV S + + +E+AIAA
Sbjct  105  IKRQALLDLIEFVESTNARFSEAAIAA  131



>ref|XP_008647861.1| PREDICTED: transposon protein isoform X1 [Zea mays]
 ref|XP_008647862.1| PREDICTED: transposon protein isoform X1 [Zea mays]
 ref|XP_008647863.1| PREDICTED: transposon protein isoform X1 [Zea mays]
 ref|XP_008647864.1| PREDICTED: transposon protein isoform X1 [Zea mays]
 gb|ACN27844.1| unknown [Zea mays]
 gb|ACN28036.1| unknown [Zea mays]
 gb|ACN29212.1| unknown [Zea mays]
 gb|AFW79075.1| transposon protein isoform 1 [Zea mays]
 gb|AFW79076.1| transposon protein isoform 2 [Zea mays]
 gb|AFW79077.1| transposon protein isoform 3 [Zea mays]
 gb|AFW79078.1| transposon protein isoform 4 [Zea mays]
Length=501

 Score =   119 bits (297),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 96/147 (65%), Gaps = 20/147 (14%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPT--NSGNGMQFTNSCNVIV--NRLNVVK  256
            M KQ+L+K+PR             +  +C D    ++G G+Q T+SC  I      + ++
Sbjct  1    MWKQLLSKLPR-------------KSPACGDSGQCSNGTGIQRTSSCGSIPPGRPASAIR  47

Query  257  RVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKD  436
            R+SSA+FP+S+VAG   I P + FKDV N EKQ L VSKL+LCC V+DF DP+K++ EKD
Sbjct  48   RMSSAVFPSSVVAG---IEPLVSFKDVPNSEKQNLFVSKLSLCCVVFDFSDPNKSSVEKD  104

Query  437  LKRQVLLELNDFVASGSVKCTESAIAA  517
            +KRQ LL+L +FV S + + +E+AIAA
Sbjct  105  IKRQALLDLIEFVESTNARFSEAAIAA  131



>ref|XP_008809266.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Phoenix dactylifera]
Length=509

 Score =   118 bits (296),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 100/145 (69%), Gaps = 4/145 (3%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            M KQ L+K+PRKS KSDS     A  +S ++ ++SGN +Q  +S N    R   VKR+SS
Sbjct  1    MWKQFLSKLPRKSSKSDSSLD-SAHNHSGSNASSSGNSIQRASSGNAGPGRSTTVKRMSS  59

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FP+S+VAG   I P L FKDV N EKQ L +SKLNLC +V DF DP+KN+AEKD+KR 
Sbjct  60   AVFPSSVVAG---IEPLLSFKDVPNNEKQNLFISKLNLCSAVLDFSDPNKNSAEKDMKRL  116

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
             LL+L DFV SG+ + TE  I+A C
Sbjct  117  TLLDLVDFVNSGTPRFTEPMISASC  141



>ref|XP_010493808.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Camelina sativa]
Length=506

 Score =   118 bits (296),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 95/148 (64%), Gaps = 10/148 (7%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPT---NSGNGMQFTNSCNVIVNRLNVVKR  259
            M KQ L+K+PRKS KS+S      + +S   P+    SG G     S  V   R N  KR
Sbjct  1    MFKQFLSKLPRKSSKSESGGGELNRSSSGQVPSPVQRSGAG-SVVGSGPV---RSNSGKR  56

Query  260  VSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDL  439
            +SSA+FPAS+VAG E + P   FKDV   EK  L VSK++LCC  +DF DP KN+ EKD+
Sbjct  57   MSSAVFPASVVAGIEPLVP---FKDVPTSEKLNLFVSKVSLCCVTFDFSDPGKNSIEKDV  113

Query  440  KRQVLLELNDFVASGSVKCTESAIAAVC  523
            KRQ LLEL DFVASGSVK TE AI A+C
Sbjct  114  KRQTLLELLDFVASGSVKFTEPAILAMC  141



>ref|XP_010456709.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like, partial [Camelina sativa]
Length=471

 Score =   117 bits (294),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 93/145 (64%), Gaps = 4/145 (3%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            M KQ L+K+PRKS KS+S      + +S   P+        +   +  V R N  KR+SS
Sbjct  1    MFKQFLSKLPRKSSKSESGGGELNRSSSGQVPSPVQRSGAGSGVGSGPV-RSNSGKRMSS  59

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPAS+VAG E + P   FKDV   EK  L VSK++LCC  +DF DP KN+ EKD+KRQ
Sbjct  60   AVFPASVVAGIEPLVP---FKDVPTSEKLNLFVSKVSLCCVTFDFSDPGKNSIEKDVKRQ  116

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
             LLEL DFVASGSVK TE AI A+C
Sbjct  117  TLLELLDFVASGSVKFTEPAILAMC  141



>ref|XP_010421407.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Camelina sativa]
Length=506

 Score =   118 bits (295),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 93/145 (64%), Gaps = 4/145 (3%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            M KQ L+K+PRKS KS+S      + +S   P+        +   +  V R N  KR+SS
Sbjct  1    MFKQFLSKLPRKSSKSESGGGELNRSSSGQVPSPVQRSGAGSGVGSGPV-RSNSGKRMSS  59

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPAS+VAG E + P   FKDV   EK  L VSK++LCC  +DF DP KN+ EKD+KRQ
Sbjct  60   AVFPASVVAGIEPLVP---FKDVPTSEKLNLFVSKVSLCCVTFDFSDPGKNSIEKDVKRQ  116

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
             LLEL DFVASGSVK TE AI A+C
Sbjct  117  TLLELLDFVASGSVKFTEPAILAMC  141



>ref|XP_010541630.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Tarenaya hassleriana]
 ref|XP_010541631.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Tarenaya hassleriana]
Length=504

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 95/150 (63%), Gaps = 15/150 (10%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGM-----QFTNSCNVIVNRLNVV  253
            M KQ L+K PR+S K+DS + +          + SG+G+     Q + +      R N  
Sbjct  1    MFKQFLSKFPRRSSKADSGELTRTS-------SGSGSGLVPSPGQRSVTSGSAPARSNSA  53

Query  254  KRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEK  433
            KR+SSA+FP S+VAG E + P   FKDV N EK  L VSK++LCC  +DF DP KN+ EK
Sbjct  54   KRMSSAVFPTSVVAGIEPLVP---FKDVPNTEKMNLFVSKVSLCCVTFDFSDPSKNSIEK  110

Query  434  DLKRQVLLELNDFVASGSVKCTESAIAAVC  523
            D+KRQ LLEL +F+ASGS+K TE AI A+C
Sbjct  111  DVKRQTLLELLEFLASGSLKFTEPAILAMC  140



>ref|XP_004969559.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X1 [Setaria italica]
Length=500

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 71/148 (48%), Positives = 94/148 (64%), Gaps = 8/148 (5%)
 Frame = +2

Query  89   MLKQILAKIPRkslksds-ldssGAQPNSCNDPTNSGNGMQFTNSCNVI--VNRLNVVKR  259
            M KQ L K+PRKS  S      SG+ P    +   +G+ +Q T+SC         + VKR
Sbjct  1    MWKQFLPKLPRKSSASGKGDHVSGSSPG--RNAAGNGSAIQRTSSCPSAGPARPASSVKR  58

Query  260  VSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDL  439
            +SSA+FP+S+VAG   I P + FKDV NGEK  L VSK++LCC V+DF DP+KN+AEKD 
Sbjct  59   MSSAVFPSSVVAG---IEPLVSFKDVPNGEKPNLFVSKVSLCCVVFDFSDPNKNSAEKDF  115

Query  440  KRQVLLELNDFVASGSVKCTESAIAAVC  523
            KRQ L++L D+V S S + TE  + A C
Sbjct  116  KRQALVDLVDYVDSASSRFTEPMVVACC  143



>ref|XP_006287577.1| hypothetical protein CARUB_v10000786mg [Capsella rubella]
 gb|EOA20475.1| hypothetical protein CARUB_v10000786mg [Capsella rubella]
Length=501

 Score =   116 bits (291),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 92/145 (63%), Gaps = 6/145 (4%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            M KQ+L+K+PRKS KSDS    G    S +    S       +       R N  KR+SS
Sbjct  1    MFKQLLSKLPRKSSKSDSG---GELNRSSSGQIASPVQRSGASGGGSGPVRSNSGKRMSS  57

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPAS+VAG E + P   FKDV + EK  L VSK++LCC  +DF DP KN+ EKD+KRQ
Sbjct  58   AVFPASVVAGIEPLVP---FKDVPSSEKLNLFVSKVSLCCVTFDFSDPGKNSIEKDVKRQ  114

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
             LLEL DFVASGSVK TE AI A+C
Sbjct  115  TLLELLDFVASGSVKFTEPAILAMC  139



>gb|KJB07811.1| hypothetical protein B456_001G045700 [Gossypium raimondii]
Length=502

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 98/147 (67%), Gaps = 11/147 (7%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQ--FTNSCNVIVNRLNVVKRV  262
            ML+Q L+K+PRKS KSDS + + +   SC   T +G+  Q   +NS N+   R    KR 
Sbjct  1    MLRQFLSKLPRKSGKSDSPELTRS--TSC---TTAGSTPQPHRSNSLNLGSGRPCAPKRT  55

Query  263  SSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLK  442
            SSA+FPAS+VAG   I P L FKDV N EK  L VSK++LCC  +DF DP KN  EKD+K
Sbjct  56   SSAVFPASVVAG---IEPLLPFKDVPNSEKMNLFVSKVSLCCVTFDFTDPTKNLIEKDVK  112

Query  443  RQVLLELNDFVASGSVKCTESAIAAVC  523
            RQ LLEL DFV SGSV+ +E AI A+C
Sbjct  113  RQTLLELLDFV-SGSVRFSEPAILAMC  138



>gb|KHG19967.1| Serine/threonine phosphatase 2A 57 kDa regulatory subunit B' 
iota-like protein [Gossypium arboreum]
Length=502

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 96/147 (65%), Gaps = 11/147 (7%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQ--FTNSCNVIVNRLNVVKRV  262
            ML+Q L+K+PRKS KSDS +    +  SC   T +G+  Q   +NS N+   R    KR 
Sbjct  1    MLRQFLSKLPRKSGKSDSPEL--TRSTSC---TTAGSSPQPHRSNSLNLGSGRPCAPKRT  55

Query  263  SSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLK  442
            SSA+FPAS+VAG   I P L FKDV N EK  L VSK++LCC  +DF DP KN  EKD+K
Sbjct  56   SSAVFPASVVAG---IEPLLPFKDVPNSEKMNLFVSKVSLCCVTFDFTDPTKNLIEKDVK  112

Query  443  RQVLLELNDFVASGSVKCTESAIAAVC  523
            RQ LLEL DFV SGSV+ +E AI A C
Sbjct  113  RQTLLELLDFV-SGSVRFSEPAILATC  138



>ref|XP_002516615.1| protein phosphatase 2a, regulatory subunit, putative [Ricinus 
communis]
 gb|EEF45956.1| protein phosphatase 2a, regulatory subunit, putative [Ricinus 
communis]
Length=498

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 69/146 (47%), Positives = 89/146 (61%), Gaps = 14/146 (10%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDP-TNSGNGMQFTNSCNVIVNRLNVVKRVS  265
            M KQ L+K+PRK           ++P S     T S +  +  NS      + N  KR S
Sbjct  1    MFKQFLSKLPRK----------SSKPESTESTRTESPSVQRCNNSSPASGVKSNGPKRTS  50

Query  266  SAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKR  445
            SA+FPAS+VAG E + P   FKDV + E+  L VSK++LCC  +DF DP KN  EKD+K+
Sbjct  51   SAVFPASVVAGIEPLVP---FKDVPSAERMNLFVSKVSLCCVTFDFTDPTKNTLEKDVKK  107

Query  446  QVLLELNDFVASGSVKCTESAIAAVC  523
            Q LLEL DFVASGS+K +E AI A+C
Sbjct  108  QTLLELLDFVASGSMKFSEPAILAMC  133



>ref|XP_008445128.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Cucumis melo]
Length=515

 Score =   116 bits (290),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 94/149 (63%), Gaps = 7/149 (5%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTN----SGNGMQFTNSCNVIVNRLNVVK  256
            MLKQIL+K+PRKS  S     +    ++ + P +    SG+G Q ++       R N  K
Sbjct  1    MLKQILSKLPRKSSDSSDSPRTPRSSSNRSSPRSSTAPSGHGTQRSSGGASASGRSNATK  60

Query  257  RVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKD  436
            + SSA+FPAS+VAG E + P   FKDV + EK  L VSKL+LCC  +DF DP KN+ EK 
Sbjct  61   KTSSAVFPASLVAGIEPLVP---FKDVPSSEKMNLFVSKLSLCCVTFDFTDPSKNSIEKG  117

Query  437  LKRQVLLELNDFVASGSVKCTESAIAAVC  523
            +KRQ L+EL DFV +G+VK  E AI A+C
Sbjct  118  VKRQTLIELVDFVGAGTVKFNEPAIHALC  146



>ref|NP_197933.1| protein phosphatase 2A regulatory B subunit [Arabidopsis thaliana]
 sp|Q93YV6.1|2A5I_ARATH RecName: Full=Serine/threonine protein phosphatase 2A 57 kDa 
regulatory subunit B' iota isoform; Short=AtB' iota; Short=PP2A, 
B' subunit, iota isoform [Arabidopsis thaliana]
 gb|AAL24096.1| putative AtBgamma protein [Arabidopsis thaliana]
 gb|AAN13126.1| putative AtBgamma protein [Arabidopsis thaliana]
 gb|AED93456.1| protein phosphatase 2A regulatory B subunit [Arabidopsis thaliana]
Length=500

 Score =   115 bits (289),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 71/95 (75%), Gaps = 3/95 (3%)
 Frame = +2

Query  239  RLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDK  418
            R N  KR+SSA+FPAS+VAG E + P   FKDV + EK  L VSK++LCC  +DF DP K
Sbjct  47   RSNSGKRMSSAVFPASVVAGIEPLVP---FKDVPSSEKLNLFVSKVSLCCVTFDFSDPGK  103

Query  419  NAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVC  523
            N+ EKD+KRQ LLEL DFVASGSVK TE AI A+C
Sbjct  104  NSIEKDVKRQTLLELLDFVASGSVKFTEPAILAMC  138



>ref|XP_008394018.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Malus domestica]
Length=512

 Score =   115 bits (289),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 95/150 (63%), Gaps = 8/150 (5%)
 Frame = +2

Query  89   MLKQILAKIPRkslks----dsldssGAQPNSCNDPTNSGNGMQFTNSCNVI-VNRLNVV  253
            MLKQ L+K+PRK+LKS    +S  ++  +  S   P+  G G   +N  N     + N  
Sbjct  1    MLKQFLSKLPRKALKSDERPESPRTNXPRSGSRTGPSGLGGGTPRSNGGNXSGPGKANAP  60

Query  254  KRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEK  433
            KR+SSA+FPAS VAG E + P   FKDV   EK  L VSK++LCC  +DF DP KN+ EK
Sbjct  61   KRMSSAVFPASXVAGIEPLVP---FKDVPTPEKMNLFVSKVSLCCVTFDFTDPTKNSIEK  117

Query  434  DLKRQVLLELNDFVASGSVKCTESAIAAVC  523
            D+KRQ LLEL DFVA GS++ +E AI A C
Sbjct  118  DVKRQTLLELVDFVAIGSMRFSEPAILATC  147



>ref|XP_002308635.2| hypothetical protein POPTR_0006s26320g, partial [Populus trichocarpa]
 gb|EEE92158.2| hypothetical protein POPTR_0006s26320g, partial [Populus trichocarpa]
Length=383

 Score =   114 bits (285),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 67/90 (74%), Gaps = 3/90 (3%)
 Frame = +2

Query  254  KRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEK  433
            KR SS +FPAS+VAG E + P   FKDVSN EK  L VSK++LCC  +DF DP KN  EK
Sbjct  50   KRTSSVVFPASVVAGIEPLVP---FKDVSNAEKMNLFVSKVSLCCVTFDFSDPSKNTLEK  106

Query  434  DLKRQVLLELNDFVASGSVKCTESAIAAVC  523
            D+KRQ LLEL DFVASGS++ +E AI A+C
Sbjct  107  DVKRQTLLELVDFVASGSMRFSEPAILAMC  136



>ref|XP_010109039.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform [Morus notabilis]
 gb|EXC20791.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform [Morus notabilis]
Length=668

 Score =   116 bits (291),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 75/147 (51%), Positives = 96/147 (65%), Gaps = 5/147 (3%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNV--VKRV  262
            M KQIL+K+PRKS KS+S  SS  +  S +   +SG+G++ + S             KR+
Sbjct  1    MFKQILSKLPRKSSKSESPRSSSPRSQSNSRAGSSGSGLENSKSNGGNSGSSRSNSTKRM  60

Query  263  SSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLK  442
            SS +FPAS+VAG E + P   FKDV N EK  L VSK++LCC  +DF DP+KN  EKD+K
Sbjct  61   SSVVFPASMVAGIEPLVP---FKDVPNAEKMNLFVSKVSLCCVTFDFTDPNKNTVEKDVK  117

Query  443  RQVLLELNDFVASGSVKCTESAIAAVC  523
            RQ LLEL DFVAS  +K TE AI A+C
Sbjct  118  RQTLLELVDFVASRPMKFTEPAILAMC  144



>gb|AFW81037.1| hypothetical protein ZEAMMB73_275381 [Zea mays]
Length=504

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 93/146 (64%), Gaps = 17/146 (12%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVI---VNRLNVVKR  259
            M KQ L+K+PR+S               C+    SG G+Q T+SC  I       + ++R
Sbjct  1    MWKQFLSKLPRRSSA-------SGDSGHCS----SGAGIQRTSSCGSIPPGRPPASAIRR  49

Query  260  VSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDL  439
            +SSA+FP+S+VAG   I P + FKDV + EKQ L VSKL+LCC V+DF DPD+++ EKD+
Sbjct  50   MSSAVFPSSVVAG---IEPLVSFKDVPSSEKQSLFVSKLSLCCVVFDFSDPDRSSVEKDI  106

Query  440  KRQVLLELNDFVASGSVKCTESAIAA  517
            KRQ LL+L +FV S + + +E+A+ A
Sbjct  107  KRQALLDLIEFVESTNARFSEAAVVA  132



>emb|CDY54903.1| BnaC02g48620D [Brassica napus]
Length=486

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 71/148 (48%), Positives = 90/148 (61%), Gaps = 28/148 (19%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            M KQ L+K+PRK           ++P+S +DP+ S             V R N VKR+SS
Sbjct  1    MFKQFLSKLPRK----------SSKPDSTSDPSGSS------------VVRSNSVKRMSS  38

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FP+S+VAG E + P   FKDV   EK  L VSKL+LCC  +DF D  KN+ EKD+KRQ
Sbjct  39   AVFPSSVVAGIEPLVP---FKDVPTSEKLNLFVSKLSLCCVTFDFSDQTKNSIEKDVKRQ  95

Query  449  VLLELNDFV---ASGSVKCTESAIAAVC  523
             LLEL DFV   +S SV+ TE AI A+C
Sbjct  96   TLLELLDFVSSSSSSSVRFTEPAILAMC  123



>ref|XP_002874266.1| hypothetical protein ARALYDRAFT_489409 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50525.1| hypothetical protein ARALYDRAFT_489409 [Arabidopsis lyrata subsp. 
lyrata]
Length=499

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 94/150 (63%), Gaps = 18/150 (12%)
 Frame = +2

Query  89   MLKQILAKIPRkslksds-----ldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVV  253
            M KQ L+K+PRKS KSDS       S           T++G+G   +NS           
Sbjct  1    MFKQFLSKLPRKSSKSDSGELNRSSSGPVSSPVQRSGTSAGSGPVRSNSG----------  50

Query  254  KRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEK  433
            KR+SSA+FPAS+VAG E + P   FKDV + EK  L VSK++LCC  +DF +P KN+ EK
Sbjct  51   KRMSSAVFPASVVAGIEPLVP---FKDVPSSEKLNLFVSKVSLCCVTFDFSEPGKNSIEK  107

Query  434  DLKRQVLLELNDFVASGSVKCTESAIAAVC  523
            D+KRQ LLEL DFVASGSVK TE AI A+C
Sbjct  108  DVKRQTLLELLDFVASGSVKFTEPAILAMC  137



>ref|XP_011019731.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Populus euphratica]
Length=499

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 71/146 (49%), Positives = 95/146 (65%), Gaps = 13/146 (9%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQ-PNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVS  265
            ML+QIL+K+P+KS K+DS +S+  + P +      S  G+  ++S           KR S
Sbjct  1    MLRQILSKLPKKSSKTDSAESTRPESPLTQQRSNGSTAGLGKSSSGP---------KRTS  51

Query  266  SAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKR  445
            S +FPAS+VAG E + P   FKDV N EK  L VSK++LCC  +DF DP KN  EKD+KR
Sbjct  52   SVVFPASVVAGIEPLVP---FKDVPNAEKMNLFVSKVSLCCVTFDFSDPSKNTLEKDVKR  108

Query  446  QVLLELNDFVASGSVKCTESAIAAVC  523
            Q LLEL DFVASG+++ +E AI A+C
Sbjct  109  QTLLELVDFVASGAMRFSEPAILAMC  134



>ref|XP_004961286.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Setaria italica]
Length=500

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 93/145 (64%), Gaps = 16/145 (11%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVI--VNRLNVVKRV  262
            M KQ L+K+PRKS               C++    G G+Q T+S   I      + ++R+
Sbjct  1    MWKQFLSKLPRKSSA-------SGDSGQCSN----GTGIQRTSSLGSIPPSRPASAIRRM  49

Query  263  SSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLK  442
            SSA+FP+S+VAG   I P + FKDV N EKQ L VSKL+LCC V+DF DP+K++ EKD+K
Sbjct  50   SSAVFPSSVVAG---IEPLVSFKDVPNSEKQNLFVSKLSLCCVVFDFSDPNKSSVEKDIK  106

Query  443  RQVLLELNDFVASGSVKCTESAIAA  517
            RQ LL+L +FV S + + +E++IAA
Sbjct  107  RQALLDLIEFVESSNARFSEASIAA  131



>ref|XP_006476190.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X1 [Citrus sinensis]
Length=539

 Score =   114 bits (285),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 56/90 (62%), Positives = 68/90 (76%), Gaps = 3/90 (3%)
 Frame = +2

Query  254  KRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEK  433
            KR SSA+FPAS+VAG   I P L FKDV NGEK  L VSK++LCC  +DF DP KN  EK
Sbjct  89   KRTSSAVFPASVVAG---IEPLLPFKDVPNGEKMNLFVSKVSLCCVTFDFTDPTKNCVEK  145

Query  434  DLKRQVLLELNDFVASGSVKCTESAIAAVC  523
            D+K+Q L+EL DFVA+GS+K +E AI A+C
Sbjct  146  DVKKQTLIELLDFVAAGSMKFSEPAILAMC  175



>ref|XP_006476191.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X2 [Citrus sinensis]
 gb|KDO79624.1| hypothetical protein CISIN_1g010120mg [Citrus sinensis]
Length=518

 Score =   113 bits (283),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 68/90 (76%), Gaps = 3/90 (3%)
 Frame = +2

Query  254  KRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEK  433
            KR SSA+FPAS+VAG   I P L FKDV NGEK  L VSK++LCC  +DF DP KN  EK
Sbjct  68   KRTSSAVFPASVVAG---IEPLLPFKDVPNGEKMNLFVSKVSLCCVTFDFTDPTKNCVEK  124

Query  434  DLKRQVLLELNDFVASGSVKCTESAIAAVC  523
            D+K+Q L+EL DFVA+GS+K +E AI A+C
Sbjct  125  DVKKQTLIELLDFVAAGSMKFSEPAILAMC  154



>ref|XP_006450560.1| hypothetical protein CICLE_v10008015mg [Citrus clementina]
 gb|ESR63800.1| hypothetical protein CICLE_v10008015mg [Citrus clementina]
Length=518

 Score =   113 bits (282),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 68/90 (76%), Gaps = 3/90 (3%)
 Frame = +2

Query  254  KRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEK  433
            KR SSA+FPAS+VAG   I P L FKDV NGEK  L VSK++LCC  +DF DP KN  EK
Sbjct  68   KRTSSAVFPASVVAG---IEPLLPFKDVPNGEKMNLFVSKVSLCCVTFDFTDPTKNCVEK  124

Query  434  DLKRQVLLELNDFVASGSVKCTESAIAAVC  523
            D+K+Q L+EL DFVA+GS+K +E AI A+C
Sbjct  125  DVKKQTLIELLDFVAAGSMKFSEPAILAMC  154



>emb|CDX88186.1| BnaA06g27770D [Brassica napus]
Length=495

 Score =   112 bits (281),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 71/95 (75%), Gaps = 3/95 (3%)
 Frame = +2

Query  239  RLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDK  418
            R N  KR+SSA+FPAS+V+G   I P L FKDV N EK  L VSK++LCC  +DF DP+K
Sbjct  42   RSNSGKRMSSAVFPASVVSG---IEPLLPFKDVPNSEKLNLFVSKVSLCCVTFDFSDPNK  98

Query  419  NAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVC  523
            N+ EK +KRQ LLEL DFVASGSV+ TE AI A+C
Sbjct  99   NSIEKLVKRQTLLELLDFVASGSVRFTEPAILAMC  133



>emb|CDX80521.1| BnaC07g29230D [Brassica napus]
Length=496

 Score =   112 bits (281),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 71/95 (75%), Gaps = 3/95 (3%)
 Frame = +2

Query  239  RLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDK  418
            R N  KR+SSA+FPAS+V+G   I P L FKDV N EK  L VSK++LCC  +DF DP+K
Sbjct  43   RSNSGKRMSSAVFPASVVSG---IEPLLPFKDVPNSEKLNLFVSKVSLCCVTFDFSDPNK  99

Query  419  NAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVC  523
            N+ EK +KRQ LLEL DFVASGSV+ TE AI A+C
Sbjct  100  NSIEKLVKRQTLLELLDFVASGSVRFTEPAILAMC  134



>ref|XP_008785874.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X1 [Phoenix dactylifera]
Length=526

 Score =   113 bits (282),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 99/151 (66%), Gaps = 4/151 (3%)
 Frame = +2

Query  71   HWSFATMLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNV  250
            H + ATM KQ ++K+PRKS K D+  +S    N  N+    GN ++ T S N + +    
Sbjct  14   HPNTATMWKQFISKLPRKSSKYDTASNSPPS-NPGNNAAACGNPIERTASGNGLPDGAAS  72

Query  251  VKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAE  430
            +KR++SA FP+S+V G   I P + FKDV N EKQ + +SKLNLCC ++DF DP+K++  
Sbjct  73   MKRLASAEFPSSVVVG---IEPLISFKDVPNFEKQNVFLSKLNLCCIIFDFSDPNKDSVG  129

Query  431  KDLKRQVLLELNDFVASGSVKCTESAIAAVC  523
            KDLKRQ L+EL D+V++ + + T+  IAA C
Sbjct  130  KDLKRQTLIELVDYVSTDAPRFTDQMIAASC  160



>ref|XP_004498632.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Cicer arietinum]
Length=500

 Score =   112 bits (281),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 92/146 (63%), Gaps = 9/146 (6%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQ-PNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVS  265
            MLKQI  K+PRKS K+D+ +S+    P S + P  +G            + R +     S
Sbjct  1    MLKQIFNKLPRKSSKTDTDESNRVDSPRSTDSPPAAGKSNHRLQGGGASLKRAS-----S  55

Query  266  SAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKR  445
            SA+FPAS+V+G E + P   FKDV N EK  L VSKL+LCC  +DF DP KN A+KD+KR
Sbjct  56   SAVFPASMVSGIEPLVP---FKDVPNAEKMNLFVSKLSLCCVTFDFTDPGKNTADKDVKR  112

Query  446  QVLLELNDFVASGSVKCTESAIAAVC  523
            + L+EL DFVA GS+K +E AI A+C
Sbjct  113  KTLVELVDFVAYGSMKFSEPAILAMC  138



>ref|XP_009151080.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Brassica rapa]
Length=495

 Score =   112 bits (281),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 71/95 (75%), Gaps = 3/95 (3%)
 Frame = +2

Query  239  RLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDK  418
            R N  KR+SSA+FPAS+V+G   I P L FKDV N EK  L VSK++LCC  +DF DP+K
Sbjct  42   RSNSGKRMSSAVFPASVVSG---IEPLLPFKDVPNSEKLNLFVSKVSLCCVAFDFSDPNK  98

Query  419  NAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVC  523
            N+ EK +KRQ LLEL DFVASGSV+ TE AI A+C
Sbjct  99   NSIEKLVKRQTLLELLDFVASGSVRFTEPAILAMC  133



>ref|XP_007161261.1| hypothetical protein PHAVU_001G055500g [Phaseolus vulgaris]
 gb|ESW33255.1| hypothetical protein PHAVU_001G055500g [Phaseolus vulgaris]
Length=491

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 92/146 (63%), Gaps = 9/146 (6%)
 Frame = +2

Query  89   MLKQILAKIPRkslk-sdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVS  265
            ML+QIL+K+PRKSLK      + G    S + P  +G   +     +    R +     S
Sbjct  1    MLRQILSKLPRKSLKPDSDESTWGDSARSADSPRVAGKSQRPHGGSSTAAKRAS-----S  55

Query  266  SAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKR  445
            SA+FPAS+V+G E + P   FKDV+N EK  L VSKL+LCC  +DF DP K+ A+KD+KR
Sbjct  56   SAVFPASMVSGFEPLVP---FKDVANAEKMNLFVSKLSLCCVTFDFCDPSKSVADKDVKR  112

Query  446  QVLLELNDFVASGSVKCTESAIAAVC  523
            + L+EL DFVA G+V+ +E AI A+C
Sbjct  113  KTLVELVDFVACGTVRFSEPAILALC  138



>ref|XP_003544625.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Glycine max]
Length=492

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 91/146 (62%), Gaps = 9/146 (6%)
 Frame = +2

Query  89   MLKQILAKIPRkslk-sdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVS  265
            MLKQIL+K+PRKSLK      + G    S + P  +G   +     +    R +     S
Sbjct  1    MLKQILSKLPRKSLKPDSDELTRGDSARSADSPRAAGRSYKLHGVSSSTAKRAS-----S  55

Query  266  SAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKR  445
            SA+FPAS+V+G E + P   FKDV N EK  L VSKL+LCC  +DF DP K+ A+KD+KR
Sbjct  56   SAVFPASMVSGIEPLVP---FKDVPNAEKMNLFVSKLSLCCVTFDFTDPGKSIADKDVKR  112

Query  446  QVLLELNDFVASGSVKCTESAIAAVC  523
            + L+EL DFVA G+++ +E AI A+C
Sbjct  113  KTLVELVDFVACGTMRFSEPAILAMC  138



>emb|CDY05497.1| BnaA02g31940D [Brassica napus]
Length=485

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 71/146 (49%), Positives = 90/146 (62%), Gaps = 25/146 (17%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            M KQ L+K+PRKS          ++P+S +DP+ S             V R N VKR+SS
Sbjct  1    MFKQFLSKLPRKS---------SSKPDSTSDPSGSS------------VVRSNSVKRMSS  39

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FP+S+VAG E + P   FKDV   EK  L VSKL+LCC  +DF D  KN+ EKD+KRQ
Sbjct  40   AVFPSSVVAGIEPLVP---FKDVPTSEKLNLFVSKLSLCCVTFDFSDQTKNSLEKDVKRQ  96

Query  449  VLLELNDF-VASGSVKCTESAIAAVC  523
             LLEL DF  +S SV+ TE AI A+C
Sbjct  97   TLLELLDFVSSSSSVRFTEPAILAMC  122



>ref|XP_009129957.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Brassica rapa]
Length=487

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 71/146 (49%), Positives = 90/146 (62%), Gaps = 25/146 (17%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            M KQ L+K+PRKS          ++P+S +DP+ S             V R N VKR+SS
Sbjct  3    MFKQFLSKLPRKS---------SSKPDSTSDPSGSS------------VVRSNSVKRMSS  41

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FP+S+VAG E + P   FKDV   EK  L VSKL+LCC  +DF D  KN+ EKD+KRQ
Sbjct  42   AVFPSSVVAGIEPLVP---FKDVPTSEKLNLFVSKLSLCCVTFDFSDQTKNSLEKDVKRQ  98

Query  449  VLLELNDF-VASGSVKCTESAIAAVC  523
             LLEL DF  +S SV+ TE AI A+C
Sbjct  99   TLLELLDFVSSSSSVRFTEPAILAMC  124



>ref|XP_010670759.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Beta vulgaris subsp. vulgaris]
Length=499

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 90/146 (62%), Gaps = 9/146 (6%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            MLKQIL+KIPRK  KSD       +P   N+   SGNG     + N    + N  KR SS
Sbjct  1    MLKQILSKIPRKPFKSD-----NGEPILNNNLNGSGNGTPRARNGNAASGKANATKRTSS  55

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FP S+VAG   I P + FKDV N EK  L +SKLNLCC  +DF DP KN +EKD+KR+
Sbjct  56   AVFPTSVVAG---IEPLVSFKDVPNSEKMNLFLSKLNLCCVTFDFYDPSKNTSEKDIKRE  112

Query  449  VLLELNDFVASG-SVKCTESAIAAVC  523
             L+EL DFVA G   K  E AI A+C
Sbjct  113  TLIELVDFVAVGPPSKFPEPAIFAMC  138



>ref|XP_011026522.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Populus euphratica]
Length=500

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 89/145 (61%), Gaps = 11/145 (8%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            ML+QIL+K+PRKS K+D  +   A+P S   P           S        N  KR SS
Sbjct  2    MLRQILSKLPRKSSKTDLAE--SARPES---PVTQQIS---NGSSAGSGKSSNGPKRTSS  53

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
             +FPAS+VAG E + P   FKDV N EK  L VSK++LCC  +DF D  KN  EKD+KRQ
Sbjct  54   VVFPASVVAGIEPLVP---FKDVPNAEKMNLFVSKVSLCCVTFDFSDSSKNTLEKDVKRQ  110

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
             LLEL DFVA+GS+K +E AI A+C
Sbjct  111  TLLELVDFVAAGSMKFSEPAILAMC  135



>ref|XP_003588682.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform [Medicago truncatula]
 gb|AES58933.1| protein phosphatase 2A regulatory B subunit family protein [Medicago 
truncatula]
Length=494

 Score =   109 bits (273),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 87/145 (60%), Gaps = 13/145 (9%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            MLKQI  K+PRK+ K+        + +  +    +G   Q        + R +     SS
Sbjct  1    MLKQIFNKLPRKTSKTY-----SDESSRVDSSRAAGKSHQRPQGAAASLKRAS-----SS  50

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPAS+V+G E + P   FKDV N EK  L VSKL+LCC  +DF DP KN AEKD+KR+
Sbjct  51   AVFPASMVSGIEPLVP---FKDVPNAEKMNLFVSKLSLCCVTFDFTDPGKNVAEKDVKRK  107

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
             L+EL DFVA GS+K +E AI A+C
Sbjct  108  TLVELVDFVACGSMKFSEPAILAMC  132



>ref|XP_008785883.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X2 [Phoenix dactylifera]
 ref|XP_008785890.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X2 [Phoenix dactylifera]
Length=507

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 95/145 (66%), Gaps = 4/145 (3%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            M KQ ++K+PRKS K D+  +S    N  N+    GN ++ T S N + +    +KR++S
Sbjct  1    MWKQFISKLPRKSSKYDTASNSPPS-NPGNNAAACGNPIERTASGNGLPDGAASMKRLAS  59

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A FP+S+V G   I P + FKDV N EKQ + +SKLNLCC ++DF DP+K++  KDLKRQ
Sbjct  60   AEFPSSVVVG---IEPLISFKDVPNFEKQNVFLSKLNLCCIIFDFSDPNKDSVGKDLKRQ  116

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
             L+EL D+V++ + + T+  IAA C
Sbjct  117  TLIELVDYVSTDAPRFTDQMIAASC  141



>ref|XP_004292963.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Fragaria vesca subsp. vesca]
Length=525

 Score =   108 bits (270),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 53/90 (59%), Positives = 66/90 (73%), Gaps = 3/90 (3%)
 Frame = +2

Query  254  KRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEK  433
            KR+SSA+FPAS+VAG E + P   FKDV   EK  L VSK++LCC  +DF DP KN+ EK
Sbjct  74   KRMSSAVFPASVVAGIEPLVP---FKDVPGSEKMNLFVSKVSLCCVTFDFTDPTKNSIEK  130

Query  434  DLKRQVLLELNDFVASGSVKCTESAIAAVC  523
            D+KRQ LLEL +FV+S S+K +E AI A C
Sbjct  131  DVKRQTLLELVEFVSSASMKFSEPAILATC  160



>emb|CDP18419.1| unnamed protein product [Coffea canephora]
Length=496

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 67/91 (74%), Gaps = 3/91 (3%)
 Frame = +2

Query  251  VKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAE  430
            +KR SSA+FPAS+VAG E + P   FKDV + EK  L +SKL+LCC V+DF +P KN +E
Sbjct  43   LKRASSAVFPASVVAGFEPLVP---FKDVPSSEKMNLFISKLSLCCVVFDFTNPSKNTSE  99

Query  431  KDLKRQVLLELNDFVASGSVKCTESAIAAVC  523
            K+LKR  L+EL DFV+S +VK +E AI  VC
Sbjct  100  KELKRATLIELVDFVSSNTVKYSEPAILVVC  130



>dbj|BAK03510.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=500

 Score =   107 bits (268),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 88/145 (61%), Gaps = 10/145 (7%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIV--NRLNVVKRV  262
            M KQ L+K+PR             Q +  N     GN +Q T+S          + +KR+
Sbjct  1    MWKQFLSKLPRTKSSGGGGGGDSGQCSGGN-----GNPIQRTSSVPAGGGGRSASTIKRM  55

Query  263  SSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLK  442
            SSA+FP+S+VAG ES+   + FKDV + E+  L VSKL LCC+V+DF DP K++AEKD+K
Sbjct  56   SSAVFPSSVVAGIESL---VSFKDVPSSERHNLFVSKLGLCCAVFDFSDPAKSSAEKDIK  112

Query  443  RQVLLELNDFVASGSVKCTESAIAA  517
            RQ LL+L DFV S S +  E+ IAA
Sbjct  113  RQTLLDLIDFVDSSSGRYPEAVIAA  137



>gb|EYU21914.1| hypothetical protein MIMGU_mgv1a005231mg [Erythranthe guttata]
Length=492

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 85/145 (59%), Gaps = 13/145 (9%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            M KQIL KIP+KS K D        PNS  + ++ G+    TN+           KR S+
Sbjct  2    MWKQILGKIPKKSQKPDQDS--SRNPNSGPNTSSPGSIRANTNTP--------AAKRASA  51

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FP  ++AG   I P L FKDVS+ EK  L +SKL+LCC V+DF DP KN  EK+LKR 
Sbjct  52   AVFPTCVIAG---IEPLLAFKDVSSSEKMNLFISKLSLCCVVFDFTDPAKNVQEKELKRA  108

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
             L+EL DFV+    K +E AI A C
Sbjct  109  TLIELLDFVSQNPPKFSEPAILASC  133



>ref|XP_011087131.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Sesamum indicum]
Length=491

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 84/145 (58%), Gaps = 13/145 (9%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            M KQIL+K+PRKS K D       Q N  + P     G     + N         KR S+
Sbjct  1    MWKQILSKLPRKSQKPDQ----DLQRNPDSGPNTPSLGSGRIGAAN------PAAKRASA  50

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPAS++AG   I P L FKDVS+ EK  L +SKL+LCC V+DF DP KN  EK+LKR 
Sbjct  51   AVFPASVIAG---IEPLLPFKDVSSSEKMNLFISKLSLCCVVFDFTDPAKNIQEKELKRA  107

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
             LLEL +FV+    K +E AI A C
Sbjct  108  TLLELLEFVSENPPKFSEPAILASC  132



>ref|XP_011081886.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Sesamum indicum]
Length=490

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 85/149 (57%), Gaps = 21/149 (14%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNV----VK  256
            M KQIL K+PRK            +P    D  ++ N     NS +   +R+N      K
Sbjct  1    MWKQILGKLPRK----------SQKP----DQDSTRNPSLGPNSSSPGSSRVNASSPAAK  46

Query  257  RVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKD  436
            R S+A+FPAS++AG   I P L FKDV + EK  L +SKL+LCC V+DF DP KN  EK+
Sbjct  47   RASAAVFPASVIAG---IEPLLAFKDVPSSEKMNLFISKLSLCCVVFDFTDPAKNIQEKE  103

Query  437  LKRQVLLELNDFVASGSVKCTESAIAAVC  523
            LKR  LLEL DFV+    K +E AI A C
Sbjct  104  LKRATLLELLDFVSQNPPKFSEPAILASC  132



>gb|EYU29254.1| hypothetical protein MIMGU_mgv1a005961mg [Erythranthe guttata]
Length=463

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 78/146 (53%), Gaps = 25/146 (17%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCND-PTNSGNGMQFTNSCNVIVNRLNVVKRVS  265
            M KQ L K+PR              P S  D P N   G    N+ N         KR S
Sbjct  1    MWKQFLGKLPR------------KSPKSDQDLPRNPNLG---PNAAN------PAAKRAS  39

Query  266  SAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKR  445
            +A+FPAS++AG   I P L FKDV N E+  L +SKL+LC  V+DF DP KN  EK+LKR
Sbjct  40   AAVFPASVIAG---IEPLLAFKDVPNSERMNLFISKLSLCSVVFDFTDPAKNIQEKELKR  96

Query  446  QVLLELNDFVASGSVKCTESAIAAVC  523
              LLEL +FV+    K +E AI A C
Sbjct  97   ATLLELLEFVSENPPKFSEPAILASC  122



>ref|XP_004241801.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Solanum lycopersicum]
Length=498

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 88/150 (59%), Gaps = 22/150 (15%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVN----RLNVV-  253
            M K  L+K+P+KSLK              ++  +SG G   +NS N   N    R N V 
Sbjct  1    MWKHFLSKLPKKSLK--------------SESVDSGRGNSDSNSPNASSNLGPGRPNSVP  46

Query  254  KRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEK  433
            +R SS +FPAS++AG   I P + FKDV + EK  L +SKL+LCC  +DF DP KN AEK
Sbjct  47   RRTSSVVFPASVIAG---IEPLISFKDVPSSEKMNLFISKLSLCCVDFDFRDPTKNVAEK  103

Query  434  DLKRQVLLELNDFVASGSVKCTESAIAAVC  523
            +LKR  L EL DFV++   K +E AI A+C
Sbjct  104  ELKRATLFELLDFVSANPPKFSEPAILALC  133



>ref|XP_006353657.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Solanum tuberosum]
Length=498

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 88/145 (61%), Gaps = 12/145 (8%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            M K  L+K+P+KSLKS+S+D      +S +   +S  G    NS         V +R SS
Sbjct  1    MWKHFLSKLPKKSLKSESVDLGRGNSDSHSPNASSNLGPGRPNS---------VPRRTSS  51

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
             +FPAS++AG   I P + FKDV + EK  L +SKL+LCC  +DF DP KN AEK+LKR 
Sbjct  52   VVFPASVIAG---IEPLISFKDVPSSEKMNLFISKLSLCCVDFDFRDPTKNVAEKELKRA  108

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
             L EL DFV++   K +E AI A+C
Sbjct  109  TLFELLDFVSANPPKFSEPAILALC  133



>ref|XP_009619322.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Nicotiana tomentosiformis]
Length=499

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 63/91 (69%), Gaps = 3/91 (3%)
 Frame = +2

Query  251  VKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAE  430
            ++R SS +FPAS++AG   I P + FKDV + EK  L +SKL+LCC  +DF DP KN AE
Sbjct  47   LRRTSSVVFPASVIAG---IEPLISFKDVPSSEKMNLFISKLSLCCVDFDFRDPTKNVAE  103

Query  431  KDLKRQVLLELNDFVASGSVKCTESAIAAVC  523
            K+LKR  L EL DFV+S   K +E AI A+C
Sbjct  104  KELKRATLFELLDFVSSNPPKFSEPAILAMC  134



>ref|XP_009798807.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Nicotiana sylvestris]
Length=499

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 68/147 (46%), Positives = 92/147 (63%), Gaps = 15/147 (10%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldss--GAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRV  262
            M K  L+K+P+K+LKS+S+DS+   + P   N   N G+G    NS        + ++R 
Sbjct  1    MWKHFLSKLPKKALKSESVDSARGNSGPLGPNASPNLGSGR--PNS--------SALRRT  50

Query  263  SSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLK  442
            SS +FPAS++AG   I P + FKDV + EK  L +SKL+LCC  +DF DP KN AEK+LK
Sbjct  51   SSVVFPASVIAG---IEPLISFKDVPSSEKMNLFISKLSLCCVDFDFRDPTKNVAEKELK  107

Query  443  RQVLLELNDFVASGSVKCTESAIAAVC  523
            R  L EL DFV+S   K +E AI A+C
Sbjct  108  RATLFELLDFVSSNPPKFSEPAILAMC  134



>ref|XP_010925297.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Elaeis guineensis]
 ref|XP_010925298.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Elaeis guineensis]
Length=507

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 91/153 (59%), Gaps = 20/153 (13%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDP--------TNSGNGMQFTNSCNVIVNRL  244
            M KQ ++K+PRKS             N  N P           GN ++ T S N + +  
Sbjct  1    MWKQFISKLPRKS---------SKYDNGSNSPPNNAGNNAAACGNPVERTASGNGLPDGA  51

Query  245  NVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNA  424
              +KR++SA FP+S+VAG   I P + FKDV N EKQ + +SKLNLCC ++DF DP+K++
Sbjct  52   ASLKRLASAEFPSSVVAG---IEPLISFKDVPNLEKQNVFLSKLNLCCIIFDFSDPNKDS  108

Query  425  AEKDLKRQVLLELNDFVASGSVKCTESAIAAVC  523
              KDLKRQ L+EL D+V++ + + T+  IA+ C
Sbjct  109  MGKDLKRQTLIELVDYVSTDAPRFTDQMIASSC  141



>ref|XP_002284526.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Vitis vinifera]
 ref|XP_010648553.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Vitis vinifera]
Length=492

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 81/145 (56%), Gaps = 16/145 (11%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            MLKQIL+++PR            A      D   +  G   ++S +      +  K  +S
Sbjct  1    MLKQILSRLPR-----------KALKAESGDLVRTDTGTPRSSSGSPGSRPTSAKK--TS  47

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            ++FP + VAG E   P   F DV   EK  L VSKLNLCC+V+DF DP KN+ EKD+KRQ
Sbjct  48   SVFPTNAVAGVE---PSAAFNDVPIAEKLNLFVSKLNLCCTVFDFNDPSKNSIEKDVKRQ  104

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
             L+EL DF+ SG  + TE  IAA+C
Sbjct  105  TLIELVDFMVSGPPRFTEPVIAAMC  129



>ref|NP_001146050.1| uncharacterized protein LOC100279581 [Zea mays]
 gb|ACL53110.1| unknown [Zea mays]
Length=455

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 66/86 (77%), Gaps = 3/86 (3%)
 Frame = +2

Query  260  VSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDL  439
            +SSA+FP+S+VAG   I P + FKDV + EKQ L VSKL+LCC V+DF DPD+++ EKD+
Sbjct  1    MSSAVFPSSVVAG---IEPLVSFKDVPSSEKQSLFVSKLSLCCVVFDFSDPDRSSVEKDI  57

Query  440  KRQVLLELNDFVASGSVKCTESAIAA  517
            KRQ LL+L +FV S + + +E+A+ A
Sbjct  58   KRQALLDLIEFVESTNARFSEAAVVA  83



>ref|XP_003550157.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform 1 [Glycine max]
Length=492

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 68/146 (47%), Positives = 93/146 (64%), Gaps = 9/146 (6%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQ-PNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVS  265
            MLKQIL+K+PRKSLK DS +S       S + P  +G   +     +         +  S
Sbjct  1    MLKQILSKLPRKSLKPDSDESPRVDSARSADSPRAAGRSNKPHGGSSS-----AAKRASS  55

Query  266  SAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKR  445
            SA+FPAS+V+G E + P   FKDV N EK  L VSKL+LCC  +DF DP K++A+KD+KR
Sbjct  56   SAVFPASMVSGIEPLVP---FKDVPNAEKMNLFVSKLSLCCVTFDFTDPSKSSADKDVKR  112

Query  446  QVLLELNDFVASGSVKCTESAIAAVC  523
            + L+EL DFVA G+++ +E AI A+C
Sbjct  113  KTLVELVDFVACGTMRFSEPAILAIC  138



>gb|EPS62004.1| hypothetical protein M569_12788, partial [Genlisea aurea]
Length=473

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 83/145 (57%), Gaps = 16/145 (11%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            M KQ L K+PRK+ K D        P S +   + G+G   TN+ N         K  S+
Sbjct  1    MWKQFLGKLPRKTQKPD-----PDSPISASATLSPGSGR--TNAVNA------AYKLASA  47

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPA ++AG E   P L FKDV   EK  L +SKL+LCC V+DF DP KN  EK+LKR 
Sbjct  48   AVFPACVIAGVE---PLLAFKDVPCSEKLNLFISKLSLCCVVFDFTDPAKNIQEKELKRA  104

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
             LLEL +FV+    K +E++I A C
Sbjct  105  TLLELLEFVSQNPPKFSENSILAAC  129



>ref|XP_007137075.1| hypothetical protein PHAVU_009G097600g [Phaseolus vulgaris]
 gb|ESW09069.1| hypothetical protein PHAVU_009G097600g [Phaseolus vulgaris]
Length=497

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 68/148 (46%), Positives = 91/148 (61%), Gaps = 10/148 (7%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCND-PTNSGNGMQFTNSCNVIVNRLNVVKRVS  265
            MLKQ L+++PRK+ K DS +S  A  +  +D P  +G      +  + +    N  KR S
Sbjct  1    MLKQFLSRLPRKTPKPDSDESCRADSSRSDDSPRAAGRH----SRAHGVAAASNAAKRTS  56

Query  266  S-AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLK  442
            S A+FPAS V+  E + P   FKDV + EK  L VSKL+LCC  +DF DP KN  EK++K
Sbjct  57   SSAVFPASTVSVIEPLVP---FKDVPSAEKMNLFVSKLSLCCVSFDFRDPVKNTVEKEVK  113

Query  443  RQVLLELNDFVAS-GSVKCTESAIAAVC  523
            R+ L+EL DFV+S GS +  E AI AVC
Sbjct  114  RKTLVELVDFVSSCGSSRFGEPAILAVC  141



>gb|KJB40702.1| hypothetical protein B456_007G074200 [Gossypium raimondii]
 gb|KJB40703.1| hypothetical protein B456_007G074200 [Gossypium raimondii]
 gb|KJB40704.1| hypothetical protein B456_007G074200 [Gossypium raimondii]
 gb|KJB40705.1| hypothetical protein B456_007G074200 [Gossypium raimondii]
Length=523

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 62/152 (41%), Positives = 85/152 (56%), Gaps = 16/152 (11%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGN------------GMQFT--NSCN  226
            M+KQIL ++PRK  KS      G   +S N  T+S N            G  F+  +S N
Sbjct  1    MIKQILNRLPRKPSKSSDNREGGTSTSSSNAYTSSRNSDLASNHYANSSGASFSGFHSTN  60

Query  227  VIVNRLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFG  406
              +N+ N + +V +A    + VA   S  P   F+DV N EKQ L + KLN+CC V+DF 
Sbjct  61   SGLNQGNKISQVVNAKLNGNTVA--TSFEPLPNFRDVPNSEKQNLFIRKLNICCIVFDFT  118

Query  407  DPDKNAAEKDLKRQVLLELNDFVASGSVKCTE  502
            DP KN  EKD+KRQ LLE+ D+V+S + K +E
Sbjct  119  DPTKNVKEKDIKRQTLLEIMDYVSSANGKFSE  150



>ref|XP_003603467.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform [Medicago truncatula]
 gb|AES73718.1| protein phosphatase 2A regulatory B subunit family protein [Medicago 
truncatula]
Length=499

 Score = 95.9 bits (237),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 68/147 (46%), Positives = 87/147 (59%), Gaps = 9/147 (6%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            MLKQ L+K+PRK+ K DS +S     +  +  T   N  Q  N       + N  KR SS
Sbjct  1    MLKQFLSKLPRKASKHDSDESCRVDSHDSHRVTGKNNRSQGGNDGG----KANAAKRNSS  56

Query  269  A-IFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKR  445
            A +FP S V+  E + P   FKDV + EK  L VSKL+LCC  +DF D  KN  EKD+KR
Sbjct  57   AAVFPTSTVSLIEPLVP---FKDVPSSEKMNLFVSKLSLCCVAFDFTDSGKNVVEKDVKR  113

Query  446  QVLLELNDFVAS-GSVKCTESAIAAVC  523
            + L+EL DFV+S GS K +E AI A+C
Sbjct  114  RTLVELVDFVSSFGSAKFSEPAILAMC  140



>gb|KHG13833.1| Serine/threonine phosphatase 2A 59 kDa regulatory subunit B' 
eta-like protein [Gossypium arboreum]
Length=523

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 61/152 (40%), Positives = 85/152 (56%), Gaps = 16/152 (11%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGN------------GMQFT--NSCN  226
            M+KQIL ++PRK  KS      G   +S N  T+S N            G  F+  +S N
Sbjct  1    MIKQILNRLPRKPSKSSDNREGGTSTSSSNAYTSSRNSDLASNHYANSSGASFSGFHSTN  60

Query  227  VIVNRLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFG  406
              +N+ N + +V +A    + VA      P+  F+DV N EKQ L + KLN+CC V+DF 
Sbjct  61   SGLNQGNKISQVVNAKLNGNTVATSFEALPN--FRDVPNSEKQNLFIRKLNICCIVFDFT  118

Query  407  DPDKNAAEKDLKRQVLLELNDFVASGSVKCTE  502
            DP KN  EKD+KRQ LLE+ D+V+S + K +E
Sbjct  119  DPTKNVKEKDIKRQTLLEIVDYVSSANGKFSE  150



>ref|XP_002448078.1| hypothetical protein SORBIDRAFT_06g020625 [Sorghum bicolor]
 gb|EES12406.1| hypothetical protein SORBIDRAFT_06g020625 [Sorghum bicolor]
Length=407

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 59/165 (36%), Positives = 83/165 (50%), Gaps = 26/165 (16%)
 Frame = +2

Query  68   IHWSFATMLKQILAKIPRkslksdsldssGAQPNSCNDPTNS---GNGMQFTNSCNVIVN  238
            + W +  M+KQIL ++PR             +P    D   +   GNG + +NS +V  +
Sbjct  9    VSWFWWEMIKQILGRLPR-------------KPGKAGDSREAAAAGNGTEPSNSYSVARS  55

Query  239  RLNVVKR-------VSSAIFPASIVAGG---ESISPHLCFKDVSNGEKQGLLVSKLNLCC  388
                 KR       V S + P  ++ G     S  P   FKDV   EKQ L V K+NLCC
Sbjct  56   MDPGNKRAGNGDYPVPSGVTPNPVMNGAVVYHSNEPLPAFKDVPASEKQNLFVKKVNLCC  115

Query  389  SVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVC  523
            +VYDF DP KN  EK++KRQ L+EL D+V S + K +E  +  + 
Sbjct  116  AVYDFADPTKNLKEKEVKRQTLMELVDYVTSANGKFSEVVMLEIT  160



>gb|EPS71240.1| hypothetical protein M569_03516, partial [Genlisea aurea]
Length=471

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 75/145 (52%), Gaps = 26/145 (18%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            M +Q L K+PRKS K D   S G      + PT +                    KR SS
Sbjct  1    MWRQFLGKLPRKSQKPDPDSSKG----QISSPTTAS-------------------KRASS  37

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FP  ++AG   I P L FKDV + E+  L V KLNLC  V+DF DP  +  EKDLKR 
Sbjct  38   AVFPTCLIAG---IEPLLAFKDVPSSERMNLFVGKLNLCSVVFDFTDPSTDVQEKDLKRA  94

Query  449  VLLELNDFVASGSVKCTESAIAAVC  523
             LLEL DFV+    K  E+AI A C
Sbjct  95   TLLELLDFVSRNPPKFPENAILAAC  119



>gb|EPS70113.1| hypothetical protein M569_04647, partial [Genlisea aurea]
Length=465

 Score = 90.5 bits (223),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 57/151 (38%), Positives = 79/151 (52%), Gaps = 28/151 (19%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            M KQ L K+P+K           A P+S   P +S            + NR+N     +S
Sbjct  1    MWKQFLGKLPKKPQ--------KADPDSARTPLSSP-----------VSNRINATAAAAS  41

Query  269  A------IFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAE  430
                   +FP S++AG   I P + F++V + EK  L VSKLNLCC V+DF D  KN  E
Sbjct  42   KRASSSAVFPTSLIAG---IEPLVSFREVPSSEKMNLFVSKLNLCCVVFDFTDSSKNIQE  98

Query  431  KDLKRQVLLELNDFVASGSVKCTESAIAAVC  523
            KDLKR  LL+L +FV+    K +E A+++ C
Sbjct  99   KDLKRAALLDLLEFVSQNPSKFSEDAVSSTC  129



>ref|XP_004976008.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like [Setaria italica]
Length=513

 Score = 90.9 bits (224),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 84/155 (54%), Gaps = 17/155 (11%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKR---  259
            M+K IL ++PRK  K+     + A        T++GNGM+ +NS +V  +     KR   
Sbjct  1    MIKNILGRLPRKPGKAGDSRDAAAA-------TSAGNGMEPSNSYSVARSMDPANKRAGN  53

Query  260  ----VSSAIFPASIVAGG---ESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDK  418
                V   + P  ++ G     S  P   FKDV+  EKQ L V K+NLCC+VYDF DP K
Sbjct  54   GDYAVPPGVAPNPVMNGAVVYHSNEPLPAFKDVAASEKQNLFVKKVNLCCAVYDFTDPTK  113

Query  419  NAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVC  523
            N  EK++KRQ L+EL D+V S + K +E  +  + 
Sbjct  114  NLKEKEVKRQTLMELVDYVTSANGKFSEVVMQEIT  148



>ref|XP_004501280.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X1 [Cicer arietinum]
 ref|XP_004501281.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X2 [Cicer arietinum]
Length=498

 Score = 90.5 bits (223),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 63/91 (69%), Gaps = 4/91 (4%)
 Frame = +2

Query  254  KRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEK  433
            K  S+A+FPAS V+  E + P   FKDV + EK  L VSKL+LCC  +DF DP KN  EK
Sbjct  55   KNSSAAVFPASTVSLIEPLVP---FKDVPSSEKMNLFVSKLSLCCVSFDFTDPGKNVVEK  111

Query  434  DLKRQVLLELNDFVAS-GSVKCTESAIAAVC  523
            D+KR+ L+EL DFV++ GS + +E AI A+C
Sbjct  112  DVKRRTLVELVDFVSTFGSSRFSEPAILAMC  142



>ref|XP_011021363.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
 ref|XP_011021364.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
 ref|XP_011021365.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
 ref|XP_011021366.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
 ref|XP_011021367.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
Length=547

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 60/170 (35%), Positives = 85/170 (50%), Gaps = 25/170 (15%)
 Frame = +2

Query  71   HWSFATMLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNV  250
            ++ F  M+KQIL ++P+K  KS      G    +   P+N+ +  + T+  +   NRL  
Sbjct  16   YFFFLVMIKQILGRLPKKPSKSSENREFGGPAIA---PSNTSSASKSTS--DFQSNRLGT  70

Query  251  VKRVSSAIFPASIVAG----------------GESISPHL----CFKDVSNGEKQGLLVS  370
            +   S     ++   G                G S+ P       F+DV N EKQ L + 
Sbjct  71   LNNSSPPGLDSAPHLGFSHGMKPTQVGNPKLNGSSVPPPYEALPTFRDVPNSEKQNLFIR  130

Query  371  KLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAV  520
            KLNLCC V+DF DP KN  EKD+KRQ LLEL D+V S + K TE+ +  V
Sbjct  131  KLNLCCVVFDFADPTKNLKEKDIKRQTLLELVDYVTSANGKFTETVMQEV  180



>gb|KHN10390.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform [Glycine soja]
Length=430

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 58/79 (73%), Gaps = 3/79 (4%)
 Frame = +2

Query  287  IVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELN  466
            +V+G E + P   FKDV N EK  L VSKL+LCC  +DF DP K++A+KD+KR+ L+EL 
Sbjct  1    MVSGIEPLVP---FKDVPNAEKMNLFVSKLSLCCVTFDFTDPSKSSADKDVKRKTLVELV  57

Query  467  DFVASGSVKCTESAIAAVC  523
            DFVA G+++ +E AI A+C
Sbjct  58   DFVACGTMRFSEPAILAIC  76



>ref|XP_011042316.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
 ref|XP_011042318.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
 ref|XP_011042319.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
 ref|XP_011042320.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
 ref|XP_011042321.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
Length=547

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 60/170 (35%), Positives = 85/170 (50%), Gaps = 25/170 (15%)
 Frame = +2

Query  71   HWSFATMLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNV  250
            ++ F  M+KQIL ++P+K  KS      G    +   P+N+ +  + T+  +   NRL  
Sbjct  16   YFFFLVMIKQILGRLPKKPSKSSENREFGGPAIA---PSNTSSASKSTS--DFQSNRLGT  70

Query  251  VKRVSSAIFPASIVAG----------------GESISPHL----CFKDVSNGEKQGLLVS  370
            +   S     ++   G                G S+ P       F+DV N EKQ L + 
Sbjct  71   LNNSSPPGLDSAPHLGFSHGMKPTQVGNPKLNGSSVPPPYEALPTFRDVPNSEKQNLFIR  130

Query  371  KLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAV  520
            KLNLCC V+DF DP KN  EKD+KRQ LLEL D+V S + K TE+ +  V
Sbjct  131  KLNLCCVVFDFADPTKNLKEKDIKRQTLLELVDYVTSANGKFTETVMQEV  180



>ref|XP_008669249.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Zea mays]
 tpg|DAA37270.1| TPA: hypothetical protein ZEAMMB73_719926 [Zea mays]
Length=510

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 55/158 (35%), Positives = 79/158 (50%), Gaps = 26/158 (16%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNS---GNGMQFTNSCNVIVNRLNVVKR  259
            M+KQIL ++PR             +P    D   +   GNG + +NS +V+       KR
Sbjct  1    MIKQILGRLPR-------------KPGKAGDSREAAAAGNGTEPSNSYSVVRGMDPGNKR  47

Query  260  VSSAIFPAS-------IVAGG---ESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGD  409
              +  +P         ++ G     S  P   FKDV   EKQ L V K+NLCC+VYDF D
Sbjct  48   AGNGDYPVPSGLTSNPVMNGAVVYHSSEPLPAFKDVPASEKQNLFVKKVNLCCAVYDFAD  107

Query  410  PDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVC  523
            P KN  EK++KRQ L+EL D++ S + K +E  +  + 
Sbjct  108  PTKNLKEKEVKRQTLMELVDYITSANGKFSEVVMLEIT  145



>ref|NP_001183245.1| hypothetical protein [Zea mays]
 gb|ACR36180.1| unknown [Zea mays]
 gb|AFW58631.1| hypothetical protein ZEAMMB73_760675 [Zea mays]
Length=510

 Score = 87.8 bits (216),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 58/158 (37%), Positives = 81/158 (51%), Gaps = 26/158 (16%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNS---GNGMQFTNSCNVIVNRLNVVKR  259
            M+KQIL ++PR             +P    D   +   GNG + +NS +V  +     KR
Sbjct  1    MIKQILGRLPR-------------KPGKAGDSREAAAAGNGTEPSNSYSVARSMDPGNKR  47

Query  260  -------VSSAIFPASIVAGG---ESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGD  409
                   V S + P  ++ G     S  P   FKDV   EKQ L V K++LCC+VYDF D
Sbjct  48   AGNGDYPVPSGVIPNPVMNGAVVYHSNEPLPAFKDVPMSEKQNLFVKKVSLCCAVYDFVD  107

Query  410  PDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVC  523
            P KN  EK++KRQ L+EL D+VAS + K +E  +  + 
Sbjct  108  PTKNLKEKEVKRQTLMELVDYVASANGKFSEVVMLEIT  145



>ref|XP_003522642.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Glycine max]
Length=496

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 59/85 (69%), Gaps = 4/85 (5%)
 Frame = +2

Query  272  IFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQV  451
            +FPAS V+  E + P   FKDV + EK  L VSKL+LCC  +DF DP KN  EK++KR+ 
Sbjct  59   VFPASTVSLIEPLVP---FKDVPSSEKMNLFVSKLSLCCVTFDFTDPGKNTVEKEVKRRT  115

Query  452  LLELNDFVAS-GSVKCTESAIAAVC  523
            L+EL DFV+S GS + +E AI AVC
Sbjct  116  LVELVDFVSSCGSSRFSEPAILAVC  140



>gb|KJB11611.1| hypothetical protein B456_001G268200 [Gossypium raimondii]
Length=419

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 80/147 (54%), Gaps = 11/147 (7%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssG-AQPNSCNDPTNSGNGMQ--------FTNSCNVIVNR  241
            M+KQI  ++PRK  KS      G    +S N  T+S N            +++ N+ +N+
Sbjct  2    MIKQIFNRLPRKQSKSSDNREGGGTSASSSNAYTSSRNNANSGGPASSGVSSTPNLGLNQ  61

Query  242  LNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKN  421
             N V +V +      + A      P   FKD+ N EKQ L + KLNLCC V+DF DP KN
Sbjct  62   GNKVSQVVNTKLNGDVFASSFVTLP--SFKDIPNSEKQNLFIRKLNLCCVVFDFSDPTKN  119

Query  422  AAEKDLKRQVLLELNDFVASGSVKCTE  502
              EKD+KRQ LLEL D+V+S + K +E
Sbjct  120  LKEKDIKRQTLLELVDYVSSANGKFSE  146



>ref|XP_003526435.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Glycine max]
Length=497

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 58/85 (68%), Gaps = 4/85 (5%)
 Frame = +2

Query  272  IFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQV  451
            +FPAS V+  E + P   FKDV + EK  L VSKL+LCC  +DF DP KN  EK++KR+ 
Sbjct  60   VFPASTVSLIEPLVP---FKDVPSSEKMNLFVSKLSLCCVTFDFTDPGKNTVEKEVKRRT  116

Query  452  LLELNDFVAS-GSVKCTESAIAAVC  523
            L+EL DFV+S GS +  E AI AVC
Sbjct  117  LVELVDFVSSCGSSRFGEPAILAVC  141



>ref|NP_001053130.1| Os04g0485100 [Oryza sativa Japonica Group]
 emb|CAE03154.2| OSJNBa0081L15.16 [Oryza sativa Japonica Group]
 emb|CAD41393.2| OJ000223_09.6 [Oryza sativa Japonica Group]
 dbj|BAF15044.1| Os04g0485100 [Oryza sativa Japonica Group]
 gb|EAY94598.1| hypothetical protein OsI_16375 [Oryza sativa Indica Group]
 gb|EAZ31144.1| hypothetical protein OsJ_15242 [Oryza sativa Japonica Group]
 dbj|BAG95856.1| unnamed protein product [Oryza sativa Japonica Group]
Length=509

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 81/148 (55%), Gaps = 7/148 (5%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            M+KQIL ++PRK  K+       A PN  N+P+NS +  +     N      + V  V +
Sbjct  1    MIKQILGRLPRKPGKAGDSRD-AAGPNG-NEPSNSYSVARSVEQGNKRSGNGDYV--VPA  56

Query  269  AIFPASIVAGG---ESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDL  439
             + P  ++ G     S  P   FKDV   EKQ L V K+NLCC+VYDF DP KN  EK+ 
Sbjct  57   GLTPNPMMNGTVVYHSNEPLPAFKDVPASEKQNLFVKKVNLCCAVYDFADPTKNLKEKET  116

Query  440  KRQVLLELNDFVASGSVKCTESAIAAVC  523
            KRQ L+EL D+V S + K +E  ++ + 
Sbjct  117  KRQTLMELVDYVTSANGKFSEVVMSEIT  144



>gb|KJB11609.1| hypothetical protein B456_001G268200 [Gossypium raimondii]
 gb|KJB11610.1| hypothetical protein B456_001G268200 [Gossypium raimondii]
Length=516

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 80/147 (54%), Gaps = 11/147 (7%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssG-AQPNSCNDPTNSGNGMQ--------FTNSCNVIVNR  241
            M+KQI  ++PRK  KS      G    +S N  T+S N            +++ N+ +N+
Sbjct  2    MIKQIFNRLPRKQSKSSDNREGGGTSASSSNAYTSSRNNANSGGPASSGVSSTPNLGLNQ  61

Query  242  LNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKN  421
             N V +V +      + A      P   FKD+ N EKQ L + KLNLCC V+DF DP KN
Sbjct  62   GNKVSQVVNTKLNGDVFASSFVTLP--SFKDIPNSEKQNLFIRKLNLCCVVFDFSDPTKN  119

Query  422  AAEKDLKRQVLLELNDFVASGSVKCTE  502
              EKD+KRQ LLEL D+V+S + K +E
Sbjct  120  LKEKDIKRQTLLELVDYVSSANGKFSE  146



>ref|XP_007031732.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' eta isoform 1 [Theobroma cacao]
 ref|XP_007031733.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' eta isoform 1 [Theobroma cacao]
 gb|EOY02658.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' eta isoform 1 [Theobroma cacao]
 gb|EOY02659.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' eta isoform 1 [Theobroma cacao]
Length=525

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 44/98 (45%), Positives = 63/98 (64%), Gaps = 3/98 (3%)
 Frame = +2

Query  209  FTNSCNVIVNRLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCC  388
            F ++ N+ +N  N + +V +A    ++ A  E++     F+D+ N EKQ L + KLNLCC
Sbjct  58   FNSTPNIGLNPGNKISQVVNAKLNGNMFASFEALPS---FRDIPNSEKQNLFIRKLNLCC  114

Query  389  SVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTE  502
             V+DF DP KN  EKD+KRQ LLEL D+V+S S K +E
Sbjct  115  IVFDFTDPTKNFKEKDIKRQTLLELVDYVSSASGKFSE  152



>ref|XP_002314559.1| serine/threonine protein phosphatase 2A regulatory subunit B' 
[Populus trichocarpa]
 gb|EEF00730.1| serine/threonine protein phosphatase 2A regulatory subunit B' 
[Populus trichocarpa]
Length=526

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 58/164 (35%), Positives = 82/164 (50%), Gaps = 25/164 (15%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            M+KQIL ++P+K  KS      G    +   P+N+ +  + T+  +   NRL  +   S 
Sbjct  1    MIKQILGRLPKKPSKSSENREFGGPSIA---PSNTSSASKSTS--DFQSNRLGTLNNSSP  55

Query  269  AIFPASIVAG----------------GESISPHL----CFKDVSNGEKQGLLVSKLNLCC  388
                ++   G                G S+ P       F+DV N EKQ L + KLNLCC
Sbjct  56   PGLDSAPHLGFSHGMKPTQAGNPKLNGSSVPPPYEALPTFRDVPNSEKQNLFIRKLNLCC  115

Query  389  SVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAV  520
             V+DF DP KN  EKD+KRQ LLEL D++ S + K TE+ +  V
Sbjct  116  VVFDFADPTKNLKEKDIKRQTLLELVDYITSANGKFTETVMQEV  159



>emb|CDP16651.1| unnamed protein product [Coffea canephora]
Length=521

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 84/157 (54%), Gaps = 14/157 (9%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCN--------DPTNSGNGMQFTNSCNVIVNR-  241
            M+KQIL ++PRK  KS      G    S N        D +NS +G     S  V  N  
Sbjct  1    MIKQILNRLPRKPSKSAEGRDGGPPTFSSNASTSSRNNDLSNSRSGNSNATSLAVASNPG  60

Query  242  LNVVKRVSSAIFPASIVAGGESISPHLC---FKDVSNGEKQGLLVSKLNLCCSVYDFGDP  412
            LN   ++  A+     V G  ++SP+     F+DV N EKQ L + KLNLC  V+DF DP
Sbjct  61   LNHGNKLPQAL--NMKVNGNLAVSPYEALPSFRDVPNSEKQNLFIKKLNLCSVVFDFTDP  118

Query  413  DKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVC  523
             KN  EKD+KRQ L+EL D+V+S + K TE+ +  + 
Sbjct  119  TKNLKEKDIKRQTLVELVDYVSSANGKFTETVMQEII  155



>emb|CDY38628.1| BnaA05g19590D [Brassica napus]
Length=509

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 80/146 (55%), Gaps = 8/146 (5%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssG-AQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVS  265
            M+KQI  K+PRK  KS + DS+G    NS   P  S +  +  N         N  K + 
Sbjct  1    MIKQIFGKLPRKPSKSLNNDSNGEGAVNSYYAPNPSASASRLPNGTIAP----NSNKNIQ  56

Query  266  SAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKR  445
            +  FP S VA  E++     F+DV   EK  L + KL +CC V+DF DP KN  EK++KR
Sbjct  57   AGPFPPSGVAVYEALP---SFRDVPISEKPNLFLQKLTMCCVVFDFRDPSKNLKEKEIKR  113

Query  446  QVLLELNDFVASGSVKCTESAIAAVC  523
            Q LLEL D+VAS  VK  E+AI  + 
Sbjct  114  QTLLELVDYVASVGVKFNEAAIQELT  139



>ref|XP_004169443.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like [Cucumis sativus]
Length=524

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 60/158 (38%), Positives = 83/158 (53%), Gaps = 15/158 (9%)
 Frame = +2

Query  89   MLKQILAKIPRk------------slksdsldssGAQPN--SCNDPTNSGNGMQFTNSCN  226
            M+KQIL ++PRK            +  S S  S+  + N  + N  TN+G G  F+   +
Sbjct  1    MIKQILNRLPRKPSKSTEHREGAGTTISSSNASTSLRSNDLAANHHTNTGTG-SFSGPNS  59

Query  227  VIVNRLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFG  406
             +   LN   + S  +   S      S      FKDV N EKQ L + KLN+CC V+DF 
Sbjct  60   TLSVGLNHGSKPSQGLNSKSNGNSQVSYEALPGFKDVPNSEKQSLFIKKLNMCCVVFDFT  119

Query  407  DPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAV  520
            DP KN  EKD+KRQ L+EL D+VAS + K +E+ I  +
Sbjct  120  DPSKNLKEKDIKRQTLIELVDYVASANGKLSENVIQEI  157



>ref|XP_008797311.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Phoenix dactylifera]
Length=522

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 84/155 (54%), Gaps = 17/155 (11%)
 Frame = +2

Query  89   MLKQILAKIPRkslksd--sldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNR-------  241
            M+KQIL ++PRK  KS      S G+ P+  N  T+S +G    +S   + ++       
Sbjct  1    MIKQILGRLPRKPSKSADNRDSSGGSTPSLPNASTSSRSGDLLNSSVTDLNSQVLPGLNP  60

Query  242  -LNVVKRVSSAIFPASIVAGGESISPHL----CFKDVSNGEKQGLLVSKLNLCCSVYDFG  406
             LN   R   A+   S+   G  +SP       F+DV + EKQ L + KLNLCC V+DF 
Sbjct  61   GLNHGSRYPPAV---SLRLNGNLVSPPYEALPSFRDVPSSEKQNLFIKKLNLCCVVFDFT  117

Query  407  DPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAI  511
            DP KN  EKD+KRQ LLEL D+V S + K  E+ I
Sbjct  118  DPTKNLREKDIKRQTLLELVDYVTSANGKFPENVI  152



>ref|XP_007031734.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' eta isoform 3, partial [Theobroma cacao]
 gb|EOY02660.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' eta isoform 3, partial [Theobroma cacao]
Length=415

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 65/105 (62%), Gaps = 3/105 (3%)
 Frame = +2

Query  209  FTNSCNVIVNRLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCC  388
            F ++ N+ +N  N + +V +A    ++ A  E++     F+D+ N EKQ L + KLNLCC
Sbjct  58   FNSTPNIGLNPGNKISQVVNAKLNGNMFASFEALP---SFRDIPNSEKQNLFIRKLNLCC  114

Query  389  SVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVC  523
             V+DF DP KN  EKD+KRQ LLEL D+V+S S K +E  +  + 
Sbjct  115  IVFDFTDPTKNFKEKDIKRQTLLELVDYVSSASGKFSEIVMQEIV  159



>ref|XP_006447169.1| hypothetical protein CICLE_v10014898mg [Citrus clementina]
 ref|XP_006447170.1| hypothetical protein CICLE_v10014898mg [Citrus clementina]
 ref|XP_006469971.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like isoform X1 [Citrus sinensis]
 gb|ESR60409.1| hypothetical protein CICLE_v10014898mg [Citrus clementina]
 gb|ESR60410.1| hypothetical protein CICLE_v10014898mg [Citrus clementina]
Length=524

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 60/155 (39%), Positives = 77/155 (50%), Gaps = 21/155 (14%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQP-----------------NSCNDPTNSGNGMQFTN  217
            M+KQIL K PRK  KS      G                    N   +P+N  N     +
Sbjct  1    MIKQILNKFPRKPSKSSDYREGGGTSTSSSHASANSRNSDLAGNRYANPSNVSNS-AINS  59

Query  218  SCNVIVNRLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVY  397
              NV VN  N   +  ++    + +A  E++     FKDV N EKQ L V KLNLCC V+
Sbjct  60   VANVGVNHGNKFPQAVNSKLNGNPLAYYEALPS---FKDVPNAEKQNLFVRKLNLCCVVF  116

Query  398  DFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTE  502
            DF DP KN  EKD+KRQ L+EL D+V+S + K  E
Sbjct  117  DFTDPTKNLKEKDIKRQTLVELVDYVSSANGKFQE  151



>emb|CAC09487.2| H0811E11.3 [Oryza sativa Indica Group]
 emb|CAH67484.1| H0805A05.14 [Oryza sativa Indica Group]
Length=509

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 80/148 (54%), Gaps = 7/148 (5%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            M+KQIL ++PRK  K+       A PN  N+P+NS +  +     N      + V  V +
Sbjct  1    MIKQILGRLPRKPGKAGDSRD-AAGPNG-NEPSNSYSVARSVEQGNKRSGNGDYV--VPA  56

Query  269  AIFPASIVAGG---ESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDL  439
             + P  ++ G     S  P   FKDV   EKQ L V K+NLCC VYDF DP KN  EK+ 
Sbjct  57   GLTPNPMMNGTVVYHSNEPLPAFKDVPASEKQNLFVKKVNLCCVVYDFADPTKNLKEKET  116

Query  440  KRQVLLELNDFVASGSVKCTESAIAAVC  523
            KRQ L+EL D+V S + K +E  ++ + 
Sbjct  117  KRQTLMELVDYVTSANGKFSEVVMSEIT  144



>ref|XP_010551033.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' zeta isoform-like [Tarenaya hassleriana]
 ref|XP_010551034.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' zeta isoform-like [Tarenaya hassleriana]
Length=525

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 61/151 (40%), Positives = 85/151 (56%), Gaps = 13/151 (9%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssG----AQPNSCNDPTNSGNGM---QFTNSCNVIVNRLN  247
            M+KQI  K+PRK  KS   DS+G    +  NS   P+ SGNG    +  NS   I  +  
Sbjct  1    MIKQIFGKLPRKPSKSLPSDSNGEGGISSLNSYYSPS-SGNGTLSPRSLNSNRTIQGKKP  59

Query  248  VVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAA  427
            +   + +  FP S+V   E++     F+DV   EK  L + KL++CC V+DF DP KN  
Sbjct  60   LGDSLQADPFPPSVVY--EALPG---FRDVPVSEKPNLFIRKLHMCCVVFDFSDPSKNLK  114

Query  428  EKDLKRQVLLELNDFVASGSVKCTESAIAAV  520
            EK++KRQ LLEL D++AS  VK  E A+  +
Sbjct  115  EKEIKRQTLLELVDYIASVPVKFNEMAMQEI  145



>ref|XP_006830091.1| hypothetical protein AMTR_s00123p00060730 [Amborella trichopoda]
 gb|ERM97507.1| hypothetical protein AMTR_s00123p00060730 [Amborella trichopoda]
Length=550

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 63/168 (38%), Positives = 85/168 (51%), Gaps = 31/168 (18%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPN---------SCNDPTNS--GNGMQF--------  211
            M+KQIL ++PRK  KS   + +G  P          S ++P+N+  GNG  F        
Sbjct  1    MIKQILGRLPRKPSKSSENNEAGGNPATNASPAAMASPSNPSNNLRGNGGNFRASNVTTA  60

Query  212  ---TNSCNVIVNRLNVVKRVSSAIFPASIVA--------GGESISPHLCFKDVSNGEKQG  358
               +N+   + N L    R +    P SIV         G  +      F+DV + EKQ 
Sbjct  61   SRGSNAGPTLSNSL-AGSRSNHGKKPNSIVPNANNNTTFGSSAYEALPGFRDVPSSEKQN  119

Query  359  LLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTE  502
            L + KLN+C  V+DF DP KNA EKD+KRQ LLEL D+V S S + TE
Sbjct  120  LFIRKLNMCYVVFDFSDPAKNAKEKDVKRQTLLELVDYVTSASGRFTE  167



>ref|XP_008441374.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Cucumis melo]
 gb|ADN34067.1| protein phosphatase 2a [Cucumis melo subsp. melo]
Length=524

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 59/158 (37%), Positives = 83/158 (53%), Gaps = 15/158 (9%)
 Frame = +2

Query  89   MLKQILAKIPRk-slksdsldssGAQPNSCNDPT-------------NSGNGMQFTNSCN  226
            M+KQIL ++PRK S  ++  + +G   +S N  T             N+G G  F+   +
Sbjct  1    MIKQILNRLPRKPSKSTEHREGAGTTISSSNASTSLRSNDLAANHHANTGTG-SFSGPNS  59

Query  227  VIVNRLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFG  406
             +   LN   + S  +   S      S      FKDV N EKQ L + KLN+CC V+DF 
Sbjct  60   TLSVGLNHGSKPSQGLNSKSNGNSQVSYEALPGFKDVPNSEKQSLFIKKLNMCCVVFDFT  119

Query  407  DPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAV  520
            DP KN  EKD+KRQ L+EL D+VAS + K +E+ I  +
Sbjct  120  DPSKNLKEKDIKRQTLIELVDYVASANGKLSENVIQEI  157



>gb|KGN45729.1| hypothetical protein Csa_6G008600 [Cucumis sativus]
Length=524

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 59/158 (37%), Positives = 83/158 (53%), Gaps = 15/158 (9%)
 Frame = +2

Query  89   MLKQILAKIPRk-slksdsldssGAQPNSCNDPT-------------NSGNGMQFTNSCN  226
            M+KQIL ++PRK S  ++  + +G   +S N  T             N+G G  F+   +
Sbjct  1    MIKQILNRLPRKPSKSTEHREGAGTTISSSNASTSLRSNDLAANHHANTGTG-SFSGPNS  59

Query  227  VIVNRLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFG  406
             +   LN   + S  +   S      S      FKDV N EKQ L + KLN+CC V+DF 
Sbjct  60   TLSVGLNHGSKPSQGLNSKSNGNSQVSYEALPGFKDVPNSEKQSLFIKKLNMCCVVFDFT  119

Query  407  DPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAV  520
            DP KN  EKD+KRQ L+EL D+VAS + K +E+ I  +
Sbjct  120  DPSKNLKEKDIKRQTLIELVDYVASANGKLSENVIQEI  157



>ref|XP_004138464.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine protein phosphatase 
2A 59 kDa regulatory subunit B' eta isoform-like [Cucumis 
sativus]
Length=524

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 59/158 (37%), Positives = 83/158 (53%), Gaps = 15/158 (9%)
 Frame = +2

Query  89   MLKQILAKIPRk-slksdsldssGAQPNSCNDPT-------------NSGNGMQFTNSCN  226
            M+KQIL ++PRK S  ++  + +G   +S N  T             N+G G  F+   +
Sbjct  1    MIKQILNRLPRKPSKSTEHREGAGTTISSSNASTSLRSNDLAANHHANTGTG-SFSGPNS  59

Query  227  VIVNRLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFG  406
             +   LN   + S  +   S      S      FKDV N EKQ L + KLN+CC V+DF 
Sbjct  60   TLSVGLNHGSKPSQGLNSKSNGNSQVSYEALPGFKDVPNSEKQSLFIKKLNMCCVVFDFT  119

Query  407  DPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAV  520
            DP KN  EKD+KRQ L+EL D+VAS + K +E+ I  +
Sbjct  120  DPSKNLKEKDIKRQTLIELVDYVASANGKLSENVIQEI  157



>ref|XP_002311732.2| hypothetical protein POPTR_0008s18020g, partial [Populus trichocarpa]
 gb|EEE89099.2| hypothetical protein POPTR_0008s18020g, partial [Populus trichocarpa]
Length=407

 Score = 84.3 bits (207),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +2

Query  326  FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTES  505
            F+DV N EKQ L + KLNLCC V+DF DP KN  EKD+KRQ LLEL D+V S + K TE+
Sbjct  95   FRDVPNSEKQNLFIRKLNLCCVVFDFTDPTKNLKEKDIKRQTLLELVDYVTSANGKFTET  154

Query  506  AIAAVC  523
             +  V 
Sbjct  155  VMQEVI  160



>emb|CBI27539.3| unnamed protein product [Vitis vinifera]
Length=451

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 74/140 (53%), Gaps = 16/140 (11%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNS-GNGMQFTNSCNVIVNRLNVVKRVS  265
            M+KQI +K+PRK  K+      G      N+   S G+ ++     N+ VN   +     
Sbjct  1    MIKQIFSKLPRKLSKAVENRELGGTTAFSNNSNRSRGSDVESNQFANLNVNGNYMTPNTY  60

Query  266  SAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKR  445
             A+ PA              F+DV + EKQ L + KLNLCC V+DF DP KN  EK++KR
Sbjct  61   EAL-PA--------------FRDVPSSEKQNLFIGKLNLCCVVFDFTDPTKNIKEKEIKR  105

Query  446  QVLLELNDFVASGSVKCTES  505
            Q LLEL D+V S S K TE+
Sbjct  106  QTLLELVDYVTSASGKFTET  125



>ref|XP_009371715.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Pyrus x bretschneideri]
 ref|XP_009371716.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Pyrus x bretschneideri]
Length=514

 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 78/148 (53%), Gaps = 3/148 (2%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            M+KQIL ++PRK   S+  +   +  NS    ++ GN +      +      +     + 
Sbjct  1    MIKQILNRLPRKPKSSEHREGGSSNTNSNASASSRGNSISSNKYASSSTTFSSATSTPNF  60

Query  269  AIFPASIVAGGESISPHLC---FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDL  439
             +   S + G    SP+     FKDV N EKQ LL+ KLNLCC V+DF DP KN  EK++
Sbjct  61   GVNVNSKLNGNSLASPYEALPSFKDVPNAEKQNLLIKKLNLCCVVFDFSDPTKNIKEKEI  120

Query  440  KRQVLLELNDFVASGSVKCTESAIAAVC  523
            KRQ L+EL D++AS + K  E  +  + 
Sbjct  121  KRQTLVELVDYIASANGKFPEIVVQEIV  148



>ref|XP_009370310.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Pyrus x bretschneideri]
Length=514

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 78/148 (53%), Gaps = 3/148 (2%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            M+KQIL ++PRK   S+  +   +  NS    ++ GN +      +      +     + 
Sbjct  1    MIKQILNRLPRKPKSSEHREGGSSNTNSNASASSRGNSISSNKYASSSTTFSSATSTPNF  60

Query  269  AIFPASIVAGGESISPHLC---FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDL  439
             +   S + G    SP+     FKDV N EKQ LL+ KLNLCC V+DF DP KN  EK++
Sbjct  61   GVNVNSKLNGNSLASPYEALPSFKDVPNAEKQNLLIKKLNLCCVVFDFSDPTKNIKEKEI  120

Query  440  KRQVLLELNDFVASGSVKCTESAIAAVC  523
            KRQ L+EL D++AS + K  E  +  + 
Sbjct  121  KRQTLVELVDYIASANGKFPEIVVQEIV  148



>ref|XP_010244149.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' gamma isoform-like [Nelumbo nucifera]
Length=554

 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 68/123 (55%), Gaps = 2/123 (2%)
 Frame = +2

Query  155  GAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSSAIFPASIVAGGESISPHLCFKD  334
            G  PNS +  + + NG    +S  V  N+ N  K+  SA      V    +      F+D
Sbjct  58   GKAPNSGSGASRTNNGASAPHSSGV--NKSNQGKKSGSATSQVGPVLASTAYEALPSFRD  115

Query  335  VSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIA  514
            V + EKQ L + KLN+CC+++DF DP KN  EKD+KRQ LLEL D++AS + K  E ++ 
Sbjct  116  VPSSEKQNLFIRKLNMCCTLFDFTDPSKNLKEKDIKRQTLLELVDYIASVTSKFNEISMQ  175

Query  515  AVC  523
             + 
Sbjct  176  EIT  178



>ref|XP_010660818.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform isoform X2 [Vitis vinifera]
Length=419

 Score = 84.0 bits (206),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 56/144 (39%), Positives = 78/144 (54%), Gaps = 19/144 (13%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            M+K IL ++PRK  KS      GA P S + P N GN +    + N+ +N          
Sbjct  1    MIKNILNRLPRKPSKSAENRDGGANPTSNSGP-NYGNKI--PQAVNMKLNG---------  48

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
                 S  A  E++     F+DV N EKQ L + KL+LCC V+DF DP KN  EK++KRQ
Sbjct  49   ----NSAAASYEALP---SFRDVPNSEKQTLFIRKLSLCCVVFDFTDPTKNLKEKEIKRQ  101

Query  449  VLLELNDFVASGSVKCTESAIAAV  520
             L+EL D+V S + K TE+ +  +
Sbjct  102  TLVELVDYVTSANGKFTENVMQEI  125



>ref|XP_002266932.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform [Vitis vinifera]
Length=515

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 82/160 (51%), Gaps = 24/160 (15%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNS-GNGMQFTNSCNVIVNRLNVVKRVS  265
            M+KQI +K+PRK  K+      G      N+   S G+ ++     N     LNV    +
Sbjct  1    MIKQIFSKLPRKLSKAVENRELGGTTAFSNNSNRSRGSDVESNQFAN-----LNVTSLAA  55

Query  266  SAIFP-------ASIVAGGES------ISPHL-----CFKDVSNGEKQGLLVSKLNLCCS  391
            S   P       + I  GG S      ++P+       F+DV + EKQ L + KLNLCC 
Sbjct  56   SNSTPITGNNLGSKIPQGGNSKVNGNYMTPNTYEALPAFRDVPSSEKQNLFIGKLNLCCV  115

Query  392  VYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAI  511
            V+DF DP KN  EK++KRQ LLEL D+V S S K TE+ +
Sbjct  116  VFDFTDPTKNIKEKEIKRQTLLELVDYVTSASGKFTETVM  155



>ref|XP_009145466.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' zeta isoform [Brassica rapa]
Length=509

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 79/146 (54%), Gaps = 8/146 (5%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssG-AQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVS  265
            M+KQI  K+PRK  KS + DS+G    NS   P  S +  +  N         N  K + 
Sbjct  1    MIKQIFGKLPRKPSKSLNNDSNGEGAVNSYYAPNPSASASRLPNGTLAP----NSNKNIQ  56

Query  266  SAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKR  445
            +  FP S V   E++     F+DV   EK  L + KL +CC V+DF DP KN  EK++KR
Sbjct  57   AGPFPPSGVVVYEALP---SFRDVPISEKPNLFLQKLTMCCVVFDFRDPSKNLKEKEIKR  113

Query  446  QVLLELNDFVASGSVKCTESAIAAVC  523
            Q LLEL D+VAS  VK  E+AI  + 
Sbjct  114  QTLLELVDYVASVGVKFNEAAIQELT  139



>ref|NP_172803.1| protein phosphatase 2A B'theta [Arabidopsis thaliana]
 ref|NP_973816.1| protein phosphatase 2A B'theta [Arabidopsis thaliana]
 sp|Q8LF36.2|2A5T_ARATH RecName: Full=Serine/threonine protein phosphatase 2A 57 kDa 
regulatory subunit B' theta isoform; Short=AtB' theta; Short=PP2A, 
B' subunit, theta isoform [Arabidopsis thaliana]
 gb|AAG09562.1|AC011810_21 Putative protein phosphatase 2A regulatory subunit B [Arabidopsis 
thaliana]
 gb|ABH04491.1| At1g13460 [Arabidopsis thaliana]
 gb|AEE29021.1| protein phosphatase 2A B'theta [Arabidopsis thaliana]
 gb|AEE29022.1| protein phosphatase 2A B'theta [Arabidopsis thaliana]
Length=492

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +2

Query  326  FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTES  505
            FKDV N EKQ L V KL+LCC V+DF DP KN  EKD+KRQ LLEL D+VAS + K +E+
Sbjct  76   FKDVPNAEKQNLFVRKLSLCCVVFDFSDPTKNVKEKDIKRQTLLELVDYVASPNGKFSET  135

Query  506  AIAAVC  523
             I  V 
Sbjct  136  VIQEVV  141



>gb|AAM61625.1| B regulatory subunit of protein phosphatase 2A, putative [Arabidopsis 
thaliana]
Length=492

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +2

Query  326  FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTES  505
            FKDV N EKQ L V KL+LCC V+DF DP KN  EKD+KRQ LLEL D+VAS + K +E+
Sbjct  76   FKDVPNAEKQNLFVRKLSLCCVVFDFSDPTKNVKEKDIKRQTLLELVDYVASPNGKFSET  135

Query  506  AIAAVC  523
             I  V 
Sbjct  136  VIQEVV  141



>gb|KDO52091.1| hypothetical protein CISIN_1g0107851mg, partial [Citrus sinensis]
Length=382

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 77/155 (50%), Gaps = 21/155 (14%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQP-----------------NSCNDPTNSGNGMQFTN  217
            M+KQIL K PRK  KS      G                    N   +P+N  N     +
Sbjct  1    MIKQILNKFPRKPSKSSDYREGGGTSTSSSHASANSRNSDLAGNRYANPSNVSNSA-INS  59

Query  218  SCNVIVNRLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVY  397
              NV VN  N   +  ++    + +A  E++     FKDV N EKQ L V KLNLCC V+
Sbjct  60   VANVGVNHGNKFPQAVNSKLNGNPLAYYEALP---SFKDVPNAEKQNLFVRKLNLCCVVF  116

Query  398  DFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTE  502
            DF DP KN  EKD+KRQ L+EL D+V+S + K  E
Sbjct  117  DFTDPTKNLKEKDIKRQTLVELVDYVSSANGKFPE  151



>ref|XP_011097329.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Sesamum indicum]
Length=524

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 58/159 (36%), Positives = 81/159 (51%), Gaps = 17/159 (11%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGN----GMQFTNSCNVIVNRLNVV-  253
            M+K IL K+PRK  K       G+     N  T S +    G +  NS   I   +N   
Sbjct  1    MIKNILNKLPRKQTKLVDHRDGGSSTYPSNASTTSRSSYAVGSRSGNSNTTIGPGINSTS  60

Query  254  -------KRVSSAIFPASIVAGGESISPHLC---FKDVSNGEKQGLLVSKLNLCCSVYDF  403
                    ++  A+   + V G     P+     F+DV N EKQ L + KL+LCC+V+DF
Sbjct  61   NSGPSYGNKLHDAL--NTKVNGNAGPVPYEALPSFRDVPNAEKQNLFIKKLSLCCAVFDF  118

Query  404  GDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAV  520
             DP KN  EKD+KRQ L+EL D+VAS + K TE+ +  +
Sbjct  119  TDPAKNLKEKDIKRQTLVELVDYVASTNAKFTETVMQEI  157



>ref|XP_011029624.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
Length=526

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 41/78 (53%), Positives = 51/78 (65%), Gaps = 3/78 (4%)
 Frame = +2

Query  296  GGESISPHLC---FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELN  466
            GG   +P+     F+DV N EKQ L + KLNLCC V+DF DP KN  EKD+KRQ LLEL 
Sbjct  82   GGSVSAPYEALPGFRDVPNSEKQNLFIRKLNLCCLVFDFTDPTKNLKEKDIKRQTLLELV  141

Query  467  DFVASGSVKCTESAIAAV  520
            D+V S + K TE+ +  V
Sbjct  142  DYVTSANGKFTETVMQEV  159



>ref|XP_006438131.1| hypothetical protein CICLE_v10031285mg [Citrus clementina]
 ref|XP_006438132.1| hypothetical protein CICLE_v10031285mg [Citrus clementina]
 gb|ESR51371.1| hypothetical protein CICLE_v10031285mg [Citrus clementina]
 gb|ESR51372.1| hypothetical protein CICLE_v10031285mg [Citrus clementina]
Length=508

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 55/79 (70%), Gaps = 3/79 (4%)
 Frame = +2

Query  284  SIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLEL  463
            S+VA  E++     F+DV++ EKQ LL+ KLNLCC ++DF DP KN  EKD+KRQ LLEL
Sbjct  83   SVVAPYEALP---GFRDVASFEKQNLLIRKLNLCCVLFDFTDPTKNLKEKDVKRQTLLEL  139

Query  464  NDFVASGSVKCTESAIAAV  520
             DF+ S + K TE+ +  V
Sbjct  140  VDFITSANGKFTETVMQEV  158



>gb|KDO52090.1| hypothetical protein CISIN_1g0107851mg [Citrus sinensis]
Length=413

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 77/155 (50%), Gaps = 21/155 (14%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQP-----------------NSCNDPTNSGNGMQFTN  217
            M+KQIL K PRK  KS      G                    N   +P+N  N     +
Sbjct  1    MIKQILNKFPRKPSKSSDYREGGGTSTSSSHASANSRNSDLAGNRYANPSNVSNS-AINS  59

Query  218  SCNVIVNRLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVY  397
              NV VN  N   +  ++    + +A  E++     FKDV N EKQ L V KLNLCC V+
Sbjct  60   VANVGVNHGNKFPQAVNSKLNGNPLAYYEALP---SFKDVPNAEKQNLFVRKLNLCCVVF  116

Query  398  DFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTE  502
            DF DP KN  EKD+KRQ L+EL D+V+S + K  E
Sbjct  117  DFTDPTKNLKEKDIKRQTLVELVDYVSSANGKFPE  151



>gb|KDO82045.1| hypothetical protein CISIN_1g010504mg [Citrus sinensis]
 gb|KDO82046.1| hypothetical protein CISIN_1g010504mg [Citrus sinensis]
Length=508

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 55/79 (70%), Gaps = 3/79 (4%)
 Frame = +2

Query  284  SIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLEL  463
            S+VA  E++     F+DV++ EKQ LL+ KLNLCC ++DF DP KN  EKD+KRQ LLEL
Sbjct  83   SVVAPYEALP---GFRDVASFEKQNLLIRKLNLCCVLFDFTDPTKNLKEKDVKRQTLLEL  139

Query  464  NDFVASGSVKCTESAIAAV  520
             DF+ S + K TE+ +  V
Sbjct  140  VDFITSANGKFTETVMQEV  158



>ref|XP_006469972.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like isoform X2 [Citrus sinensis]
Length=501

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 77/155 (50%), Gaps = 21/155 (14%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQP-----------------NSCNDPTNSGNGMQFTN  217
            M+KQIL K PRK  KS      G                    N   +P+N  N     +
Sbjct  1    MIKQILNKFPRKPSKSSDYREGGGTSTSSSHASANSRNSDLAGNRYANPSNVSNSA-INS  59

Query  218  SCNVIVNRLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVY  397
              NV VN  N   +  ++    + +A  E++     FKDV N EKQ L V KLNLCC V+
Sbjct  60   VANVGVNHGNKFPQAVNSKLNGNPLAYYEALP---SFKDVPNAEKQNLFVRKLNLCCVVF  116

Query  398  DFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTE  502
            DF DP KN  EKD+KRQ L+EL D+V+S + K  E
Sbjct  117  DFTDPTKNLKEKDIKRQTLVELVDYVSSANGKFQE  151



>ref|XP_006417120.1| hypothetical protein EUTSA_v10007450mg [Eutrema salsugineum]
 gb|ESQ35473.1| hypothetical protein EUTSA_v10007450mg [Eutrema salsugineum]
Length=497

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +2

Query  326  FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTES  505
            FKDV N EKQ L + KLNLCC V+DF DP KN  EK++KRQ LLEL D+VAS + K +E+
Sbjct  81   FKDVPNAEKQNLFLKKLNLCCVVFDFSDPTKNVKEKEIKRQTLLELVDYVASANGKFSET  140

Query  506  AI  511
             I
Sbjct  141  VI  142



>ref|XP_010089442.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' zeta isoform [Morus notabilis]
 gb|EXB37815.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' zeta isoform [Morus notabilis]
Length=545

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 60/171 (35%), Positives = 90/171 (53%), Gaps = 30/171 (18%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssG--------AQPNSCNDPTNSGNGMQ------------  208
            M+KQIL KIPRK  KS   DS G        +  NS N P NS NG++            
Sbjct  1    MIKQILGKIPRKPSKSTQDDSYGDGGVDNGYSSVNSYNGP-NSSNGLKPSSTQSKSSISG  59

Query  209  --FTNSCNVIV---NRLNVVKRVSSAIFPAS--IVAGGESISPHLCFKDVSNGEKQGLLV  367
               + S N  +   N+ N  K+ ++++      + +GG    P   F+DV + EKQ L +
Sbjct  60   LGISRSSNGTIAGGNKSNQAKKSAASVTQVDPLLASGGYEALP--SFRDVPSSEKQNLFI  117

Query  368  SKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAV  520
             KLN+CC V++F DP  +  +KD+KRQ LLEL D+++S + K  E+ +  +
Sbjct  118  KKLNMCCVVFNFSDPVSDLKKKDIKRQTLLELVDYISSVNSKFNEAVMQEI  168



>gb|KHG26982.1| Serine/threonine phosphatase 2A 59 kDa regulatory subunit B' 
eta-like protein [Gossypium arboreum]
Length=516

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 79/147 (54%), Gaps = 11/147 (7%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssG-AQPNSCNDPTNSGNGMQ--------FTNSCNVIVNR  241
            M+KQI  ++PRK  KS      G    +S N  T+S N            +++ N+ +N+
Sbjct  2    MIKQIFNRLPRKQSKSSDNREGGGTSASSSNAYTSSRNNANSGGPASSGVSSTPNLGLNQ  61

Query  242  LNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKN  421
             N V +V +      ++A      P   FKD+ N EKQ L + KLNLC  V+DF DP KN
Sbjct  62   GNKVSQVVNTKLNGDVLASSFETLP--SFKDIPNSEKQNLFIRKLNLCRVVFDFSDPTKN  119

Query  422  AAEKDLKRQVLLELNDFVASGSVKCTE  502
              EKD+KRQ LLEL D+V+S + K  E
Sbjct  120  LKEKDIKRQTLLELVDYVSSANGKFPE  146



>gb|KJB33914.1| hypothetical protein B456_006G038500 [Gossypium raimondii]
Length=425

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +2

Query  326  FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTES  505
            F+DV N EKQ LL+ KLNLCC V+DF DP KN  EKDLKRQ LLEL D+V+S + K +E 
Sbjct  93   FRDVPNSEKQNLLIRKLNLCCIVFDFTDPTKNLKEKDLKRQTLLELVDYVSSANGKFSEI  152

Query  506  AIAAVC  523
             +  + 
Sbjct  153  VMQEIV  158



>ref|XP_006652431.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like [Oryza brachyantha]
Length=507

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 83/155 (54%), Gaps = 21/155 (14%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            M+KQIL ++PRK  K+       A PN  N+P+NS +  +     N         KR  +
Sbjct  1    MIKQILGRLPRKPGKNGDSRDV-AGPNG-NEPSNSYSVARSVEQGN---------KRSGN  49

Query  269  AIF-----PAS-IVAGG----ESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDK  418
              +     PAS ++  G     S  P   FKDV   EKQ L V K+NLCC+VYDF DP K
Sbjct  50   GEYVVPAGPASNLMMNGSVVYHSNEPLPAFKDVPASEKQNLFVKKVNLCCAVYDFTDPTK  109

Query  419  NAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVC  523
            N  EK+ KRQ L+EL D+V S + K +E+ ++ + 
Sbjct  110  NLKEKETKRQTLMELVDYVTSANGKFSEAVMSEIT  144



>ref|XP_004231808.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform [Solanum lycopersicum]
 ref|XP_010315939.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform [Solanum lycopersicum]
 ref|XP_010315940.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform [Solanum lycopersicum]
 ref|XP_010315941.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform [Solanum lycopersicum]
 ref|XP_010315942.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform [Solanum lycopersicum]
 ref|XP_010315943.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform [Solanum lycopersicum]
Length=523

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 59/159 (37%), Positives = 83/159 (52%), Gaps = 18/159 (11%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNS-GNGMQFTNSCNVIVNRLNVVKRVS  265
            M+KQIL ++PRK  KS      G+  +  N  T S  + +    S N     ++ V   S
Sbjct  1    MIKQILNRLPRKPSKSAENRDGGSSASPSNASTGSRSSDLSTAQSGNSSATTVSGV--TS  58

Query  266  SAIFP---------ASIVAGGESISPHLC-----FKDVSNGEKQGLLVSKLNLCCSVYDF  403
            S + P         A+    G S +  LC     FKDV   EKQ L + KLNLCC ++DF
Sbjct  59   STLGPNHGNRLPQGANAKVNG-SAAVFLCETLPSFKDVPTAEKQNLFIKKLNLCCVLFDF  117

Query  404  GDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAV  520
             DP K+  EKD+KRQ L+EL D+++S + K TE+ I  +
Sbjct  118  TDPTKHLKEKDIKRQTLIELVDYLSSANGKFTETVIQEI  156



>ref|XP_004239176.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Solanum lycopersicum]
Length=502

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +2

Query  326  FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTES  505
            F+DV N EKQ L + KLN+CC ++DF DP KN  EK++KRQ LLEL ++V S +VK TE 
Sbjct  75   FRDVPNAEKQNLFIRKLNMCCVLFDFTDPTKNLKEKEIKRQTLLELVEYVTSANVKFTEV  134

Query  506  AIAAVC  523
             + AV 
Sbjct  135  VMQAVV  140



>ref|XP_002301608.1| serine/threonine protein phosphatase 2A regulatory subunit B' 
[Populus trichocarpa]
 gb|EEE80881.1| serine/threonine protein phosphatase 2A regulatory subunit B' 
[Populus trichocarpa]
Length=514

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 55/158 (35%), Positives = 81/158 (51%), Gaps = 33/158 (21%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            M+KQIL K+PRK           ++P+S ND  N G    +++  +    RLN     + 
Sbjct  1    MIKQILGKLPRK----------PSKPSS-NDSNNDGGLHAYSSGAS----RLN-----NG  40

Query  269  AIFPASIVAGGESISPHL-------------CFKDVSNGEKQGLLVSKLNLCCSVYDFGD  409
            ++ P S    G+  +P L              F+DV N EK  L + KLN+CC V+DF D
Sbjct  41   SLVPNSKGNQGKKSAPQLDPLMTSGVYEALPSFRDVPNSEKHNLFMKKLNMCCVVFDFSD  100

Query  410  PDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVC  523
            P KN  EKD+KRQ L EL D++++ + K  E A+  + 
Sbjct  101  PSKNLKEKDIKRQTLHELLDYISTVTSKFNEIAMQEIT  138



>emb|CDY44320.1| BnaC05g30730D [Brassica napus]
Length=508

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 80/146 (55%), Gaps = 9/146 (6%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssG-AQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVS  265
            M+KQI  K+PRK  KS + DS+G    NS   P  S +G +  N         N  K + 
Sbjct  1    MIKQIFGKLPRKPSKSLNNDSNGEGAVNSYYAPNPSASGSRLPNGTLAP----NSNKNIQ  56

Query  266  SAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKR  445
            +  FP S V   E++     F+DV   EK  L + KL +CC V+DF DP KN  EK++KR
Sbjct  57   AGPFPPSGVVY-EALP---SFRDVPISEKPNLFLQKLTMCCVVFDFRDPSKNLKEKEIKR  112

Query  446  QVLLELNDFVASGSVKCTESAIAAVC  523
            Q LLEL D+VAS  VK  E+AI  + 
Sbjct  113  QTLLELVDYVASVGVKFNEAAIQELT  138



>ref|XP_007222861.1| hypothetical protein PRUPE_ppa004258mg [Prunus persica]
 gb|EMJ24060.1| hypothetical protein PRUPE_ppa004258mg [Prunus persica]
Length=520

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 59/157 (38%), Positives = 82/157 (52%), Gaps = 13/157 (8%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNS-GNGMQFTNSCNVIV-----NRLNV  250
            M KQIL+K+PRKS K+      G+     N PT+S  +    + S N++      N ++ 
Sbjct  1    MFKQILSKLPRKSSKNSESRD-GSHTMYSNPPTSSRSSDFGISKSGNLVTSFPAGNPVSD  59

Query  251  V------KRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDP  412
            V      K V  A    +      S      F+DV N EKQ L + KLNLCC V+DF DP
Sbjct  60   VGKSYGNKNVRGANLKPNGFVLSSSYEALPGFRDVPNSEKQSLFIKKLNLCCVVFDFTDP  119

Query  413  DKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVC  523
             K+  EK++KRQ LLEL D+V S + K TE+ +  + 
Sbjct  120  TKHLKEKEIKRQTLLELVDYVTSANGKFTETVMQEIA  156



>ref|XP_008379151.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Malus domestica]
Length=515

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +2

Query  326  FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTES  505
            FKDV N EKQ LL+ KLNLCC V+DF DP KN  EK++KRQ L+EL D++AS + K +E+
Sbjct  84   FKDVPNAEKQNLLIKKLNLCCVVFDFNDPTKNIKEKEIKRQTLVELVDYIASANGKFSET  143

Query  506  AIAAVC  523
             +  + 
Sbjct  144  VMQEIV  149



>ref|XP_006852143.1| hypothetical protein AMTR_s00049p00063500 [Amborella trichopoda]
 gb|ERN13610.1| hypothetical protein AMTR_s00049p00063500 [Amborella trichopoda]
Length=528

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 56/154 (36%), Positives = 79/154 (51%), Gaps = 11/154 (7%)
 Frame = +2

Query  89   MLKQILAKIPR--kslksdsldssGAQPNS--CND--PTNSGNGMQFTNSCN----VIVN  238
            M+KQIL K+PR              + PN+   N+  P+   N    T S N     +V 
Sbjct  1    MIKQILGKLPRRPSKSSDSREGVGNSIPNARVANNYHPSRGENSAPATRSGNDSESYLVP  60

Query  239  RLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDK  418
              N VK++   I  A+  +   +      FKDV + EKQ L + KLN+CC  +DF DP K
Sbjct  61   GSNQVKKLG-LIDRANGNSASSAYEALPSFKDVPSAEKQNLFIRKLNMCCVAFDFTDPSK  119

Query  419  NAAEKDLKRQVLLELNDFVASGSVKCTESAIAAV  520
            N  EKD+KRQ LLEL D++ S + K TE+ +  +
Sbjct  120  NQKEKDVKRQTLLELVDYITSANGKFTETIMQEI  153



>ref|XP_008230444.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Prunus mume]
Length=516

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +2

Query  326  FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTES  505
            FKDV N EKQ L + KLNLCC ++DF DP KN  EKD+KRQ L+EL D++AS + K +E+
Sbjct  85   FKDVPNAEKQNLFIKKLNLCCVIFDFSDPTKNLKEKDIKRQTLVELVDYIASANGKFSET  144

Query  506  AIAAVC  523
             +  + 
Sbjct  145  VMQEIV  150



>ref|XP_007215087.1| hypothetical protein PRUPE_ppa004318mg [Prunus persica]
 gb|EMJ16286.1| hypothetical protein PRUPE_ppa004318mg [Prunus persica]
Length=516

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +2

Query  326  FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTES  505
            FKDV N EKQ L + KLNLCC ++DF DP KN  EKD+KRQ L+EL D++AS + K +E+
Sbjct  85   FKDVPNAEKQNLFIKKLNLCCVIFDFSDPTKNLKEKDIKRQTLVELVDYIASANGKFSET  144

Query  506  AIAAVC  523
             +  + 
Sbjct  145  VMQEIV  150



>gb|KJB33915.1| hypothetical protein B456_006G038500 [Gossypium raimondii]
 gb|KJB33916.1| hypothetical protein B456_006G038500 [Gossypium raimondii]
Length=524

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 38/59 (64%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +2

Query  326  FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTE  502
            F+DV N EKQ LL+ KLNLCC V+DF DP KN  EKDLKRQ LLEL D+V+S + K +E
Sbjct  93   FRDVPNSEKQNLLIRKLNLCCIVFDFTDPTKNLKEKDLKRQTLLELVDYVSSANGKFSE  151



>ref|XP_004304704.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Fragaria vesca subsp. 
vesca]
Length=522

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +2

Query  326  FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTES  505
            FKDV N EKQ L + KLNLCC V+DF DP KN  EKD+KRQ L+EL D++AS + K +ES
Sbjct  90   FKDVPNSEKQNLCIKKLNLCCYVFDFTDPTKNLKEKDIKRQTLVELVDYIASANGKFSES  149

Query  506  AIAAVC  523
             I  + 
Sbjct  150  VIQELV  155



>ref|XP_010531427.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Tarenaya hassleriana]
Length=520

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +2

Query  326  FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTES  505
            FKDV + EKQ L ++KLNL C+V+DF DP KN  EKD+KRQ LLEL D+V SG+ K +E+
Sbjct  89   FKDVPSSEKQNLFITKLNLSCAVFDFTDPTKNGREKDIKRQTLLELVDYVTSGNGKFSET  148

Query  506  AIAA  517
             + A
Sbjct  149  VMQA  152



>gb|KDP30791.1| hypothetical protein JCGZ_13734 [Jatropha curcas]
Length=544

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 60/170 (35%), Positives = 84/170 (49%), Gaps = 29/170 (17%)
 Frame = +2

Query  89   MLKQILAKIPRk-------------slksdsldssGAQPNSCNDPTN---------SGNG  202
            M+KQIL K+PRK              + + S  +S   PNS N             SG G
Sbjct  1    MIKQILGKLPRKPSKSSNNDSNNDGGVNAFSSLNSSHGPNSINTSKQPSNSSRSSNSGLG  60

Query  203  MQFTNSCNVIVNRLNVVKRVSSA----IFPASIVAGGESISPHLCFKDVSNGEKQGLLVS  370
                N+ N+     ++  + S+     + P S V   E   P   F+DVS+ EKQ L + 
Sbjct  61   ASRINNGNLATQNKSIQGKKSATGAGQVGPVSAVWVYE---PLPSFRDVSSSEKQSLFIR  117

Query  371  KLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAV  520
            KLN+CC V+DF DP KN  EKD+KRQ LLEL D+++S + K  E  +  +
Sbjct  118  KLNMCCVVFDFNDPSKNLKEKDIKRQTLLELVDYISSVTSKFNEVTMQEI  167



>ref|XP_009148646.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform [Brassica rapa]
 ref|XP_009148647.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform [Brassica rapa]
Length=493

 Score = 82.0 bits (201),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +2

Query  326  FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTES  505
            FKDVSN EKQ L + KL+LCC ++DF DP KN  EK++KRQ LLEL D+VA+ + K +ES
Sbjct  76   FKDVSNAEKQTLFLKKLSLCCVLFDFSDPSKNVKEKEIKRQTLLELVDYVATANGKFSES  135

Query  506  AI  511
             I
Sbjct  136  VI  137



>ref|XP_008340161.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Malus domestica]
Length=521

 Score = 82.0 bits (201),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 59/157 (38%), Positives = 84/157 (54%), Gaps = 16/157 (10%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNS----------GNGMQFTNSCNVIVN  238
            ML+QIL K+PRKS K+      GAQ    N PT+S          GN      S N + +
Sbjct  1    MLRQILNKLPRKSSKNAENRD-GAQTLYSNPPTSSRSSDLGTSKSGNLTTSFPSGNAVAD  59

Query  239  RLNVVKRVSSAIFPASIVAGGESISPHLC---FKDVSNGEKQGLLVSKLNLCCSVYDFGD  409
             +      S+    A++   G +IS +     F+DV N EKQ L + KL+LCC V+DF D
Sbjct  60   XVKSYSNKSAR--GANMKPNGFAISSYEALPGFRDVPNAEKQSLFIKKLSLCCVVFDFTD  117

Query  410  PDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAV  520
            P K+  EK++KRQ LLEL D+V   + K +E+ +  +
Sbjct  118  PTKHLKEKEIKRQTLLELVDYVTKPNSKFSEALMQEL  154



>ref|XP_006447619.1| hypothetical protein CICLE_v10014856mg [Citrus clementina]
 ref|XP_006469633.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' zeta isoform-like [Citrus sinensis]
 gb|ESR60859.1| hypothetical protein CICLE_v10014856mg [Citrus clementina]
 gb|KDO54277.1| hypothetical protein CISIN_1g041798mg [Citrus sinensis]
Length=534

 Score = 82.0 bits (201),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 58/162 (36%), Positives = 88/162 (54%), Gaps = 23/162 (14%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNR-LNVVKRVS  265
            M+KQIL K+PRK  KS + +S+G   NS   P NS N    ++  N++ ++ +N   R++
Sbjct  1    MIKQILGKLPRKPSKSTNNESNGESLNSTQVP-NSIN----SSKANLLSSKSVNSGSRLN  55

Query  266  SAIF-PASIVAGGESISPHLC----------------FKDVSNGEKQGLLVSKLNLCCSV  394
            +    P +    G+  +P                   FKDV + EK  L + KLN+CC +
Sbjct  56   NGTLAPTTKSNQGKKSAPTATQVGSLLNSSVYEALPSFKDVPSAEKPNLFIRKLNMCCVI  115

Query  395  YDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAV  520
            +DF DP KN  EKD+KRQ LLEL D+++S + K  E A+  +
Sbjct  116  FDFNDPAKNLKEKDIKRQTLLELVDYMSSVTSKFNEVAMQEI  157



>emb|CAN66032.1| hypothetical protein VITISV_019650 [Vitis vinifera]
Length=535

 Score = 82.0 bits (201),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 61/173 (35%), Positives = 82/173 (47%), Gaps = 26/173 (15%)
 Frame = +2

Query  50   FRFDLYIHWSFATMLKQILAKIPRkslksdsldssGAQPNSCNDPTNS-GNGMQFTNSCN  226
            FRF    H         I +K+PRK  K+      G      N+   S G+ ++     N
Sbjct  10   FRFGWLRHLCLVE--ASIFSKLPRKLSKAVENRELGGTTAFSNNSNRSRGSDVESNQFAN  67

Query  227  VIVNRLNVVKRVSSAIFP-------ASIVAGGES------ISPHL-----CFKDVSNGEK  352
                 LNV    +S   P       + I  GG S      ++P+       F+DV + EK
Sbjct  68   -----LNVTSLAASNSTPITGNNLGSKIPQGGNSKVNGNYMTPNTYEALPAFRDVPSSEK  122

Query  353  QGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAI  511
            Q L + KLNLCC V+DF DP KN  EK++KRQ LLEL D+V S S K TE+ +
Sbjct  123  QNLFIGKLNLCCVVFDFTDPTKNIKEKEIKRQTLLELVDYVTSASGKFTETVM  175



>ref|XP_002314558.1| hypothetical protein POPTR_0010s06450g [Populus trichocarpa]
 gb|EEF00729.1| hypothetical protein POPTR_0010s06450g [Populus trichocarpa]
Length=507

 Score = 81.6 bits (200),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +2

Query  326  FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTES  505
            FKDV N EKQ L + KLN+CC ++DF DP KN  EK++KRQ LLEL D+V S S K +E+
Sbjct  85   FKDVPNSEKQSLFIKKLNMCCFLFDFTDPTKNLKEKEIKRQTLLELVDYVTSISGKFSET  144

Query  506  AIAAV  520
            A+  V
Sbjct  145  AMQEV  149



>ref|XP_006338659.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like isoform X1 [Solanum tuberosum]
 ref|XP_006338660.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like isoform X2 [Solanum tuberosum]
 ref|XP_006338661.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like isoform X3 [Solanum tuberosum]
Length=520

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +2

Query  326  FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTES  505
            FKDV   EKQ L + KLNLCC ++DF DP K+  EKD+KRQ L+EL D+++S +VK TE+
Sbjct  89   FKDVPTAEKQTLFIKKLNLCCVLFDFTDPTKHLKEKDIKRQTLVELVDYISSVNVKFTET  148

Query  506  AIAAVC  523
             I  + 
Sbjct  149  VIQEIV  154



>gb|AHE76186.1| protein phosphatase 2a [Chrysanthemum indicum]
Length=505

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +2

Query  326  FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTES  505
            F++V + EKQ L + K+N+CC ++DF DP KN  EK++KRQ LLEL DFVAS +VK TES
Sbjct  84   FREVPSSEKQNLFIKKVNMCCVIFDFTDPTKNLKEKEIKRQTLLELVDFVASSNVKFTES  143

Query  506  AI  511
             +
Sbjct  144  VM  145



>ref|XP_002890006.1| hypothetical protein ARALYDRAFT_471504 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66265.1| hypothetical protein ARALYDRAFT_471504 [Arabidopsis lyrata subsp. 
lyrata]
Length=495

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +2

Query  326  FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTES  505
            FKDV N EKQ L V KL+LCC  +DF DP KN  EK++KRQ LLEL D+VAS + K +E+
Sbjct  79   FKDVPNAEKQNLFVKKLSLCCVTFDFSDPTKNVKEKEIKRQTLLELVDYVASPNGKFSET  138

Query  506  AIAAVC  523
             I  V 
Sbjct  139  VIQEVV  144



>gb|KHF99622.1| Serine/threonine phosphatase 2A 59 kDa regulatory subunit B' 
zeta-like protein [Gossypium arboreum]
Length=548

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 60/169 (36%), Positives = 85/169 (50%), Gaps = 34/169 (20%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQ------------PNSCNDPTNSGNGMQFTNSCNVI  232
            M+KQI  K+PRK  KS   + +G              PNS N  +  G+  +F+NS +  
Sbjct  1    MMKQIFGKLPRKPSKSSQHEPNGDALNGNSFFNSSLGPNSLNS-SKPGSAFKFSNSGS--  57

Query  233  VNRLNVVKRVSSAIFPASIVAGGESISPHLC----------------FKDVSNGEKQGLL  364
              RLN    V+S    ++    G+   P                   F+DV + EKQ L 
Sbjct  58   --RLNG-GTVNSHSSSSANSNQGKKTDPLASQAGLMLVSGIYEALPGFRDVPSTEKQSLF  114

Query  365  VSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAI  511
            + KLN+CC V+DFGDP KN  EKD+K+Q LLEL D+++S + K  E A+
Sbjct  115  LKKLNMCCVVFDFGDPTKNLREKDIKKQTLLELVDYISSVTSKFNELAV  163



>emb|CBI28848.3| unnamed protein product [Vitis vinifera]
Length=475

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +2

Query  326  FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTES  505
            F+DV N EK  L + KLNLCC V+DF DP KN  EKD+KRQ LLEL D+++S S K  E+
Sbjct  66   FRDVPNPEKPNLFIRKLNLCCVVFDFNDPSKNPKEKDIKRQTLLELVDYISSVSSKFNET  125

Query  506  AIAAVC  523
            A+  + 
Sbjct  126  AMQEIT  131



>ref|XP_008222034.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Prunus mume]
Length=520

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +2

Query  326  FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTES  505
            F+DV N EKQ L + KLNLCC V+DF DP K+  EK++KRQ LLEL D+V S + K TE+
Sbjct  91   FRDVPNSEKQSLFIKKLNLCCVVFDFTDPTKHLKEKEIKRQTLLELVDYVTSANGKFTET  150

Query  506  AIAAVC  523
             +  + 
Sbjct  151  VMQEIA  156



>ref|XP_009590023.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Nicotiana tomentosiformis]
 ref|XP_009590024.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Nicotiana tomentosiformis]
 ref|XP_009590025.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Nicotiana tomentosiformis]
 ref|XP_009590026.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Nicotiana tomentosiformis]
Length=524

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 42/102 (41%), Positives = 59/102 (58%), Gaps = 9/102 (9%)
 Frame = +2

Query  215  NSCNVIVNRLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSV  394
            N  N +   +N     S+A+FP   +           FKDV + EKQ L + KLNLCC +
Sbjct  65   NHGNRLPQSVNAKVNGSAAVFPYETLPS---------FKDVPSSEKQNLFIKKLNLCCLM  115

Query  395  YDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAV  520
            +DF DP K+  EKD+KRQ L+EL D+V+S + K TE+ I  +
Sbjct  116  FDFTDPTKHLKEKDIKRQTLVELVDYVSSANGKFTETVIQEI  157



>ref|XP_002870241.1| hypothetical protein ARALYDRAFT_329973 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46500.1| hypothetical protein ARALYDRAFT_329973 [Arabidopsis lyrata subsp. 
lyrata]
Length=948

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 58/152 (38%), Positives = 79/152 (52%), Gaps = 27/152 (18%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPT--------NSGNGMQFTNSCNVIVNRL  244
            M+KQI  K+PRK  KS   D   + PN    PT        N  NG     S +   NR 
Sbjct  443  MIKQIFGKLPRKPSKSSHND---SNPNGEGGPTSKSSASNSNGANGTVIAPS-STSSNRT  498

Query  245  NVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNA  424
            N V  V  A+ P+              F+DV + EK  L + KL+LCC V+DF DP KN 
Sbjct  499  NQVNGVYEAL-PS--------------FRDVPSSEKPNLFIKKLSLCCVVFDFSDPSKNL  543

Query  425  AEKDLKRQVLLELNDFVASGSVKCTESAIAAV  520
             EK++KRQ LLEL D++A+ S K +++A+  +
Sbjct  544  REKEIKRQTLLELVDYIATVSSKLSDAAMQEI  575



>ref|XP_010111637.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' eta isoform [Morus notabilis]
 gb|EXC31382.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' eta isoform [Morus notabilis]
Length=525

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 57/163 (35%), Positives = 86/163 (53%), Gaps = 24/163 (15%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPN--------------SCNDPTNSG----NGMQFT  214
            M+KQ+L K+P+K  KS      G                  + N   N G    +G+  T
Sbjct  1    MIKQLLNKLPKKPSKSAENREGGGTSTSSSNANNNSRSGDLASNRHGNPGGPSLSGLNST  60

Query  215  NSCNVIV-NRLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCS  391
            +S  V   N+LN  + V+S +   ++ +  E++     F+DV N EKQ L + KLNLCC 
Sbjct  61   SSLGVNYGNKLN--QAVNSKLNGNTLASSYEALPS---FRDVPNSEKQNLFIKKLNLCCV  115

Query  392  VYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAV  520
            ++DF DP KN  EKD+KRQ L+EL D++AS + K  E+ +  +
Sbjct  116  LFDFTDPVKNLKEKDIKRQTLVELVDYIASANGKFPEAVLQEI  158



>ref|XP_009402720.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009402721.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009402722.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Musa acuminata subsp. 
malaccensis]
Length=522

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +2

Query  326  FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTES  505
            FKDV N EKQ L + KL+LCC V+DF DP KN  EKD+KRQ LLEL D+V S S K  E+
Sbjct  91   FKDVPNSEKQSLFMRKLDLCCVVFDFTDPSKNLKEKDIKRQTLLELVDYVTSSSGKFPEN  150

Query  506  AIAAVC  523
             +  + 
Sbjct  151  VMQEIA  156



>gb|EPS71994.1| hypothetical protein M569_02763, partial [Genlisea aurea]
Length=431

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +2

Query  326  FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTES  505
            F+DV + EKQ L V K+ +CC V+DF DP KN  EK++KRQ LLEL DFVA+ + K +E+
Sbjct  8    FRDVHSSEKQQLFVRKVKMCCVVFDFTDPTKNIKEKEIKRQTLLELVDFVATANGKFSET  67

Query  506  AIAAVC  523
            AI  V 
Sbjct  68   AIQEVV  73



>ref|XP_002969377.1| hypothetical protein SELMODRAFT_267276 [Selaginella moellendorffii]
 gb|EFJ29465.1| hypothetical protein SELMODRAFT_267276 [Selaginella moellendorffii]
Length=467

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 47/68 (69%), Gaps = 0/68 (0%)
 Frame = +2

Query  308  ISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGS  487
              P   F+DV + EKQ L V KL+LCC V+DF DP K+  EK++KRQ LLEL D+V SGS
Sbjct  32   FEPLPLFRDVPSSEKQSLFVKKLHLCCCVFDFTDPSKHTREKEIKRQTLLELVDYVTSGS  91

Query  488  VKCTESAI  511
             K TE+ +
Sbjct  92   GKFTENVL  99



>ref|XP_002970708.1| hypothetical protein SELMODRAFT_171686 [Selaginella moellendorffii]
 gb|EFJ28034.1| hypothetical protein SELMODRAFT_171686 [Selaginella moellendorffii]
Length=474

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 47/68 (69%), Gaps = 0/68 (0%)
 Frame = +2

Query  308  ISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGS  487
              P   F+DV + EKQ L V KL+LCC V+DF DP K+  EK++KRQ LLEL D+V SGS
Sbjct  32   FEPLPLFRDVPSSEKQSLFVKKLHLCCCVFDFTDPSKHTREKEIKRQTLLELVDYVTSGS  91

Query  488  VKCTESAI  511
             K TE+ +
Sbjct  92   GKFTENVL  99



>ref|XP_006307325.1| hypothetical protein CARUB_v10008945mg [Capsella rubella]
 gb|EOA40223.1| hypothetical protein CARUB_v10008945mg [Capsella rubella]
Length=495

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 50/77 (65%), Gaps = 3/77 (4%)
 Frame = +2

Query  299  GESISPHLC---FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELND  469
            G   SP+     FKDV N EKQ L + KLNLCC V+DF DP KN  EK++KRQ LL+L D
Sbjct  67   GTGFSPYEALPSFKDVPNAEKQNLCLRKLNLCCLVFDFSDPTKNVKEKEIKRQTLLDLVD  126

Query  470  FVASGSVKCTESAIAAV  520
            +VAS   K +E AI  V
Sbjct  127  YVASPGGKFSEMAIQEV  143



>ref|XP_011470807.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' gamma isoform-like [Fragaria vesca subsp. 
vesca]
Length=526

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 56/159 (35%), Positives = 80/159 (50%), Gaps = 24/159 (15%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNVVKRVSS  268
            M+KQIL +IPRK  KS       +Q ++ ND   +G G    NS     +     +  + 
Sbjct  1    MIKQILGRIPRKPSKS-------SQNDAYNDGGVNGIGPNSINSSKSSNSGSGNSRTSNG  53

Query  269  AIFPAS---------------IVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDF  403
             + P S               + +G     P   F+DV + EKQGL + KLN+CC V+DF
Sbjct  54   VLAPLSSKPSQSKKPGQVGPLLFSGAYEALPS--FRDVPSAEKQGLFIKKLNMCCVVFDF  111

Query  404  GDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAV  520
             DP KN  EKD+KRQ LLEL D+++S + K  E  +  +
Sbjct  112  NDPWKNVKEKDVKRQTLLELVDYISSVNSKFNEVTMQEI  150



>ref|XP_007222857.1| hypothetical protein PRUPE_ppa004253mg [Prunus persica]
 gb|EMJ24056.1| hypothetical protein PRUPE_ppa004253mg [Prunus persica]
Length=520

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/157 (37%), Positives = 85/157 (54%), Gaps = 16/157 (10%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSC----------NDPTNSGNG--MQFTNSCNVI  232
            M+KQIL K+PRK  KS      G    S           N P NS +   +   ++ N+ 
Sbjct  1    MIKQILGKLPRKPSKSAENREFGGSSASSLSSRSSDVVSNRPINSNSVPLLGLDSASNLG  60

Query  233  VNR-LNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGD  409
             +   N+ + V+S +  +S  A  +++     F+DV + EKQ L + KLNLCC ++DF D
Sbjct  61   YSHGSNLPQLVNSNLNGSSATASYQALP---AFRDVPSSEKQNLFMKKLNLCCVLFDFTD  117

Query  410  PDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAV  520
            P K+  EKD+KRQ LLEL D+V S + K TE+ +  V
Sbjct  118  PTKHLREKDIKRQTLLELVDYVTSANGKFTETVVQEV  154



>ref|XP_011021368.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
 ref|XP_011021369.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
 ref|XP_011021370.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
 ref|XP_011042310.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
 ref|XP_011042311.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
 ref|XP_011042312.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
Length=507

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = +2

Query  326  FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTES  505
            FKDV N EKQ L + KLN+CC ++DF DP KN  EK+ KRQ LLEL D+V S S K +E+
Sbjct  85   FKDVPNSEKQSLFIKKLNMCCFLFDFTDPTKNLKEKETKRQTLLELVDYVTSISGKFSET  144

Query  506  AIAAV  520
            A+  V
Sbjct  145  AMQEV  149



>ref|XP_002514975.1| protein phosphatase 2a, regulatory subunit, putative [Ricinus 
communis]
 gb|EEF47529.1| protein phosphatase 2a, regulatory subunit, putative [Ricinus 
communis]
Length=524

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 55/164 (34%), Positives = 84/164 (51%), Gaps = 33/164 (20%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGA-------------------QPNSCNDPTNSGNG---  202
            M+KQIL ++PRK  KS      G+                   +P S ND +  G+    
Sbjct  1    MIKQILGRLPRKPSKSSENRELGSSSAPSSTSTSSRNSDIVSNRPVSLNDTSPPGSDSTP  60

Query  203  -MQFTNSCNVIVNRLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLN  379
             + + +    I       + V+S +   S++A  E++     F+DV + EKQ L + KL+
Sbjct  61   HLGYAHGSKPI-------QAVNSKLNGNSVIASYEALPG---FRDVPSSEKQNLFIRKLS  110

Query  380  LCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAI  511
            LCC ++DF DP KN  EKD+KRQ L+EL D+V S + K TE+ +
Sbjct  111  LCCVLFDFTDPTKNLKEKDIKRQTLVELVDYVTSANGKITETVM  154



>gb|KHG16605.1| Serine/threonine phosphatase 2A 59 kDa regulatory subunit B' 
eta-like protein [Gossypium arboreum]
Length=431

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 83/155 (54%), Gaps = 11/155 (7%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTN-----SCNVIVNRLNVV  253
            MLKQIL+K+PRKS KS      G   N+      SG G + ++     S N+ V+   V 
Sbjct  1    MLKQILSKLPRKSSKSADNREHGGHHNAYYSNV-SGGGSRSSDFGTGKSGNLSVSSFAVS  59

Query  254  KRVSSAIFPASIVA--GGESISPHLC---FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDK  418
               +   + ++ +   G   +S +     FKDV   E+Q L V KLNLCC ++DF DP K
Sbjct  60   NSTADVGWKSADLKQNGNHMLSSYEAMPAFKDVPTSERQNLFVKKLNLCCMIFDFTDPTK  119

Query  419  NAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVC  523
            N  EK++KRQ LLEL ++V S + K ++  +  + 
Sbjct  120  NLKEKEIKRQTLLELLEYVTSANGKFSDVVLQEIV  154



>ref|XP_009772668.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Nicotiana sylvestris]
 ref|XP_009772669.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Nicotiana sylvestris]
 ref|XP_009772670.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Nicotiana sylvestris]
Length=524

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 41/102 (40%), Positives = 59/102 (58%), Gaps = 9/102 (9%)
 Frame = +2

Query  215  NSCNVIVNRLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSV  394
            N  N +   +N     ++A+FP   +           FKDV + EKQ L + KLNLCC +
Sbjct  65   NHGNRLPQSVNAKVNGNAAVFPCETLPS---------FKDVPSSEKQNLFIKKLNLCCVL  115

Query  395  YDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAV  520
            +DF DP K+  EKD+KRQ L+EL D+V+S + K TE+ I  +
Sbjct  116  FDFTDPTKHLKEKDIKRQTLVELVDYVSSANGKFTETVIQEI  157



>ref|XP_010250854.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Nelumbo nucifera]
 ref|XP_010250855.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Nelumbo nucifera]
 ref|XP_010250856.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Nelumbo nucifera]
 ref|XP_010250857.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Nelumbo nucifera]
Length=525

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 57/155 (37%), Positives = 78/155 (50%), Gaps = 20/155 (13%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQ-PNSCNDPTNSGNGMQFTNS---------------  220
            M+KQIL ++PRK  KS     SG   P   N  TNS +    +N                
Sbjct  1    MIKQILGRLPRKPSKSAENRESGGTAPTPSNASTNSRSSELVSNRAGNPNSTSLPPPNSA  60

Query  221  -CNVIVNRLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVY  397
             C+ + N  N + +V ++    +         P   F++V + EKQ L + KLNLCC ++
Sbjct  61   PCSGL-NHGNKLPQVLNSKLNGNSATSSYDALPG--FREVPSSEKQNLFIRKLNLCCVIF  117

Query  398  DFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTE  502
            DF DP KN  EKD+KRQ LLEL D+V S + K TE
Sbjct  118  DFTDPTKNLKEKDIKRQTLLELVDYVTSANGKFTE  152



>ref|XP_008222035.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Prunus mume]
Length=520

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +2

Query  323  CFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTE  502
             F+DV + EKQ L + KLNLCC V+DF DP K+  EKD+KRQ LLEL D+V S + K TE
Sbjct  89   AFRDVPSSEKQNLFMKKLNLCCVVFDFTDPTKHLREKDIKRQTLLELVDYVTSANGKFTE  148

Query  503  SAIAAV  520
            + +  V
Sbjct  149  TVVQEV  154



>ref|XP_006341761.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like [Solanum tuberosum]
Length=502

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +2

Query  326  FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTES  505
            F+DV N EK  L + KLN+CC ++DF DP KN  EK++KRQ LLEL ++V S +VK TE 
Sbjct  75   FRDVPNAEKHNLFIRKLNMCCVLFDFTDPTKNLKEKEIKRQTLLELVEYVTSANVKFTEM  134

Query  506  AIAAVC  523
             + +V 
Sbjct  135  VMQSVV  140



>emb|CDX98102.1| BnaA06g08530D [Brassica napus]
Length=463

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +2

Query  326  FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTES  505
            FKDV N EKQ L + KL+LCC ++DF DP KN  EK++KRQ LLEL D+VA+ + K +ES
Sbjct  46   FKDVPNAEKQTLFLKKLSLCCVLFDFSDPSKNVKEKEIKRQTLLELVDYVATANGKFSES  105

Query  506  AI  511
             I
Sbjct  106  VI  107



>ref|XP_010025360.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Eucalyptus grandis]
 ref|XP_010025361.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Eucalyptus grandis]
 gb|KCW62002.1| hypothetical protein EUGRSUZ_H04680 [Eucalyptus grandis]
Length=525

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 58/157 (37%), Positives = 77/157 (49%), Gaps = 18/157 (11%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNS-CNDPTNSGNGMQFTNSCNVI-----------  232
            M KQ L+K+PRKS KS     +G   N   N   NS +G   +     +           
Sbjct  1    MFKQFLSKLPRKSSKSADSRDNGGGSNPYANASINSRSGELGSAKSGALNPTSSSAPNHV  60

Query  233  ----VNRLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYD  400
                 N  N   R S+      +V+      P   FKDVS+ EKQ LL+ KLNL C ++D
Sbjct  61   SDKGSNHGNKTSRNSNVQLNGYMVSSAYEALPG--FKDVSSSEKQHLLIRKLNLSCVIFD  118

Query  401  FGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAI  511
            F DP KN  EK++KRQ LLEL D+V S + K  E+ +
Sbjct  119  FTDPTKNLREKEIKRQTLLELVDYVTSVNAKFAETVM  155



>ref|XP_006414514.1| hypothetical protein EUTSA_v10024939mg [Eutrema salsugineum]
 gb|ESQ55967.1| hypothetical protein EUTSA_v10024939mg [Eutrema salsugineum]
Length=516

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/163 (34%), Positives = 81/163 (50%), Gaps = 37/163 (23%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQ--FTNSCN------------  226
            M+KQI  K+PRK  K           +S NDP  +G G    F  S              
Sbjct  1    MIKQIFGKLPRKPSK-----------SSHNDPNPNGEGRDNVFMESSTSNSHGANGTVPA  49

Query  227  ---VIVNRLNVVKRVSSA-IFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSV  394
               ++ NR N   + S A  FP       E++     F+DV + EK  L + KL++CC V
Sbjct  50   FPPLVNNRTNQANKPSGAGAFPVY-----EALP---SFRDVPSSEKPNLFIKKLSMCCVV  101

Query  395  YDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVC  523
            +DF DP KN  EK++KRQ LLEL D++A+ S K +++A+  + 
Sbjct  102  FDFSDPSKNLREKEIKRQTLLELVDYIATVSTKFSDAAMQEIA  144



>ref|XP_002514974.1| protein phosphatase 2a, regulatory subunit, putative [Ricinus 
communis]
 gb|EEF47528.1| protein phosphatase 2a, regulatory subunit, putative [Ricinus 
communis]
Length=527

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = +2

Query  326  FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTES  505
            F+DV N EKQ L + KLNLCC V+DF DP KN  EK++KRQ LLEL D+V S + K +E+
Sbjct  96   FRDVPNSEKQNLFIRKLNLCCFVFDFTDPTKNLKEKEIKRQTLLELVDYVTSANAKFSET  155

Query  506  AIAAV  520
             +  V
Sbjct  156  VMQEV  160



>ref|XP_008340163.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Malus domestica]
Length=522

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +2

Query  323  CFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTE  502
             F+DV N EK  L V KLNLCC V+DF DP KN  EKD+KRQ LLEL D+V S + K TE
Sbjct  91   AFRDVPNSEKHNLFVKKLNLCCVVFDFTDPTKNLREKDIKRQTLLELVDYVTSANGKFTE  150



>ref|XP_006484025.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like [Citrus sinensis]
 gb|KDO82044.1| hypothetical protein CISIN_1g009829mg [Citrus sinensis]
Length=524

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 57/156 (37%), Positives = 80/156 (51%), Gaps = 17/156 (11%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssG-----------AQPNSCNDPTNSGN----GMQFTNSC  223
            M+KQIL K+PRKS K+      G              +S    + SGN      Q  +S 
Sbjct  1    MIKQILKKLPRKSSKTGDNREHGRNSVTHSIASTGSRSSDLGKSKSGNLNTVSPQMNDSA  60

Query  224  NVIVNRLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDF  403
            +  V   N ++   ++    ++V       P L  KDV + EKQ L + KLNLCC V+DF
Sbjct  61   SDAVQDGNKIQLGMNSKLNGNLVLSSYDTLPAL--KDVPSAEKQNLFIKKLNLCCVVFDF  118

Query  404  GDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAI  511
             DP KN  EK++KRQ+LLEL D+V S + K  E+ +
Sbjct  119  TDPTKNLKEKEIKRQMLLELVDYVTSANGKFNETVM  154



>ref|XP_006438130.1| hypothetical protein CICLE_v10031228mg [Citrus clementina]
 gb|ESR51370.1| hypothetical protein CICLE_v10031228mg [Citrus clementina]
Length=524

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 57/156 (37%), Positives = 80/156 (51%), Gaps = 17/156 (11%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssG-----------AQPNSCNDPTNSGN----GMQFTNSC  223
            M+KQIL K+PRKS K+      G              +S    + SGN      Q  +S 
Sbjct  1    MIKQILKKLPRKSSKTGDNREHGRNSVTHSIASTGSRSSDLGKSKSGNLNTVSPQMNDSA  60

Query  224  NVIVNRLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDF  403
            +  V   N ++   ++    ++V       P L  KDV + EKQ L + KLNLCC V+DF
Sbjct  61   SDAVQDGNKIQLGMNSKLNGNLVLSSYGTLPAL--KDVPSAEKQNLFIKKLNLCCVVFDF  118

Query  404  GDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAI  511
             DP KN  EK++KRQ+LLEL D+V S + K  E+ +
Sbjct  119  TDPTKNLKEKEIKRQMLLELVDYVTSANGKFNETVM  154



>ref|XP_004142950.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like [Cucumis sativus]
 ref|XP_004159560.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like [Cucumis sativus]
 gb|KGN62353.1| hypothetical protein Csa_2G350360 [Cucumis sativus]
Length=525

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 56/158 (35%), Positives = 80/158 (51%), Gaps = 14/158 (9%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssG----AQPNSCNDPTNSGNGMQFTNSCNVIVN--RLNV  250
            M+KQI +K+PRKS K       G    A   +    ++ GN +    S N++ +    N 
Sbjct  1    MIKQIFSKLPRKSSKGGESREHGGSHMAPSTAYASASSRGNDLASGKSANLVSSFAATNS  60

Query  251  VKRVSSAIFPASIVAGG--------ESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFG  406
            V+ V       +   G          S  P   F++V + EKQ L V KLNLCC ++DF 
Sbjct  61   VQDVGQNHGTKANKGGNAKLNGIPTSSYEPLPGFREVPSSEKQNLFVKKLNLCCFLFDFT  120

Query  407  DPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAV  520
            DP K+  EK++KRQ LLE+ D+V S + K TE+ I  V
Sbjct  121  DPTKHLKEKEIKRQTLLEIVDYVTSVNSKFTETVIQEV  158



>gb|KCW62001.1| hypothetical protein EUGRSUZ_H04680 [Eucalyptus grandis]
Length=545

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 58/157 (37%), Positives = 77/157 (49%), Gaps = 18/157 (11%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNS-CNDPTNSGNGMQFTNSCNVI-----------  232
            M KQ L+K+PRKS KS     +G   N   N   NS +G   +     +           
Sbjct  1    MFKQFLSKLPRKSSKSADSRDNGGGSNPYANASINSRSGELGSAKSGALNPTSSSAPNHV  60

Query  233  ----VNRLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYD  400
                 N  N   R S+      +V+      P   FKDVS+ EKQ LL+ KLNL C ++D
Sbjct  61   SDKGSNHGNKTSRNSNVQLNGYMVSSAYEALPG--FKDVSSSEKQHLLIRKLNLSCVIFD  118

Query  401  FGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAI  511
            F DP KN  EK++KRQ LLEL D+V S + K  E+ +
Sbjct  119  FTDPTKNLREKEIKRQTLLELVDYVTSVNAKFAETVM  155



>ref|XP_010657226.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' gamma isoform [Vitis vinifera]
 emb|CAN75915.1| hypothetical protein VITISV_022158 [Vitis vinifera]
Length=548

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = +2

Query  326  FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTES  505
            F+DV N EK  L + KLNLCC V+DF DP KN  EKD+KRQ LLEL D+++S S K  E+
Sbjct  107  FRDVPNPEKPNLFIRKLNLCCVVFDFNDPSKNPKEKDIKRQTLLELVDYISSVSSKFNET  166

Query  506  AIAAV  520
            A+  +
Sbjct  167  AMQEI  171



>gb|KDP26745.1| hypothetical protein JCGZ_17903 [Jatropha curcas]
Length=524

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 59/173 (34%), Positives = 81/173 (47%), Gaps = 45/173 (26%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssG----------------------AQPNSCNDPTNS---  193
            M+KQIL K+PRK  KS      G                      A  NS + P +    
Sbjct  1    MIKQILGKLPRKPSKSSESREFGGPSAPSNTSTSSRSNDLASNKSATLNSTSPPPSDSAP  60

Query  194  ----GNGMQFTNSCNVIVNRLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGL  361
                G+G + T + N  +N               S++A  E++     F+DV + EKQ L
Sbjct  61   HLGYGHGSKLTQAANSKLN-------------GNSVIAPYEALP---AFRDVPSSEKQNL  104

Query  362  LVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAV  520
             + KLNLC  V+DF DP KN  EKD+KRQ L+EL D+V S + K TE+ +  V
Sbjct  105  FIRKLNLCSVVFDFTDPTKNLKEKDIKRQTLVELVDYVTSANGKFTETVMQEV  157



>ref|XP_010228176.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like isoform X1 [Brachypodium 
distachyon]
 ref|XP_010228177.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like isoform X1 [Brachypodium 
distachyon]
Length=517

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = +2

Query  305  SISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASG  484
            S  P   FKDV + +KQ LL+ KLNLCC V+DF DP KN  EK++KRQ LLEL D+VAS 
Sbjct  79   SFEPLPSFKDVPSTKKQHLLIRKLNLCCVVFDFTDPTKNIKEKEIKRQTLLELVDYVASA  138

Query  485  SVKCTESAIAAVC  523
            + K  E  +  + 
Sbjct  139  NGKFPEIVMQEIT  151



>ref|XP_009359306.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Pyrus x bretschneideri]
Length=522

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +2

Query  323  CFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTE  502
             F+DV N EK  L V KLNLCC V+DF DP KN  EKD+KRQ LLEL D+V S + K TE
Sbjct  91   AFRDVPNSEKHNLFVKKLNLCCVVFDFTDPTKNLREKDIKRQTLLELVDYVTSANGKFTE  150



>ref|XP_011047218.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' gamma isoform [Populus euphratica]
Length=541

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 58/164 (35%), Positives = 85/164 (52%), Gaps = 20/164 (12%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLNV------  250
            M+KQIL K+PRK  +S S DS+     + +   NS +G    N+     N          
Sbjct  1    MIKQILGKLPRKPSRSSSNDSNNDGGLNAHSSLNSSHGANSINNSKPSSNSSKASNPSLG  60

Query  251  VKRVSSAIF-PASIVAGGESISPHL-------------CFKDVSNGEKQGLLVSKLNLCC  388
              R+++ I  P S ++ G+  +P L              F+DV N EK  L + KLN+CC
Sbjct  61   ASRLNNGILAPNSKMSQGKKSAPQLGPVITSGVYEALPSFRDVPNSEKPNLFIKKLNMCC  120

Query  389  SVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAV  520
             V+DF DP KN  EKD+KRQ LLEL D++++ + K  E A+  +
Sbjct  121  VVFDFSDPAKNLKEKDIKRQTLLELVDYISTLTSKFNEMAMQEI  164



>ref|XP_003601378.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' gamma isoform [Medicago truncatula]
 gb|AES71629.1| protein phosphatase 2A regulatory B subunit family protein [Medicago 
truncatula]
Length=535

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 64/170 (38%), Positives = 86/170 (51%), Gaps = 31/170 (18%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldss-----------GAQPNSCNDPT------------NSGN  199
            M+KQIL KIPRKS KS S               G+  NS +D T            +   
Sbjct  1    MIKQILGKIPRKSSKSSSHSDFNGDGGLVNGGFGSSLNSSSDDTLKSNSASSKSSSSGNG  60

Query  200  GMQFTNSCNVIVNRLNVVKRVSSAIFP--ASIVAGGESISPHL-CFKDVSNGEKQGLLVS  370
                TNS     N+ N  K+ + AI      I+A G      L  F+DVS+ EK  L + 
Sbjct  61   SSASTNS-----NKTNQAKKSAPAIGSQVGLIMANGNGGYEALPSFRDVSSSEKPNLFIR  115

Query  371  KLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAV  520
            KLN+CC V+DF DP K+  EKD+KRQ LLEL D+++S + K  E+A+  +
Sbjct  116  KLNMCCIVFDFSDPSKHVKEKDIKRQTLLELVDYISSVNSKFNEAAMQEI  165



>ref|XP_010228178.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like isoform X2 [Brachypodium 
distachyon]
Length=449

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = +2

Query  305  SISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASG  484
            S  P   FKDV + +KQ LL+ KLNLCC V+DF DP KN  EK++KRQ LLEL D+VAS 
Sbjct  79   SFEPLPSFKDVPSTKKQHLLIRKLNLCCVVFDFTDPTKNIKEKEIKRQTLLELVDYVASA  138

Query  485  SVKCTESAIAAVC  523
            + K  E  +  + 
Sbjct  139  NGKFPEIVMQEIT  151



>ref|XP_009412705.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=497

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 82/155 (53%), Gaps = 17/155 (11%)
 Frame = +2

Query  89   MLKQILAKIPR--kslksdsldssGAQPNSCNDPTNSGNGM----QFTNSCNVI------  232
            M+KQIL ++PR            +G  P S +   +S NG     + TN  N I      
Sbjct  1    MIKQILNRLPRKPSKSSDSRDSVTGPTPPSSSSSISSRNGDLQAGRITNLSNQIPPGSSP  60

Query  233  -VNRLN-VVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFG  406
             +N+LN     V+S      +V   E++     FKDV++ EKQ L + KL+LCC V+DF 
Sbjct  61   GINQLNKYAPAVNSRPNGNYVVPVYEALP---SFKDVTSSEKQSLFMRKLDLCCVVFDFT  117

Query  407  DPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAI  511
            DP KN  EKD+KRQ LLEL D+V S S K  E+ +
Sbjct  118  DPAKNLKEKDVKRQTLLELVDYVTSASGKFPENVM  152



>ref|NP_001059361.1| Os07g0274800 [Oryza sativa Japonica Group]
 dbj|BAC84389.1| putative protein phosphatase PP2A0 B' subunit gamma isoform [Oryza 
sativa Japonica Group]
 dbj|BAF21275.1| Os07g0274800 [Oryza sativa Japonica Group]
 dbj|BAG91016.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC81852.1| hypothetical protein OsI_25621 [Oryza sativa Indica Group]
 gb|EEE66955.1| hypothetical protein OsJ_23826 [Oryza sativa Japonica Group]
Length=517

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = +2

Query  305  SISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASG  484
            S  P   FKDV N EKQ LL+ KL LCC V+DF DP KN  EK++K Q LLE+ D+V S 
Sbjct  79   SFQPLPSFKDVPNSEKQNLLIRKLKLCCIVFDFTDPTKNIQEKEMKSQTLLEIVDYVVSA  138

Query  485  SVKCTESAIAAVC  523
            +VK  E  +  + 
Sbjct  139  TVKFPEIVMLEIT  151



>gb|AFW58632.1| hypothetical protein ZEAMMB73_760675 [Zea mays]
Length=470

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 55/91 (60%), Gaps = 3/91 (3%)
 Frame = +2

Query  260  VSSAIFPASIVAGG---ESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAE  430
            V S + P  ++ G     S  P   FKDV   EKQ L V K++LCC+VYDF DP KN  E
Sbjct  15   VPSGVIPNPVMNGAVVYHSNEPLPAFKDVPMSEKQNLFVKKVSLCCAVYDFVDPTKNLKE  74

Query  431  KDLKRQVLLELNDFVASGSVKCTESAIAAVC  523
            K++KRQ L+EL D+VAS + K +E  +  + 
Sbjct  75   KEVKRQTLMELVDYVASANGKFSEVVMLEIT  105



>ref|XP_006287591.1| hypothetical protein CARUB_v10000801mg [Capsella rubella]
 gb|EOA20489.1| hypothetical protein CARUB_v10000801mg [Capsella rubella]
Length=494

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 64/112 (57%), Gaps = 13/112 (12%)
 Frame = +2

Query  182  PTNSGNGMQFTNSCNVIVNRLNVVKRVSSAIFPASIVAGGE-----SISPHLCFKDVSNG  346
            P  SG G       N++VN  +    + S+  P S+VA  +     S+ P   F+DVS  
Sbjct  29   PGRSGPG------SNMVVNHASRGSLIPSS--PGSMVATAQPPPMYSVEPLPLFRDVSVS  80

Query  347  EKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTE  502
            E+Q L + KL +CC  +DF D  KNA EK++KRQ LLEL DF+ SG+ K TE
Sbjct  81   ERQSLFLRKLQICCFQFDFTDTLKNAREKEIKRQTLLELVDFIQSGAGKLTE  132



>gb|AGT16585.1| hypothetical protein SHCRBa_109_M04_F_40 [Saccharum hybrid cultivar 
R570]
Length=519

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +2

Query  326  FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTES  505
            FKDV N EKQ L + KLNLCC  +DF DP KN  EK++KRQ L+EL D++AS + K +E+
Sbjct  89   FKDVPNTEKQSLFIKKLNLCCMQFDFTDPTKNIKEKEIKRQTLVELVDYIASATGKFSEA  148

Query  506  AIAAVC  523
            ++  + 
Sbjct  149  SMQEIT  154



>gb|EYU44814.1| hypothetical protein MIMGU_mgv1a004709mg [Erythranthe guttata]
Length=513

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +2

Query  326  FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTES  505
            FKDV N EKQ L + KL+LCC V+DF DP KN  EKD+KRQ L+EL D+V S + K  E+
Sbjct  93   FKDVPNAEKQNLFIKKLSLCCVVFDFTDPTKNLKEKDIKRQTLVELLDYVTSANGKFNET  152

Query  506  AIAAVC  523
             +  + 
Sbjct  153  VVQEIV  158



>ref|XP_010248839.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Nelumbo nucifera]
 ref|XP_010248840.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Nelumbo nucifera]
Length=523

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 44/99 (44%), Positives = 60/99 (61%), Gaps = 5/99 (5%)
 Frame = +2

Query  233  VNRLNVVKRVSSAIFPASIVAGGESISPHLC---FKDVSNGEKQGLLVSKLNLCCSVYDF  403
            V+ LN   +VS  +   S + G  +IS +     F+DV + EKQ L + KLNLCC V+DF
Sbjct  60   VSGLNYGNKVSQVL--NSKLNGNSAISSYEALPGFRDVPSSEKQNLFIKKLNLCCVVFDF  117

Query  404  GDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAV  520
             DP KN  EKD K+Q LLEL D+V S + K TE+ +  +
Sbjct  118  TDPTKNLKEKDTKKQTLLELVDYVTSANGKFTETVMQEI  156



>gb|EPS59388.1| hypothetical protein M569_15419, partial [Genlisea aurea]
Length=486

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 72/153 (47%), Gaps = 20/153 (13%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNR--------L  244
            MLKQIL KIP+   K+      G   N      ++    + T   +V V+         L
Sbjct  2    MLKQILGKIPKMYSKTS-----GGDSNPSTSSFSNSKRREGTTRFSVPVDEALVSPYSVL  56

Query  245  NVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNA  424
            N+         PA   A          F+DV + EKQ L V KL +CC V+DF DP KN 
Sbjct  57   NIGSYGQDKFLPAPYEALP-------GFRDVHSSEKQQLFVRKLKMCCVVFDFADPTKNV  109

Query  425  AEKDLKRQVLLELNDFVASGSVKCTESAIAAVC  523
             EK++KRQ LLEL +FV S + K  E+ +  V 
Sbjct  110  REKEIKRQTLLELIEFVTSANGKFNETVMQEVV  142



>ref|XP_009412704.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=522

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 83/155 (54%), Gaps = 17/155 (11%)
 Frame = +2

Query  89   MLKQILAKIPRk--slksdsldssGAQPNSCNDPTNSGNGM----QFTNSCNVI------  232
            M+KQIL ++PRK           +G  P S +   +S NG     + TN  N I      
Sbjct  1    MIKQILNRLPRKPSKSSDSRDSVTGPTPPSSSSSISSRNGDLQAGRITNLSNQIPPGSSP  60

Query  233  -VNRLN-VVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFG  406
             +N+LN     V+S      +V   E++     FKDV++ EKQ L + KL+LCC V+DF 
Sbjct  61   GINQLNKYAPAVNSRPNGNYVVPVYEALP---SFKDVTSSEKQSLFMRKLDLCCVVFDFT  117

Query  407  DPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAI  511
            DP KN  EKD+KRQ LLEL D+V S S K  E+ +
Sbjct  118  DPAKNLKEKDVKRQTLLELVDYVTSASGKFPENVM  152



>emb|CDY30030.1| BnaC05g09900D [Brassica napus]
Length=496

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +2

Query  326  FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTES  505
            FKDV N EKQ L + KL+LCC ++DF DP KN  EK++KRQ LLEL D+VA+ + K +E+
Sbjct  79   FKDVPNAEKQTLFLKKLSLCCVLFDFSDPSKNVKEKEIKRQTLLELVDYVATANGKFSET  138

Query  506  AI  511
             I
Sbjct  139  VI  140



>ref|NP_001146165.1| hypothetical protein [Zea mays]
 gb|ACL53388.1| unknown [Zea mays]
 gb|AFW61329.1| hypothetical protein ZEAMMB73_791311 [Zea mays]
Length=502

 Score = 79.0 bits (193),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 83/158 (53%), Gaps = 20/158 (13%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIVNRLN-------  247
            M+KQIL ++P+K  KS   + +GA P S   PT          + + +V+  N       
Sbjct  1    MIKQILGRLPKKQAKSGEKELAGAGP-SLPSPTADTRTTTDLTTSSRLVSPSNYASTATN  59

Query  248  -----VVKRVS--SAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFG  406
                 V  R +  S  FPAS  AG E++     F+DV   EK GL + KL +CC V+DF 
Sbjct  60   QGQSFVAARAAGVSNGFPAS--AGYEALP---SFRDVPAPEKPGLFLRKLAMCCVVFDFA  114

Query  407  DPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAV  520
            DP K+A EK++KRQ LLEL D++ S + K  E  +  V
Sbjct  115  DPTKDAREKEVKRQTLLELVDYITSATGKFPEHVVPEV  152



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564104274800