BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001F16

Length=610
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007210357.1|  hypothetical protein PRUPE_ppa001580mg             321   7e-101   Prunus persica
ref|XP_008238126.1|  PREDICTED: uncharacterized protein RSN1            320   2e-100   Prunus mume [ume]
ref|XP_011082330.1|  PREDICTED: CSC1-like protein At1g32090             319   3e-100   Sesamum indicum [beniseed]
ref|XP_004245915.1|  PREDICTED: CSC1-like protein At1g32090             318   8e-100   Solanum lycopersicum
ref|XP_011074804.1|  PREDICTED: CSC1-like protein At1g32090             317   9e-100   Sesamum indicum [beniseed]
gb|KJB25199.1|  hypothetical protein B456_004G180800                    310   1e-99    Gossypium raimondii
ref|XP_006352918.1|  PREDICTED: uncharacterized protein RSN1-like       318   1e-99    Solanum tuberosum [potatoes]
gb|KDP46674.1|  hypothetical protein JCGZ_12198                         317   2e-99    Jatropha curcas
ref|XP_009784323.1|  PREDICTED: CSC1-like protein At1g32090             316   4e-99    Nicotiana sylvestris
ref|XP_008373502.1|  PREDICTED: uncharacterized protein RSN1            316   4e-99    
ref|XP_007040777.1|  Early-responsive to dehydration stress prote...    316   5e-99    
ref|XP_007040776.1|  Early-responsive to dehydration stress prote...    315   6e-99    
ref|XP_009603996.1|  PREDICTED: CSC1-like protein At1g32090             315   8e-99    Nicotiana tomentosiformis
gb|KJB51550.1|  hypothetical protein B456_008G222200                    313   9e-99    Gossypium raimondii
ref|XP_010110413.1|  Uncharacterized protein RSN1                       306   1e-98    
gb|KJB51549.1|  hypothetical protein B456_008G222200                    312   1e-97    Gossypium raimondii
ref|XP_009373514.1|  PREDICTED: CSC1-like protein At1g32090             312   1e-97    Pyrus x bretschneideri [bai li]
emb|CDP11732.1|  unnamed protein product                                311   2e-97    Coffea canephora [robusta coffee]
ref|XP_010664612.1|  PREDICTED: CSC1-like protein At1g32090 isofo...    307   3e-97    Vitis vinifera
ref|XP_010261636.1|  PREDICTED: CSC1-like protein At1g32090             310   3e-97    Nelumbo nucifera [Indian lotus]
ref|XP_010056204.1|  PREDICTED: CSC1-like protein At1g32090             310   4e-97    Eucalyptus grandis [rose gum]
ref|XP_010276749.1|  PREDICTED: CSC1-like protein At1g32090             308   9e-97    Nelumbo nucifera [Indian lotus]
gb|KHG26829.1|  putative membrane C2G11.09                              310   1e-96    Gossypium arboreum [tree cotton]
gb|EYU29074.1|  hypothetical protein MIMGU_mgv1a021500mg                307   3e-96    Erythranthe guttata [common monkey flower]
gb|KHN40403.1|  Putative membrane protein C2G11.09                      308   3e-96    Glycine soja [wild soybean]
ref|XP_003516847.1|  PREDICTED: uncharacterized protein RSN1-like       308   3e-96    Glycine max [soybeans]
ref|XP_011018446.1|  PREDICTED: CSC1-like protein At1g32090             308   7e-96    Populus euphratica
gb|KDO58806.1|  hypothetical protein CISIN_1g040696mg                   307   1e-95    Citrus sinensis [apfelsine]
gb|EYU23284.1|  hypothetical protein MIMGU_mgv1a001448mg                306   3e-95    Erythranthe guttata [common monkey flower]
ref|XP_002304365.2|  hypothetical protein POPTR_0003s09900g             306   3e-95    
emb|CDP11733.1|  unnamed protein product                                307   4e-95    Coffea canephora [robusta coffee]
ref|XP_006432649.1|  hypothetical protein CICLE_v10000312mg             305   5e-95    Citrus clementina [clementine]
ref|XP_007158205.1|  hypothetical protein PHAVU_002G133000g             306   5e-95    Phaseolus vulgaris [French bean]
ref|XP_003533453.1|  PREDICTED: uncharacterized protein RSN1-like       305   5e-95    Glycine max [soybeans]
ref|XP_010054102.1|  PREDICTED: CSC1-like protein At1g32090             303   1e-94    Eucalyptus grandis [rose gum]
ref|XP_006368323.1|  early-responsive to dehydration family protein     304   1e-94    
ref|XP_002273732.1|  PREDICTED: CSC1-like protein At1g32090 isofo...    303   1e-94    Vitis vinifera
ref|XP_010518924.1|  PREDICTED: CSC1-like protein At1g32090             303   2e-94    Tarenaya hassleriana [spider flower]
ref|XP_002519965.1|  Extensin-3 precursor, putative                     304   2e-94    
ref|XP_011028084.1|  PREDICTED: CSC1-like protein At1g32090             303   4e-94    Populus euphratica
ref|XP_010677412.1|  PREDICTED: CSC1-like protein At1g32090             302   8e-94    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004300169.1|  PREDICTED: CSC1-like protein At1g32090             301   3e-93    Fragaria vesca subsp. vesca
ref|XP_004512449.1|  PREDICTED: uncharacterized membrane protein ...    300   3e-93    Cicer arietinum [garbanzo]
ref|XP_008448614.1|  PREDICTED: uncharacterized protein RSN1            300   5e-93    Cucumis melo [Oriental melon]
ref|XP_003612662.1|  Membrane protein, putative                         300   5e-93    Medicago truncatula
ref|XP_004146108.1|  PREDICTED: uncharacterized membrane protein ...    299   1e-92    Cucumis sativus [cucumbers]
ref|XP_002893699.1|  hypothetical protein ARALYDRAFT_473392             297   6e-92    
ref|XP_010920040.1|  PREDICTED: LOW QUALITY PROTEIN: CSC1-like pr...    296   9e-92    
ref|XP_008788615.1|  PREDICTED: CSC1-like protein At1g32090             295   2e-91    Phoenix dactylifera
ref|NP_174489.1|  early-responsive to dehydration stress protein ...    296   3e-91    Arabidopsis thaliana [mouse-ear cress]
gb|AFI41197.1|  dehydration stress protein                              295   4e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009409814.1|  PREDICTED: CSC1-like protein At1g32090             293   9e-91    Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS61105.1|  hypothetical protein M569_13694                         286   3e-90    Genlisea aurea
ref|XP_006415254.1|  hypothetical protein EUTSA_v10006831mg             293   3e-90    Eutrema salsugineum [saltwater cress]
ref|XP_006304000.1|  hypothetical protein CARUB_v10011444mg             292   5e-90    Capsella rubella
gb|EPS60193.1|  hypothetical protein M569_14609                         288   6e-89    Genlisea aurea
emb|CDY35541.1|  BnaA05g16450D                                          289   8e-89    Brassica napus [oilseed rape]
ref|XP_009145210.1|  PREDICTED: CSC1-like protein At1g32090             289   8e-89    Brassica rapa
emb|CDY29933.1|  BnaC05g29030D                                          289   9e-89    Brassica napus [oilseed rape]
gb|KFK44972.1|  hypothetical protein AALP_AA1G327200                    288   1e-88    Arabis alpina [alpine rockcress]
ref|XP_010461028.1|  PREDICTED: CSC1-like protein At1g32090             286   8e-88    Camelina sativa [gold-of-pleasure]
gb|EMT13890.1|  Putative membrane protein                               285   4e-87    
gb|EMS63833.1|  Uncharacterized membrane protein C2G11.09               284   5e-87    Triticum urartu
emb|CDM81261.1|  unnamed protein product                                283   9e-87    Triticum aestivum [Canadian hard winter wheat]
ref|XP_010499754.1|  PREDICTED: CSC1-like protein At1g32090             283   1e-86    Camelina sativa [gold-of-pleasure]
ref|XP_010235059.1|  PREDICTED: CSC1-like protein At1g32090 isofo...    281   1e-86    
ref|XP_008658829.1|  PREDICTED: uncharacterized protein RSN1            283   1e-86    Zea mays [maize]
ref|XP_010478627.1|  PREDICTED: CSC1-like protein At1g32090             283   2e-86    Camelina sativa [gold-of-pleasure]
ref|XP_004983522.1|  PREDICTED: uncharacterized membrane protein ...    283   2e-86    Setaria italica
ref|XP_002464863.1|  hypothetical protein SORBIDRAFT_01g027810          282   3e-86    Sorghum bicolor [broomcorn]
ref|NP_001065504.1|  Os10g0579100                                       282   3e-86    
gb|EAY79648.1|  hypothetical protein OsI_34792                          282   3e-86    Oryza sativa Indica Group [Indian rice]
ref|XP_003574401.1|  PREDICTED: CSC1-like protein At1g32090 isofo...    281   7e-86    Brachypodium distachyon [annual false brome]
ref|XP_006662108.1|  PREDICTED: uncharacterized membrane protein ...    281   7e-86    Oryza brachyantha
ref|XP_006854105.1|  hypothetical protein AMTR_s00048p00143150          275   5e-84    Amborella trichopoda
ref|NP_001043256.1|  Os01g0534900                                       272   1e-82    
ref|XP_002440380.1|  hypothetical protein SORBIDRAFT_09g030770          270   8e-82    Sorghum bicolor [broomcorn]
ref|NP_001056508.1|  Os05g0594700                                       268   4e-81    
ref|XP_010252492.1|  PREDICTED: calcium permeable stress-gated ca...    266   2e-80    Nelumbo nucifera [Indian lotus]
ref|XP_006654880.1|  PREDICTED: uncharacterized membrane protein ...    266   2e-80    Oryza brachyantha
gb|EEE64912.1|  hypothetical protein OsJ_19772                          268   2e-80    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004960982.1|  PREDICTED: uncharacterized membrane protein ...    265   5e-80    Setaria italica
ref|XP_006469645.1|  PREDICTED: uncharacterized membrane protein ...    261   6e-80    
ref|XP_002264502.1|  PREDICTED: calcium permeable stress-gated ca...    265   7e-80    
gb|AFW81356.1|  hypothetical protein ZEAMMB73_379943                    263   1e-79    
gb|AFW81357.1|  HYP1 isoform 1                                          263   2e-79    
ref|XP_010924082.1|  PREDICTED: calcium permeable stress-gated ca...    261   6e-79    Elaeis guineensis
ref|NP_001147493.1|  LOC100281102                                       261   1e-78    Zea mays [maize]
ref|XP_009395092.1|  PREDICTED: calcium permeable stress-gated ca...    261   1e-78    
ref|XP_006447609.1|  hypothetical protein CICLE_v10014378mg             261   1e-78    Citrus clementina [clementine]
ref|XP_010231849.1|  PREDICTED: calcium permeable stress-gated ca...    260   1e-78    
ref|XP_010924080.1|  PREDICTED: calcium permeable stress-gated ca...    260   2e-78    
ref|XP_010924079.1|  PREDICTED: calcium permeable stress-gated ca...    260   2e-78    
ref|XP_003569103.1|  PREDICTED: CSC1-like protein At3g21620 isofo...    260   3e-78    Brachypodium distachyon [annual false brome]
ref|XP_010924075.1|  PREDICTED: calcium permeable stress-gated ca...    260   3e-78    Elaeis guineensis
ref|XP_010038117.1|  PREDICTED: CSC1-like protein At4g02900             259   5e-78    Eucalyptus grandis [rose gum]
ref|XP_002457968.1|  hypothetical protein SORBIDRAFT_03g023990          259   5e-78    Sorghum bicolor [broomcorn]
ref|XP_008363043.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    257   6e-78    
ref|XP_008363487.1|  PREDICTED: uncharacterized protein RSN1-like       255   6e-78    
emb|CBI32349.3|  unnamed protein product                                259   1e-77    Vitis vinifera
ref|XP_006444131.1|  hypothetical protein CICLE_v10024532mg             258   1e-77    Citrus clementina [clementine]
ref|XP_008803557.1|  PREDICTED: LOW QUALITY PROTEIN: calcium perm...    258   2e-77    Phoenix dactylifera
ref|XP_007217157.1|  hypothetical protein PRUPE_ppa001757mg             257   4e-77    Prunus persica
ref|XP_006479762.1|  PREDICTED: uncharacterized membrane protein ...    257   4e-77    
ref|XP_004968885.1|  PREDICTED: uncharacterized membrane protein ...    257   4e-77    Setaria italica
ref|XP_008229991.1|  PREDICTED: uncharacterized membrane protein ...    257   5e-77    
ref|XP_010921304.1|  PREDICTED: calcium permeable stress-gated ca...    254   9e-77    Elaeis guineensis
ref|XP_006383870.1|  early-responsive to dehydration family protein     256   9e-77    
ref|XP_006644293.1|  PREDICTED: uncharacterized membrane protein ...    256   1e-76    Oryza brachyantha
ref|XP_011047222.1|  PREDICTED: CSC1-like protein At3g21620             255   2e-76    Populus euphratica
ref|XP_010921296.1|  PREDICTED: calcium permeable stress-gated ca...    255   3e-76    Elaeis guineensis
gb|KDP20707.1|  hypothetical protein JCGZ_21178                         253   3e-76    Jatropha curcas
ref|XP_008799225.1|  PREDICTED: calcium permeable stress-gated ca...    254   4e-76    Phoenix dactylifera
ref|XP_006850790.1|  hypothetical protein AMTR_s00025p00102970          254   4e-76    Amborella trichopoda
ref|XP_002321139.1|  early-responsive to dehydration family protein     254   5e-76    Populus trichocarpa [western balsam poplar]
gb|KCW77011.1|  hypothetical protein EUGRSUZ_D01358                     252   5e-76    Eucalyptus grandis [rose gum]
ref|XP_009404947.1|  PREDICTED: calcium permeable stress-gated ca...    253   6e-76    
ref|XP_011046982.1|  PREDICTED: calcium permeable stress-gated ca...    252   8e-76    Populus euphratica
ref|XP_009404922.1|  PREDICTED: calcium permeable stress-gated ca...    253   1e-75    Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK30892.1|  hypothetical protein AALP_AA6G039600                    252   1e-75    Arabis alpina [alpine rockcress]
ref|XP_007026163.1|  ERD (early-responsive to dehydration stress)...    248   2e-75    
gb|KFK30891.1|  hypothetical protein AALP_AA6G039600                    251   2e-75    Arabis alpina [alpine rockcress]
ref|XP_008455928.1|  PREDICTED: uncharacterized membrane protein ...    250   2e-75    Cucumis melo [Oriental melon]
ref|XP_008455926.1|  PREDICTED: uncharacterized membrane protein ...    251   2e-75    
ref|XP_011016279.1|  PREDICTED: CSC1-like protein At3g21620             253   2e-75    Populus euphratica
ref|XP_007049121.1|  ERD (early-responsive to dehydration stress)...    252   3e-75    
ref|XP_010255871.1|  PREDICTED: CSC1-like protein At4g02900             252   3e-75    Nelumbo nucifera [Indian lotus]
gb|KDO78340.1|  hypothetical protein CISIN_1g004125mg                   246   3e-75    Citrus sinensis [apfelsine]
ref|XP_011463550.1|  PREDICTED: calcium permeable stress-gated ca...    251   4e-75    Fragaria vesca subsp. vesca
ref|XP_010052882.1|  PREDICTED: calcium permeable stress-gated ca...    252   4e-75    Eucalyptus grandis [rose gum]
ref|XP_010522697.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    252   5e-75    Tarenaya hassleriana [spider flower]
ref|XP_008451393.1|  PREDICTED: uncharacterized membrane protein ...    251   5e-75    Cucumis melo [Oriental melon]
ref|XP_010522696.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    252   5e-75    Tarenaya hassleriana [spider flower]
ref|XP_008451390.1|  PREDICTED: uncharacterized membrane protein ...    251   5e-75    
ref|XP_010522695.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    252   5e-75    Tarenaya hassleriana [spider flower]
ref|XP_008451392.1|  PREDICTED: uncharacterized membrane protein ...    251   6e-75    Cucumis melo [Oriental melon]
ref|XP_004289181.1|  PREDICTED: calcium permeable stress-gated ca...    251   7e-75    Fragaria vesca subsp. vesca
ref|XP_011046979.1|  PREDICTED: calcium permeable stress-gated ca...    251   7e-75    Populus euphratica
ref|XP_009418442.1|  PREDICTED: calcium permeable stress-gated ca...    251   1e-74    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008808245.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    250   1e-74    Phoenix dactylifera
ref|XP_008808246.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    250   1e-74    
gb|KHG30770.1|  putative membrane C2G11.09                              251   1e-74    Gossypium arboreum [tree cotton]
ref|XP_008455922.1|  PREDICTED: uncharacterized protein RSN1 isof...    250   2e-74    Cucumis melo [Oriental melon]
gb|KJB69241.1|  hypothetical protein B456_011G012200                    240   2e-74    Gossypium raimondii
ref|XP_006449786.1|  hypothetical protein CICLE_v10014589mg             247   2e-74    
gb|EMT18085.1|  Putative membrane protein                               250   2e-74    
ref|XP_007026162.1|  ERD (early-responsive to dehydration stress)...    247   3e-74    
ref|XP_002975592.1|  hypothetical protein SELMODRAFT_150725             249   3e-74    Selaginella moellendorffii
ref|XP_006287198.1|  hypothetical protein CARUB_v10000374mg             244   3e-74    
ref|XP_006449787.1|  hypothetical protein CICLE_v10014589mg             247   3e-74    
ref|XP_008234908.1|  PREDICTED: uncharacterized protein RSN1 isof...    249   3e-74    
ref|XP_004164564.1|  PREDICTED: uncharacterized membrane protein ...    249   4e-74    
ref|XP_004136187.1|  PREDICTED: uncharacterized membrane protein ...    249   4e-74    Cucumis sativus [cucumbers]
ref|XP_010548889.1|  PREDICTED: CSC1-like protein At3g21620             249   4e-74    Tarenaya hassleriana [spider flower]
ref|XP_006396516.1|  hypothetical protein EUTSA_v10029277mg             249   4e-74    
ref|XP_008234907.1|  PREDICTED: uncharacterized protein RSN1 isof...    249   4e-74    Prunus mume [ume]
gb|EMS65241.1|  Uncharacterized membrane protein C2G11.09               250   4e-74    Triticum urartu
gb|KJB57786.1|  hypothetical protein B456_009G181100                    249   7e-74    Gossypium raimondii
ref|XP_011007190.1|  PREDICTED: CSC1-like protein At3g21620             248   7e-74    Populus euphratica
ref|XP_002874888.1|  hypothetical protein ARALYDRAFT_352535             248   8e-74    
gb|AAC79116.1|  hypothetical protein                                    247   8e-74    Arabidopsis thaliana [mouse-ear cress]
gb|EPS74192.1|  hypothetical protein M569_00556                         248   9e-74    Genlisea aurea
ref|XP_009393118.1|  PREDICTED: CSC1-like protein At4g02900             248   1e-73    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009772361.1|  PREDICTED: CSC1-like protein At3g21620             248   1e-73    Nicotiana sylvestris
ref|XP_002271834.1|  PREDICTED: CSC1-like protein At4g02900             248   1e-73    Vitis vinifera
gb|EMS56194.1|  Uncharacterized membrane protein C2G11.09               245   1e-73    Triticum urartu
gb|KJB10672.1|  hypothetical protein B456_001G215500                    244   1e-73    Gossypium raimondii
emb|CDP03600.1|  unnamed protein product                                248   1e-73    Coffea canephora [robusta coffee]
gb|KDO78339.1|  hypothetical protein CISIN_1g004125mg                   246   2e-73    Citrus sinensis [apfelsine]
emb|CDX90914.1|  BnaA03g25940D                                          247   2e-73    
ref|XP_009134388.1|  PREDICTED: CSC1-like protein At4g02900             247   2e-73    Brassica rapa
dbj|BAK03311.1|  predicted protein                                      247   2e-73    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007026161.1|  ERD (early-responsive to dehydration stress)...    247   2e-73    
gb|EMT23208.1|  Putative membrane protein                               248   3e-73    
ref|XP_008675529.1|  PREDICTED: calcium permeable stress-gated ca...    247   3e-73    
ref|XP_008673458.1|  PREDICTED: calcium permeable stress-gated ca...    247   3e-73    
gb|KHG22816.1|  putative membrane C2G11.09                              244   4e-73    Gossypium arboreum [tree cotton]
ref|XP_006843810.1|  hypothetical protein AMTR_s00007p00254340          246   4e-73    Amborella trichopoda
gb|EMT22148.1|  Putative membrane protein                               246   4e-73    
ref|XP_006467388.1|  PREDICTED: uncharacterized membrane protein ...    246   4e-73    Citrus sinensis [apfelsine]
ref|XP_009765631.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    241   5e-73    Nicotiana sylvestris
ref|XP_007141612.1|  hypothetical protein PHAVU_008G210700g             246   5e-73    Phaseolus vulgaris [French bean]
ref|NP_192199.1|  ERD (early-responsive to dehydration stress) fa...    246   5e-73    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009592755.1|  PREDICTED: CSC1-like protein At3g21620             246   6e-73    Nicotiana tomentosiformis
ref|XP_010430503.1|  PREDICTED: CSC1-like protein At4g02900             246   6e-73    
ref|XP_002973564.1|  hypothetical protein SELMODRAFT_442177             246   6e-73    Selaginella moellendorffii
ref|XP_011086200.1|  PREDICTED: calcium permeable stress-gated ca...    246   6e-73    Sesamum indicum [beniseed]
ref|XP_010905258.1|  PREDICTED: protein OSCA1-like                      244   1e-72    Elaeis guineensis
ref|XP_010422520.1|  PREDICTED: CSC1-like protein At4g02900             245   1e-72    
emb|CDY17981.1|  BnaC03g30530D                                          245   1e-72    Brassica napus [oilseed rape]
ref|XP_006287199.1|  hypothetical protein CARUB_v10000374mg             244   1e-72    
ref|XP_006447608.1|  hypothetical protein CICLE_v10014696mg             241   1e-72    
ref|XP_003569164.1|  PREDICTED: calcium permeable stress-gated ca...    244   2e-72    Brachypodium distachyon [annual false brome]
ref|XP_003616997.1|  Transmembrane protein                              244   2e-72    Medicago truncatula
ref|XP_010455943.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    244   2e-72    Camelina sativa [gold-of-pleasure]
ref|XP_010684236.1|  PREDICTED: CSC1-like protein At4g02900             244   2e-72    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002317144.2|  early-responsive to dehydration family protein     244   2e-72    
ref|XP_010455942.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    244   2e-72    Camelina sativa [gold-of-pleasure]
gb|KJB10674.1|  hypothetical protein B456_001G215500                    244   2e-72    Gossypium raimondii
gb|KJB10673.1|  hypothetical protein B456_001G215500                    244   3e-72    Gossypium raimondii
ref|XP_011002577.1|  PREDICTED: calcium permeable stress-gated ca...    244   4e-72    Populus euphratica
emb|CDP04437.1|  unnamed protein product                                244   4e-72    Coffea canephora [robusta coffee]
ref|XP_004158583.1|  PREDICTED: uncharacterized protein RSN1-like       244   5e-72    
ref|XP_004151944.1|  PREDICTED: uncharacterized protein RSN1-like       244   5e-72    Cucumis sativus [cucumbers]
ref|NP_001291223.1|  calcium permeable stress-gated cation channel 1    243   6e-72    Populus euphratica
ref|XP_006654360.1|  PREDICTED: uncharacterized protein C354.08c-...    243   6e-72    Oryza brachyantha
ref|XP_009765629.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    241   7e-72    Nicotiana sylvestris
gb|KJB69238.1|  hypothetical protein B456_011G012200                    240   7e-72    Gossypium raimondii
ref|XP_003568506.1|  PREDICTED: CSC1-like protein At4g02900             243   8e-72    Brachypodium distachyon [annual false brome]
gb|EYU46618.1|  hypothetical protein MIMGU_mgv1a001779mg                243   9e-72    Erythranthe guttata [common monkey flower]
dbj|BAK05559.1|  predicted protein                                      243   9e-72    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004491137.1|  PREDICTED: uncharacterized protein RSN1-like       242   1e-71    Cicer arietinum [garbanzo]
ref|NP_001055457.1|  Os05g0393800                                       242   1e-71    
gb|EAY97938.1|  hypothetical protein OsI_19855                          242   2e-71    Oryza sativa Indica Group [Indian rice]
ref|XP_009396325.1|  PREDICTED: calcium permeable stress-gated ca...    242   2e-71    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010455941.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    242   2e-71    
ref|XP_011095994.1|  PREDICTED: calcium permeable stress-gated ca...    242   2e-71    Sesamum indicum [beniseed]
gb|KJB69237.1|  hypothetical protein B456_011G012200                    239   2e-71    Gossypium raimondii
ref|XP_002518432.1|  conserved hypothetical protein                     241   3e-71    
gb|KJB69239.1|  hypothetical protein B456_011G012200                    241   4e-71    Gossypium raimondii
ref|XP_003519463.1|  PREDICTED: uncharacterized membrane protein ...    241   4e-71    Glycine max [soybeans]
gb|KHN38468.1|  Putative membrane protein C2G11.09                      241   5e-71    Glycine soja [wild soybean]
dbj|BAF98597.1|  CM0545.360.nc                                          241   6e-71    Lotus japonicus
ref|XP_010488177.1|  PREDICTED: CSC1-like protein At3g21620 isofo...    239   6e-71    
ref|XP_007200309.1|  hypothetical protein PRUPE_ppa001848mg             240   7e-71    Prunus persica
gb|KDO68802.1|  hypothetical protein CISIN_1g015063mg                   233   8e-71    Citrus sinensis [apfelsine]
ref|XP_010466416.1|  PREDICTED: CSC1-like protein At3g21620 isofo...    239   8e-71    Camelina sativa [gold-of-pleasure]
gb|EPS71707.1|  hypothetical protein M569_03051                         240   8e-71    Genlisea aurea
gb|KJB42870.1|  hypothetical protein B456_007G171500                    240   8e-71    Gossypium raimondii
ref|XP_004493651.1|  PREDICTED: uncharacterized protein RSN1-like...    240   9e-71    Cicer arietinum [garbanzo]
gb|KDP30779.1|  hypothetical protein JCGZ_13722                         240   9e-71    Jatropha curcas
gb|EPS60017.1|  hypothetical protein M569_14787                         240   9e-71    Genlisea aurea
gb|KHG01808.1|  putative membrane C2G11.09                              240   9e-71    Gossypium arboreum [tree cotton]
gb|KJB42871.1|  hypothetical protein B456_007G171500                    240   1e-70    Gossypium raimondii
gb|KJB69243.1|  hypothetical protein B456_011G012200                    239   2e-70    Gossypium raimondii
gb|KJB69236.1|  hypothetical protein B456_011G012200                    239   2e-70    Gossypium raimondii
gb|EYU33878.1|  hypothetical protein MIMGU_mgv1a018274mg                239   2e-70    Erythranthe guttata [common monkey flower]
ref|XP_010488175.1|  PREDICTED: CSC1-like protein At3g21620 isofo...    239   2e-70    Camelina sativa [gold-of-pleasure]
ref|XP_010323041.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    238   2e-70    
ref|XP_004166876.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    239   2e-70    
ref|XP_008459005.1|  PREDICTED: uncharacterized membrane protein ...    239   2e-70    Cucumis melo [Oriental melon]
ref|XP_010924083.1|  PREDICTED: protein OSCA1-like isoform X6           238   3e-70    
ref|XP_010466415.1|  PREDICTED: CSC1-like protein At3g21620 isofo...    239   3e-70    
ref|XP_010323040.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    238   3e-70    
ref|XP_004242328.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    239   4e-70    Solanum lycopersicum
ref|XP_006299035.1|  hypothetical protein CARUB_v10015172mg             238   4e-70    Capsella rubella
ref|XP_009601393.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    236   4e-70    Nicotiana tomentosiformis
ref|XP_004145433.1|  PREDICTED: uncharacterized membrane protein ...    238   4e-70    Cucumis sativus [cucumbers]
ref|XP_009619499.1|  PREDICTED: calcium permeable stress-gated ca...    238   5e-70    Nicotiana tomentosiformis
ref|XP_010539247.1|  PREDICTED: calcium permeable stress-gated ca...    238   7e-70    Tarenaya hassleriana [spider flower]
ref|XP_011079804.1|  PREDICTED: CSC1-like protein At4g02900             238   8e-70    Sesamum indicum [beniseed]
ref|XP_009625807.1|  PREDICTED: CSC1-like protein At4g02900             237   9e-70    Nicotiana tomentosiformis
emb|CDY48898.1|  BnaA03g36370D                                          237   9e-70    Brassica napus [oilseed rape]
ref|XP_010099166.1|  Uncharacterized membrane protein                   238   1e-69    Morus notabilis
ref|NP_188799.1|  early-responsive to dehydration stress-related ...    237   1e-69    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006363038.1|  PREDICTED: uncharacterized protein RSN1-like...    237   1e-69    Solanum tuberosum [potatoes]
dbj|BAD94445.1|  hypothetical protein                                   237   1e-69    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006406250.1|  hypothetical protein EUTSA_v10020132mg             237   1e-69    Eutrema salsugineum [saltwater cress]
ref|XP_009771290.1|  PREDICTED: CSC1-like protein At4g02900             235   2e-69    Nicotiana sylvestris
gb|EYU27725.1|  hypothetical protein MIMGU_mgv1a001730mg                237   2e-69    Erythranthe guttata [common monkey flower]
ref|XP_004243535.1|  PREDICTED: CSC1-like protein At3g21620             237   2e-69    Solanum lycopersicum
ref|XP_004293317.1|  PREDICTED: calcium permeable stress-gated ca...    237   2e-69    Fragaria vesca subsp. vesca
emb|CDY32438.1|  BnaC03g42220D                                          236   2e-69    Brassica napus [oilseed rape]
ref|XP_009601331.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    236   2e-69    Nicotiana tomentosiformis
ref|XP_008386531.1|  PREDICTED: uncharacterized protein RSN1            236   2e-69    Malus domestica [apple tree]
ref|XP_006283166.1|  hypothetical protein CARUB_v10004197mg             236   2e-69    Capsella rubella
emb|CDP11354.1|  unnamed protein product                                236   2e-69    Coffea canephora [robusta coffee]
ref|XP_002885454.1|  hypothetical protein ARALYDRAFT_342312             236   2e-69    Arabidopsis lyrata subsp. lyrata
ref|XP_006387597.1|  hypothetical protein POPTR_0796s00210g             235   2e-69    
ref|XP_010326353.1|  PREDICTED: CSC1-like protein At4g02900             236   2e-69    Solanum lycopersicum
ref|XP_010090368.1|  Uncharacterized membrane protein                   237   3e-69    
ref|XP_006355875.1|  PREDICTED: uncharacterized protein C354.08c-...    236   3e-69    Solanum tuberosum [potatoes]
ref|XP_010439363.1|  PREDICTED: calcium permeable stress-gated ca...    236   4e-69    
ref|XP_003520558.1|  PREDICTED: uncharacterized membrane protein ...    235   4e-69    Glycine max [soybeans]
ref|XP_009803475.1|  PREDICTED: calcium permeable stress-gated ca...    235   7e-69    Nicotiana sylvestris
ref|XP_010657219.1|  PREDICTED: CSC1-like protein At3g21620             235   7e-69    Vitis vinifera
emb|CDY12941.1|  BnaA09g13330D                                          235   8e-69    Brassica napus [oilseed rape]
ref|XP_010448929.1|  PREDICTED: calcium permeable stress-gated ca...    235   8e-69    
ref|XP_011046977.1|  PREDICTED: calcium permeable stress-gated ca...    235   9e-69    Populus euphratica
ref|XP_011082546.1|  PREDICTED: CSC1-like protein At4g02900             235   9e-69    
ref|XP_007050676.1|  ERD (early-responsive to dehydration stress)...    234   9e-69    
ref|XP_009135761.1|  PREDICTED: CSC1-like protein At3g21620             234   1e-68    
ref|XP_006604421.1|  PREDICTED: uncharacterized protein RSN1-like...    234   1e-68    
ref|XP_006604422.1|  PREDICTED: uncharacterized protein RSN1-like...    234   1e-68    
ref|XP_009356857.1|  PREDICTED: CSC1-like protein At4g02900             234   1e-68    
dbj|BAJ96091.1|  predicted protein                                      234   2e-68    
ref|XP_006348154.1|  PREDICTED: uncharacterized protein RSN1-like...    233   2e-68    
gb|EMS63788.1|  Uncharacterized membrane protein C2G11.09               234   3e-68    
ref|XP_009613689.1|  PREDICTED: calcium permeable stress-gated ca...    233   3e-68    
ref|XP_010546606.1|  PREDICTED: CSC1-like protein At1g11960             234   3e-68    
ref|XP_002529341.1|  conserved hypothetical protein                     233   3e-68    
ref|XP_010510410.1|  PREDICTED: CSC1-like protein At3g21620             233   4e-68    
ref|XP_011046975.1|  PREDICTED: calcium permeable stress-gated ca...    233   4e-68    
ref|XP_004293316.1|  PREDICTED: calcium permeable stress-gated ca...    233   4e-68    
ref|XP_006352784.1|  PREDICTED: uncharacterized membrane protein ...    233   4e-68    
gb|EPS71959.1|  hypothetical protein M569_02795                         233   4e-68    
gb|KDO39720.1|  hypothetical protein CISIN_1g048588mg                   230   5e-68    
ref|XP_002301612.2|  early-responsive to dehydration family protein     233   5e-68    
ref|XP_007162399.1|  hypothetical protein PHAVU_001G148800g             233   5e-68    
ref|XP_010434078.1|  PREDICTED: calcium permeable stress-gated ca...    233   6e-68    
ref|XP_004232686.1|  PREDICTED: calcium permeable stress-gated ca...    232   7e-68    
ref|XP_010278611.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    229   7e-68    
ref|XP_006348153.1|  PREDICTED: uncharacterized protein RSN1-like...    232   9e-68    
ref|XP_010686787.1|  PREDICTED: calcium permeable stress-gated ca...    232   1e-67    
ref|XP_004962175.1|  PREDICTED: uncharacterized protein RSN1-like       232   1e-67    
ref|XP_010089460.1|  Uncharacterized membrane protein                   232   1e-67    
dbj|BAD93792.1|  hypothetical protein                                   232   1e-67    
ref|XP_009772257.1|  PREDICTED: calcium permeable stress-gated ca...    231   1e-67    
ref|NP_193943.2|  early-responsive to dehydration stress-related ...    231   1e-67    
ref|XP_006413690.1|  hypothetical protein EUTSA_v10024476mg             231   1e-67    
emb|CDX79125.1|  BnaA01g11920D                                          230   1e-67    
ref|XP_004507664.1|  PREDICTED: uncharacterized membrane protein ...    231   2e-67    
ref|XP_011046985.1|  PREDICTED: calcium permeable stress-gated ca...    234   2e-67    
ref|XP_003553451.1|  PREDICTED: uncharacterized protein RSN1-like...    231   2e-67    
dbj|BAK07493.1|  predicted protein                                      224   2e-67    
gb|EMT11783.1|  Putative membrane protein                               231   3e-67    
emb|CDX82907.1|  BnaC01g13570D                                          231   3e-67    
ref|XP_009135587.1|  PREDICTED: calcium permeable stress-gated ca...    231   3e-67    
ref|XP_003555683.1|  PREDICTED: uncharacterized membrane protein ...    231   3e-67    
ref|XP_010278603.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    229   4e-67    
ref|XP_002867790.1|  hypothetical protein ARALYDRAFT_492658             230   4e-67    
gb|KHN28986.1|  Putative membrane protein C2G11.09                      230   4e-67    
ref|XP_010035539.1|  PREDICTED: CSC1-like protein At3g21620             230   5e-67    
gb|KEH23730.1|  ERD (early-responsive to dehydration stress) fami...    230   5e-67    
ref|XP_003610472.1|  Membrane protein, putative                         230   6e-67    
gb|EMT27455.1|  Putative membrane protein                               230   6e-67    
ref|XP_011046984.1|  PREDICTED: uncharacterized protein LOC105141...    234   6e-67    
ref|XP_010278586.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    230   6e-67    
ref|XP_004295293.1|  PREDICTED: calcium permeable stress-gated ca...    230   6e-67    
ref|XP_010458617.1|  PREDICTED: CSC1-like protein At1g11960             229   8e-67    
ref|XP_003542161.1|  PREDICTED: uncharacterized membrane protein ...    229   8e-67    
ref|XP_004231619.1|  PREDICTED: calcium permeable stress-gated ca...    229   1e-66    
ref|XP_010493595.1|  PREDICTED: LOW QUALITY PROTEIN: CSC1-like pr...    229   1e-66    
gb|EMS66710.1|  Uncharacterized membrane protein C2G11.09               228   1e-66    
ref|XP_001754358.1|  predicted protein                                  228   1e-66    
ref|XP_008384098.1|  PREDICTED: uncharacterized protein RSN1            228   2e-66    
emb|CDY27443.1|  BnaC03g64830D                                          228   2e-66    
ref|XP_007145950.1|  hypothetical protein PHAVU_006G000300g             228   3e-66    
ref|XP_009357481.1|  PREDICTED: calcium permeable stress-gated ca...    228   3e-66    
gb|KDP21496.1|  hypothetical protein JCGZ_21967                         228   4e-66    
ref|XP_008371060.1|  PREDICTED: transmembrane protein 63B-like          228   4e-66    
gb|AFW78070.1|  hypothetical protein ZEAMMB73_829601                    227   6e-66    
gb|EMS50375.1|  Transmembrane protein 63B                               227   7e-66    
ref|XP_002441130.1|  hypothetical protein SORBIDRAFT_09g021010          227   7e-66    
ref|XP_006306821.1|  hypothetical protein CARUB_v10008363mg             227   8e-66    
ref|XP_001782141.1|  predicted protein                                  226   8e-66    
ref|XP_011014901.1|  PREDICTED: calcium permeable stress-gated ca...    226   1e-65    
ref|XP_010476146.1|  PREDICTED: CSC1-like protein At1g11960             226   1e-65    
ref|XP_008649660.1|  PREDICTED: LOW QUALITY PROTEIN: calcium perm...    226   1e-65    
emb|CDX76386.1|  BnaA08g10140D                                          225   1e-65    
ref|XP_009357605.1|  PREDICTED: calcium permeable stress-gated ca...    226   2e-65    
ref|XP_008224710.1|  PREDICTED: uncharacterized membrane protein ...    226   2e-65    
ref|XP_006350470.1|  PREDICTED: uncharacterized membrane protein ...    226   2e-65    
ref|XP_009108550.1|  PREDICTED: calcium permeable stress-gated ca...    226   2e-65    
ref|XP_009147369.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    225   3e-65    
ref|XP_009147329.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    225   3e-65    
ref|XP_009147362.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    225   3e-65    
ref|XP_010449938.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    224   5e-65    
emb|CDY22920.1|  BnaA01g18580D                                          224   5e-65    
ref|XP_010449936.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    224   5e-65    
emb|CDY49293.1|  BnaC01g22480D                                          224   5e-65    
ref|XP_003549667.1|  PREDICTED: uncharacterized membrane protein ...    224   5e-65    
ref|XP_010440309.1|  PREDICTED: CSC1-like protein At4g15430             224   5e-65    
gb|EYU38139.1|  hypothetical protein MIMGU_mgv1a022024mg                224   6e-65    
ref|XP_006285697.1|  hypothetical protein CARUB_v10007167mg             224   1e-64    
ref|XP_006414510.1|  hypothetical protein EUTSA_v10024504mg             221   1e-64    
ref|XP_003529649.1|  PREDICTED: uncharacterized membrane protein ...    224   1e-64    
ref|XP_010924081.1|  PREDICTED: calcium permeable stress-gated ca...    223   2e-64    
ref|XP_010434984.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    223   2e-64    
ref|XP_010434983.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    223   2e-64    
ref|XP_002892667.1|  hypothetical protein ARALYDRAFT_312226             223   2e-64    
ref|XP_009113086.1|  PREDICTED: CSC1-like protein At1g62320             223   3e-64    
ref|XP_006417282.1|  hypothetical protein EUTSA_v10006870mg             223   3e-64    
ref|XP_007211353.1|  hypothetical protein PRUPE_ppa001728mg             222   3e-64    
ref|XP_007153987.1|  hypothetical protein PHAVU_003G081500g             222   4e-64    
emb|CDY32032.1|  BnaA03g60360D                                          222   5e-64    
ref|XP_009107840.1|  PREDICTED: CSC1-like protein At4g15430             221   7e-64    
ref|XP_010418218.1|  PREDICTED: CSC1-like protein At1g62320             221   7e-64    
ref|XP_006414511.1|  hypothetical protein EUTSA_v10024504mg             221   7e-64    
emb|CDY19541.1|  BnaC09g13620D                                          221   8e-64    
emb|CDY09064.1|  BnaC08g10180D                                          221   8e-64    
ref|XP_002870239.1|  hypothetical protein ARALYDRAFT_493346             221   1e-63    
ref|XP_010430277.1|  PREDICTED: CSC1-like protein At1g62320             221   1e-63    
ref|NP_193278.4|  ERD (early-responsive to dehydration stress) fa...    221   2e-63    
ref|NP_001154237.1|  ERD (early-responsive to dehydration stress)...    220   2e-63    
ref|XP_009123383.1|  PREDICTED: CSC1-like protein At1g62320             220   2e-63    
emb|CDY30043.1|  BnaC05g09770D                                          221   2e-63    
emb|CDX98089.1|  BnaA06g08400D                                          220   2e-63    
ref|XP_009148626.1|  PREDICTED: CSC1-like protein At1g11960             220   2e-63    
ref|XP_006391905.1|  hypothetical protein EUTSA_v10023297mg             220   3e-63    
gb|KHG10946.1|  putative membrane C2G11.09                              219   3e-63    
ref|NP_172660.5|  putative ERD4 protein                                 219   3e-63    
gb|KJB42059.1|  hypothetical protein B456_007G134700                    219   4e-63    
ref|XP_002886475.1|  F24O1.4                                            219   9e-63    
ref|XP_010473449.1|  PREDICTED: CSC1-like protein At1g62320             218   9e-63    
gb|KJB22580.1|  hypothetical protein B456_004G055300                    213   2e-62    
gb|KJB22581.1|  hypothetical protein B456_004G055300                    214   4e-62    
gb|KHG01781.1|  putative membrane C2G11.09                              216   4e-62    
gb|KHG17938.1|  putative membrane C2G11.09                              216   7e-62    
ref|XP_010496174.1|  PREDICTED: protein OSCA1-like                      216   8e-62    
gb|AAC17615.1|  Similar to hypothetical protein HYP1 gb|Z97338 fr...    215   1e-61    
emb|CDY21297.1|  BnaC03g29810D                                          215   1e-61    
emb|CDX90856.1|  BnaA03g25360D                                          214   2e-61    
ref|XP_010422263.1|  PREDICTED: LOW QUALITY PROTEIN: protein OSCA...    214   3e-61    
ref|XP_002533077.1|  conserved hypothetical protein                     214   3e-61    
ref|XP_002969287.1|  hypothetical protein SELMODRAFT_91711              214   5e-61    
ref|XP_006300401.1|  hypothetical protein CARUB_v10019839mg             214   5e-61    
sp|F4HYR3.2|CSCL6_ARATH  RecName: Full=CSC1-like protein At1g62320      213   1e-60    
ref|NP_192343.1|  early-responsive to dehydration stress-related ...    213   1e-60    
gb|AAL07154.1|  unknown protein                                         213   1e-60    
ref|XP_006383869.1|  hypothetical protein POPTR_0004s00750g             213   1e-60    
ref|XP_006396699.1|  hypothetical protein EUTSA_v10028449mg             211   2e-60    
ref|XP_006287117.1|  hypothetical protein CARUB_v10000278mg             211   5e-60    
ref|XP_006396700.1|  hypothetical protein EUTSA_v10028449mg             211   5e-60    
ref|XP_009134294.1|  PREDICTED: CSC1-like protein At4g04340             210   1e-59    
emb|CAA18115.1|  putative protein                                       207   5e-59    
ref|NP_176422.1|  ERD (early-responsive to dehydration stress) fa...    207   8e-59    
ref|XP_002872689.1|  hypothetical protein ARALYDRAFT_911697             207   1e-58    
ref|XP_004292602.1|  PREDICTED: CSC1-like protein At4g02900             206   2e-58    
gb|KHN19872.1|  Putative membrane protein C2G11.09                      203   2e-57    
ref|XP_002986828.1|  hypothetical protein SELMODRAFT_425683             194   2e-54    
emb|CAB10322.1|  hypothetical protein                                   179   5e-49    
ref|XP_001770572.1|  predicted protein                                  167   2e-44    
ref|XP_001757556.1|  predicted protein                                  161   3e-42    
ref|XP_001759032.1|  predicted protein                                  160   1e-41    
gb|KJB42060.1|  hypothetical protein B456_007G134700                    156   1e-40    
gb|KJB42062.1|  hypothetical protein B456_007G134700                    156   1e-40    
ref|XP_002317143.2|  hypothetical protein POPTR_0011s01450g             141   3e-36    
gb|KJB57183.1|  hypothetical protein B456_009G152500                    140   2e-35    
gb|KJB57182.1|  hypothetical protein B456_009G152500                    140   5e-35    
gb|KJB57184.1|  hypothetical protein B456_009G152500                    140   5e-35    
gb|KJB57185.1|  hypothetical protein B456_009G152500                    140   1e-34    
ref|XP_011096640.1|  PREDICTED: CSC1-like protein ERD4                  139   2e-34    
ref|XP_010258592.1|  PREDICTED: CSC1-like protein HYP1 isoform X2       138   2e-34    
gb|EYU19152.1|  hypothetical protein MIMGU_mgv1a001965mg                137   3e-34    
ref|XP_010258582.1|  PREDICTED: CSC1-like protein HYP1 isoform X1       138   5e-34    
ref|XP_010052015.1|  PREDICTED: CSC1-like protein ERD4                  138   6e-34    
gb|EYU19153.1|  hypothetical protein MIMGU_mgv1a001965mg                138   7e-34    
emb|CDY67965.1|  BnaCnng57110D                                          135   2e-33    
ref|XP_006448975.1|  hypothetical protein CICLE_v100144071mg            134   2e-33    
gb|KHG13189.1|  putative membrane C2G11.09                              136   3e-33    
gb|KDO75370.1|  hypothetical protein CISIN_1g004795mg                   134   5e-33    
gb|KDO75375.1|  hypothetical protein CISIN_1g004795mg                   134   5e-33    
ref|XP_007211358.1|  hypothetical protein PRUPE_ppa002050mg             135   5e-33    
ref|XP_008225537.1|  PREDICTED: uncharacterized membrane protein ...    134   1e-32    
ref|XP_009115162.1|  PREDICTED: CSC1-like protein ERD4                  134   1e-32    
gb|KDO75374.1|  hypothetical protein CISIN_1g004795mg                   133   1e-32    
emb|CDY02286.1|  BnaA09g26160D                                          134   1e-32    
ref|XP_006448976.1|  hypothetical protein CICLE_v100144071mg            133   1e-32    
gb|KDO75369.1|  hypothetical protein CISIN_1g004795mg                   133   1e-32    
gb|KJB66976.1|  hypothetical protein B456_010G168400                    134   2e-32    
gb|KDO75368.1|  hypothetical protein CISIN_1g004795mg                   133   3e-32    
ref|XP_006468078.1|  PREDICTED: uncharacterized membrane protein ...    133   4e-32    
gb|KDO75367.1|  hypothetical protein CISIN_1g004795mg                   132   5e-32    
ref|XP_011010302.1|  PREDICTED: CSC1-like protein HYP1                  132   5e-32    
ref|XP_009377479.1|  PREDICTED: CSC1-like protein ERD4                  132   5e-32    
gb|KCW75871.1|  hypothetical protein EUGRSUZ_D00260                     132   6e-32    
ref|XP_007032618.1|  Early-responsive to dehydration stress prote...    131   7e-32    
gb|KDP38019.1|  hypothetical protein JCGZ_04662                         132   8e-32    
ref|XP_007032617.1|  Early-responsive to dehydration stress prote...    131   2e-31    
emb|CDP05663.1|  unnamed protein product                                130   2e-31    
ref|XP_002305383.1|  HYPOTHETICAL protein 1                             130   3e-31    
emb|CBI30957.3|  unnamed protein product                                130   3e-31    
ref|XP_010258239.1|  PREDICTED: CSC1-like protein HYP1                  130   3e-31    
ref|XP_008371649.1|  PREDICTED: uncharacterized membrane protein ...    130   4e-31    
emb|CAN64310.1|  hypothetical protein VITISV_037471                     129   4e-31    
ref|XP_002280109.1|  PREDICTED: CSC1-like protein ERD4                  130   5e-31    
ref|XP_006306879.1|  hypothetical protein CARUB_v10008433mg             129   5e-31    
ref|XP_009781612.1|  PREDICTED: CSC1-like protein ERD4                  129   7e-31    
gb|KHG16289.1|  putative membrane C2G11.09                              129   8e-31    
gb|KCW75872.1|  hypothetical protein EUGRSUZ_D00261                     129   9e-31    
ref|XP_007217011.1|  hypothetical protein PRUPE_ppa002110mg             129   9e-31    
ref|XP_004134564.1|  PREDICTED: uncharacterized membrane protein ...    129   1e-30    
ref|XP_004293515.1|  PREDICTED: CSC1-like protein ERD4                  129   1e-30    
ref|XP_010052016.1|  PREDICTED: CSC1-like protein ERD4                  129   1e-30    
ref|XP_008230809.1|  PREDICTED: phosphate metabolism protein 7-li...    127   1e-30    
ref|XP_009377481.1|  PREDICTED: CSC1-like protein ERD4                  128   2e-30    
dbj|BAB63915.1|  ERD4 protein                                           127   2e-30    
gb|ABR16200.1|  unknown                                                 128   2e-30    
gb|AES74767.2|  ERD (early-responsive to dehydration stress) fami...    126   2e-30    
sp|A9LIW2.2|CSC1L_BRAJU  RecName: Full=CSC1-like protein ERD4; Al...    127   3e-30    
ref|XP_006415482.1|  hypothetical protein EUTSA_v10006933mg             126   3e-30    
ref|XP_008646681.1|  PREDICTED: uncharacterized membrane protein ...    122   3e-30    
ref|XP_009611468.1|  PREDICTED: CSC1-like protein ERD4 isoform X2       127   3e-30    
ref|XP_006364887.1|  PREDICTED: uncharacterized membrane protein ...    127   3e-30    
ref|XP_003618548.1|  Membrane protein, putative                         127   4e-30    
ref|XP_004158645.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    127   4e-30    
ref|XP_007024954.1|  Early-responsive to dehydration stress prote...    126   4e-30    
ref|NP_564354.1|  Early-responsive to dehydration stress protein ...    127   4e-30    
ref|XP_008230808.1|  PREDICTED: phosphate metabolism protein 7-li...    127   5e-30    
gb|AES74766.2|  ERD (early-responsive to dehydration stress) fami...    127   5e-30    
ref|XP_009611467.1|  PREDICTED: CSC1-like protein ERD4 isoform X1       127   5e-30    
ref|XP_008439583.1|  PREDICTED: uncharacterized membrane protein ...    127   6e-30    
ref|XP_002890865.1|  early-responsive to dehydration 4                  127   6e-30    
ref|NP_001288888.1|  CSC1-like protein ERD4                             126   7e-30    
emb|CDY12050.1|  BnaC03g59660D                                          126   7e-30    
ref|XP_003621301.1|  Membrane protein, putative                         127   7e-30    
ref|XP_004244862.1|  PREDICTED: CSC1-like protein ERD4                  126   7e-30    
ref|NP_001108122.1|  early responsive to dehydration protein            126   7e-30    
ref|XP_001770612.1|  predicted protein                                  126   7e-30    



>ref|XP_007210357.1| hypothetical protein PRUPE_ppa001580mg [Prunus persica]
 gb|EMJ11556.1| hypothetical protein PRUPE_ppa001580mg [Prunus persica]
Length=799

 Score =   321 bits (822),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 145/179 (81%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDYN LK ER+P K+PT+K GFLGLWG+ VDS+EYYK+QIK+FD+++T+E++KILK
Sbjct  253  LQNWLDYNLLKFERHPDKKPTTKKGFLGLWGESVDSIEYYKQQIKQFDKIMTLEQQKILK  312

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+P AFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRD++W+NL+I FVSLSIR
Sbjct  313  DPKSILPVAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDVYWRNLAIPFVSLSIR  372

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +LVI +SVFALVFFY+IPIAFVQSLANLEGLE+VAPFLRP+IE KF+KSFLQGFLPGLA
Sbjct  373  KLVITLSVFALVFFYMIPIAFVQSLANLEGLERVAPFLRPVIELKFIKSFLQGFLPGLA  431



>ref|XP_008238126.1| PREDICTED: uncharacterized protein RSN1 [Prunus mume]
Length=799

 Score =   320 bits (819),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDYN LK ER+P K+PT++ GFLGLWG+ VDS+EYYK+QIK+FD+++T+E++KILK
Sbjct  253  LQNWLDYNLLKFERHPDKKPTTRKGFLGLWGESVDSIEYYKQQIKQFDKIMTLEQQKILK  312

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+P AFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRD++W+NL+I FVSLSIR
Sbjct  313  DPKSILPVAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDVYWRNLAIPFVSLSIR  372

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +LVI +SVFALVFFY+IPIAFVQSLANLEGLE+VAPFLRP+IE KF+KSFLQGFLPGLA
Sbjct  373  KLVITLSVFALVFFYMIPIAFVQSLANLEGLERVAPFLRPVIELKFIKSFLQGFLPGLA  431



>ref|XP_011082330.1| PREDICTED: CSC1-like protein At1g32090 [Sesamum indicum]
Length=800

 Score =   319 bits (817),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDYNQLK ER+P KRPT K GFLGLWG++VDS++YYK QIK+ D+ LT+ER+KILK
Sbjct  253  LQNWLDYNQLKFERHPDKRPTRKRGFLGLWGERVDSIDYYKEQIKDLDKTLTMERQKILK  312

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            D K + PAAFVSF+SRWGAAVCAQTQQSKNPTLWLT+WAPEP D++WKNL+I FVSLSIR
Sbjct  313  DSKSVTPAAFVSFNSRWGAAVCAQTQQSKNPTLWLTSWAPEPHDVYWKNLAIPFVSLSIR  372

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +LVI++SVFALVFFY+IPIAFVQSLANLEGLEKVAPFLRPLIEW FVKSFLQGFLPGLA
Sbjct  373  KLVISLSVFALVFFYMIPIAFVQSLANLEGLEKVAPFLRPLIEWSFVKSFLQGFLPGLA  431



>ref|XP_004245915.1| PREDICTED: CSC1-like protein At1g32090 [Solanum lycopersicum]
Length=815

 Score =   318 bits (815),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDY QLK ERNP KRP +K GFLGLWG++VDS+EYYK+Q+KEFDR LT+ERE ILK
Sbjct  253  LQNWLDYYQLKFERNPEKRPLTKKGFLGLWGERVDSIEYYKQQLKEFDRRLTMERESILK  312

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            D K I+PAAFVSF+SR GAAVCAQTQQSKNPTLWLTNWAPEPRDI+W+NLSISF SL++R
Sbjct  313  DSKSIMPAAFVSFNSRCGAAVCAQTQQSKNPTLWLTNWAPEPRDIYWRNLSISFFSLTLR  372

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +L+I+++VFALVFFY+IPIAFVQSLANLEGLEKVAPFLRPLIEWK +KSFLQGFLPGLA
Sbjct  373  KLLISVAVFALVFFYMIPIAFVQSLANLEGLEKVAPFLRPLIEWKVIKSFLQGFLPGLA  431



>ref|XP_011074804.1| PREDICTED: CSC1-like protein At1g32090 [Sesamum indicum]
Length=775

 Score =   317 bits (813),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDYNQLK ERNP  RPT K GFLGLWG++VDS+++YK QIK  D  LT+E +K+LK
Sbjct  254  LQNWLDYNQLKFERNPNNRPTKKRGFLGLWGQRVDSIDFYKEQIKHLDIQLTMECKKVLK  313

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK +IPAAFVSF SRWGAAVCAQTQQSKNPTLWLTNWAPEPRD++WKNL+I +VSL+IR
Sbjct  314  DPKSVIPAAFVSFKSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDVYWKNLAIPYVSLTIR  373

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RLVIAIS+FALVFFY+IPIAFVQSLANLEGL+KVAPFLRPLIEWK VKSFLQGFLPGLA
Sbjct  374  RLVIAISMFALVFFYMIPIAFVQSLANLEGLQKVAPFLRPLIEWKVVKSFLQGFLPGLA  432



>gb|KJB25199.1| hypothetical protein B456_004G180800, partial [Gossypium raimondii]
Length=511

 Score =   310 bits (794),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDYNQLK E +  KRPT KTGFLGLWGK+VDS+++YK+QIKEFD+ +T+ER+K+LK
Sbjct  120  LQNWLDYNQLKFESHSEKRPTKKTGFLGLWGKRVDSIDFYKQQIKEFDKNMTLERQKVLK  179

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            D K I+P AFVSF SRWGAAVCAQTQQSKNPTLWL NWAPEPRDI+W+NL+I F+SL+IR
Sbjct  180  DTKSILPVAFVSFKSRWGAAVCAQTQQSKNPTLWLANWAPEPRDIYWQNLAIPFLSLTIR  239

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +L+I++SVFALVFFY+IPIAFVQSLANLEGLE+VAPFLRP+IE KF+KSFLQGFLPGLA
Sbjct  240  KLIISLSVFALVFFYMIPIAFVQSLANLEGLERVAPFLRPVIELKFIKSFLQGFLPGLA  298



>ref|XP_006352918.1| PREDICTED: uncharacterized protein RSN1-like [Solanum tuberosum]
Length=815

 Score =   318 bits (814),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDYNQLK ERNP KRP +K GFLGLWG++VDS++YYK+Q+KEFDR LT+ERE ILK
Sbjct  253  LQNWLDYNQLKFERNPEKRPITKKGFLGLWGERVDSIDYYKQQLKEFDRRLTMERESILK  312

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            D K I+PAAFVSF+SR GAAVCAQTQQSKNPTLWLTNWAPEPRDI+W NLSISF SL++R
Sbjct  313  DSKSIMPAAFVSFNSRCGAAVCAQTQQSKNPTLWLTNWAPEPRDIYWSNLSISFFSLTLR  372

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +L+I+ +VFALVFFY+IPIAFVQSLANLEGLEKVAPFLRPLIEWK +KSFLQGFLPGLA
Sbjct  373  KLLISAAVFALVFFYMIPIAFVQSLANLEGLEKVAPFLRPLIEWKVIKSFLQGFLPGLA  431



>gb|KDP46674.1| hypothetical protein JCGZ_12198 [Jatropha curcas]
Length=797

 Score =   317 bits (811),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDYNQLK ER+P KRPT KTGFLGLWG++VDS++YYK+QI+E ++ + +ER+KILK
Sbjct  253  LQNWLDYNQLKFERHPDKRPTRKTGFLGLWGERVDSIDYYKQQIQELEKRMALERQKILK  312

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            D K I+P AFVSF+SRWGAAVCAQTQQSKNPTLWLTNWAPEPRDI+W+NL+I FVSLSIR
Sbjct  313  DAKSILPVAFVSFNSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIYWRNLAIPFVSLSIR  372

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +L+I++SVFALVFFY+IPIAFVQSLANLEGLEKVAPFLRP+IE KF+KSFLQGFLPGLA
Sbjct  373  KLIISLSVFALVFFYMIPIAFVQSLANLEGLEKVAPFLRPVIELKFIKSFLQGFLPGLA  431



>ref|XP_009784323.1| PREDICTED: CSC1-like protein At1g32090 [Nicotiana sylvestris]
Length=815

 Score =   316 bits (810),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDYNQLK ERNP KRPT K GFLGLWG+KVDS++YYK+Q+KE DR LT+ERE ILK
Sbjct  253  LQNWLDYNQLKFERNPEKRPTKKKGFLGLWGEKVDSIDYYKQQLKELDRRLTMEREGILK  312

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            + K I+PAAFVSF+SR GAAVCAQTQQSKNPTLWLTNWAPEPRD++W NLSISF SLS+R
Sbjct  313  NSKSIMPAAFVSFNSRCGAAVCAQTQQSKNPTLWLTNWAPEPRDVYWNNLSISFFSLSLR  372

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +L+I+++VFALVFFY+IPI FVQSLANLEGLEKVAPFLRPLIEWK +KSFLQGFLPGLA
Sbjct  373  KLLISVAVFALVFFYMIPITFVQSLANLEGLEKVAPFLRPLIEWKIIKSFLQGFLPGLA  431



>ref|XP_008373502.1| PREDICTED: uncharacterized protein RSN1 [Malus domestica]
Length=805

 Score =   316 bits (810),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 142/179 (79%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDYN LK ER+P K+PT K GFLGLWG KVDS+EYYK+QI+EF++ +T+ER+KILK
Sbjct  253  LQNWLDYNLLKFERHPDKKPTMKNGFLGLWGTKVDSIEYYKKQIQEFEKSMTLERQKILK  312

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            D K I+P AFVSFDSRWGAAVCAQTQQS+NPTLWLTNWAPEPRD++W+NL+I F+SLSIR
Sbjct  313  DTKSILPVAFVSFDSRWGAAVCAQTQQSRNPTLWLTNWAPEPRDVYWRNLAIPFISLSIR  372

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +LVI++SVFALVFFY+IPIAFVQSLANLEGLE+VAPFLRP++E KF+KSFLQGFLPGLA
Sbjct  373  KLVISLSVFALVFFYMIPIAFVQSLANLEGLERVAPFLRPVVELKFIKSFLQGFLPGLA  431



>ref|XP_007040777.1| Early-responsive to dehydration stress protein isoform 2 [Theobroma 
cacao]
 gb|EOY25278.1| Early-responsive to dehydration stress protein isoform 2 [Theobroma 
cacao]
Length=804

 Score =   316 bits (810),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDYNQLK ER+P KRPT K GFLGLWG++VDS+++YK Q+KEFD+ + +ER+K+LK
Sbjct  253  LQNWLDYNQLKFERHPEKRPTKKAGFLGLWGERVDSIDFYKHQVKEFDKKMALERQKVLK  312

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+P AFVSF SRWGAAVCAQTQQSKNPTLWLTNWAPEPRD++W+NL+I FVSL+IR
Sbjct  313  DPKSILPVAFVSFKSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDVYWRNLAIPFVSLTIR  372

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +L+I++SVFALVFFY+IPIAFVQSLANLEGLE+VAPFLRP+IE KF+KSFLQGFLPGLA
Sbjct  373  KLIISLSVFALVFFYMIPIAFVQSLANLEGLERVAPFLRPVIELKFIKSFLQGFLPGLA  431



>ref|XP_007040776.1| Early-responsive to dehydration stress protein isoform 1 [Theobroma 
cacao]
 gb|EOY25277.1| Early-responsive to dehydration stress protein isoform 1 [Theobroma 
cacao]
Length=791

 Score =   315 bits (808),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDYNQLK ER+P KRPT K GFLGLWG++VDS+++YK Q+KEFD+ + +ER+K+LK
Sbjct  253  LQNWLDYNQLKFERHPEKRPTKKAGFLGLWGERVDSIDFYKHQVKEFDKKMALERQKVLK  312

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+P AFVSF SRWGAAVCAQTQQSKNPTLWLTNWAPEPRD++W+NL+I FVSL+IR
Sbjct  313  DPKSILPVAFVSFKSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDVYWRNLAIPFVSLTIR  372

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +L+I++SVFALVFFY+IPIAFVQSLANLEGLE+VAPFLRP+IE KF+KSFLQGFLPGLA
Sbjct  373  KLIISLSVFALVFFYMIPIAFVQSLANLEGLERVAPFLRPVIELKFIKSFLQGFLPGLA  431



>ref|XP_009603996.1| PREDICTED: CSC1-like protein At1g32090 [Nicotiana tomentosiformis]
Length=809

 Score =   315 bits (808),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 145/179 (81%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDYNQLK ERNP KRPT K GFLGLWG++VDS++YYK+Q+KE DR LT+ERE ILK
Sbjct  253  LQNWLDYNQLKFERNPEKRPTKKKGFLGLWGERVDSIDYYKQQLKELDRRLTMEREGILK  312

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            + K I+PAAFVSF+SR GAAVCAQTQQSKNPTLWLTNWAPEPRD++W NLSISF SLS+R
Sbjct  313  NSKSIMPAAFVSFNSRCGAAVCAQTQQSKNPTLWLTNWAPEPRDVYWNNLSISFFSLSLR  372

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +L+I+++VFALVFFY+IPI FVQSLANLEGLEKVAPFLRPLIEWK +KSFLQGFLPGLA
Sbjct  373  KLLISVAVFALVFFYMIPITFVQSLANLEGLEKVAPFLRPLIEWKIIKSFLQGFLPGLA  431



>gb|KJB51550.1| hypothetical protein B456_008G222200 [Gossypium raimondii]
Length=709

 Score =   313 bits (802),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDYNQLK ERNP KRPT K GFLGLWG++VDS+++YK+QIKEFD+ + +ER+K+LK
Sbjct  155  LQNWLDYNQLKFERNPEKRPTKKIGFLGLWGERVDSIDFYKQQIKEFDKRMELERQKVLK  214

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            D K I+P AFVSF SRWGAAVCAQTQQSKNPTLWLT+WAPEPRD++W+NL+I FVSL+IR
Sbjct  215  DSKSILPVAFVSFKSRWGAAVCAQTQQSKNPTLWLTDWAPEPRDVYWRNLAIPFVSLTIR  274

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +L+I++SVFALVFFY+IPIAFVQSLANLEGLE+VAPFLRP+IE KF+KSFLQGFLPGLA
Sbjct  275  KLIISLSVFALVFFYMIPIAFVQSLANLEGLERVAPFLRPVIELKFIKSFLQGFLPGLA  333



>ref|XP_010110413.1| Uncharacterized protein RSN1 [Morus notabilis]
 gb|EXC26245.1| Uncharacterized protein RSN1 [Morus notabilis]
Length=498

 Score =   306 bits (785),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDYNQLK ER+P K+ T K GF+GLWG++VDS+EYYK+QIK+ DR +T+ER+ I+K
Sbjct  253  LQNWLDYNQLKFERHPDKKRTRKKGFMGLWGERVDSIEYYKQQIKDLDRRMTLERQNIIK  312

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            D K I+P  FVSF+SRWGAAVCAQTQQSKNPTLWLTNWAPEPRD++W+NL+I FVSLSIR
Sbjct  313  DTKSILPVTFVSFNSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDVYWRNLAIPFVSLSIR  372

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +LVI+ISVFALVFFY+IPIAFVQSLANLEGLE+VAPFLRP+IE  F+KSFLQGFLPGLA
Sbjct  373  KLVISISVFALVFFYMIPIAFVQSLANLEGLERVAPFLRPVIELSFIKSFLQGFLPGLA  431



>gb|KJB51549.1| hypothetical protein B456_008G222200 [Gossypium raimondii]
Length=807

 Score =   312 bits (800),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDYNQLK ERNP KRPT K GFLGLWG++VDS+++YK+QIKEFD+ + +ER+K+LK
Sbjct  253  LQNWLDYNQLKFERNPEKRPTKKIGFLGLWGERVDSIDFYKQQIKEFDKRMELERQKVLK  312

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            D K I+P AFVSF SRWGAAVCAQTQQSKNPTLWLT+WAPEPRD++W+NL+I FVSL+IR
Sbjct  313  DSKSILPVAFVSFKSRWGAAVCAQTQQSKNPTLWLTDWAPEPRDVYWRNLAIPFVSLTIR  372

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +L+I++SVFALVFFY+IPIAFVQSLANLEGLE+VAPFLRP+IE KF+KSFLQGFLPGLA
Sbjct  373  KLIISLSVFALVFFYMIPIAFVQSLANLEGLERVAPFLRPVIELKFIKSFLQGFLPGLA  431



>ref|XP_009373514.1| PREDICTED: CSC1-like protein At1g32090 [Pyrus x bretschneideri]
 ref|XP_009373515.1| PREDICTED: CSC1-like protein At1g32090 [Pyrus x bretschneideri]
 ref|XP_009373516.1| PREDICTED: CSC1-like protein At1g32090 [Pyrus x bretschneideri]
Length=805

 Score =   312 bits (800),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDYN LK ER+P K+PT K GFLGLWG KVDS+EYYK+QI+EF++ + +ER+KILK
Sbjct  253  LQNWLDYNLLKFERHPDKKPTMKNGFLGLWGTKVDSIEYYKKQIQEFEKSMALERQKILK  312

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            D K I+P AFVSFDSRW AAVCAQTQQS+NPTLWLTNWAPEPRD++W+NL+I FVSLSIR
Sbjct  313  DTKSILPVAFVSFDSRWAAAVCAQTQQSRNPTLWLTNWAPEPRDVYWRNLAIPFVSLSIR  372

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +LVI++SVFALVFFY+IPIAFVQSLANLEGLE+VAPFLRP++E KF+KSFLQGFLPGLA
Sbjct  373  KLVISLSVFALVFFYMIPIAFVQSLANLEGLERVAPFLRPVVELKFIKSFLQGFLPGLA  431



>emb|CDP11732.1| unnamed protein product [Coffea canephora]
Length=798

 Score =   311 bits (798),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDYNQLK ERNP KR   K GFLGLWG+K+DS+++YK QIKE D+ LT+ER+K+LK
Sbjct  254  LQNWLDYNQLKFERNPEKRRRRKNGFLGLWGEKIDSIDFYKHQIKELDKKLTMERQKVLK  313

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+PAAFVSF+SRWGAAVCAQTQQSKNPTLWLT WAPEPRDI+WKNL+I +VSL+IR
Sbjct  314  DPKAIMPAAFVSFNSRWGAAVCAQTQQSKNPTLWLTKWAPEPRDIYWKNLAIPYVSLTIR  373

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            R +I+++VFAL+FFY+IPIAFVQSLANLEGLEKVAPFLRP+ E KF+KSFLQGFLPGLA
Sbjct  374  RFIISVAVFALIFFYMIPIAFVQSLANLEGLEKVAPFLRPVTELKFIKSFLQGFLPGLA  432



>ref|XP_010664612.1| PREDICTED: CSC1-like protein At1g32090 isoform X2 [Vitis vinifera]
Length=624

 Score =   307 bits (786),  Expect = 3e-97, Method: Composition-based stats.
 Identities = 134/179 (75%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            ++NWLDYN+LK ER+P +RPT+K GFLG+ GK+VDS+EYY++QIKE D+ + +ER++ILK
Sbjct  105  VRNWLDYNKLKFERHPDRRPTTKIGFLGICGKRVDSIEYYEQQIKEIDKRIALERQRILK  164

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+P AFVSF+SRWGAAVCAQTQQS+NPTLWLTNWAPEPRD++W+NL+I FVSLSIR
Sbjct  165  DPKSIMPVAFVSFNSRWGAAVCAQTQQSRNPTLWLTNWAPEPRDVYWQNLAIPFVSLSIR  224

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +L+++++VFALVFFY+IPIAFVQSLANLEGLE+VAPFLR +IE KF+KSFLQGFLPGLA
Sbjct  225  KLIVSLTVFALVFFYMIPIAFVQSLANLEGLERVAPFLRAVIELKFIKSFLQGFLPGLA  283



>ref|XP_010261636.1| PREDICTED: CSC1-like protein At1g32090 [Nelumbo nucifera]
Length=780

 Score =   310 bits (795),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDYNQLK ER+P KRPT +TGFLGLWG++VDS+E+YK+++++ D+ + +ER KILK
Sbjct  253  LQNWLDYNQLKYERHPDKRPTRRTGFLGLWGERVDSIEFYKKKMQDLDKKMALERAKILK  312

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+P AFVSF+SRWGAAVCAQTQQSKNPTLWLTNWAPEPRD++WKNL+I FVSLSIR
Sbjct  313  DPKAIMPVAFVSFNSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDVYWKNLAIPFVSLSIR  372

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +LVI++SVFALVFFY+IPIAFVQSLANLEGLE+VAP+LRP+IE K +KSFLQGFLPGLA
Sbjct  373  KLVISVSVFALVFFYMIPIAFVQSLANLEGLERVAPWLRPVIELKIIKSFLQGFLPGLA  431



>ref|XP_010056204.1| PREDICTED: CSC1-like protein At1g32090 [Eucalyptus grandis]
 gb|KCW72814.1| hypothetical protein EUGRSUZ_E01258 [Eucalyptus grandis]
Length=772

 Score =   310 bits (794),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 142/179 (79%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDY QLK ER+P KRPTSK GF GLWG++VDS++YYK QIK  D+ + +EREK++ 
Sbjct  252  LQNWLDYYQLKFERHPEKRPTSKIGFCGLWGERVDSIDYYKEQIKILDKRMAVEREKVIN  311

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+P AFVSF+SRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNL+I FVSL+IR
Sbjct  312  DPKSILPVAFVSFNSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLAIPFVSLTIR  371

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +LVI++ VFALVFFY+IPIAFVQSLANLEGLE+VAPFLRP+IE KF+KSFLQGFLPGLA
Sbjct  372  KLVISLLVFALVFFYMIPIAFVQSLANLEGLERVAPFLRPVIELKFIKSFLQGFLPGLA  430



>ref|XP_010276749.1| PREDICTED: CSC1-like protein At1g32090 [Nelumbo nucifera]
Length=739

 Score =   308 bits (790),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDYNQLK ERNP KRPT KTGFLGLWG++VDS+E+YK+++K+ D+ + +ER+ ILK
Sbjct  253  LQNWLDYNQLKYERNPEKRPTRKTGFLGLWGERVDSIEFYKQKMKDLDKRMALERQTILK  312

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+P AFVSF+SRWGAAVCAQTQQSKNPTLWLTNWAPEPRD++W+NL+I F+SLSIR
Sbjct  313  DPKSIMPVAFVSFNSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDVYWRNLAIPFMSLSIR  372

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +LVI+IS+FALVFFY+IPIAFVQSLANLEGLE+VAP++RP+IE K +KSFLQGFLPGLA
Sbjct  373  KLVISISLFALVFFYMIPIAFVQSLANLEGLERVAPWIRPVIELKIIKSFLQGFLPGLA  431



>gb|KHG26829.1| putative membrane C2G11.09 [Gossypium arboreum]
Length=807

 Score =   310 bits (793),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDYNQLK ERNP KRPT   GFLGLWG++VDS+++YK+QIKEFD+ + +ER+KILK
Sbjct  253  LQNWLDYNQLKFERNPEKRPTKNIGFLGLWGERVDSIDFYKQQIKEFDKRMELERQKILK  312

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            D K I+P AFVSF SRWGAAVCAQTQQSKNPTLWLT+WAPEPRD++W+NL+I FVSL+IR
Sbjct  313  DSKSILPVAFVSFKSRWGAAVCAQTQQSKNPTLWLTDWAPEPRDVYWRNLAIPFVSLTIR  372

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +L+I++SVFALVFFY+IPIAFVQSLANLEGLE+VAPFLRP+IE  F+KSFLQGFLPGLA
Sbjct  373  KLIISLSVFALVFFYMIPIAFVQSLANLEGLERVAPFLRPVIELNFIKSFLQGFLPGLA  431



>gb|EYU29074.1| hypothetical protein MIMGU_mgv1a021500mg [Erythranthe guttata]
Length=736

 Score =   307 bits (787),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDYNQLK ER P KRPT KTGFLGLWGK+VDS+++Y ++IK+ D  + IER+KI+K
Sbjct  254  LQNWLDYNQLKFERQPDKRPTRKTGFLGLWGKRVDSIDFYNQEIKDLDEKMIIERQKIMK  313

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK ++PAAFVSF SRWGAAVCAQTQQSKNPTLWLT WAPEPRD++WKNL+I FVSL+IR
Sbjct  314  DPKSVMPAAFVSFKSRWGAAVCAQTQQSKNPTLWLTRWAPEPRDVYWKNLAIPFVSLTIR  373

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +L+I++ +FALVFFY+IPIAFVQSLANLEGLE+VAPFLRP+IEWK  KSFLQGF+PGLA
Sbjct  374  KLMISVLLFALVFFYIIPIAFVQSLANLEGLERVAPFLRPIIEWKLAKSFLQGFVPGLA  432



>gb|KHN40403.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=797

 Score =   308 bits (790),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDY QLK ER+P KRPT K GFLG WG KVD++EYYK  IKE D M+T+ER+KI+K
Sbjct  254  LQNWLDYYQLKFERHPDKRPTVKNGFLGFWGGKVDAIEYYKHSIKELDTMMTMERQKIIK  313

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+P AF+SF SRWGA+VCAQTQQSKNPTLWLT+WAPEPRD++W+NL+I FVSL+IR
Sbjct  314  DPKSILPVAFLSFKSRWGASVCAQTQQSKNPTLWLTDWAPEPRDVYWRNLAIPFVSLNIR  373

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +L+I++SVFALVFFY+IPIAFVQSLANLEGLE+VAPFLRP+IE KF+KSFLQGFLPGLA
Sbjct  374  KLIISLSVFALVFFYMIPIAFVQSLANLEGLERVAPFLRPVIELKFIKSFLQGFLPGLA  432



>ref|XP_003516847.1| PREDICTED: uncharacterized protein RSN1-like [Glycine max]
Length=797

 Score =   308 bits (790),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDY QLK ER+P KRPT K GFLG WG KVD++EYYK  IKE D M+T+ER+KI+K
Sbjct  254  LQNWLDYYQLKFERHPDKRPTVKNGFLGFWGGKVDAIEYYKHSIKELDTMMTMERQKIIK  313

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+P AF+SF SRWGA+VCAQTQQSKNPTLWLT+WAPEPRD++W+NL+I FVSL+IR
Sbjct  314  DPKSILPVAFLSFKSRWGASVCAQTQQSKNPTLWLTDWAPEPRDVYWQNLAIPFVSLNIR  373

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +L+I++SVFALVFFY+IPIAFVQSLANLEGLE+VAPFLRP+IE KF+KSFLQGFLPGLA
Sbjct  374  KLIISLSVFALVFFYMIPIAFVQSLANLEGLERVAPFLRPVIELKFIKSFLQGFLPGLA  432



>ref|XP_011018446.1| PREDICTED: CSC1-like protein At1g32090 [Populus euphratica]
Length=818

 Score =   308 bits (789),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDYNQLK ER+P KRPT K GFLGLWG++VDS+EYYK+Q+K  ++ + +ER+ ILK
Sbjct  253  LQNWLDYNQLKFERHPDKRPTRKKGFLGLWGERVDSIEYYKQQMKHLEKNMALERQTILK  312

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            D K I+P +FVSF+SRWGAAVCAQTQQSKNPTLWLTNWAPEPRDI+W+NL+I F+SL++R
Sbjct  313  DSKSILPVSFVSFNSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIYWRNLAIPFMSLTVR  372

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +L+I++SVFALVFFY+IPIAFVQSLANLEGLEKVAPFLRP+IE KF+KSFLQGFLPGLA
Sbjct  373  KLIISVSVFALVFFYMIPIAFVQSLANLEGLEKVAPFLRPVIELKFIKSFLQGFLPGLA  431



>gb|KDO58806.1| hypothetical protein CISIN_1g040696mg [Citrus sinensis]
Length=807

 Score =   307 bits (787),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDYNQLK ER+P K+PT+K GFLGLWGKKVD+++YYK Q+KE +R +++ER+KILK
Sbjct  253  LQNWLDYNQLKFERHPEKKPTTKMGFLGLWGKKVDAIDYYKHQMKELERRMSVERQKILK  312

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            D K I+P AFVSF SRWGAAVCAQTQQ KNPTLWLT+WAPEPRDI+W+NL+I FVSL+IR
Sbjct  313  DSKSILPVAFVSFKSRWGAAVCAQTQQCKNPTLWLTSWAPEPRDIYWRNLAIPFVSLTIR  372

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            + +I++SVFALVFFY+IPIAFVQSLANLEGLE+VAPFLRP+IE KF+KSFLQGF+PGLA
Sbjct  373  KCIISVSVFALVFFYMIPIAFVQSLANLEGLERVAPFLRPVIELKFIKSFLQGFVPGLA  431



>gb|EYU23284.1| hypothetical protein MIMGU_mgv1a001448mg [Erythranthe guttata]
Length=818

 Score =   306 bits (784),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 142/180 (79%), Positives = 163/180 (91%), Gaps = 1/180 (1%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGK-RPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKIL  177
            LQNWLDYNQLK ER+P K RPT+ TG LGLWG +VDS++YYK QIK  DR +T+ER+K+L
Sbjct  253  LQNWLDYNQLKHERHPNKKRPTTDTGCLGLWGDEVDSIDYYKEQIKYLDRKITMERQKVL  312

Query  178  KDPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSI  357
            KD K I PA+FVSF+SRWGAAVCAQTQQSKNPTLWLTNWAPEPRD++W+NL+I F SLS+
Sbjct  313  KDSKSITPASFVSFNSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDVYWQNLAIPFFSLSV  372

Query  358  RRLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            R+LVI++SVFALVFFY+IPIAFVQSLANLEGLEKVAPFLRP+IEWKF KSFLQGFLPGL 
Sbjct  373  RKLVISLSVFALVFFYMIPIAFVQSLANLEGLEKVAPFLRPVIEWKFAKSFLQGFLPGLT  432



>ref|XP_002304365.2| hypothetical protein POPTR_0003s09900g [Populus trichocarpa]
 gb|EEE79344.2| hypothetical protein POPTR_0003s09900g [Populus trichocarpa]
Length=808

 Score =   306 bits (783),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            L+NWLDYNQLK ER+P KRPT K GFLG+WG++VDS+EYYK+QIK  ++ +  ER+KILK
Sbjct  253  LRNWLDYNQLKFERHPDKRPTRKKGFLGIWGERVDSIEYYKQQIKLLEKNMASERQKILK  312

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            D K I+P +FVSF+SRWGAAVCAQTQQSKNPTLWLTNWAPEPRDI+W+NL+I FVSL++R
Sbjct  313  DSKSILPVSFVSFNSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIYWRNLAIPFVSLTVR  372

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +L+I++SVFALVFFY+IPIAFVQSLANLEGLEKVAPFLRP+IE KF+KSFLQGFLPGLA
Sbjct  373  KLIISLSVFALVFFYMIPIAFVQSLANLEGLEKVAPFLRPVIELKFIKSFLQGFLPGLA  431



>emb|CDP11733.1| unnamed protein product [Coffea canephora]
Length=875

 Score =   307 bits (786),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDYNQLK ERNP KRP  K  FLGLWG+K DS+++YK QIKE D+ LT+ER+K+LK
Sbjct  324  LQNWLDYNQLKFERNPEKRPRRKNCFLGLWGEKNDSIDFYKHQIKELDKKLTMERQKVLK  383

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+PAAFVSF+SRWGAAVCAQTQQSKNPTLWLT WAPEPRDI+WKNL+I FVSL+IR
Sbjct  384  DPKAIMPAAFVSFNSRWGAAVCAQTQQSKNPTLWLTKWAPEPRDIYWKNLAIPFVSLTIR  443

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            R +I+++VFAL+FFY+IPIAFVQSLANLEGLEKVAPFL P+ E KF+KSFLQGFLPGLA
Sbjct  444  RFIISVAVFALIFFYMIPIAFVQSLANLEGLEKVAPFLTPVTELKFIKSFLQGFLPGLA  502



>ref|XP_006432649.1| hypothetical protein CICLE_v10000312mg [Citrus clementina]
 ref|XP_006471456.1| PREDICTED: uncharacterized protein RSN1-like [Citrus sinensis]
 gb|ESR45889.1| hypothetical protein CICLE_v10000312mg [Citrus clementina]
Length=807

 Score =   305 bits (782),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 137/179 (77%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            L+NWLDYNQLK ER+P K+PT+K GFLGLWGKKVD+++YYK Q+KE +R +++ER+KILK
Sbjct  253  LRNWLDYNQLKFERHPEKKPTTKMGFLGLWGKKVDAIDYYKHQMKELERRMSVERQKILK  312

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            D K I+P AFVSF SRWGAAVCAQTQQ KNPTLWLTNWAPEPRDI+W+NL+I FVSL+IR
Sbjct  313  DSKSILPVAFVSFKSRWGAAVCAQTQQCKNPTLWLTNWAPEPRDIYWRNLAIPFVSLTIR  372

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            + +I++SVFALVFFY+IPIAFVQSLANLEGLE+VAP LRP+IE KF+KSFLQGF+PGLA
Sbjct  373  KFIISVSVFALVFFYMIPIAFVQSLANLEGLERVAPVLRPVIELKFIKSFLQGFVPGLA  431



>ref|XP_007158205.1| hypothetical protein PHAVU_002G133000g [Phaseolus vulgaris]
 gb|ESW30199.1| hypothetical protein PHAVU_002G133000g [Phaseolus vulgaris]
Length=857

 Score =   306 bits (785),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDY QLK ER+P KR T KTGFLGLWG KVD++EYYK  IKE D ++T ER++++K
Sbjct  253  LQNWLDYYQLKFERHPDKRSTVKTGFLGLWGGKVDAIEYYKHAIKELDNLMTSERQRVIK  312

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+P AF+SF+SRWGA+VCAQTQQSKNPTLWLT+WAPEPRD++W+NL+I FVSLSIR
Sbjct  313  DPKAILPVAFLSFNSRWGASVCAQTQQSKNPTLWLTDWAPEPRDVYWRNLAIPFVSLSIR  372

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +LVI +SVFALVFFY+IPIAFVQSLANLEGLEKVAPFLRP+IE  F+KSFLQGFLPGLA
Sbjct  373  KLVITLSVFALVFFYMIPIAFVQSLANLEGLEKVAPFLRPVIELNFIKSFLQGFLPGLA  431



>ref|XP_003533453.1| PREDICTED: uncharacterized protein RSN1-like [Glycine max]
Length=799

 Score =   305 bits (781),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 137/179 (77%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDY QLK ER+P +RPT KTG LGLWG KVD++E+YK  IKE D+M+T+ER+KI+K
Sbjct  254  LQNWLDYYQLKFERHPDRRPTVKTGILGLWGGKVDAIEHYKHSIKELDKMMTLERQKIIK  313

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+P AF+SF SRWGA+VCAQTQQSKNPTLWLT+WAPEPRD++W+NL+I FVSL+IR
Sbjct  314  DPKSILPVAFLSFKSRWGASVCAQTQQSKNPTLWLTDWAPEPRDVYWRNLAIPFVSLNIR  373

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +L+I++SVFALVFFY+IPIA VQSLANLEGLE+VAPFLRP+IE KF+KSFLQGFLPGLA
Sbjct  374  KLIISLSVFALVFFYMIPIAIVQSLANLEGLERVAPFLRPVIELKFIKSFLQGFLPGLA  432



>ref|XP_010054102.1| PREDICTED: CSC1-like protein At1g32090 [Eucalyptus grandis]
 gb|KCW78477.1| hypothetical protein EUGRSUZ_D02623 [Eucalyptus grandis]
Length=733

 Score =   303 bits (775),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 136/179 (76%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDYNQLK ER+P KRPT + GF GLWG+KVDS++YYK+QIK+ ++ + +E++K++K
Sbjct  253  LQNWLDYNQLKFERHPEKRPTKRKGFCGLWGEKVDSIDYYKQQIKDLEKRMAMEQQKVIK  312

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+  AFVSF+SRWGAAVCAQTQQSKNPTLWLT+WAPEPRD++WKNL+I F SLSIR
Sbjct  313  DPKSILSVAFVSFNSRWGAAVCAQTQQSKNPTLWLTDWAPEPRDVYWKNLAIPFFSLSIR  372

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RLVI+++VFALVFFY+IPIAFVQSLANL+GLEKVAPFLRP++E KF+KSFLQGFLPGLA
Sbjct  373  RLVISLAVFALVFFYMIPIAFVQSLANLDGLEKVAPFLRPVMELKFIKSFLQGFLPGLA  431



>ref|XP_006368323.1| early-responsive to dehydration family protein [Populus trichocarpa]
 gb|ERP64892.1| early-responsive to dehydration family protein [Populus trichocarpa]
Length=796

 Score =   304 bits (779),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 136/179 (76%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDYNQLK ER+P KRPT K GFLGLWG++VDS+E+YK+Q+K  ++ +  ER+ ILK
Sbjct  263  LQNWLDYNQLKFERHPDKRPTRKNGFLGLWGERVDSIEHYKQQMKHLEKNMASERQTILK  322

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            D K I+P +FVSF+SRWGAAVCAQTQQSKNPTLWLTNWAPEPRDI+W+NL+I F+SL++R
Sbjct  323  DSKSILPVSFVSFNSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIYWRNLAIPFMSLTVR  382

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +L+I+++VFALVFFY+IPIAFVQSLANLEGLEKVAPFLRP+IE KF+KSFLQGFLPGLA
Sbjct  383  KLIISVTVFALVFFYMIPIAFVQSLANLEGLEKVAPFLRPVIELKFIKSFLQGFLPGLA  441



>ref|XP_002273732.1| PREDICTED: CSC1-like protein At1g32090 isoform X1 [Vitis vinifera]
 emb|CBI23272.3| unnamed protein product [Vitis vinifera]
Length=772

 Score =   303 bits (777),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            ++NWLDYN+LK ER+P +RPT+K GFLG+ GK+VDS+EYY++QIKE D+ + +ER++ILK
Sbjct  253  VRNWLDYNKLKFERHPDRRPTTKIGFLGICGKRVDSIEYYEQQIKEIDKRIALERQRILK  312

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+P AFVSF+SRWGAAVCAQTQQS+NPTLWLTNWAPEPRD++W+NL+I FVSLSIR
Sbjct  313  DPKSIMPVAFVSFNSRWGAAVCAQTQQSRNPTLWLTNWAPEPRDVYWQNLAIPFVSLSIR  372

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +L+++++VFALVFFY+IPIAFVQSLANLEGLE+VAPFLR +IE KF+KSFLQGFLPGLA
Sbjct  373  KLIVSLTVFALVFFYMIPIAFVQSLANLEGLERVAPFLRAVIELKFIKSFLQGFLPGLA  431



>ref|XP_010518924.1| PREDICTED: CSC1-like protein At1g32090 [Tarenaya hassleriana]
Length=795

 Score =   303 bits (777),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQ+WLDYN LK +R+P KRP  KTGFLGLWGK+VDS+EYY +QIKEFD  +++ER+K+LK
Sbjct  254  LQSWLDYNLLKYQRHPEKRPARKTGFLGLWGKRVDSIEYYTQQIKEFDERMSMERQKVLK  313

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            D K ++P AFVSFDSRWGAAVCAQTQQSKNPTLWLT+WAPEPRDI+W+NL+I F+SLSIR
Sbjct  314  DSKLMLPVAFVSFDSRWGAAVCAQTQQSKNPTLWLTSWAPEPRDIYWQNLAIPFISLSIR  373

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +LVI +SVFALVFFY+IPIAFVQSLANLEGLE+VAPFLRP+    F+KSFLQGFLPGLA
Sbjct  374  KLVIGVSVFALVFFYMIPIAFVQSLANLEGLERVAPFLRPVTRLSFIKSFLQGFLPGLA  432



>ref|XP_002519965.1| Extensin-3 precursor, putative [Ricinus communis]
 gb|EEF42569.1| Extensin-3 precursor, putative [Ricinus communis]
Length=830

 Score =   304 bits (779),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/179 (77%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            L+NWLDYNQLK ER+P KRPT K GFL LWG++VDS++YYK+QI+E ++ + +ER+KILK
Sbjct  253  LRNWLDYNQLKFERHPDKRPTRKGGFLRLWGERVDSIDYYKQQIQELEKRMAMERQKILK  312

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK ++  AFVSF+SRWGAA+CAQTQQS NPTLWLTNWAPEPRDI+W+NL+I FVSLSIR
Sbjct  313  DPKSMLSVAFVSFNSRWGAAICAQTQQSNNPTLWLTNWAPEPRDIYWRNLAIPFVSLSIR  372

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +L+I++SVFALVFFY+IPIAFVQSLANLEGLEKVAPFLRP+IE +F+KSFLQGFLPGLA
Sbjct  373  KLIISLSVFALVFFYMIPIAFVQSLANLEGLEKVAPFLRPVIELEFIKSFLQGFLPGLA  431



>ref|XP_011028084.1| PREDICTED: CSC1-like protein At1g32090 [Populus euphratica]
Length=806

 Score =   303 bits (776),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 136/179 (76%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            L+NWLDYNQLK ER+P KRPT K GFLG+WG++VDS+EYYK+QI+  ++ + +ER+KIL 
Sbjct  253  LRNWLDYNQLKFERHPDKRPTRKKGFLGIWGERVDSIEYYKQQIQLLEKNMALERQKILT  312

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            D K I+P +FVSF+SRWGAAVCAQTQQSKNPTLWLTNWAP+PRDI+W+NL+I FVSL++R
Sbjct  313  DSKSILPVSFVSFNSRWGAAVCAQTQQSKNPTLWLTNWAPDPRDIYWRNLAIPFVSLTVR  372

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +L+I++SVFALVFFY+IPIAFVQSLANLEGLEKVAPFLRP+IE KF+KSFLQGFLPGLA
Sbjct  373  KLIISLSVFALVFFYMIPIAFVQSLANLEGLEKVAPFLRPVIELKFIKSFLQGFLPGLA  431



>ref|XP_010677412.1| PREDICTED: CSC1-like protein At1g32090 [Beta vulgaris subsp. 
vulgaris]
Length=790

 Score =   302 bits (773),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDYNQLK ER PG RPT+KTGFLGLWG++VDS++YYK Q+K+ ++ +T+ER+++L 
Sbjct  252  LQNWLDYNQLKFERKPGSRPTTKTGFLGLWGERVDSIDYYKEQLKQLEKKMTMERQRVLT  311

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            D K I+PAAFVSF+SRWGAAVCAQT+QS+NPTLWLT+WAPEPRD++W+NL+I FVSL+IR
Sbjct  312  DQKSILPAAFVSFNSRWGAAVCAQTEQSRNPTLWLTSWAPEPRDVYWRNLAIPFVSLTIR  371

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            + VI ++VFALVFFY+IPIAFVQSLANLE LE+VAPFLRP+IE   +KSFLQGFLPGLA
Sbjct  372  KFVIGVTVFALVFFYMIPIAFVQSLANLEALERVAPFLRPVIEVNIIKSFLQGFLPGLA  430



>ref|XP_004300169.1| PREDICTED: CSC1-like protein At1g32090 [Fragaria vesca subsp. 
vesca]
Length=833

 Score =   301 bits (771),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNWLDY QLK ER+P K+PT+KTG LGL GK+VD++EYYK+QI  FD+ + +E+EKILK
Sbjct  254  VQNWLDYYQLKYERHPNKKPTTKTGCLGLCGKRVDAIEYYKQQIMAFDKRMALEQEKILK  313

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            D K ++P AFVSF SRWGAAVCAQT QSKNPTLWLTNWAPEPRDI+W+NL+I FVSLSIR
Sbjct  314  DSKSLLPVAFVSFRSRWGAAVCAQTTQSKNPTLWLTNWAPEPRDIYWRNLAIPFVSLSIR  373

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +LVI++SVFALVFFY+IPIAFVQSLANLEGLE+VAPFLRP+IE KF+KSFLQGFLPGLA
Sbjct  374  KLVISLSVFALVFFYMIPIAFVQSLANLEGLERVAPFLRPVIELKFIKSFLQGFLPGLA  432



>ref|XP_004512449.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Cicer 
arietinum]
Length=798

 Score =   300 bits (769),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDY +LK +R P +RPT  TG LGLWG+KVD++EYY++ IKE D++++ ER+KI+K
Sbjct  253  LQNWLDYYRLKFQRRPDRRPTITTGCLGLWGRKVDAIEYYEQHIKELDKLMSSERQKIIK  312

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+P AF+SF+SRWGA+VCAQTQQSKNPTLWLT+WAPEPRDI+W+NL+I FVSL+IR
Sbjct  313  DPKSILPVAFLSFNSRWGASVCAQTQQSKNPTLWLTDWAPEPRDIYWRNLAIPFVSLTIR  372

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +L+I +SVFALVFFY+IPIAFVQSLANL+GLEKVAPFLRP+IE KF+KSFLQGFLPGLA
Sbjct  373  KLIITLSVFALVFFYMIPIAFVQSLANLDGLEKVAPFLRPVIELKFIKSFLQGFLPGLA  431



>ref|XP_008448614.1| PREDICTED: uncharacterized protein RSN1 [Cucumis melo]
 ref|XP_008448615.1| PREDICTED: uncharacterized protein RSN1 [Cucumis melo]
Length=795

 Score =   300 bits (768),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 136/179 (76%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDY  LK ER+P KRPT+KTG+ G+ G++VD++EYYK+Q+K+ D  + +ER+KI+K
Sbjct  253  LQNWLDYYLLKFERHPDKRPTTKTGWFGICGRRVDAIEYYKQQMKDLDARMALERQKIIK  312

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+P AFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEP+D++W+NL+I FVSLSIR
Sbjct  313  DPKAILPVAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPQDVYWQNLAIPFVSLSIR  372

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +LVI++ VFALVFFY+IPIAFVQSLANLEGLE+VAPFLRP+IE KF+KSFLQGFLPGLA
Sbjct  373  KLVISLLVFALVFFYMIPIAFVQSLANLEGLERVAPFLRPVIELKFIKSFLQGFLPGLA  431



>ref|XP_003612662.1| Membrane protein, putative [Medicago truncatula]
 gb|AES95620.1| ERD (early-responsive to dehydration stress) family protein [Medicago 
truncatula]
Length=799

 Score =   300 bits (768),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 133/179 (74%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDY ++K +++P  RPT KTG LGLWG+KVD++EYY + +KE D+++T+ER+KI+K
Sbjct  253  LQNWLDYYRIKFQKHPDTRPTVKTGCLGLWGRKVDAIEYYDQHVKELDKLMTLERQKIIK  312

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+P AF+SF+SRW A+VCAQTQQSKNPTLWLT+WAPEPRDI+W+NLSI FVSL++R
Sbjct  313  DPKSILPVAFLSFNSRWAASVCAQTQQSKNPTLWLTDWAPEPRDIYWQNLSIPFVSLTVR  372

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +LVI +SVFALVFFY+IPIAFVQSLANL+GLEKVAPFLRP+IE KF+KSFLQGFLPGLA
Sbjct  373  KLVITLSVFALVFFYMIPIAFVQSLANLDGLEKVAPFLRPVIELKFIKSFLQGFLPGLA  431



>ref|XP_004146108.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Cucumis 
sativus]
 ref|XP_004164183.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Cucumis 
sativus]
 gb|KGN55705.1| hypothetical protein Csa_3G006670 [Cucumis sativus]
Length=795

 Score =   299 bits (765),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/179 (76%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDY  LK ER+P KRPT+KTG  G+ G++VD++EYYK+Q+K+ D  + +ER+KI+K
Sbjct  253  LQNWLDYYLLKFERHPDKRPTTKTGCFGICGRRVDAIEYYKQQMKDLDARMGLERQKIIK  312

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+P AFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEP D++W+NL+I FVSLSIR
Sbjct  313  DPKAILPVAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPHDVYWQNLAIPFVSLSIR  372

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +LVI++ VFALVFFY+IPIAFVQSLANLEGLE+VAPFLRP+IE KF+KSFLQGFLPGLA
Sbjct  373  KLVISLLVFALVFFYMIPIAFVQSLANLEGLERVAPFLRPVIELKFIKSFLQGFLPGLA  431



>ref|XP_002893699.1| hypothetical protein ARALYDRAFT_473392 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69958.1| hypothetical protein ARALYDRAFT_473392 [Arabidopsis lyrata subsp. 
lyrata]
Length=806

 Score =   297 bits (761),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 136/179 (76%), Positives = 160/179 (89%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQ W DY  LK +RNP K+PT +TGFLGLWGKKVDS+EYYK+QIKEFD  +++ER+K+LK
Sbjct  254  LQRWFDYYVLKHQRNPHKQPTCRTGFLGLWGKKVDSIEYYKQQIKEFDHNMSLERQKVLK  313

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            D K ++P AFVSFDSRWGAAVCAQTQQSKNPTLWLT+ APEPRDI+W+NL+I F+SL+IR
Sbjct  314  DSKLMLPVAFVSFDSRWGAAVCAQTQQSKNPTLWLTSSAPEPRDIYWQNLAIPFISLTIR  373

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +LVI +SVFALVFFY+IPIAFVQSLANLEGLE+VAPFLRP+    F+KSFLQGFLPGLA
Sbjct  374  KLVIGVSVFALVFFYMIPIAFVQSLANLEGLERVAPFLRPVTRLDFIKSFLQGFLPGLA  432



>ref|XP_010920040.1| PREDICTED: LOW QUALITY PROTEIN: CSC1-like protein At1g32090 [Elaeis 
guineensis]
Length=760

 Score =   296 bits (757),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 160/179 (89%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDYN LK ER+PGKRPT K GFLGL G++VDS++YY+ +I E D+ +  ER+++LK
Sbjct  255  LQNWLDYNMLKFERHPGKRPTRKKGFLGLCGERVDSIDYYREKISELDKKIASERQRVLK  314

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+P AFV+FDSRWGAAVCAQTQQS+NPT WLT+WAPEPRD++W+NL+I FVSLSIR
Sbjct  315  DPKAIMPVAFVTFDSRWGAAVCAQTQQSRNPTRWLTDWAPEPRDVYWRNLAIPFVSLSIR  374

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+I+I VFALVFFY+IPIAFVQSLANLEGLEKVAPFLR +IE K +KSFLQGFLPGLA
Sbjct  375  RLIISILVFALVFFYMIPIAFVQSLANLEGLEKVAPFLRRVIEIKVIKSFLQGFLPGLA  433



>ref|XP_008788615.1| PREDICTED: CSC1-like protein At1g32090 [Phoenix dactylifera]
Length=759

 Score =   295 bits (755),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 160/179 (89%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDYN LK ER+P KRPT K GFLGLWG++VDS++YY+ +I E D+ +  E +++LK
Sbjct  255  LQNWLDYNLLKFERHPEKRPTRKKGFLGLWGERVDSIDYYREKISELDKKIASEHQRVLK  314

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+P AFV+FDSRWGAAVCAQTQQS+NPT WLT+WAPEPRD++W+NL+I FVSLSIR
Sbjct  315  DPKAIMPVAFVTFDSRWGAAVCAQTQQSRNPTQWLTDWAPEPRDVYWRNLAIPFVSLSIR  374

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+I+IS+FALVFFY+IPIAFVQSLANLEGLEKVAPFLR +IE K +KSFLQGFLPGLA
Sbjct  375  RLIISISLFALVFFYMIPIAFVQSLANLEGLEKVAPFLRRVIEIKVIKSFLQGFLPGLA  433



>ref|NP_174489.1| early-responsive to dehydration stress protein (ERD4) [Arabidopsis 
thaliana]
 sp|Q9FVQ5.1|CSCL1_ARATH RecName: Full=CSC1-like protein At1g32090 [Arabidopsis thaliana]
 gb|AAG23449.1|AC084165_15 hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01245.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE31435.1| early-responsive to dehydration stress protein (ERD4) [Arabidopsis 
thaliana]
 gb|AIU34620.1| hyperosmolality-gated Ca2+ permeable channel 1.8 [Arabidopsis 
thaliana]
Length=806

 Score =   296 bits (757),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 160/179 (89%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQ W DY  LK +RNP K+PT +TGFLGLWGK+VDS+EYYK+QIKEFD  +++ER+K+LK
Sbjct  254  LQRWFDYYVLKHQRNPHKQPTCRTGFLGLWGKRVDSIEYYKQQIKEFDHNMSLERQKVLK  313

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            D K ++P AFVSFDSRWGAAVCAQTQQSKNPTLWLT+ APEPRDI+W+NL+I F+SL+IR
Sbjct  314  DSKLMLPVAFVSFDSRWGAAVCAQTQQSKNPTLWLTSSAPEPRDIYWQNLAIPFISLTIR  373

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +LVI +SVFALVFFY+IPIAFVQSLANLEGL++VAPFLRP+    F+KSFLQGFLPGLA
Sbjct  374  KLVIGVSVFALVFFYMIPIAFVQSLANLEGLDRVAPFLRPVTRLDFIKSFLQGFLPGLA  432



>gb|AFI41197.1| dehydration stress protein, partial [Arabidopsis thaliana]
Length=806

 Score =   295 bits (755),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 160/179 (89%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQ W DY  LK +RNP K+PT +TGFLGLWGK+VDS+EYYK+QIKEFD  +++ER+K+LK
Sbjct  254  LQRWFDYYVLKHQRNPHKQPTCRTGFLGLWGKRVDSIEYYKQQIKEFDHNMSLERQKVLK  313

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            D K ++P AFVSFDSRWGAAVCAQTQQSKNPTLWLT+ APEPRDI+W+NL+I F+SL+IR
Sbjct  314  DSKLMLPVAFVSFDSRWGAAVCAQTQQSKNPTLWLTSSAPEPRDIYWQNLAIPFISLTIR  373

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +LVI +SVFALVFFY+IPIAFVQSLANLEGL++VAPFLRP+    F+KSFLQGFLPGLA
Sbjct  374  KLVIGVSVFALVFFYMIPIAFVQSLANLEGLDRVAPFLRPVTRLDFIKSFLQGFLPGLA  432



>ref|XP_009409814.1| PREDICTED: CSC1-like protein At1g32090 [Musa acuminata subsp. 
malaccensis]
Length=763

 Score =   293 bits (751),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 157/179 (88%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDYNQLK ER P KRPT+K GFLGL G++VD++ YY+ +I E D  +  ER++ILK
Sbjct  253  LQNWLDYNQLKFERQPEKRPTTKRGFLGLCGERVDAINYYRERISELDEKIAYERQRILK  312

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK ++  AFV+FDSRWGAAVCAQTQQSKNPT WLT WAPEPRD++W+NL I FVSLSIR
Sbjct  313  DPKAVMQVAFVTFDSRWGAAVCAQTQQSKNPTKWLTEWAPEPRDVYWENLPIPFVSLSIR  372

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+I+I+VFALVFFY+IPIAFVQSLANLEGLEKVAPFLRP+IE K +KSFLQGFLPGLA
Sbjct  373  RLIISIAVFALVFFYMIPIAFVQSLANLEGLEKVAPFLRPVIEIKVIKSFLQGFLPGLA  431



>gb|EPS61105.1| hypothetical protein M569_13694, partial [Genlisea aurea]
Length=557

 Score =   286 bits (733),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            L NWLDYNQ++ ER+P KRP  K GFLGL+G+KVDS+++YK +IK  D+ L++ER+++LK
Sbjct  19   LGNWLDYNQIRSERHPHKRPRRKNGFLGLYGEKVDSIDFYKEKIKSLDKKLSVERQQVLK  78

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK + PAAFVSFDSRWGAAVCAQTQQSKNPTLWLT+WAPEPRD++W NL+I FV ++IR
Sbjct  79   DPKYVTPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTDWAPEPRDVYWPNLAIPFVWITIR  138

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +L+I++++FAL+FFY+IPIAFVQSLANL+GL++VAPFLRPLI+  FVKSFLQGFLPGLA
Sbjct  139  KLLISLALFALIFFYMIPIAFVQSLANLDGLQRVAPFLRPLIQAPFVKSFLQGFLPGLA  197



>ref|XP_006415254.1| hypothetical protein EUTSA_v10006831mg [Eutrema salsugineum]
 gb|ESQ33607.1| hypothetical protein EUTSA_v10006831mg [Eutrema salsugineum]
Length=799

 Score =   293 bits (749),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 131/179 (73%), Positives = 160/179 (89%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNW DY  LK +RNP K+PT +TGFLGLWG KVDS+EYY++QI++FD  +++ER+K+LK
Sbjct  254  LQNWFDYYVLKHQRNPHKKPTCRTGFLGLWGNKVDSIEYYQQQIRDFDHTMSLERQKVLK  313

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            D K ++P AFVSFDSRWGA+VCAQTQQSKNPTLWLT+ APEPRDI+W+NL+I F+SL+IR
Sbjct  314  DSKLMLPVAFVSFDSRWGASVCAQTQQSKNPTLWLTSSAPEPRDIYWQNLAIPFISLTIR  373

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +LVI +SVFALVFFY+IPIAFVQSLANLEGL++VAPFLRP+    F+KSFLQGFLPGLA
Sbjct  374  KLVIGVSVFALVFFYMIPIAFVQSLANLEGLDRVAPFLRPITRLDFIKSFLQGFLPGLA  432



>ref|XP_006304000.1| hypothetical protein CARUB_v10011444mg [Capsella rubella]
 gb|EOA36898.1| hypothetical protein CARUB_v10011444mg [Capsella rubella]
Length=808

 Score =   292 bits (748),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 157/179 (88%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQ W DY  LK +RNP K PT + GFLGLWGK VDSVEYYK+QIKEFD  +++ER+K+L+
Sbjct  254  LQRWFDYYVLKHQRNPHKMPTCRIGFLGLWGKMVDSVEYYKQQIKEFDHNMSLERQKVLQ  313

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            D K ++P AFVSFDSRWGAAVCAQTQQSKNPTLWLT+ APEPRDI+WKNL+I F+SL+IR
Sbjct  314  DSKLMLPVAFVSFDSRWGAAVCAQTQQSKNPTLWLTSSAPEPRDIYWKNLAIPFISLTIR  373

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +LVI ISVFALVFFY+IPIAFVQSLANLEGL++VAPFLRP+    F+KSFLQGFLPGLA
Sbjct  374  KLVIGISVFALVFFYMIPIAFVQSLANLEGLDRVAPFLRPITRLDFIKSFLQGFLPGLA  432



>gb|EPS60193.1| hypothetical protein M569_14609, partial [Genlisea aurea]
Length=720

 Score =   288 bits (736),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 159/179 (89%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDYNQLKLERNPGKRP+ + GFLGLWG++VD++++YK QI++  R   IERE+ + 
Sbjct  255  LQNWLDYNQLKLERNPGKRPSRRRGFLGLWGERVDTIDFYKEQIEDLQRKAGIERERAMN  314

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            D K + PAAFVSFDSRWGAAVCAQTQQS+NPT WLT+WAPEPRD++WKNL I F+S+++R
Sbjct  315  DSKSVSPAAFVSFDSRWGAAVCAQTQQSRNPTAWLTDWAPEPRDVYWKNLGIPFLSITVR  374

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            ++ +++++FALVFFY++PIA VQSLANL+GLE+VAPFLRP++E K VKSFLQGFLPGLA
Sbjct  375  KVAVSVAMFALVFFYMVPIALVQSLANLDGLERVAPFLRPVVERKVVKSFLQGFLPGLA  433



>emb|CDY35541.1| BnaA05g16450D [Brassica napus]
Length=805

 Score =   289 bits (740),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 133/180 (74%), Positives = 160/180 (89%), Gaps = 1/180 (1%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKR-PTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKIL  177
            LQ+W DY  LK +RNP K+ PT +TGFLGLWGKKVDS+EYY++QIK+FD  + +ER+K+L
Sbjct  254  LQDWYDYYVLKHQRNPHKKKPTCRTGFLGLWGKKVDSIEYYQQQIKDFDHTMALERQKVL  313

Query  178  KDPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSI  357
            KD K ++P AFVSFDSRWGAAVCAQTQQSKNPTLWLT+ APEPRDI+W+NLSI F+SL+I
Sbjct  314  KDSKLMLPVAFVSFDSRWGAAVCAQTQQSKNPTLWLTSSAPEPRDIYWQNLSIPFISLTI  373

Query  358  RRLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            R+L+I +SVFALVFFY+IPIAFVQSLANL+GL++VAPFLRP+    FVKSFLQGFLPGLA
Sbjct  374  RKLIIGVSVFALVFFYMIPIAFVQSLANLQGLDRVAPFLRPVTRLDFVKSFLQGFLPGLA  433



>ref|XP_009145210.1| PREDICTED: CSC1-like protein At1g32090 [Brassica rapa]
Length=805

 Score =   289 bits (739),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 133/180 (74%), Positives = 160/180 (89%), Gaps = 1/180 (1%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKR-PTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKIL  177
            LQ+W DY  LK +RNP K+ PT +TGFLGLWGKKVDS+EYY++QIK+FD  + +ER+K+L
Sbjct  254  LQDWYDYYVLKHQRNPHKKKPTCRTGFLGLWGKKVDSIEYYQQQIKDFDHTMALERQKVL  313

Query  178  KDPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSI  357
            KD K ++P AFVSFDSRWGAAVCAQTQQSKNPTLWLT+ APEPRDI+W+NLSI F+SL+I
Sbjct  314  KDSKLMLPVAFVSFDSRWGAAVCAQTQQSKNPTLWLTSSAPEPRDIYWQNLSIPFISLTI  373

Query  358  RRLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            R+L+I +SVFALVFFY+IPIAFVQSLANL+GL++VAPFLRP+    FVKSFLQGFLPGLA
Sbjct  374  RKLIIGVSVFALVFFYMIPIAFVQSLANLQGLDRVAPFLRPVTRLDFVKSFLQGFLPGLA  433



>emb|CDY29933.1| BnaC05g29030D [Brassica napus]
Length=805

 Score =   289 bits (739),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 133/180 (74%), Positives = 160/180 (89%), Gaps = 1/180 (1%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKR-PTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKIL  177
            LQ+W DY  LK +RNP K+ PT +TGFLGLWGKKVDS+EYY++QIK+FD  + +ER+K+L
Sbjct  254  LQDWYDYYVLKHQRNPHKKKPTCRTGFLGLWGKKVDSIEYYQQQIKDFDHTMALERQKVL  313

Query  178  KDPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSI  357
            KD K ++P AFVSFDSRWGAAVCAQTQQSKNPTLWLT+ APEPRDI+W+NLSI F+SL+I
Sbjct  314  KDSKLMLPVAFVSFDSRWGAAVCAQTQQSKNPTLWLTSSAPEPRDIYWQNLSIPFISLTI  373

Query  358  RRLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            R+L+I +SVFALVFFY+IPIAFVQSLANL+GL++VAPFLRP+    FVKSFLQGFLPGLA
Sbjct  374  RKLIIGVSVFALVFFYMIPIAFVQSLANLQGLDRVAPFLRPVTRLDFVKSFLQGFLPGLA  433



>gb|KFK44972.1| hypothetical protein AALP_AA1G327200 [Arabis alpina]
Length=800

 Score =   288 bits (738),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 159/179 (89%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQ W DY  LK +RNP K+PT +TGFLGLWGK VDS+EYY++QIKEF+  +++ER+ +L+
Sbjct  255  LQRWFDYYVLKHQRNPHKKPTCRTGFLGLWGKMVDSIEYYEQQIKEFNHSMSLERQNVLQ  314

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            D K ++P AFVSFDSRWGAAVCAQTQQSKNPTLWLT+ APEPRDI+W+NL+I F+SL+IR
Sbjct  315  DSKLMLPVAFVSFDSRWGAAVCAQTQQSKNPTLWLTSSAPEPRDIYWQNLAIPFISLTIR  374

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +L+I ISVFALVFFY+IPIAFVQSLANL+GLE+VAPFLRP++   F+KSFLQGFLPGLA
Sbjct  375  KLLIGISVFALVFFYMIPIAFVQSLANLDGLERVAPFLRPVMRLDFIKSFLQGFLPGLA  433



>ref|XP_010461028.1| PREDICTED: CSC1-like protein At1g32090 [Camelina sativa]
Length=815

 Score =   286 bits (733),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 157/179 (88%), Gaps = 1/179 (1%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQ W DY  LK +R+  K PT K GFLGLWGK+VDS+EYYK+QIKEFD  +++ER+K+LK
Sbjct  254  LQRWFDYYVLKHQRS-QKNPTCKIGFLGLWGKRVDSIEYYKQQIKEFDHNMSLERQKVLK  312

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            D K ++P AFVSFDSRWGAAVCAQTQQSKNPTLWLT+ APEPRDI+WKNL+I F+SL+IR
Sbjct  313  DSKLMLPVAFVSFDSRWGAAVCAQTQQSKNPTLWLTSSAPEPRDIYWKNLAIPFISLTIR  372

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +LVI ISVFALVFFY+IPIAFVQSLANLEGLE+VAPFLRP+    F+KSFLQGFLPGLA
Sbjct  373  KLVIGISVFALVFFYMIPIAFVQSLANLEGLERVAPFLRPVTRLDFIKSFLQGFLPGLA  431



>gb|EMT13890.1| Putative membrane protein [Aegilops tauschii]
Length=801

 Score =   285 bits (728),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 154/179 (86%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDY QLK ER+P KRPT +TG  G  G+KVD ++YY+ +I E D+ +  ER ++L 
Sbjct  250  LQNWLDYYQLKFERHPEKRPTGRTGCFGFCGRKVDQIDYYRARISELDKRIASERHRVLN  309

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK ++P +FV+FDSRWGAAVCAQTQQSKNPT WLTNWAPEPRD++W+NL+I F SLSIR
Sbjct  310  DPKAVMPVSFVTFDSRWGAAVCAQTQQSKNPTQWLTNWAPEPRDVYWQNLAIPFFSLSIR  369

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            + +I+I+VFALVFFY+IPIAFVQSLANLEG+E+VAPFLRP+IE K VKSFLQGFLPGLA
Sbjct  370  KFLISIAVFALVFFYMIPIAFVQSLANLEGIERVAPFLRPVIEVKVVKSFLQGFLPGLA  428



>gb|EMS63833.1| Uncharacterized membrane protein C2G11.09 [Triticum urartu]
Length=804

 Score =   284 bits (727),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 155/179 (87%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDY QLK ER+P KRPT +TG  G  G++VD ++YY+ +I E D+ +  ER+++L 
Sbjct  250  LQNWLDYYQLKFERHPEKRPTGRTGCFGFCGRQVDQIDYYRARISELDKRIASERQRVLN  309

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+P +FV+FDSRWGAAVCAQTQQSKNPT WLTNWAPEPRD++W+NL+I F SLSIR
Sbjct  310  DPKAIMPVSFVTFDSRWGAAVCAQTQQSKNPTQWLTNWAPEPRDVYWQNLAIPFFSLSIR  369

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            + +I+I+VFALVFFY+IPIAFVQSLANLEG+E+VAPFLRP+IE K VKSFLQGFLPGLA
Sbjct  370  KFLISIAVFALVFFYMIPIAFVQSLANLEGIERVAPFLRPVIEVKVVKSFLQGFLPGLA  428



>emb|CDM81261.1| unnamed protein product [Triticum aestivum]
Length=801

 Score =   283 bits (725),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 154/179 (86%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDY QLK ER+P KRPT +TG  G  G++VD ++YY+ +I E D+ +  ER ++L 
Sbjct  250  LQNWLDYYQLKFERHPEKRPTGRTGCFGFCGRQVDQIDYYRARISELDKRIASERHRVLN  309

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK ++P +FV+FDSRWGAAVCAQTQQSKNPT WLTNWAPEPRD++W+NL+I F SLSIR
Sbjct  310  DPKAVMPVSFVTFDSRWGAAVCAQTQQSKNPTQWLTNWAPEPRDVYWQNLAIPFFSLSIR  369

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            + +I+I+VFALVFFY+IPIAFVQSLANLEG+E+VAPFLRP+IE K VKSFLQGFLPGLA
Sbjct  370  KFLISIAVFALVFFYMIPIAFVQSLANLEGIERVAPFLRPVIEVKVVKSFLQGFLPGLA  428



>ref|XP_010499754.1| PREDICTED: CSC1-like protein At1g32090 [Camelina sativa]
Length=814

 Score =   283 bits (725),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 133/179 (74%), Positives = 156/179 (87%), Gaps = 1/179 (1%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQ W DY  LK +R+  K PT K GFLGLWGK+VDS+EYYK+QIKEFD  +++ER+K+LK
Sbjct  254  LQRWFDYYVLKHQRS-QKNPTCKLGFLGLWGKRVDSIEYYKQQIKEFDHNMSLERQKVLK  312

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            D K ++P  FVSFDSRWGAAVCAQTQQSKNPTLWLT+ APEPRDI+W+NL+I F+SL+IR
Sbjct  313  DSKLMLPVTFVSFDSRWGAAVCAQTQQSKNPTLWLTSSAPEPRDIYWQNLAIPFISLTIR  372

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +LVI ISVFALVFFY+IPIAFVQSLANLEGLE+VAPFLRP+    F+KSFLQGFLPGLA
Sbjct  373  KLVIGISVFALVFFYMIPIAFVQSLANLEGLERVAPFLRPVTRLDFIKSFLQGFLPGLA  431



>ref|XP_010235059.1| PREDICTED: CSC1-like protein At1g32090 isoform X2 [Brachypodium 
distachyon]
Length=699

 Score =   281 bits (719),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 154/179 (86%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDY QLK ER+P KRPT +TG  G  G+KVD ++YY+ +I E D+ +  ER+++L 
Sbjct  155  LQNWLDYYQLKFERHPEKRPTGRTGCFGFCGRKVDQIDYYRARISELDKRMASERQRVLN  214

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK ++P +FV+FDSRWGAAVCAQTQQSKNPT WLT+WAPEPRD++W+NL+I F SLSIR
Sbjct  215  DPKAVMPVSFVTFDSRWGAAVCAQTQQSKNPTQWLTDWAPEPRDVYWQNLAIPFFSLSIR  274

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            + +I+I+VFALVFFY+IPIAFVQSLANLEG+EKVAPF+RP+IE K VKSFLQGFLPGL 
Sbjct  275  KFLISIAVFALVFFYMIPIAFVQSLANLEGIEKVAPFVRPVIEVKVVKSFLQGFLPGLT  333



>ref|XP_008658829.1| PREDICTED: uncharacterized protein RSN1 [Zea mays]
 tpg|DAA46522.1| TPA: hypothetical protein ZEAMMB73_184326 [Zea mays]
Length=810

 Score =   283 bits (725),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 156/179 (87%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDY +LK ER+P +RPT +TG LG  G++VD ++YY+ +I E +R +T ER+KIL 
Sbjct  254  LQNWLDYYELKFERHPERRPTRRTGCLGFCGREVDQIDYYRARISELERRMTSERQKILN  313

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK ++P +FV+FDSRWGAAVCAQTQQSKNPT WLT+WAPEPRD++W+NL+I F SLSIR
Sbjct  314  DPKAVMPVSFVTFDSRWGAAVCAQTQQSKNPTQWLTDWAPEPRDVYWQNLAIPFFSLSIR  373

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            R +++++VFALVFFY+IPIAFVQSLANLEGLEKVAPFL+P+IE   VKSFLQGFLPGLA
Sbjct  374  RFLMSVAVFALVFFYMIPIAFVQSLANLEGLEKVAPFLKPVIEAHVVKSFLQGFLPGLA  432



>ref|XP_010478627.1| PREDICTED: CSC1-like protein At1g32090 [Camelina sativa]
Length=815

 Score =   283 bits (724),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 156/179 (87%), Gaps = 1/179 (1%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQ W DY  LK +R+  K PT K GFLGLWGK+VDS+EYYK+QIKEFD  +++ER+K+LK
Sbjct  254  LQRWFDYYVLKHQRS-QKNPTCKLGFLGLWGKRVDSIEYYKQQIKEFDHNMSLERQKVLK  312

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            D K ++P  FVSFDSRWGAAVCAQTQQSKNPTLWLT+ APEPRDI+W+NL+I F+SL+IR
Sbjct  313  DSKLMLPVTFVSFDSRWGAAVCAQTQQSKNPTLWLTSSAPEPRDIYWQNLAIPFISLTIR  372

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +LVI +SVFALVFFY+IPIAFVQSLANLEGLE+VAPFLRP+    F+KSFLQGFLPGLA
Sbjct  373  KLVIGVSVFALVFFYMIPIAFVQSLANLEGLERVAPFLRPVTRLDFIKSFLQGFLPGLA  431



>ref|XP_004983522.1| PREDICTED: uncharacterized membrane protein C24H6.13-like [Setaria 
italica]
Length=809

 Score =   283 bits (724),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 155/179 (87%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDY QLK ER+P KRPT +TG LG  G++VD ++YY+ +I E +R +  ER+K+L 
Sbjct  253  LQNWLDYYQLKFERHPEKRPTRRTGCLGFCGREVDQIDYYQARISELERKMASERQKVLN  312

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+P +FV+FDSRWGAAVCAQTQQSKNPT WLT+WAPEPRD++W+NL+I F SLSIR
Sbjct  313  DPKAIMPVSFVTFDSRWGAAVCAQTQQSKNPTQWLTDWAPEPRDVYWQNLAIPFFSLSIR  372

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            R +I+++VFALVFFY+IPI FVQSLANLEGLEKVAPFL+P+IE K VKSFLQGF+PGLA
Sbjct  373  RFLISVAVFALVFFYMIPITFVQSLANLEGLEKVAPFLKPVIEVKVVKSFLQGFVPGLA  431



>ref|XP_002464863.1| hypothetical protein SORBIDRAFT_01g027810 [Sorghum bicolor]
 gb|EER91861.1| hypothetical protein SORBIDRAFT_01g027810 [Sorghum bicolor]
Length=808

 Score =   282 bits (722),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 156/179 (87%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDY +LK ER+P +RPT +TG LG  G++VD ++YY+ +I E ++ +  ER+K+L 
Sbjct  253  LQNWLDYYELKFERHPERRPTGRTGCLGFCGREVDQIDYYRARISELEKRMASERQKVLN  312

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK ++P +FV+FDSRWGAAVCAQTQQSKNPT WLT+WAPEPRD++W+NL+I F SLSIR
Sbjct  313  DPKAVMPVSFVTFDSRWGAAVCAQTQQSKNPTQWLTDWAPEPRDVYWQNLAIPFFSLSIR  372

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            R +I+++VFALVFFY+IPIAFVQSLANLEGLEKVAPFL+P+IE K VKSFLQGFLPGLA
Sbjct  373  RFLISVAVFALVFFYMIPIAFVQSLANLEGLEKVAPFLKPVIEVKVVKSFLQGFLPGLA  431



>ref|NP_001065504.1| Os10g0579100 [Oryza sativa Japonica Group]
 gb|AAG46169.1|AC018727_21 unknown protein [Oryza sativa Japonica Group]
 gb|AAP55175.1| early-responsive to dehydration protein, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF27341.1| Os10g0579100 [Oryza sativa Japonica Group]
 gb|EAZ17098.1| hypothetical protein OsJ_32597 [Oryza sativa Japonica Group]
 gb|AIU34631.1| hyperosmolality-gated Ca2+ permeable channel 1.4 [Oryza sativa]
Length=810

 Score =   282 bits (722),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 155/179 (87%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDY QLK ER+PGKRP  +TG LG  G++VD ++YY+ +I E D+ L  ER+++L 
Sbjct  249  LQNWLDYYQLKFERHPGKRPIGRTGCLGFCGREVDQIDYYRARISELDKKLASERQRVLN  308

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK ++P AFV+FDSRWGAAVCAQTQQSKNPT WLT+WAPEPRD++W+NL+I F SLSIR
Sbjct  309  DPKAVMPVAFVTFDSRWGAAVCAQTQQSKNPTQWLTDWAPEPRDVYWQNLAIPFFSLSIR  368

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            + +I+I+VFALVFFY+IPIAFVQSLANLEG+EKVAPFLRP+I+   VKSFLQGFLPGLA
Sbjct  369  KFLISIAVFALVFFYMIPIAFVQSLANLEGIEKVAPFLRPVIDTPVVKSFLQGFLPGLA  427



>gb|EAY79648.1| hypothetical protein OsI_34792 [Oryza sativa Indica Group]
Length=811

 Score =   282 bits (722),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 155/179 (87%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDY QLK ER+PGKRP  +TG LG  G++VD ++YY+ +I E D+ L  ER+++L 
Sbjct  249  LQNWLDYYQLKFERHPGKRPIGRTGCLGFCGREVDQIDYYRARISELDKKLASERQRVLN  308

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK ++P AFV+FDSRWGAAVCAQTQQSKNPT WLT+WAPEPRD++W+NL+I F SLSIR
Sbjct  309  DPKAVMPVAFVTFDSRWGAAVCAQTQQSKNPTQWLTDWAPEPRDVYWQNLAIPFFSLSIR  368

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            + +I+I+VFALVFFY+IPIAFVQSLANLEG+EKVAPFLRP+I+   VKSFLQGFLPGLA
Sbjct  369  KFLISIAVFALVFFYMIPIAFVQSLANLEGIEKVAPFLRPVIDAPVVKSFLQGFLPGLA  427



>ref|XP_003574401.1| PREDICTED: CSC1-like protein At1g32090 isoform X1 [Brachypodium 
distachyon]
Length=794

 Score =   281 bits (719),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 154/179 (86%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDY QLK ER+P KRPT +TG  G  G+KVD ++YY+ +I E D+ +  ER+++L 
Sbjct  250  LQNWLDYYQLKFERHPEKRPTGRTGCFGFCGRKVDQIDYYRARISELDKRMASERQRVLN  309

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK ++P +FV+FDSRWGAAVCAQTQQSKNPT WLT+WAPEPRD++W+NL+I F SLSIR
Sbjct  310  DPKAVMPVSFVTFDSRWGAAVCAQTQQSKNPTQWLTDWAPEPRDVYWQNLAIPFFSLSIR  369

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            + +I+I+VFALVFFY+IPIAFVQSLANLEG+EKVAPF+RP+IE K VKSFLQGFLPGL 
Sbjct  370  KFLISIAVFALVFFYMIPIAFVQSLANLEGIEKVAPFVRPVIEVKVVKSFLQGFLPGLT  428



>ref|XP_006662108.1| PREDICTED: uncharacterized membrane protein C24H6.13-like [Oryza 
brachyantha]
Length=807

 Score =   281 bits (720),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 155/179 (87%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDY QLKLER+ G+RP  +TG LG  G++VD ++YY  +I E D+ L  ER+++L 
Sbjct  250  LQNWLDYYQLKLERHSGRRPIGRTGCLGFCGREVDQIDYYHARISELDKKLASERQRVLN  309

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK ++P AFV+FDSRWGAAVCAQTQQSKNPT WLT+WAPEPRD++W+NL+I F SLSIR
Sbjct  310  DPKAVMPVAFVTFDSRWGAAVCAQTQQSKNPTQWLTDWAPEPRDVYWENLAIPFFSLSIR  369

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            + +I+++VFALVFFY+IPIAFVQSLANLEG+EKVAPFLRP+IE + VKSFLQGFLPGLA
Sbjct  370  KFLISVAVFALVFFYMIPIAFVQSLANLEGIEKVAPFLRPVIEARVVKSFLQGFLPGLA  428



>ref|XP_006854105.1| hypothetical protein AMTR_s00048p00143150 [Amborella trichopoda]
 gb|ERN15572.1| hypothetical protein AMTR_s00048p00143150 [Amborella trichopoda]
Length=760

 Score =   275 bits (704),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 155/180 (86%), Gaps = 1/180 (1%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNP-GKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKIL  177
            L+NWLDY QLK ER+P  KRPT++ GF GL G++VDS++YY ++I   ++ +  ER+KIL
Sbjct  253  LRNWLDYYQLKYERHPEKKRPTTRRGFFGLCGERVDSIDYYTQRINVLEKRIQSERQKIL  312

Query  178  KDPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSI  357
             D K  +P AFVSFDSRWGAAVCAQTQQSKNPTLWLT+WAPEPRD++W+NL+I FVSL+I
Sbjct  313  NDSKGALPVAFVSFDSRWGAAVCAQTQQSKNPTLWLTDWAPEPRDVYWQNLAIPFVSLTI  372

Query  358  RRLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RRL+I +SVF LVFFY+IPIAFVQSLANLEGLE+VAPFLR +IE KF+KSFLQGFLPGL 
Sbjct  373  RRLIITVSVFLLVFFYMIPIAFVQSLANLEGLERVAPFLRTVIELKFIKSFLQGFLPGLT  432



>ref|NP_001043256.1| Os01g0534900 [Oryza sativa Japonica Group]
 dbj|BAD87679.1| putative ERD4 protein [Oryza sativa Japonica Group]
 dbj|BAF05170.1| Os01g0534900 [Oryza sativa Japonica Group]
 dbj|BAG96168.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC70822.1| hypothetical protein OsI_02298 [Oryza sativa Indica Group]
 gb|EEE54743.1| hypothetical protein OsJ_02101 [Oryza sativa Japonica Group]
 gb|AIU34628.1| hyperosmolality-gated Ca2+ permeable channel 1.1 [Oryza sativa]
Length=768

 Score =   272 bits (695),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 152/179 (85%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNWLDY QLK ERN  +RPT+KTGFLG +G KVD++EYY  +I+  ++  T ER KI+K
Sbjct  251  MQNWLDYYQLKYERNTSQRPTTKTGFLGCFGSKVDAIEYYTSEIERIEKEETDERGKIMK  310

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK ++PAAFVSF SRWGAAVCAQTQQ+ NPT+WLT WAPEPRD++W NLSI FV L+IR
Sbjct  311  DPKSVVPAAFVSFRSRWGAAVCAQTQQTSNPTVWLTEWAPEPRDVYWDNLSIPFVYLTIR  370

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+IA++ F L FFY++PIAFVQSLAN+EG+EK APFL+PLIE + +KSF+QGFLPG+A
Sbjct  371  RLIIAVAFFFLNFFYVLPIAFVQSLANIEGIEKAAPFLKPLIEMRTIKSFIQGFLPGIA  429



>ref|XP_002440380.1| hypothetical protein SORBIDRAFT_09g030770 [Sorghum bicolor]
 gb|EES18810.1| hypothetical protein SORBIDRAFT_09g030770 [Sorghum bicolor]
Length=766

 Score =   270 bits (689),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 120/179 (67%), Positives = 152/179 (85%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNWLDY +LK ERNP +RPT+KTGFLG +G KVD+++YYK +I++  +    ER+K++K
Sbjct  251  MQNWLDYYRLKYERNPSERPTTKTGFLGCFGSKVDAIDYYKSEIEKIGKEEAEERKKVMK  310

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK ++PAAFVSF SRWGAAVCAQTQQ+ NPT+WLT WAPEPRD++W NLSI FVSL++R
Sbjct  311  DPKSVVPAAFVSFRSRWGAAVCAQTQQTSNPTVWLTEWAPEPRDVYWNNLSIPFVSLTVR  370

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+IA++ F L FFY+IPI  VQSLANLEG+EK  PFL+PLIE  F+KSF+QGFLPG+A
Sbjct  371  RLIIAVAFFFLNFFYIIPITLVQSLANLEGIEKALPFLKPLIELPFIKSFIQGFLPGIA  429



>ref|NP_001056508.1| Os05g0594700 [Oryza sativa Japonica Group]
 gb|AAV59379.1| putative early-responsive to dehydration stress protein (ERD4) 
[Oryza sativa Japonica Group]
 dbj|BAF18422.1| Os05g0594700 [Oryza sativa Japonica Group]
 gb|EAY99267.1| hypothetical protein OsI_21231 [Oryza sativa Indica Group]
 dbj|BAG93571.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AIU34629.1| hyperosmolality-gated Ca2+ permeable channel 1.2 [Oryza sativa]
Length=766

 Score =   268 bits (684),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 120/179 (67%), Positives = 152/179 (85%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDY QLK ERNP KRPT+KTGFLG +G +VD++EYYK +I++  +    ER+KI+K
Sbjct  251  LQNWLDYYQLKYERNPSKRPTTKTGFLGCFGSEVDAIEYYKAEIEKIGKEEADERQKIMK  310

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DP+  +PAAFVSF SRWGAAVCAQTQQ+ NPT+W+T WAPEPRD++W NLSI FVSL++R
Sbjct  311  DPQSAVPAAFVSFRSRWGAAVCAQTQQTSNPTVWITEWAPEPRDVYWNNLSIPFVSLTVR  370

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL++A++ F L FFY+IPIAFVQSLA+LEG+EK  PFL+PLI+   +KSF+QGFLPG+A
Sbjct  371  RLIVAVAFFFLNFFYVIPIAFVQSLASLEGIEKALPFLKPLIKIDVIKSFIQGFLPGIA  429



>ref|XP_010252492.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Nelumbo 
nucifera]
Length=770

 Score =   266 bits (681),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 154/179 (86%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDYNQLK  RNP K+PT KTGFLGLWG++VD+++YY  +I E  + +  ERE +  
Sbjct  255  LQNWLDYNQLKHTRNPSKKPTMKTGFLGLWGERVDAIDYYTSKIDELSKEIEAERESVRS  314

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            +PK I+PAAFVSF +RWGAAVCAQTQQS+NPTLWLT WAPEPRD++WKNL+I FVSL++R
Sbjct  315  NPKSIMPAAFVSFKTRWGAAVCAQTQQSRNPTLWLTEWAPEPRDVYWKNLAIPFVSLTVR  374

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL++A++ F L FF++IPIAFVQSLAN+EG+EK APFL+ +IE KF+KSF+QGFLPG+A
Sbjct  375  RLIVAVAFFFLTFFFMIPIAFVQSLANIEGIEKSAPFLKSIIEVKFIKSFIQGFLPGIA  433



>ref|XP_006654880.1| PREDICTED: uncharacterized membrane protein YLR241W-like [Oryza 
brachyantha]
Length=770

 Score =   266 bits (680),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/179 (67%), Positives = 152/179 (85%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            ++NWLDY QLK ERN  KRPT+KTGFLG +G +VD++EYYK +I++  +    ER+KI+K
Sbjct  251  MRNWLDYYQLKYERNQSKRPTTKTGFLGCFGSEVDAIEYYKTEIEKIGKEEAAERKKIIK  310

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK ++PAAFVSF SRWGAAVCAQTQQ+ NPT+WLT WAPEPRD++W NLSI FVSL++R
Sbjct  311  DPKSVVPAAFVSFRSRWGAAVCAQTQQTSNPTVWLTEWAPEPRDVYWNNLSIPFVSLTVR  370

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+IA++ F L FFY+IPIAFVQSLA+LEG+EK  PFL+PLI+   +KSF+QGFLPG+A
Sbjct  371  RLIIAVAFFFLNFFYIIPIAFVQSLASLEGIEKALPFLKPLIDIPSIKSFIQGFLPGIA  429



>gb|EEE64912.1| hypothetical protein OsJ_19772 [Oryza sativa Japonica Group]
Length=893

 Score =   268 bits (685),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/179 (67%), Positives = 152/179 (85%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDY QLK ERNP KRPT+KTGFLG +G +VD++EYYK +I++  +    ER+KI+K
Sbjct  251  LQNWLDYYQLKYERNPSKRPTTKTGFLGCFGSEVDAIEYYKAEIEKIGKEEADERQKIMK  310

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DP+  +PAAFVSF SRWGAAVCAQTQQ+ NPT+W+T WAPEPRD++W NLSI FVSL++R
Sbjct  311  DPQSAVPAAFVSFRSRWGAAVCAQTQQTSNPTVWITEWAPEPRDVYWNNLSIPFVSLTVR  370

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL++A++ F L FFY+IPIAFVQSLA+LEG+EK  PFL+PLI+   +KSF+QGFLPG+A
Sbjct  371  RLIVAVAFFFLNFFYVIPIAFVQSLASLEGIEKALPFLKPLIKIDVIKSFIQGFLPGIA  429



>ref|XP_004960982.1| PREDICTED: uncharacterized membrane protein YLR241W-like [Setaria 
italica]
Length=768

 Score =   265 bits (677),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 117/179 (65%), Positives = 150/179 (84%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNWLDY +LK ERNP +RPT+KTGFLG +G KVD+++YYK +I++  +    ER+K++K
Sbjct  252  MQNWLDYYRLKYERNPSERPTTKTGFLGCFGSKVDAIDYYKSEIEKIGKEEAEERKKVMK  311

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK ++PAAFVSF SRWGAAVCAQTQQ+ NPT+WLT WAPEPRD++W NLSI FVSL++R
Sbjct  312  DPKSVVPAAFVSFRSRWGAAVCAQTQQTSNPTVWLTEWAPEPRDVYWNNLSIPFVSLTVR  371

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+IA++ F L FFY+IPI FVQSLANLEG+EK  PFL+PL+E   +KSF+QG LPG+ 
Sbjct  372  RLIIAVAFFFLNFFYVIPITFVQSLANLEGIEKALPFLKPLVELPLIKSFIQGLLPGIV  430



>ref|XP_006469645.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X3 [Citrus sinensis]
Length=599

 Score =   261 bits (667),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 152/179 (85%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNWLD+ QLK  RNP ++P++KTGFLGLWGK VD++++Y  +I+   + +++ER+K++ 
Sbjct  91   MQNWLDFYQLKYSRNPARKPSTKTGFLGLWGKTVDAIDFYTSKIETLKKEISLERDKVMS  150

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
              K +IPAAFVSF +RWGA+VCAQTQQ++NPTLWLT+WAPEPRD++W NL+I FVSL+IR
Sbjct  151  SGKSVIPAAFVSFKTRWGASVCAQTQQTRNPTLWLTDWAPEPRDVYWDNLAIPFVSLTIR  210

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+I ++ F L FF++IPIA VQSLAN+EG+EK  PFL+P+IE K +KSF+QGFLPG+A
Sbjct  211  RLIIFVAYFFLTFFFMIPIAIVQSLANIEGIEKALPFLKPIIEVKVIKSFIQGFLPGIA  269



>ref|XP_002264502.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Vitis 
vinifera]
 ref|XP_010655368.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Vitis 
vinifera]
 ref|XP_010655369.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Vitis 
vinifera]
 ref|XP_010655370.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Vitis 
vinifera]
 emb|CBI23200.3| unnamed protein product [Vitis vinifera]
Length=771

 Score =   265 bits (676),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 150/179 (84%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNWLDY Q+K  RN   RP  KTGFLGLWG +VD++++Y  +I++  + +++ERE++  
Sbjct  253  MQNWLDYYQIKYSRNESSRPFLKTGFLGLWGNRVDAMDFYTSEIEKLCKEISVERERVAN  312

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+PAAFVSF +RWGAAVCAQTQQS+NPTLWLT WAPEPRD++W NL+I FVSL++R
Sbjct  313  DPKSIMPAAFVSFKTRWGAAVCAQTQQSRNPTLWLTEWAPEPRDVYWHNLAIPFVSLTVR  372

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+IA++ F L FFY+IPIAFVQSLA++EG+EK  PFLRP+IE KF+KS +QGFLPG+ 
Sbjct  373  RLIIAVAFFFLTFFYMIPIAFVQSLASIEGIEKAVPFLRPIIEKKFIKSLIQGFLPGIV  431



>gb|AFW81356.1| hypothetical protein ZEAMMB73_379943, partial [Zea mays]
Length=731

 Score =   263 bits (672),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/179 (66%), Positives = 149/179 (83%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            ++NWLDY  LK ERN   RPT+KTGFLG +G KVD+++YYK +I++  +    ER+ ++K
Sbjct  251  MRNWLDYYLLKYERNSSLRPTTKTGFLGCFGSKVDAIDYYKSEIEKIGKQEAEERKNVMK  310

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK ++PAAFVSF SRWGAAVCAQTQQ+ NPTLWLT WAPEPRD++W NLSI FVSL+IR
Sbjct  311  DPKSVVPAAFVSFRSRWGAAVCAQTQQTSNPTLWLTEWAPEPRDVYWNNLSIPFVSLTIR  370

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL++A++ F L FFY+IPI FVQSLANLEG+EK  PFL+PLI+  F+KSF+QGFLPG+A
Sbjct  371  RLIVAVAFFFLNFFYVIPITFVQSLANLEGIEKALPFLKPLIDLPFIKSFIQGFLPGIA  429



>gb|AFW81357.1| HYP1 isoform 1 [Zea mays]
 gb|AFW81358.1| HYP1 isoform 2 [Zea mays]
Length=768

 Score =   263 bits (672),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/179 (66%), Positives = 149/179 (83%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            ++NWLDY  LK ERN   RPT+KTGFLG +G KVD+++YYK +I++  +    ER+ ++K
Sbjct  251  MRNWLDYYLLKYERNSSLRPTTKTGFLGCFGSKVDAIDYYKSEIEKIGKQEAEERKNVMK  310

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK ++PAAFVSF SRWGAAVCAQTQQ+ NPTLWLT WAPEPRD++W NLSI FVSL+IR
Sbjct  311  DPKSVVPAAFVSFRSRWGAAVCAQTQQTSNPTLWLTEWAPEPRDVYWNNLSIPFVSLTIR  370

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL++A++ F L FFY+IPI FVQSLANLEG+EK  PFL+PLI+  F+KSF+QGFLPG+A
Sbjct  371  RLIVAVAFFFLNFFYVIPITFVQSLANLEGIEKALPFLKPLIDLPFIKSFIQGFLPGIA  429



>ref|XP_010924082.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X5 [Elaeis guineensis]
Length=688

 Score =   261 bits (666),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 117/179 (65%), Positives = 152/179 (85%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNWLDY QLK +RNP KRPT+KTGFLGL G KVD++E+Y  +++   +    EREK+ K
Sbjct  251  MQNWLDYYQLKYDRNPSKRPTTKTGFLGLCGDKVDAIEFYTSEVERLSKKAATEREKVKK  310

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK ++PAAFVSF +RWGAAVCAQTQQ++NPTLWLT WAPEPRD++W+NL++ FVSL++R
Sbjct  311  DPKSVMPAAFVSFRTRWGAAVCAQTQQTRNPTLWLTKWAPEPRDVYWQNLAMPFVSLTVR  370

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+IA++ F L FF++IPIAFVQSLAN+EG+EK  PFL+P+IE   +KSF+QGFLPG+A
Sbjct  371  RLIIAVAFFFLTFFFMIPIAFVQSLANIEGIEKAVPFLKPIIEVHIIKSFIQGFLPGIA  429



>ref|NP_001147493.1| LOC100281102 [Zea mays]
 gb|ACG27714.1| HYP1 [Zea mays]
Length=768

 Score =   261 bits (668),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/179 (65%), Positives = 148/179 (83%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            ++NWLDY  LK ERN   RPT+KTGFLG +G KVD+++YYK +I++  +    ER+ ++K
Sbjct  251  MRNWLDYYLLKYERNSSLRPTTKTGFLGCFGSKVDAIDYYKSEIEKIGKQEAEERKNVMK  310

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK ++PAAFVSF SRWGAAVCAQTQQ+ NPTLWLT WAPEPRD++W NLSI FVSL+IR
Sbjct  311  DPKSVVPAAFVSFRSRWGAAVCAQTQQTSNPTLWLTEWAPEPRDVYWNNLSIPFVSLTIR  370

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL++A++ F L  FY+IPI FVQSLANLEG+EK  PFL+PLI+  F+KSF+QGFLPG+A
Sbjct  371  RLIVAVAFFFLKLFYVIPITFVQSLANLEGIEKALPFLKPLIDLPFIKSFIQGFLPGIA  429



>ref|XP_009395092.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009395094.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009395095.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Musa acuminata subsp. malaccensis]
Length=768

 Score =   261 bits (667),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 149/179 (83%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNW DY QLK +R+P KRPT KTGFLGL G +VD++E+Y  +I E       ERE I  
Sbjct  252  MQNWHDYYQLKYDRDPSKRPTRKTGFLGLCGDEVDAIEFYTSKIDELSEKEATEREMIKN  311

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            + K I+PAAFVSF +RWGAAVCAQTQQ++NPTLWLT WAPEPRD++W+NL+I FVSL++R
Sbjct  312  NSKSIMPAAFVSFRTRWGAAVCAQTQQTQNPTLWLTEWAPEPRDVYWQNLAIPFVSLTVR  371

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL++A++VF L FF++IPIAFVQSLAN+EG+EKV PFL+P+IE K +K+F+QGFLPG+A
Sbjct  372  RLIVAVAVFFLTFFFMIPIAFVQSLANIEGIEKVVPFLKPIIEEKTIKAFIQGFLPGIA  430



>ref|XP_006447609.1| hypothetical protein CICLE_v10014378mg [Citrus clementina]
 ref|XP_006469643.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X1 [Citrus sinensis]
 ref|XP_006469644.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X2 [Citrus sinensis]
 gb|ESR60849.1| hypothetical protein CICLE_v10014378mg [Citrus clementina]
Length=759

 Score =   261 bits (667),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 152/179 (85%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNWLD+ QLK  RNP ++P++KTGFLGLWGK VD++++Y  +I+   + +++ER+K++ 
Sbjct  251  MQNWLDFYQLKYSRNPARKPSTKTGFLGLWGKTVDAIDFYTSKIETLKKEISLERDKVMS  310

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
              K +IPAAFVSF +RWGA+VCAQTQQ++NPTLWLT+WAPEPRD++W NL+I FVSL+IR
Sbjct  311  SGKSVIPAAFVSFKTRWGASVCAQTQQTRNPTLWLTDWAPEPRDVYWDNLAIPFVSLTIR  370

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+I ++ F L FF++IPIA VQSLAN+EG+EK  PFL+P+IE K +KSF+QGFLPG+A
Sbjct  371  RLIIFVAYFFLTFFFMIPIAIVQSLANIEGIEKALPFLKPIIEVKVIKSFIQGFLPGIA  429



>ref|XP_010231849.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X2 [Brachypodium distachyon]
Length=703

 Score =   260 bits (664),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/179 (68%), Positives = 151/179 (84%), Gaps = 1/179 (1%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            ++NWLDY QLK ER   KRPT+KTGFLG +G +VD+++YYK +I++  +    ER+K++K
Sbjct  186  MRNWLDYYQLKSERK-SKRPTTKTGFLGCFGSEVDAIDYYKSEIEKIGKEEAEERKKVVK  244

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+PAAFVSF SRWGAAVCAQTQQ+ NPTLWLT WAPEPRD++W NLSI FVSL++R
Sbjct  245  DPKSIMPAAFVSFRSRWGAAVCAQTQQTSNPTLWLTEWAPEPRDVYWNNLSIPFVSLTVR  304

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+IA++ F L FFY+IPIAFVQ+LANLEG+EK  PFL+PLIE   VKSF+QGFLPG+A
Sbjct  305  RLIIAVAFFFLNFFYVIPIAFVQTLANLEGIEKALPFLKPLIETPSVKSFIQGFLPGIA  363



>ref|XP_010924080.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X3 [Elaeis guineensis]
Length=732

 Score =   260 bits (664),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/179 (65%), Positives = 152/179 (85%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNWLDY QLK +RNP KRPT+KTGFLGL G KVD++E+Y  +++   +    EREK+ K
Sbjct  217  MQNWLDYYQLKYDRNPSKRPTTKTGFLGLCGDKVDAIEFYTSEVERLSKKAATEREKVKK  276

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK ++PAAFVSF +RWGAAVCAQTQQ++NPTLWLT WAPEPRD++W+NL++ FVSL++R
Sbjct  277  DPKSVMPAAFVSFRTRWGAAVCAQTQQTRNPTLWLTKWAPEPRDVYWQNLAMPFVSLTVR  336

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+IA++ F L FF++IPIAFVQSLAN+EG+EK  PFL+P+IE   +KSF+QGFLPG+A
Sbjct  337  RLIIAVAFFFLTFFFMIPIAFVQSLANIEGIEKAVPFLKPIIEVHIIKSFIQGFLPGIA  395



>ref|XP_010924079.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X2 [Elaeis guineensis]
Length=745

 Score =   260 bits (664),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/179 (65%), Positives = 152/179 (85%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNWLDY QLK +RNP KRPT+KTGFLGL G KVD++E+Y  +++   +    EREK+ K
Sbjct  230  MQNWLDYYQLKYDRNPSKRPTTKTGFLGLCGDKVDAIEFYTSEVERLSKKAATEREKVKK  289

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK ++PAAFVSF +RWGAAVCAQTQQ++NPTLWLT WAPEPRD++W+NL++ FVSL++R
Sbjct  290  DPKSVMPAAFVSFRTRWGAAVCAQTQQTRNPTLWLTKWAPEPRDVYWQNLAMPFVSLTVR  349

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+IA++ F L FF++IPIAFVQSLAN+EG+EK  PFL+P+IE   +KSF+QGFLPG+A
Sbjct  350  RLIIAVAFFFLTFFFMIPIAFVQSLANIEGIEKAVPFLKPIIEVHIIKSFIQGFLPGIA  408



>ref|XP_003569103.1| PREDICTED: CSC1-like protein At3g21620 isoform X1 [Brachypodium 
distachyon]
Length=768

 Score =   260 bits (665),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/179 (68%), Positives = 151/179 (84%), Gaps = 1/179 (1%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            ++NWLDY QLK ER   KRPT+KTGFLG +G +VD+++YYK +I++  +    ER+K++K
Sbjct  251  MRNWLDYYQLKSERK-SKRPTTKTGFLGCFGSEVDAIDYYKSEIEKIGKEEAEERKKVVK  309

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+PAAFVSF SRWGAAVCAQTQQ+ NPTLWLT WAPEPRD++W NLSI FVSL++R
Sbjct  310  DPKSIMPAAFVSFRSRWGAAVCAQTQQTSNPTLWLTEWAPEPRDVYWNNLSIPFVSLTVR  369

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+IA++ F L FFY+IPIAFVQ+LANLEG+EK  PFL+PLIE   VKSF+QGFLPG+A
Sbjct  370  RLIIAVAFFFLNFFYVIPIAFVQTLANLEGIEKALPFLKPLIETPSVKSFIQGFLPGIA  428



>ref|XP_010924075.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Elaeis guineensis]
 ref|XP_010924076.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Elaeis guineensis]
 ref|XP_010924077.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Elaeis guineensis]
Length=766

 Score =   260 bits (664),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/179 (65%), Positives = 152/179 (85%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNWLDY QLK +RNP KRPT+KTGFLGL G KVD++E+Y  +++   +    EREK+ K
Sbjct  251  MQNWLDYYQLKYDRNPSKRPTTKTGFLGLCGDKVDAIEFYTSEVERLSKKAATEREKVKK  310

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK ++PAAFVSF +RWGAAVCAQTQQ++NPTLWLT WAPEPRD++W+NL++ FVSL++R
Sbjct  311  DPKSVMPAAFVSFRTRWGAAVCAQTQQTRNPTLWLTKWAPEPRDVYWQNLAMPFVSLTVR  370

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+IA++ F L FF++IPIAFVQSLAN+EG+EK  PFL+P+IE   +KSF+QGFLPG+A
Sbjct  371  RLIIAVAFFFLTFFFMIPIAFVQSLANIEGIEKAVPFLKPIIEVHIIKSFIQGFLPGIA  429



>ref|XP_010038117.1| PREDICTED: CSC1-like protein At4g02900 [Eucalyptus grandis]
 gb|KCW49929.1| hypothetical protein EUGRSUZ_K03391 [Eucalyptus grandis]
Length=756

 Score =   259 bits (663),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 147/179 (82%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNW  Y Q K ERNP  +PT+KTGF GLWG +VD+++YY  +I++       ERE+++ 
Sbjct  252  LQNWYIYYQNKYERNPSMKPTTKTGFCGLWGTRVDAIDYYAAEIEKLTEEEQAERERVIS  311

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK IIPAAFVSF SRWGAAVCAQTQQ+ NPT+WLT WAPEPRD++W NL+I +V L+IR
Sbjct  312  DPKAIIPAAFVSFKSRWGAAVCAQTQQTSNPTIWLTQWAPEPRDVYWDNLAIPYVELTIR  371

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL++A+++F L FF++IPIAFVQSLAN+EG+EKV PFL+PLIE K VKS +QGFLPG+A
Sbjct  372  RLLMAVALFFLTFFFMIPIAFVQSLANIEGIEKVLPFLKPLIERKGVKSLIQGFLPGIA  430



>ref|XP_002457968.1| hypothetical protein SORBIDRAFT_03g023990 [Sorghum bicolor]
 gb|EES03088.1| hypothetical protein SORBIDRAFT_03g023990 [Sorghum bicolor]
Length=768

 Score =   259 bits (663),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 151/179 (84%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNWLDY QLK ERN  KRPT+KTGFLG +G KVD+++YY  +I+  +     EREKI+K
Sbjct  251  MQNWLDYYQLKFERNASKRPTTKTGFLGCFGTKVDAIQYYTSEIERIENEEAEEREKIVK  310

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK ++PAAFVSF SRWGAAVCAQTQQ+ NPT+WLT WAPEPRD++W NLSI FVSL++R
Sbjct  311  DPKSVVPAAFVSFRSRWGAAVCAQTQQTSNPTVWLTEWAPEPRDVYWDNLSIPFVSLTVR  370

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL++A++ F L FFY+IPIAFVQSLAN+EG+EK APFL+PLIE   +KSF+QGFLPG+A
Sbjct  371  RLIVAVAFFFLNFFYVIPIAFVQSLANIEGIEKAAPFLKPLIEEPTIKSFIQGFLPGIA  429



>ref|XP_008363043.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized membrane protein 
C2G11.09-like [Malus domestica]
Length=660

 Score =   257 bits (657),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 148/178 (83%), Gaps = 0/178 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
            QNWLDY QLK  RN  KRP+ KTGFLGLWGK VD++++Y  +I+   + +++ER+KI   
Sbjct  145  QNWLDYYQLKFSRNSSKRPSKKTGFLGLWGKWVDAIDFYTSEIERPSKEISLERDKITNS  204

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
            PK I+PAAFVSF +RWGAAVCAQTQ S+NPT+WLT WAPEP D++W NL+I +V+L+IRR
Sbjct  205  PKSIMPAAFVSFRTRWGAAVCAQTQLSRNPTIWLTEWAPEPHDVYWDNLAILYVTLTIRR  264

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            LV+A++ F L F ++IPIAFVQSLAN+EG+EK  PFL+P++E KF+KSF+QGFLPG+A
Sbjct  265  LVVAVAFFFLTFXFMIPIAFVQSLANIEGIEKAVPFLKPIVEVKFIKSFIQGFLPGIA  322



>ref|XP_008363487.1| PREDICTED: uncharacterized protein RSN1-like [Malus domestica]
Length=567

 Score =   255 bits (651),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 151/179 (84%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNWLDY QLK  RN  KRP+ +TGFLGLWGK VD+V++Y  +I+   + +++ER+KI  
Sbjct  48   IQNWLDYYQLKFSRNSSKRPSKRTGFLGLWGKWVDAVDFYTSEIERLSKEISLERDKITS  107

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
             PK I+PAAFVSF +RWGAAVCAQ QQS+NPT+WLT WAPEPRD++W NL+I +V+L+IR
Sbjct  108  SPKSIMPAAFVSFRTRWGAAVCAQAQQSRNPTIWLTEWAPEPRDVYWDNLAIPYVTLTIR  167

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RLV+A++ F L FF++IPIAFVQSLAN+EG+EK  PFL+P+IE KF+KSF+QGFLPG+A
Sbjct  168  RLVVAVAFFFLTFFFMIPIAFVQSLANIEGIEKAVPFLKPIIEVKFIKSFIQGFLPGIA  226



>emb|CBI32349.3| unnamed protein product [Vitis vinifera]
Length=766

 Score =   259 bits (661),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 150/179 (84%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWL Y Q K ERNP K+PT+KTGF GLWG  VD+V++Y  ++++    +T ERE+++ 
Sbjct  262  LQNWLTYYQNKYERNPEKKPTTKTGFCGLWGTNVDAVDHYAAKMEKLCEAVTEERERVIT  321

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+PAAFVSF +RWGAAVCAQTQQS+NPT+WLT WAPEPRDI+W NL+I +V L+IR
Sbjct  322  DPKAIMPAAFVSFKTRWGAAVCAQTQQSRNPTIWLTEWAPEPRDIYWDNLAIPYVELTIR  381

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL++A++VF L FF++IPIAFVQS+AN++G+EKV PFL+ L+E   +KSF+QGFLPG+A
Sbjct  382  RLLMAVAVFFLTFFFMIPIAFVQSIANIDGIEKVLPFLKSLMEMNVIKSFIQGFLPGIA  440



>ref|XP_006444131.1| hypothetical protein CICLE_v10024532mg [Citrus clementina]
 ref|XP_006479761.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X1 [Citrus sinensis]
 gb|ESR57371.1| hypothetical protein CICLE_v10024532mg [Citrus clementina]
Length=760

 Score =   258 bits (660),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/179 (66%), Positives = 149/179 (83%), Gaps = 1/179 (1%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            L+NWL Y +   ER   K+PT+KTGF GLWG +VD+++YY  +I +       EREK++ 
Sbjct  252  LRNWLTYYKNTYERT-SKKPTTKTGFWGLWGTRVDAIDYYTAEINKLTEEENAEREKVIS  310

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            D   IIPAAFVSF SRWGAAVCAQTQQS+NPT+WLTNWAPEPRDIFW NLSI +V L+IR
Sbjct  311  DANSIIPAAFVSFKSRWGAAVCAQTQQSRNPTIWLTNWAPEPRDIFWDNLSIPYVELTIR  370

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL++A+S+FAL+FF++IPIAFVQSLAN+EG++KV PFL+PLI++ FVKSF+QGFLPG+A
Sbjct  371  RLLMAVSLFALIFFFMIPIAFVQSLANIEGIQKVLPFLKPLIDFGFVKSFIQGFLPGIA  429



>ref|XP_008803557.1| PREDICTED: LOW QUALITY PROTEIN: calcium permeable stress-gated 
cation channel 1-like [Phoenix dactylifera]
Length=767

 Score =   258 bits (659),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 150/178 (84%), Gaps = 0/178 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
            QNWLDY QLK +RNP KRPT+KTGFLGL+GKKVD++E+Y  +++   +    E EK+ KD
Sbjct  252  QNWLDYYQLKYDRNPSKRPTAKTGFLGLYGKKVDAIEFYTTEVERLSKKEATEHEKVKKD  311

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
            PK I+P AFVSF +RWGAAVCAQTQQ++NPTLWLT WAPEPRD++W+NL+I FVSL++RR
Sbjct  312  PKSIMPVAFVSFRTRWGAAVCAQTQQTRNPTLWLTKWAPEPRDVYWQNLAIPFVSLTVRR  371

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            L+I ++ F L FF++IPIAFVQSLAN+EG+EK  PFL+P+I+   +KSF+QGFLPG+A
Sbjct  372  LIIGVAFFFLTFFFMIPIAFVQSLANIEGIEKAVPFLKPIIDLHIIKSFIQGFLPGIA  429



>ref|XP_007217157.1| hypothetical protein PRUPE_ppa001757mg [Prunus persica]
 gb|EMJ18356.1| hypothetical protein PRUPE_ppa001757mg [Prunus persica]
Length=769

 Score =   257 bits (657),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 152/179 (85%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDY QLKL RNP KRP+ KTGFLGLWG +VD++++Y  +I+   + ++ ER+KI  
Sbjct  251  LQNWLDYYQLKLSRNPSKRPSKKTGFLGLWGNRVDAIDFYTSEIERLLKEISSERDKITS  310

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            +PK I+PAAFVSF +RW AAVCAQTQQS+NPT+WLT WAPEPRD+ W NL+I +VSL+IR
Sbjct  311  NPKSIMPAAFVSFRTRWNAAVCAQTQQSRNPTIWLTEWAPEPRDVCWDNLAIPYVSLTIR  370

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RLV+A++ F L FF++IPIAFVQSLAN+EG+EK  PFL+P+IE KF+KSF+QGFLPG+A
Sbjct  371  RLVVAVAFFFLTFFFMIPIAFVQSLANIEGIEKAVPFLKPVIEVKFIKSFIQGFLPGIA  429



>ref|XP_006479762.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X2 [Citrus sinensis]
Length=760

 Score =   257 bits (656),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 150/179 (84%), Gaps = 1/179 (1%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            L+NWL Y +   ER   K+PT+KTGF GLWG +VD+++YY  +I +    ++ + EK++ 
Sbjct  252  LRNWLTYYKNTYERT-SKKPTTKTGFWGLWGTRVDAIDYYTAEINKLTEEVSFDTEKVIS  310

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            D   IIPAAFVSF SRWGAAVCAQTQQS+NPT+WLTNWAPEPRDIFW NLSI +V L+IR
Sbjct  311  DANSIIPAAFVSFKSRWGAAVCAQTQQSRNPTIWLTNWAPEPRDIFWDNLSIPYVELTIR  370

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL++A+S+FAL+FF++IPIAFVQSLAN+EG++KV PFL+PLI++ FVKSF+QGFLPG+A
Sbjct  371  RLLMAVSLFALIFFFMIPIAFVQSLANIEGIQKVLPFLKPLIDFGFVKSFIQGFLPGIA  429



>ref|XP_004968885.1| PREDICTED: uncharacterized membrane protein YLR241W-like [Setaria 
italica]
Length=768

 Score =   257 bits (657),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 150/179 (84%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNWLD+  LK ERN  +RPT+KTGFLG +G KVD++EYYK +I+  +     EREKI+K
Sbjct  251  MQNWLDFYLLKFERNASQRPTTKTGFLGCFGTKVDAIEYYKSEIERIENEEAEEREKIVK  310

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK ++PAAFVSF SRWGAAVCAQTQQ+ NPT+WLT WAPEPRD++W NLSI FVSL+IR
Sbjct  311  DPKSVVPAAFVSFRSRWGAAVCAQTQQTSNPTVWLTEWAPEPRDVYWDNLSIPFVSLTIR  370

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL++A++ F L FFY+IPIAFVQSLANLEG+EK  PFL+PLIE   +KSF+QGFLPG+A
Sbjct  371  RLIVAVAFFFLNFFYVIPIAFVQSLANLEGIEKAVPFLKPLIEIPTIKSFIQGFLPGIA  429



>ref|XP_008229991.1| PREDICTED: uncharacterized membrane protein C2G11.09 [Prunus 
mume]
Length=769

 Score =   257 bits (657),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 120/179 (67%), Positives = 151/179 (84%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDY QLKL RNP KRP+ KTGFLGLWG +VD++++Y  +I+   + ++ ER+ I  
Sbjct  251  LQNWLDYYQLKLSRNPSKRPSKKTGFLGLWGNRVDAIDFYTSEIERLLKEISSERDTITS  310

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            +PK I+PAAFVSF +RW AAVCAQTQQS+NPTLWLT WAPEPRDI W NL+I +VSL+IR
Sbjct  311  NPKSIMPAAFVSFRTRWNAAVCAQTQQSRNPTLWLTEWAPEPRDICWDNLAIPYVSLTIR  370

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RLV+A++ F L FF++IPIAFVQSLAN+EG+EK  PFL+P+IE KF+KSF+QGFLPG+A
Sbjct  371  RLVVAVAFFFLTFFFMIPIAFVQSLANIEGIEKAVPFLKPVIEVKFIKSFIQGFLPGIA  429



>ref|XP_010921304.1| PREDICTED: calcium permeable stress-gated cation channel 1 isoform 
X2 [Elaeis guineensis]
Length=682

 Score =   254 bits (650),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 118/179 (66%), Positives = 149/179 (83%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNWLDY QLK +RNP KRPT KTGFLGL GKKVD++E+Y  +I+   +    EREK+ K
Sbjct  251  MQNWLDYYQLKYDRNPSKRPTRKTGFLGLCGKKVDAIEFYTSEIERLSKEEATEREKVKK  310

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            +PK ++P AFVSF +RWGAAVCAQTQQ++NPTLWLT WAPEPRD++WKNL I FVSL++R
Sbjct  311  NPKSVMPVAFVSFRTRWGAAVCAQTQQTRNPTLWLTKWAPEPRDVYWKNLPIPFVSLTVR  370

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+IA++ F L FF++IPIAFVQSLAN+EG+EK  PFL+ +IE   +KSF+QGFLPG+A
Sbjct  371  RLIIAVAFFFLTFFFMIPIAFVQSLANIEGIEKAVPFLKHIIEVHIIKSFIQGFLPGIA  429



>ref|XP_006383870.1| early-responsive to dehydration family protein [Populus trichocarpa]
 gb|ERP61667.1| early-responsive to dehydration family protein [Populus trichocarpa]
Length=775

 Score =   256 bits (655),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 117/179 (65%), Positives = 151/179 (84%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNWLDY + K  RN  +RP +KTGFLGLWG KVD+++YY  +I++  + +T EREK+L 
Sbjct  255  MQNWLDYYRFKYSRNRSQRPQTKTGFLGLWGAKVDAIDYYISEIEKLSKEITEEREKVLN  314

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DP CI+PAAFVSF +RWGAAVCAQTQQS+NPTLWLT WAPEPRD++W NL+I +VSLS+R
Sbjct  315  DPNCIMPAAFVSFKTRWGAAVCAQTQQSRNPTLWLTEWAPEPRDVYWPNLAIPYVSLSVR  374

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+I +S F L FF++IPIAFVQSLA++EG+EK  PFL+P+IE +F+KS +QGFLPG+A
Sbjct  375  RLIIGVSFFFLAFFFMIPIAFVQSLASIEGIEKSLPFLKPVIEVEFIKSVVQGFLPGIA  433



>ref|XP_006644293.1| PREDICTED: uncharacterized membrane protein YLR241W-like isoform 
X1 [Oryza brachyantha]
 ref|XP_006644294.1| PREDICTED: uncharacterized membrane protein YLR241W-like isoform 
X2 [Oryza brachyantha]
Length=769

 Score =   256 bits (654),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 152/179 (85%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNWLDY QLK ERN  KRPT KTGFLG +G KVD++EYY  +I+  ++  T EREKI+K
Sbjct  251  MQNWLDYYQLKYERNTSKRPTMKTGFLGCFGSKVDAIEYYTSEIERIEKEETEEREKIVK  310

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK ++PAAFVSF SRWGAAVCAQTQQ+ NPT+WLT WAPEPRD++W NLSI FV L++R
Sbjct  311  DPKSVVPAAFVSFRSRWGAAVCAQTQQTSNPTVWLTEWAPEPRDVYWDNLSIPFVYLTVR  370

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+IA++ F L FFY+IPIAFVQSLAN+EG+EK APFL+PLIE + +KSF+QGFLPG+A
Sbjct  371  RLIIAVAFFFLNFFYVIPIAFVQSLANIEGIEKAAPFLKPLIEMRTIKSFIQGFLPGIA  429



>ref|XP_011047222.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011047223.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011047224.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011047225.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
Length=768

 Score =   255 bits (652),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 154/179 (86%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            ++NWLDY+Q+K  RN  ++P+ KTGFLGLWG +VD++++Y  +I+   R +++ER+KI+ 
Sbjct  251  MKNWLDYHQIKYSRNQSRKPSLKTGFLGLWGNRVDAIDHYTSEIERLSREISLERDKIVN  310

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            +PK I+PAAFVSF +RWGAAVCAQTQQS+NPT+WLT WAPEPRD++W NL+I FVSL++R
Sbjct  311  NPKSIMPAAFVSFKTRWGAAVCAQTQQSRNPTIWLTGWAPEPRDVYWDNLAIPFVSLTLR  370

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RLVIA++ F L FF++IPIAFVQSLAN+EG+EK  PFL+P+IE K +KSF+QGFLPG+A
Sbjct  371  RLVIAVAFFFLTFFFMIPIAFVQSLANIEGIEKALPFLKPIIEMKVIKSFIQGFLPGIA  429



>ref|XP_010921296.1| PREDICTED: calcium permeable stress-gated cation channel 1 isoform 
X1 [Elaeis guineensis]
Length=760

 Score =   255 bits (651),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/179 (66%), Positives = 149/179 (83%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNWLDY QLK +RNP KRPT KTGFLGL GKKVD++E+Y  +I+   +    EREK+ K
Sbjct  251  MQNWLDYYQLKYDRNPSKRPTRKTGFLGLCGKKVDAIEFYTSEIERLSKEEATEREKVKK  310

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            +PK ++P AFVSF +RWGAAVCAQTQQ++NPTLWLT WAPEPRD++WKNL I FVSL++R
Sbjct  311  NPKSVMPVAFVSFRTRWGAAVCAQTQQTRNPTLWLTKWAPEPRDVYWKNLPIPFVSLTVR  370

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+IA++ F L FF++IPIAFVQSLAN+EG+EK  PFL+ +IE   +KSF+QGFLPG+A
Sbjct  371  RLIIAVAFFFLTFFFMIPIAFVQSLANIEGIEKAVPFLKHIIEVHIIKSFIQGFLPGIA  429



>gb|KDP20707.1| hypothetical protein JCGZ_21178 [Jatropha curcas]
Length=694

 Score =   253 bits (647),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 149/178 (84%), Gaps = 0/178 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNWLDY QLK  RN   RP  KTGFLGLWGKKVD++++Y  +I++  + +  E+E++ K
Sbjct  173  MQNWLDYYQLKYSRNQSHRPFMKTGFLGLWGKKVDAIDHYTSEIEKLRKEIAEEKERVKK  232

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+PAAFVSF SRWGAAVCAQTQQS+NPTLWLT WAPEPRD++W+NL+I +V L+IR
Sbjct  233  DPKVIMPAAFVSFKSRWGAAVCAQTQQSRNPTLWLTEWAPEPRDVYWQNLAIPYVELTIR  292

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGL  534
            RL++ ++ F L FF++IPI FVQ LAN+EG+EK APFL+P+IE KF+KSFLQGFLPG+
Sbjct  293  RLIMGVAFFFLTFFFMIPIGFVQVLANIEGIEKAAPFLKPVIEIKFIKSFLQGFLPGI  350



>ref|XP_008799225.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Phoenix dactylifera]
Length=762

 Score =   254 bits (650),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 149/179 (83%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNWLDY QLK +RNP KRPT KTGFLGL GKKVD++E+Y  +I+   +    EREK+ K
Sbjct  251  MQNWLDYYQLKYDRNPSKRPTRKTGFLGLCGKKVDAIEFYTSEIERLSKEEATEREKVKK  310

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            +PK ++P AFVSF +RWGAAVCAQTQQ++NPTLWLT WAPEPRDI+W+NL I FVSL +R
Sbjct  311  NPKSVMPVAFVSFRTRWGAAVCAQTQQARNPTLWLTEWAPEPRDIYWQNLPIPFVSLIVR  370

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+IA++ F L FF++IPIAFVQSLAN+EG+EK APFL+ +IE   +KSF+QGFLPG+A
Sbjct  371  RLIIAVAFFFLTFFFMIPIAFVQSLANIEGIEKAAPFLKSIIEVHVIKSFIQGFLPGIA  429



>ref|XP_006850790.1| hypothetical protein AMTR_s00025p00102970 [Amborella trichopoda]
 gb|ERN12371.1| hypothetical protein AMTR_s00025p00102970 [Amborella trichopoda]
Length=765

 Score =   254 bits (650),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 147/179 (82%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWL YNQ K  RNP +RPT K GFLGLWG  VDS+++Y  +I +  +   IERE+++ 
Sbjct  253  LQNWLIYNQNKYARNPSRRPTRKIGFLGLWGGSVDSIDFYTSEIDKLAKEEEIERERVIS  312

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+PAAFVSF +RW AAVCAQTQQS+NPTLWLT WAPEPRD++W NL+I FVSL+IR
Sbjct  313  DPKAIMPAAFVSFRTRWAAAVCAQTQQSRNPTLWLTEWAPEPRDVYWHNLAIPFVSLTIR  372

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+I +++F L+FFY+IPI FVQSLAN+E +EK  PFL+PLIE K VKSF+QG+LPGLA
Sbjct  373  RLIIGVTLFFLIFFYIIPITFVQSLANIEAIEKAVPFLKPLIERKGVKSFIQGYLPGLA  431



>ref|XP_002321139.1| early-responsive to dehydration family protein [Populus trichocarpa]
 gb|EEE99454.1| early-responsive to dehydration family protein [Populus trichocarpa]
Length=768

 Score =   254 bits (650),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 153/179 (85%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            ++NWLDY Q+K  RN  ++P+ KTGFLGLWG +VD++++Y  +I+   R +++ER+KI+ 
Sbjct  251  MKNWLDYYQIKYSRNQSRKPSLKTGFLGLWGNRVDAIDHYTSEIERLSREISLERDKIVN  310

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            +PK I+PAAFVSF +RWGAAVCAQTQQS+NPT+WLT WAPEPRD++W NL+I FVSL++R
Sbjct  311  NPKSIMPAAFVSFKTRWGAAVCAQTQQSRNPTIWLTGWAPEPRDVYWDNLAIPFVSLTLR  370

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RLVIA++ F L FF++IPIAFVQSLAN+EG+EK  PFL+P+IE K +KSF+QGFLPG+A
Sbjct  371  RLVIAVAFFFLTFFFMIPIAFVQSLANIEGIEKALPFLKPIIEMKVIKSFIQGFLPGIA  429



>gb|KCW77011.1| hypothetical protein EUGRSUZ_D01358 [Eucalyptus grandis]
Length=663

 Score =   252 bits (644),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 153/179 (85%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNWLDY+QLK  RN  KRP +KTGFLGL G +VD++++Y  ++++  + +  EREK+  
Sbjct  144  MQNWLDYHQLKYTRNNSKRPLTKTGFLGLCGNQVDALDHYTLEVEKLSKEIAAEREKVAS  203

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+PAAFVSF +RWGAAVCAQTQQ +NPTLWLT+WAPEPRD++W NL+I +VSL+IR
Sbjct  204  DPKSIMPAAFVSFKTRWGAAVCAQTQQCRNPTLWLTDWAPEPRDVYWPNLAIPYVSLTIR  263

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL++A++ F L FF++IPIAFVQSLA+L+G+EKVAPFLRP+I+  F+KSF+QGFLPG+A
Sbjct  264  RLIMAVAFFFLTFFFMIPIAFVQSLASLDGIEKVAPFLRPIIDIGFIKSFIQGFLPGIA  322



>ref|XP_009404947.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=718

 Score =   253 bits (646),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 118/179 (66%), Positives = 152/179 (85%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNW DY QLK +++P KRP  KTGFLGL G+KVD++++YK +I E  +  T E+E I K
Sbjct  202  MQNWRDYYQLKYDKDPSKRPAVKTGFLGLCGEKVDAIDFYKSKIDELSKKETTEQEMIKK  261

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+PAAFVSF +RWGAAVCAQTQQ++NPTLWLT WAPEPRD++W+NL+I FVSL++R
Sbjct  262  DPKSIMPAAFVSFRTRWGAAVCAQTQQTRNPTLWLTEWAPEPRDVYWQNLAIPFVSLTVR  321

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+IA++ F L FF++IPIAFVQSLAN+EG+EKV PFL+P+IE   +KSF+QGFLPG+A
Sbjct  322  RLIIAVAFFFLTFFFMIPIAFVQSLANIEGIEKVVPFLKPVIEVGTIKSFIQGFLPGIA  380



>ref|XP_011046982.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X2 [Populus euphratica]
Length=672

 Score =   252 bits (643),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 149/179 (83%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNWLDY + K  RN  +RP +KTGFLGLWG KVD+++YY  +I++  + +  EREK+L 
Sbjct  152  MQNWLDYYRFKYSRNRSQRPQTKTGFLGLWGAKVDAIDYYISEIEKLSKEIAEEREKVLN  211

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DP CI+PAAFVSF +RWGAAVCAQTQQS+NPTLWLT WAPEPRD++W NL+I +VSLS+R
Sbjct  212  DPNCIMPAAFVSFKTRWGAAVCAQTQQSRNPTLWLTEWAPEPRDVYWPNLAIPYVSLSVR  271

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+I +S F L FF++IPIAFVQSLA++EG+EK  PFL+ +IE +F+KS +QGFLPG+A
Sbjct  272  RLIIGVSFFFLAFFFMIPIAFVQSLASIEGIEKSLPFLKSVIEVEFIKSVVQGFLPGIA  330



>ref|XP_009404922.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009404929.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009404937.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=768

 Score =   253 bits (647),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/179 (66%), Positives = 152/179 (85%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNW DY QLK +++P KRP  KTGFLGL G+KVD++++YK +I E  +  T E+E I K
Sbjct  252  MQNWRDYYQLKYDKDPSKRPAVKTGFLGLCGEKVDAIDFYKSKIDELSKKETTEQEMIKK  311

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+PAAFVSF +RWGAAVCAQTQQ++NPTLWLT WAPEPRD++W+NL+I FVSL++R
Sbjct  312  DPKSIMPAAFVSFRTRWGAAVCAQTQQTRNPTLWLTEWAPEPRDVYWQNLAIPFVSLTVR  371

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+IA++ F L FF++IPIAFVQSLAN+EG+EKV PFL+P+IE   +KSF+QGFLPG+A
Sbjct  372  RLIIAVAFFFLTFFFMIPIAFVQSLANIEGIEKVVPFLKPVIEVGTIKSFIQGFLPGIA  430



>gb|KFK30892.1| hypothetical protein AALP_AA6G039600 [Arabis alpina]
Length=693

 Score =   252 bits (643),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 141/179 (79%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWL Y + K ER P  RPT+KTG+ G WG  VD++++Y  +I +   +   EREKI+ 
Sbjct  177  LQNWLTYYENKYERKPTNRPTTKTGYGGFWGTTVDAIDFYTSKIHDLAEIEAAEREKIMN  236

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+PAAFVSF SRWG AVCAQTQQ  NPT+WLT WAPEPRD++W NLSI +V LSIR
Sbjct  237  DPKSIMPAAFVSFKSRWGTAVCAQTQQCHNPTIWLTEWAPEPRDVYWDNLSIPYVELSIR  296

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+  I++F L+F ++IPIAFVQSLANLEG++KV PFL+PLIE K VKS +QGFLPG+A
Sbjct  297  RLLTTIALFFLIFCFMIPIAFVQSLANLEGIQKVLPFLKPLIEMKTVKSVIQGFLPGIA  355



>ref|XP_007026163.1| ERD (early-responsive to dehydration stress) family protein isoform 
3 [Theobroma cacao]
 gb|EOY28785.1| ERD (early-responsive to dehydration stress) family protein isoform 
3 [Theobroma cacao]
Length=521

 Score =   248 bits (632),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 150/177 (85%), Gaps = 0/177 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
            QNWLDY QLK  RN  KRP  KTGFLGL G+KVD+++++  +I++  + +  ERE++ KD
Sbjct  254  QNWLDYYQLKYSRNSAKRPFMKTGFLGLRGEKVDAIDHHISEIEKLSKEIAEERERVKKD  313

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
            PKCI+PAAFVSF SRWGAAVCAQTQQS+NPTLWLT WA EPRD++W+NL+I +VSL++RR
Sbjct  314  PKCIMPAAFVSFKSRWGAAVCAQTQQSRNPTLWLTEWASEPRDVYWQNLAIPYVSLAVRR  373

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGL  534
            L++A++ F L FF++IPIA VQ+LA++EGLEK APFL+PLIE KF+KS +QGFLPG+
Sbjct  374  LIMAVAFFFLTFFFMIPIASVQALASIEGLEKAAPFLKPLIEIKFIKSVIQGFLPGI  430



>gb|KFK30891.1| hypothetical protein AALP_AA6G039600 [Arabis alpina]
Length=684

 Score =   251 bits (642),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 141/179 (79%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWL Y + K ER P  RPT+KTG+ G WG  VD++++Y  +I +   +   EREKI+ 
Sbjct  168  LQNWLTYYENKYERKPTNRPTTKTGYGGFWGTTVDAIDFYTSKIHDLAEIEAAEREKIMN  227

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+PAAFVSF SRWG AVCAQTQQ  NPT+WLT WAPEPRD++W NLSI +V LSIR
Sbjct  228  DPKSIMPAAFVSFKSRWGTAVCAQTQQCHNPTIWLTEWAPEPRDVYWDNLSIPYVELSIR  287

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+  I++F L+F ++IPIAFVQSLANLEG++KV PFL+PLIE K VKS +QGFLPG+A
Sbjct  288  RLLTTIALFFLIFCFMIPIAFVQSLANLEGIQKVLPFLKPLIEMKTVKSVIQGFLPGIA  346



>ref|XP_008455928.1| PREDICTED: uncharacterized membrane protein YLR241W isoform X3 
[Cucumis melo]
Length=629

 Score =   250 bits (639),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 147/179 (82%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNWLD+ QLK  RN  KR T KTGFLGLWG +VD++ YY  +I+   + +++E +K + 
Sbjct  112  MQNWLDFYQLKYSRNQSKRATVKTGFLGLWGDQVDAINYYSSKIEILSKEISLEADKTVS  171

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+PAAFVSF SRWGAAVCAQTQQS+NPT+WLT WAPEPRD++W NL+I FVSL+IR
Sbjct  172  DPKSIMPAAFVSFKSRWGAAVCAQTQQSRNPTIWLTEWAPEPRDVYWDNLAIPFVSLAIR  231

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+  ++ F L FF++IPIAFVQSLAN+E +EK APFLRP+IE KF+KS +QGFLPG+A
Sbjct  232  RLIAGVAFFFLTFFFMIPIAFVQSLANIESIEKTAPFLRPIIELKFIKSVIQGFLPGIA  290



>ref|XP_008455926.1| PREDICTED: uncharacterized membrane protein YLR241W isoform X2 
[Cucumis melo]
 ref|XP_008455927.1| PREDICTED: uncharacterized membrane protein YLR241W isoform X2 
[Cucumis melo]
Length=649

 Score =   251 bits (640),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 147/179 (82%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNWLD+ QLK  RN  KR T KTGFLGLWG +VD++ YY  +I+   + +++E +K + 
Sbjct  132  MQNWLDFYQLKYSRNQSKRATVKTGFLGLWGDQVDAINYYSSKIEILSKEISLEADKTVS  191

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+PAAFVSF SRWGAAVCAQTQQS+NPT+WLT WAPEPRD++W NL+I FVSL+IR
Sbjct  192  DPKSIMPAAFVSFKSRWGAAVCAQTQQSRNPTIWLTEWAPEPRDVYWDNLAIPFVSLAIR  251

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+  ++ F L FF++IPIAFVQSLAN+E +EK APFLRP+IE KF+KS +QGFLPG+A
Sbjct  252  RLIAGVAFFFLTFFFMIPIAFVQSLANIESIEKTAPFLRPIIELKFIKSVIQGFLPGIA  310



>ref|XP_011016279.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011016280.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011016281.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
Length=768

 Score =   253 bits (645),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 152/179 (85%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            ++NWLDY Q+K  RN  ++P+ KTGFLGLWG +VD++++Y  +I+   R +++ER+KI+ 
Sbjct  251  MKNWLDYYQIKYSRNQSRKPSLKTGFLGLWGNRVDAIDHYTSEIERLSREISLERDKIVN  310

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            +PK I+PAAFVSF +RWGAAVCAQTQQS+NPT+WLT WAPEPRD++W NL+I FVSL++R
Sbjct  311  NPKSIMPAAFVSFKTRWGAAVCAQTQQSRNPTIWLTGWAPEPRDVYWDNLAIPFVSLTLR  370

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RLVIA++ F L FF++IPIAFVQSLAN+EG+EK  PFL+P+IE K  KSF+QGFLPG+A
Sbjct  371  RLVIAVAFFFLTFFFMIPIAFVQSLANIEGIEKALPFLKPIIEMKVFKSFIQGFLPGIA  429



>ref|XP_007049121.1| ERD (early-responsive to dehydration stress) family protein [Theobroma 
cacao]
 gb|EOX93278.1| ERD (early-responsive to dehydration stress) family protein [Theobroma 
cacao]
Length=768

 Score =   252 bits (644),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 151/179 (84%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNWLD+ Q K ERNP +RP+ KTGFLGLWG  VD++++Y  +I+   R ++ EREK+  
Sbjct  251  IQNWLDFYQNKYERNPSRRPSLKTGFLGLWGNSVDAIDFYTSKIERLSRDISAEREKVAN  310

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            +PK I+PAAFVSF +RWGAAVCAQTQQS+NPT+WLT WAPEPRD++W+NL+I FV L+IR
Sbjct  311  NPKSIMPAAFVSFKTRWGAAVCAQTQQSRNPTIWLTEWAPEPRDVYWENLAIPFVFLTIR  370

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL++A++ F L FF++IPIAFVQSLAN+EG+EK  PFL+P+IE K +KSF+QGFLPG+A
Sbjct  371  RLIVAVAFFFLTFFFMIPIAFVQSLANIEGIEKALPFLKPIIEMKGIKSFIQGFLPGIA  429



>ref|XP_010255871.1| PREDICTED: CSC1-like protein At4g02900 [Nelumbo nucifera]
Length=759

 Score =   252 bits (644),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 146/179 (82%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWL Y Q K ERNP  +PT+KTGF  LWG  VD+++YY  +I++  +    E E+++ 
Sbjct  251  LQNWLIYYQNKYERNPKNKPTTKTGFWSLWGTTVDAIDYYTAEIEKLSKEEAEETERVIS  310

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+P AFVSF +RWGAAVCAQTQQS NPTLWLT WAPEPRD++W NL+I FV L++R
Sbjct  311  DPKSIMPVAFVSFKTRWGAAVCAQTQQSSNPTLWLTEWAPEPRDVYWPNLAIPFVELNVR  370

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +L++A+++F L FF++IPIAFVQSLAN+EG++KV PFL+P+I+ KFVKS +QGFLPG+A
Sbjct  371  KLIMAVALFFLTFFFMIPIAFVQSLANIEGIQKVVPFLKPIIKKKFVKSIIQGFLPGIA  429



>gb|KDO78340.1| hypothetical protein CISIN_1g004125mg [Citrus sinensis]
 gb|KDO78341.1| hypothetical protein CISIN_1g004125mg [Citrus sinensis]
Length=505

 Score =   246 bits (629),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 148/178 (83%), Gaps = 0/178 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
            QNWLDY QLK  RN  KRP  KTGFLGLWG+KVD ++Y+  +I++  + +  ERE+++ D
Sbjct  256  QNWLDYYQLKYSRNNSKRPMMKTGFLGLWGEKVDGIDYHISEIEKLSKEIAEERERVVSD  315

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
            PK I+PAAFVSF+SRWGAAVCAQTQQ++NPTLWLT WA EPRD++W+NL+I +VSLS+RR
Sbjct  316  PKAIMPAAFVSFNSRWGAAVCAQTQQTRNPTLWLTEWASEPRDVYWQNLAIPYVSLSVRR  375

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            L++ ++ F L FF++IPIA VQS A++EG+EK  PFL+P+IE KF+KS +QGFLPG+A
Sbjct  376  LIMGVAFFFLTFFFMIPIAIVQSFASIEGIEKAVPFLKPVIEAKFIKSVIQGFLPGIA  433



>ref|XP_011463550.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X2 [Fragaria vesca subsp. vesca]
Length=718

 Score =   251 bits (641),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 151/179 (84%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNWLDY QLK  RNP  RP +KTGFLGL GK++D++ +Y  +++   + ++ ER+KI  
Sbjct  201  VQNWLDYYQLKFSRNPSNRPLTKTGFLGLLGKRLDAINHYTSEVERLSQEISSERDKITN  260

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            +PK I+P+AFVSF +RWGAAVCAQTQQ++NPTLWLT WAPEPRD++W NL+I +VSL+IR
Sbjct  261  NPKSIMPSAFVSFKTRWGAAVCAQTQQTRNPTLWLTEWAPEPRDVYWDNLAIPYVSLAIR  320

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+IA++ F L FF++IPIAFVQSLAN+EG+E+ APFL+ ++E KF+KSF+QGFLPG+A
Sbjct  321  RLIIAVAFFFLTFFFMIPIAFVQSLANIEGIERAAPFLKAIVEVKFIKSFIQGFLPGIA  379



>ref|XP_010052882.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Eucalyptus grandis]
 gb|KCW77010.1| hypothetical protein EUGRSUZ_D01358 [Eucalyptus grandis]
Length=774

 Score =   252 bits (643),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 153/179 (85%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNWLDY+QLK  RN  KRP +KTGFLGL G +VD++++Y  ++++  + +  EREK+  
Sbjct  255  MQNWLDYHQLKYTRNNSKRPLTKTGFLGLCGNQVDALDHYTLEVEKLSKEIAAEREKVAS  314

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+PAAFVSF +RWGAAVCAQTQQ +NPTLWLT+WAPEPRD++W NL+I +VSL+IR
Sbjct  315  DPKSIMPAAFVSFKTRWGAAVCAQTQQCRNPTLWLTDWAPEPRDVYWPNLAIPYVSLTIR  374

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL++A++ F L FF++IPIAFVQSLA+L+G+EKVAPFLRP+I+  F+KSF+QGFLPG+A
Sbjct  375  RLIMAVAFFFLTFFFMIPIAFVQSLASLDGIEKVAPFLRPIIDIGFIKSFIQGFLPGIA  433



>ref|XP_010522697.1| PREDICTED: CSC1-like protein At4g02900 isoform X3 [Tarenaya hassleriana]
Length=785

 Score =   252 bits (643),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 144/179 (80%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNW  Y Q K +RNP KRPT+KTG+ G WG  VD+++YY  +I++       ER+++L 
Sbjct  252  LQNWWTYYQNKYDRNPSKRPTTKTGYGGFWGTTVDAIDYYDAKIQDLAEKEAAERQRVLN  311

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            D K I+PAAFVSF SRWGAAVCAQTQ   NPT+WLT WAPEPRDIFW NLSI +V L+IR
Sbjct  312  DTKAIVPAAFVSFKSRWGAAVCAQTQLCHNPTIWLTEWAPEPRDIFWDNLSIPYVELTIR  371

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL++AI++F LVFF++IPIAFVQSLAN+EG++KV PFL+PLI+ K VKS +QGFLPG+A
Sbjct  372  RLLMAIALFLLVFFFMIPIAFVQSLANIEGIQKVFPFLKPLIDMKTVKSVIQGFLPGIA  430



>ref|XP_008451393.1| PREDICTED: uncharacterized membrane protein C2G11.09 isoform 
X3 [Cucumis melo]
Length=745

 Score =   251 bits (642),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 146/179 (82%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWL Y + K ERNP +RPT+KTGF GLWG  VD+++YY  ++++      +EREK+L 
Sbjct  251  LQNWLVYYENKYERNPSQRPTTKTGFWGLWGSTVDAIDYYTTEVEKISTEEDVEREKVLS  310

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DP  +IPAAFVSF +RW AAVCAQTQQS NPT+WLT WAPEPRDI+W+NL+I +V L+IR
Sbjct  311  DPNSLIPAAFVSFKTRWAAAVCAQTQQSSNPTIWLTEWAPEPRDIYWENLAIPYVKLAIR  370

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +L++A+++F L F +++PI FVQSLAN+EG+EKV PFL+P+IE K +KS +QGFLPG+A
Sbjct  371  KLIMAVALFFLTFCFMVPITFVQSLANIEGIEKVFPFLKPIIEKKVIKSVIQGFLPGIA  429



>ref|XP_010522696.1| PREDICTED: CSC1-like protein At4g02900 isoform X2 [Tarenaya hassleriana]
Length=800

 Score =   252 bits (644),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 144/179 (80%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNW  Y Q K +RNP KRPT+KTG+ G WG  VD+++YY  +I++       ER+++L 
Sbjct  252  LQNWWTYYQNKYDRNPSKRPTTKTGYGGFWGTTVDAIDYYDAKIQDLAEKEAAERQRVLN  311

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            D K I+PAAFVSF SRWGAAVCAQTQ   NPT+WLT WAPEPRDIFW NLSI +V L+IR
Sbjct  312  DTKAIVPAAFVSFKSRWGAAVCAQTQLCHNPTIWLTEWAPEPRDIFWDNLSIPYVELTIR  371

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL++AI++F LVFF++IPIAFVQSLAN+EG++KV PFL+PLI+ K VKS +QGFLPG+A
Sbjct  372  RLLMAIALFLLVFFFMIPIAFVQSLANIEGIQKVFPFLKPLIDMKTVKSVIQGFLPGIA  430



>ref|XP_008451390.1| PREDICTED: uncharacterized membrane protein C2G11.09 isoform 
X1 [Cucumis melo]
 ref|XP_008451391.1| PREDICTED: uncharacterized membrane protein C2G11.09 isoform 
X1 [Cucumis melo]
Length=761

 Score =   251 bits (642),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 146/179 (82%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWL Y + K ERNP +RPT+KTGF GLWG  VD+++YY  ++++      +EREK+L 
Sbjct  251  LQNWLVYYENKYERNPSQRPTTKTGFWGLWGSTVDAIDYYTTEVEKISTEEDVEREKVLS  310

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DP  +IPAAFVSF +RW AAVCAQTQQS NPT+WLT WAPEPRDI+W+NL+I +V L+IR
Sbjct  311  DPNSLIPAAFVSFKTRWAAAVCAQTQQSSNPTIWLTEWAPEPRDIYWENLAIPYVKLAIR  370

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +L++A+++F L F +++PI FVQSLAN+EG+EKV PFL+P+IE K +KS +QGFLPG+A
Sbjct  371  KLIMAVALFFLTFCFMVPITFVQSLANIEGIEKVFPFLKPIIEKKVIKSVIQGFLPGIA  429



>ref|XP_010522695.1| PREDICTED: CSC1-like protein At4g02900 isoform X1 [Tarenaya hassleriana]
Length=803

 Score =   252 bits (644),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 144/179 (80%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNW  Y Q K +RNP KRPT+KTG+ G WG  VD+++YY  +I++       ER+++L 
Sbjct  252  LQNWWTYYQNKYDRNPSKRPTTKTGYGGFWGTTVDAIDYYDAKIQDLAEKEAAERQRVLN  311

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            D K I+PAAFVSF SRWGAAVCAQTQ   NPT+WLT WAPEPRDIFW NLSI +V L+IR
Sbjct  312  DTKAIVPAAFVSFKSRWGAAVCAQTQLCHNPTIWLTEWAPEPRDIFWDNLSIPYVELTIR  371

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL++AI++F LVFF++IPIAFVQSLAN+EG++KV PFL+PLI+ K VKS +QGFLPG+A
Sbjct  372  RLLMAIALFLLVFFFMIPIAFVQSLANIEGIQKVFPFLKPLIDMKTVKSVIQGFLPGIA  430



>ref|XP_008451392.1| PREDICTED: uncharacterized membrane protein C2G11.09 isoform 
X2 [Cucumis melo]
Length=759

 Score =   251 bits (641),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 146/179 (82%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWL Y + K ERNP +RPT+KTGF GLWG  VD+++YY  ++++      +EREK+L 
Sbjct  251  LQNWLVYYENKYERNPSQRPTTKTGFWGLWGSTVDAIDYYTTEVEKISTEEDVEREKVLS  310

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DP  +IPAAFVSF +RW AAVCAQTQQS NPT+WLT WAPEPRDI+W+NL+I +V L+IR
Sbjct  311  DPNSLIPAAFVSFKTRWAAAVCAQTQQSSNPTIWLTEWAPEPRDIYWENLAIPYVKLAIR  370

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +L++A+++F L F +++PI FVQSLAN+EG+EKV PFL+P+IE K +KS +QGFLPG+A
Sbjct  371  KLIMAVALFFLTFCFMVPITFVQSLANIEGIEKVFPFLKPIIEKKVIKSVIQGFLPGIA  429



>ref|XP_004289181.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Fragaria vesca subsp. vesca]
Length=767

 Score =   251 bits (641),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 151/179 (84%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNWLDY QLK  RNP  RP +KTGFLGL GK++D++ +Y  +++   + ++ ER+KI  
Sbjct  250  VQNWLDYYQLKFSRNPSNRPLTKTGFLGLLGKRLDAINHYTSEVERLSQEISSERDKITN  309

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            +PK I+P+AFVSF +RWGAAVCAQTQQ++NPTLWLT WAPEPRD++W NL+I +VSL+IR
Sbjct  310  NPKSIMPSAFVSFKTRWGAAVCAQTQQTRNPTLWLTEWAPEPRDVYWDNLAIPYVSLAIR  369

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+IA++ F L FF++IPIAFVQSLAN+EG+E+ APFL+ ++E KF+KSF+QGFLPG+A
Sbjct  370  RLIIAVAFFFLTFFFMIPIAFVQSLANIEGIERAAPFLKAIVEVKFIKSFIQGFLPGIA  428



>ref|XP_011046979.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Populus euphratica]
 ref|XP_011046980.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Populus euphratica]
 ref|XP_011046981.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Populus euphratica]
Length=775

 Score =   251 bits (642),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 149/179 (83%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNWLDY + K  RN  +RP +KTGFLGLWG KVD+++YY  +I++  + +  EREK+L 
Sbjct  255  MQNWLDYYRFKYSRNRSQRPQTKTGFLGLWGAKVDAIDYYISEIEKLSKEIAEEREKVLN  314

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DP CI+PAAFVSF +RWGAAVCAQTQQS+NPTLWLT WAPEPRD++W NL+I +VSLS+R
Sbjct  315  DPNCIMPAAFVSFKTRWGAAVCAQTQQSRNPTLWLTEWAPEPRDVYWPNLAIPYVSLSVR  374

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+I +S F L FF++IPIAFVQSLA++EG+EK  PFL+ +IE +F+KS +QGFLPG+A
Sbjct  375  RLIIGVSFFFLAFFFMIPIAFVQSLASIEGIEKSLPFLKSVIEVEFIKSVVQGFLPGIA  433



>ref|XP_009418442.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Musa acuminata subsp. malaccensis]
Length=768

 Score =   251 bits (640),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 149/179 (83%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            ++NWLDY QLK +RNP KRPT KTGFLGL G KVD++++Y  ++ +       EREKI+K
Sbjct  252  MENWLDYYQLKFDRNPSKRPTRKTGFLGLCGDKVDAIDFYTSKVDKLSEEEAAEREKIIK  311

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            +PK I+ AAFVSF +RWGAAVCAQTQQS+NPTLWLT WAPEPRD++W+NL+I FVS++IR
Sbjct  312  NPKFIMSAAFVSFRTRWGAAVCAQTQQSRNPTLWLTEWAPEPRDVYWQNLAIPFVSITIR  371

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL++A++ F L FF++IPI FVQSLAN+EG+EK  PFL+PLIE   +KSF+QGFLPG+A
Sbjct  372  RLIVAVAFFFLTFFFMIPITFVQSLANIEGIEKAVPFLKPLIEVPVIKSFIQGFLPGIA  430



>ref|XP_008808245.1| PREDICTED: CSC1-like protein At4g02900 isoform X1 [Phoenix dactylifera]
Length=759

 Score =   250 bits (639),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 144/178 (81%), Gaps = 0/178 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWL Y + K  RNP KRP +KTGFLGLWGK VD+++YY  +I++  +    ERE+++ 
Sbjct  251  LQNWLVYYENKKTRNPEKRPITKTGFLGLWGKTVDAIDYYTAEIEKLSKEEATERERLVS  310

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+P AFVSF +RWGAAVCAQTQQS NPTLWLT WAPEPRD++W NL+I FV  ++R
Sbjct  311  DPKAIMPTAFVSFRTRWGAAVCAQTQQSSNPTLWLTEWAPEPRDVYWSNLAIPFVEQTMR  370

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGL  534
            RL++A++ F L FF++IPIAFVQSLAN+EG+EKVAPFL+P+IE +   SF++GFL G+
Sbjct  371  RLMMAVAFFLLTFFFMIPIAFVQSLANIEGIEKVAPFLKPIIEKEVASSFIKGFLSGI  428



>ref|XP_008808246.1| PREDICTED: CSC1-like protein At4g02900 isoform X2 [Phoenix dactylifera]
Length=753

 Score =   250 bits (639),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 144/178 (81%), Gaps = 0/178 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWL Y + K  RNP KRP +KTGFLGLWGK VD+++YY  +I++  +    ERE+++ 
Sbjct  251  LQNWLVYYENKKTRNPEKRPITKTGFLGLWGKTVDAIDYYTAEIEKLSKEEATERERLVS  310

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+P AFVSF +RWGAAVCAQTQQS NPTLWLT WAPEPRD++W NL+I FV  ++R
Sbjct  311  DPKAIMPTAFVSFRTRWGAAVCAQTQQSSNPTLWLTEWAPEPRDVYWSNLAIPFVEQTMR  370

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGL  534
            RL++A++ F L FF++IPIAFVQSLAN+EG+EKVAPFL+P+IE +   SF++GFL G+
Sbjct  371  RLMMAVAFFLLTFFFMIPIAFVQSLANIEGIEKVAPFLKPIIEKEVASSFIKGFLSGI  428



>gb|KHG30770.1| putative membrane C2G11.09 [Gossypium arboreum]
Length=770

 Score =   251 bits (640),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 149/177 (84%), Gaps = 0/177 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
            QNWLDY QLK  RN  KRP  KTGFLGLWGKKVD+++++  +IK+    +  ERE++LKD
Sbjct  254  QNWLDYYQLKYSRNNAKRPIMKTGFLGLWGKKVDAIDHHITEIKKLSDEIAEERERVLKD  313

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
            PK I+PAAFVSF SRWGAAVCAQTQQS+NPTLWLT+WAPEPRD++W+NLSI +VS+++RR
Sbjct  314  PKSIMPAAFVSFKSRWGAAVCAQTQQSRNPTLWLTDWAPEPRDVYWQNLSIPYVSIAVRR  373

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGL  534
            L++A++ F L FF++IPIA VQ+LA +EGLEK APFL+ LIE  F+KS +QGFLPG+
Sbjct  374  LIMAVAFFFLTFFFIIPIASVQALATIEGLEKAAPFLKALIEIPFIKSVIQGFLPGI  430



>ref|XP_008455922.1| PREDICTED: uncharacterized protein RSN1 isoform X1 [Cucumis melo]
 ref|XP_008455924.1| PREDICTED: uncharacterized protein RSN1 isoform X1 [Cucumis melo]
 ref|XP_008455925.1| PREDICTED: uncharacterized protein RSN1 isoform X1 [Cucumis melo]
Length=768

 Score =   250 bits (639),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 147/179 (82%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNWLD+ QLK  RN  KR T KTGFLGLWG +VD++ YY  +I+   + +++E +K + 
Sbjct  251  MQNWLDFYQLKYSRNQSKRATVKTGFLGLWGDQVDAINYYSSKIEILSKEISLEADKTVS  310

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+PAAFVSF SRWGAAVCAQTQQS+NPT+WLT WAPEPRD++W NL+I FVSL+IR
Sbjct  311  DPKSIMPAAFVSFKSRWGAAVCAQTQQSRNPTIWLTEWAPEPRDVYWDNLAIPFVSLAIR  370

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+  ++ F L FF++IPIAFVQSLAN+E +EK APFLRP+IE KF+KS +QGFLPG+A
Sbjct  371  RLIAGVAFFFLTFFFMIPIAFVQSLANIESIEKTAPFLRPIIELKFIKSVIQGFLPGIA  429



>gb|KJB69241.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
Length=341

 Score =   240 bits (612),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 147/178 (83%), Gaps = 0/178 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
            QNWLDY QLK  RN  +RP  KTGFLGL GKKVD++E+++ +I +  + +  ERE++ KD
Sbjct  92   QNWLDYYQLKYSRNNAQRPIMKTGFLGLCGKKVDAIEHHEAEIGKLSKEIAEERERVKKD  151

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
            PK I+PAAFVSF SRWGAAVCAQTQQS++PT WLT WAPEP D++W NL I +VSL+IRR
Sbjct  152  PKAIMPAAFVSFKSRWGAAVCAQTQQSRDPTSWLTEWAPEPCDVYWPNLPIPYVSLAIRR  211

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            L++A++ F L FF++IPIA VQ+LA++EGLEKVAPFL+P+I+ KF+KS +QG LPGLA
Sbjct  212  LIMAVAFFFLTFFFMIPIASVQALASIEGLEKVAPFLKPIIDMKFIKSVIQGILPGLA  269



>ref|XP_006449786.1| hypothetical protein CICLE_v10014589mg [Citrus clementina]
 gb|ESR63026.1| hypothetical protein CICLE_v10014589mg [Citrus clementina]
Length=618

 Score =   247 bits (631),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 148/178 (83%), Gaps = 0/178 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
            QNWLDY QLK  RN  KRP  KTGFLGLWG+KVD ++Y+  +I++  + +  ERE+++ D
Sbjct  256  QNWLDYYQLKHSRNNSKRPMMKTGFLGLWGEKVDGIDYHISEIEKLSKEIAEERERVVSD  315

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
            PK I+PAAFVSF+SRWGAAVCAQTQQ++NPTLWLT WA EPRD++W+NL+I +VSLS+RR
Sbjct  316  PKAIMPAAFVSFNSRWGAAVCAQTQQTRNPTLWLTEWASEPRDVYWQNLAIPYVSLSVRR  375

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            L++ ++ F L FF++IPIA VQS A++EG+EK  PFLRP+IE KF+KS +QGFLPG+A
Sbjct  376  LIMGVAFFFLTFFFMIPIAIVQSFASIEGIEKAVPFLRPVIEAKFIKSVIQGFLPGIA  433



>gb|EMT18085.1| Putative membrane protein [Aegilops tauschii]
Length=766

 Score =   250 bits (638),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 144/179 (80%), Gaps = 1/179 (1%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNWLDY QLK ER   +RPT+KTGF G +G  VD+++YYK +I++  +    E +K++K
Sbjct  253  MQNWLDYYQLKFERK-AERPTTKTGFFGCFGSDVDAIDYYKSEIEKIGKEEAEEHKKVMK  311

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+PAAFVSF SRWGAAV AQTQQ+ NPT+WLT WAPEPRD++W NLSI FVSL++R
Sbjct  312  DPKSIMPAAFVSFRSRWGAAVAAQTQQTSNPTVWLTEWAPEPRDVYWNNLSIPFVSLTVR  371

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+I ++ F L FFY+IPIAFVQ+LANLEG+EK  PFL P IE   +KSF+QGFLPGLA
Sbjct  372  RLIIGVAFFFLNFFYVIPIAFVQTLANLEGIEKALPFLEPFIETPSIKSFIQGFLPGLA  430



>ref|XP_007026162.1| ERD (early-responsive to dehydration stress) family protein isoform 
2 [Theobroma cacao]
 gb|EOY28784.1| ERD (early-responsive to dehydration stress) family protein isoform 
2 [Theobroma cacao]
Length=618

 Score =   247 bits (630),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 150/177 (85%), Gaps = 0/177 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
            QNWLDY QLK  RN  KRP  KTGFLGL G+KVD+++++  +I++  + +  ERE++ KD
Sbjct  254  QNWLDYYQLKYSRNSAKRPFMKTGFLGLRGEKVDAIDHHISEIEKLSKEIAEERERVKKD  313

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
            PKCI+PAAFVSF SRWGAAVCAQTQQS+NPTLWLT WA EPRD++W+NL+I +VSL++RR
Sbjct  314  PKCIMPAAFVSFKSRWGAAVCAQTQQSRNPTLWLTEWASEPRDVYWQNLAIPYVSLAVRR  373

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGL  534
            L++A++ F L FF++IPIA VQ+LA++EGLEK APFL+PLIE KF+KS +QGFLPG+
Sbjct  374  LIMAVAFFFLTFFFMIPIASVQALASIEGLEKAAPFLKPLIEIKFIKSVIQGFLPGI  430



>ref|XP_002975592.1| hypothetical protein SELMODRAFT_150725 [Selaginella moellendorffii]
 gb|EFJ23221.1| hypothetical protein SELMODRAFT_150725 [Selaginella moellendorffii]
Length=759

 Score =   249 bits (637),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 144/179 (80%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDY QL+ +R   +RP +KTG  GLWG+KVD+++YY   I +  +  T+ERE++L 
Sbjct  253  LQNWLDYYQLQFQRKNTERPMTKTGLWGLWGQKVDAIQYYTDGINQISKEATVERERVLN  312

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            D    +P AFVSF SRWGAAVCAQTQQ+++PT+WLT WAPEPRD++W+NLS+ ++ L++R
Sbjct  313  DDSSKLPVAFVSFRSRWGAAVCAQTQQTRDPTVWLTEWAPEPRDVYWRNLSVPYLQLTMR  372

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +L I  +VF L+FFY+IP+ FVQSLANLEG+EK   FLRP+IE KF+KSFLQGFLPGLA
Sbjct  373  KLFITGAVFLLIFFYIIPVTFVQSLANLEGIEKKLTFLRPIIEAKFIKSFLQGFLPGLA  431



>ref|XP_006287198.1| hypothetical protein CARUB_v10000374mg [Capsella rubella]
 gb|EOA20096.1| hypothetical protein CARUB_v10000374mg [Capsella rubella]
Length=497

 Score =   244 bits (622),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 139/179 (78%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNWL Y + K ER P  RPT+KTG+ G WG  VD++++Y  +++        EREKI+ 
Sbjct  252  MQNWLTYYENKYERKPTNRPTTKTGYGGFWGTTVDAIDFYTSKMEILAEQEAAEREKIMN  311

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+PAAFVSF SRWG AVCAQTQQ  NPT+WLT WAPEPRD+FW NL+I +V LSIR
Sbjct  312  DPKAIMPAAFVSFKSRWGTAVCAQTQQCHNPTIWLTEWAPEPRDVFWDNLAIPYVELSIR  371

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+   ++F L+F ++IPIAFVQSLANLEG++KV PFL+P+IE K VKS +QGFLPG+A
Sbjct  372  RLLTTTALFFLIFCFMIPIAFVQSLANLEGIQKVLPFLKPVIEMKTVKSVIQGFLPGIA  430



>ref|XP_006449787.1| hypothetical protein CICLE_v10014589mg [Citrus clementina]
 gb|ESR63027.1| hypothetical protein CICLE_v10014589mg [Citrus clementina]
Length=634

 Score =   247 bits (630),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 148/178 (83%), Gaps = 0/178 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
            QNWLDY QLK  RN  KRP  KTGFLGLWG+KVD ++Y+  +I++  + +  ERE+++ D
Sbjct  256  QNWLDYYQLKHSRNNSKRPMMKTGFLGLWGEKVDGIDYHISEIEKLSKEIAEERERVVSD  315

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
            PK I+PAAFVSF+SRWGAAVCAQTQQ++NPTLWLT WA EPRD++W+NL+I +VSLS+RR
Sbjct  316  PKAIMPAAFVSFNSRWGAAVCAQTQQTRNPTLWLTEWASEPRDVYWQNLAIPYVSLSVRR  375

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            L++ ++ F L FF++IPIA VQS A++EG+EK  PFLRP+IE KF+KS +QGFLPG+A
Sbjct  376  LIMGVAFFFLTFFFMIPIAIVQSFASIEGIEKAVPFLRPVIEAKFIKSVIQGFLPGIA  433



>ref|XP_008234908.1| PREDICTED: uncharacterized protein RSN1 isoform X2 [Prunus mume]
Length=749

 Score =   249 bits (636),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 144/178 (81%), Gaps = 0/178 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
             NWL Y Q + ERNP  RPT+KTGFLGLWG KVD++ YY  +I++  +    EREK++ D
Sbjct  253  NNWLVYYQTRYERNPKSRPTTKTGFLGLWGHKVDAINYYIEEIEKMSQEEKQEREKVVSD  312

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
            P  I+PAAFVSF +RWGAAVCAQTQQS NP +WLT WA EPRD++W+NL+I +V L++R+
Sbjct  313  PDAIMPAAFVSFRTRWGAAVCAQTQQSSNPIVWLTEWASEPRDVYWRNLAIPYVELNVRK  372

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            L++A++ F+L FF++IPIAFVQSLAN+EG+ KV PFL+PL+E K VKS +QGFLPG+A
Sbjct  373  LLMAVAFFSLTFFFMIPIAFVQSLANIEGIMKVLPFLKPLLEMKPVKSVIQGFLPGIA  430



>ref|XP_004164564.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Cucumis 
sativus]
Length=755

 Score =   249 bits (636),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 144/179 (80%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWL Y + K ERNP +RPT+KTGF GLWG  VD+++YY   +++      +EREK+L 
Sbjct  251  LQNWLVYYENKYERNPSQRPTTKTGFWGLWGSTVDAIDYYTAAMEKISTEEDVEREKVLS  310

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DP  IIPAAFVSF +RW AAVCAQTQQS NPT+WLT WAPEPRDI+W NL+I +V L+IR
Sbjct  311  DPNSIIPAAFVSFKTRWAAAVCAQTQQSSNPTIWLTEWAPEPRDIYWDNLAIPYVKLAIR  370

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +L++A+++F L F +++PIAFVQSLAN+E +EKV PFL+P+IE K +KS +QGFLPG+A
Sbjct  371  KLIMAVALFFLTFCFMVPIAFVQSLANIESIEKVFPFLKPIIEKKVIKSVIQGFLPGIA  429



>ref|XP_004136187.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Cucumis 
sativus]
 gb|KGN44866.1| hypothetical protein Csa_7G392390 [Cucumis sativus]
Length=756

 Score =   249 bits (636),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 144/179 (80%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWL Y + K ERNP +RPT+KTGF GLWG  VD+++YY   +++      +EREK+L 
Sbjct  251  LQNWLVYYENKYERNPSQRPTTKTGFWGLWGSTVDAIDYYTAAMEKISTEEDVEREKVLS  310

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DP  IIPAAFVSF +RW AAVCAQTQQS NPT+WLT WAPEPRDI+W NL+I +V L+IR
Sbjct  311  DPNSIIPAAFVSFKTRWAAAVCAQTQQSSNPTIWLTEWAPEPRDIYWDNLAIPYVKLAIR  370

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +L++A+++F L F +++PIAFVQSLAN+E +EKV PFL+P+IE K +KS +QGFLPG+A
Sbjct  371  KLIMAVALFFLTFCFMVPIAFVQSLANIESIEKVFPFLKPIIEKKVIKSVIQGFLPGIA  429



>ref|XP_010548889.1| PREDICTED: CSC1-like protein At3g21620 [Tarenaya hassleriana]
Length=764

 Score =   249 bits (636),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 146/179 (82%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNWLDY Q K  RNP KRP  K GFLG WG+ VD++EYY  +I+   R ++ E+EKI+ 
Sbjct  254  MQNWLDYYQNKHTRNPSKRPFVKMGFLGCWGESVDAIEYYTSKIEGIMRRISEEKEKIMS  313

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
             PK ++PAAFVSF SRWGA VCAQTQQS+NPT+WLT WAPEPRDI+W NL++ +V L+IR
Sbjct  314  SPKSVVPAAFVSFKSRWGAVVCAQTQQSRNPTVWLTEWAPEPRDIYWNNLALPYVQLTIR  373

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RLVIA++ F L FF++IPIAFVQSLAN+EG+EK  PFL+P+IE K +KSF+QGFLPG+A
Sbjct  374  RLVIAVAFFFLTFFFVIPIAFVQSLANIEGIEKAVPFLKPIIEMKVIKSFIQGFLPGIA  432



>ref|XP_006396516.1| hypothetical protein EUTSA_v10029277mg, partial [Eutrema salsugineum]
 gb|ESQ37969.1| hypothetical protein EUTSA_v10029277mg, partial [Eutrema salsugineum]
Length=766

 Score =   249 bits (636),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 141/179 (79%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNWL Y + K ER P  RPT+KTG+ G WG  VD++++Y  +I++       EREKI+ 
Sbjct  252  VQNWLTYYENKYERKPSNRPTTKTGYGGFWGTTVDAIDFYTSKIEDLAEKEAAEREKIMN  311

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+PAAFVSF SRWG AVCAQTQQ  NPT+WLT WAPEPRD+FW NL+I +V LSIR
Sbjct  312  DPKAIVPAAFVSFKSRWGTAVCAQTQQCHNPTIWLTEWAPEPRDVFWDNLAIPYVELSIR  371

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+  +++F L+F ++IPIAFVQSLANLEG++KV PFL+PLI+ K VKS +QGFLPG+A
Sbjct  372  RLITTVALFFLIFCFMIPIAFVQSLANLEGIQKVLPFLKPLIDMKTVKSVIQGFLPGIA  430



>ref|XP_008234907.1| PREDICTED: uncharacterized protein RSN1 isoform X1 [Prunus mume]
Length=756

 Score =   249 bits (636),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 144/178 (81%), Gaps = 0/178 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
             NWL Y Q + ERNP  RPT+KTGFLGLWG KVD++ YY  +I++  +    EREK++ D
Sbjct  253  NNWLVYYQTRYERNPKSRPTTKTGFLGLWGHKVDAINYYIEEIEKMSQEEKQEREKVVSD  312

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
            P  I+PAAFVSF +RWGAAVCAQTQQS NP +WLT WA EPRD++W+NL+I +V L++R+
Sbjct  313  PDAIMPAAFVSFRTRWGAAVCAQTQQSSNPIVWLTEWASEPRDVYWRNLAIPYVELNVRK  372

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            L++A++ F+L FF++IPIAFVQSLAN+EG+ KV PFL+PL+E K VKS +QGFLPG+A
Sbjct  373  LLMAVAFFSLTFFFMIPIAFVQSLANIEGIMKVLPFLKPLLEMKPVKSVIQGFLPGIA  430



>gb|EMS65241.1| Uncharacterized membrane protein C2G11.09 [Triticum urartu]
Length=813

 Score =   250 bits (638),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 120/193 (62%), Positives = 152/193 (79%), Gaps = 15/193 (8%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTI-------  159
            ++NWLDY Q KLER   KRPT+KTGFLG +G +VD++++ K +I++  + LT+       
Sbjct  286  MRNWLDYYQNKLERK-SKRPTTKTGFLGCFGSEVDAIDHCKSEIEKIGKELTVRIHSLIH  344

Query  160  -------EREKILKDPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIF  318
                   ER+K++KDPK I+PAAFVSF SRWGAAVCAQTQQ+ NPTLWLT WAPEPRD++
Sbjct  345  DNTQEAEERKKVMKDPKSIMPAAFVSFRSRWGAAVCAQTQQTSNPTLWLTEWAPEPRDVY  404

Query  319  WKNLSISFVSLSIRRLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKF  498
            W NLSI FVSL++RRL+I ++ F L FFY+IPIAFVQ+LANLEG+EK  PFL+PLIE   
Sbjct  405  WSNLSIPFVSLTVRRLIIGVAFFFLNFFYVIPIAFVQTLANLEGIEKALPFLKPLIESPP  464

Query  499  VKSFLQGFLPGLA  537
            +KSF+QGFLPGLA
Sbjct  465  IKSFIQGFLPGLA  477



>gb|KJB57786.1| hypothetical protein B456_009G181100 [Gossypium raimondii]
 gb|KJB57787.1| hypothetical protein B456_009G181100 [Gossypium raimondii]
Length=770

 Score =   249 bits (635),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 149/177 (84%), Gaps = 0/177 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
            QNWLDY QLK  RN  KRP  KTGFLGLWG+KVD+++++  +I++    +  ERE++LKD
Sbjct  254  QNWLDYYQLKYSRNNAKRPIMKTGFLGLWGEKVDAIDHHITEIEKLSNEIAEERERVLKD  313

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
            PK I+PAAFVSF SRWGAAVCAQTQQS+NPTLWLT+WAPEPRD++W+NLSI +VS+++RR
Sbjct  314  PKSIMPAAFVSFKSRWGAAVCAQTQQSRNPTLWLTDWAPEPRDVYWQNLSIPYVSIAVRR  373

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGL  534
            L++A++ F L FF++IPIA VQ+LA +EGLEK APFL+ LIE  F+KS +QGFLPG+
Sbjct  374  LIMAVAFFFLTFFFMIPIASVQALATIEGLEKAAPFLKALIEIPFIKSVIQGFLPGI  430



>ref|XP_011007190.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011007191.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011007193.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
Length=767

 Score =   248 bits (634),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 152/179 (85%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            ++NWLDY Q+K  RN  + P+ KTGFLGL+G +VD++++Y  +I+   R +++ER++I+ 
Sbjct  251  MKNWLDYYQIKYSRNKSRMPSLKTGFLGLFGTRVDAIDHYTSEIERLSREISLERDEIVN  310

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            +PK I+PAAFVSF +RWGAAVCAQTQQS+NPT+WLT WAPEPRD++W NL+I FVSL++R
Sbjct  311  NPKAIMPAAFVSFKTRWGAAVCAQTQQSRNPTMWLTEWAPEPRDVYWDNLAIPFVSLALR  370

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RLVIA++ F L FF+++PIAFVQSLAN+EG+EK  PFL+P+IE K +KSF+QGFLPG+A
Sbjct  371  RLVIAVAFFFLTFFFMVPIAFVQSLANIEGIEKALPFLKPIIEMKVIKSFIQGFLPGIA  429



>ref|XP_002874888.1| hypothetical protein ARALYDRAFT_352535 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51147.1| hypothetical protein ARALYDRAFT_352535 [Arabidopsis lyrata subsp. 
lyrata]
Length=776

 Score =   248 bits (634),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 141/179 (79%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNWL Y + K ER P  RPT+KTG+ G WG  VD++++Y  ++    R   +EREKI+ 
Sbjct  260  MQNWLTYYENKFERKPSSRPTTKTGYGGFWGTTVDAIDFYTSKMDILARQEAVEREKIMN  319

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+PAAFVSF SRWG AVCAQTQQ  NPT+WLT WAPEPRD+FW NL+I +V LSIR
Sbjct  320  DPKSIMPAAFVSFRSRWGTAVCAQTQQCHNPTIWLTEWAPEPRDVFWDNLAIPYVELSIR  379

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+  +++F L+F ++IPIAFVQSLANLEG++KV PFL+P+IE K VKS +QGFLPG+A
Sbjct  380  RLLTTVALFFLIFCFMIPIAFVQSLANLEGIQKVLPFLKPVIEMKTVKSVIQGFLPGIA  438



>gb|AAC79116.1| hypothetical protein [Arabidopsis thaliana]
Length=680

 Score =   247 bits (630),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 140/179 (78%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNWL Y + K ER P  RPT+KTG+ G WG  VD++++Y  ++        +EREKI+ 
Sbjct  147  MQNWLTYYENKFERKPSSRPTTKTGYGGFWGTTVDAIDFYTSKMDILAEQEAVEREKIMN  206

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+PAAFVSF SRWG AVCAQTQQ  NPT+WLT WAPEPRD+FW NL+I +V LSIR
Sbjct  207  DPKAIMPAAFVSFRSRWGTAVCAQTQQCHNPTIWLTEWAPEPRDVFWDNLAIPYVELSIR  266

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+  +++F L+F ++IPIAFVQSLANLEG++KV PFL+P+IE K VKS +QGFLPG+A
Sbjct  267  RLLTTVALFFLIFCFMIPIAFVQSLANLEGIQKVLPFLKPVIEMKTVKSVIQGFLPGIA  325



>gb|EPS74192.1| hypothetical protein M569_00556, partial [Genlisea aurea]
Length=761

 Score =   248 bits (633),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 109/179 (61%), Positives = 145/179 (81%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNW  Y Q + ER+P  RPT++TGF GLWGKKVD+++YY  +I +       ER+K+  
Sbjct  252  LQNWRTYYQTRYERDPKSRPTTRTGFWGLWGKKVDAIDYYTAEIVKLSEQEAEERKKVTN  311

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK +IPAAFVSF +RWGAAVCAQTQQ+ NPT+WLT WAPEPRDI+W NL+I +V L+++
Sbjct  312  DPKAVIPAAFVSFRTRWGAAVCAQTQQTSNPTVWLTEWAPEPRDIYWDNLAIPYVQLAVK  371

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL++A++ F L FF++IPIAFVQSLA++EG+E+V PFL+PLIE K +K+ +QGFLPG+A
Sbjct  372  RLLMAVATFFLTFFFMIPIAFVQSLASVEGIERVFPFLKPLIEAKKIKAIVQGFLPGIA  430



>ref|XP_009393118.1| PREDICTED: CSC1-like protein At4g02900 [Musa acuminata subsp. 
malaccensis]
Length=758

 Score =   248 bits (633),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 141/179 (79%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            L+NW  Y + K  RN   RPT+KTG  GL GK VD+++YYK  I++  +    ERE+I+ 
Sbjct  252  LENWFIYYENKYNRNTNIRPTTKTGLFGLLGKSVDAIDYYKAAIEQLLKEEASERERIIS  311

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DP  I+PAAFVSF +RWGAAVCAQTQQS NPTLWLT+WAPEPRD++W NL+I FV L+IR
Sbjct  312  DPNAIMPAAFVSFKTRWGAAVCAQTQQSSNPTLWLTDWAPEPRDVYWPNLAIPFVELTIR  371

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL++A+++F L FF++IPIAFVQSLAN+EG EKV P LR LIE   +KSF+QGFLPG+A
Sbjct  372  RLIMAVAIFFLTFFFMIPIAFVQSLANIEGFEKVFPLLRSLIETNLIKSFIQGFLPGIA  430



>ref|XP_009772361.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana sylvestris]
 ref|XP_009772362.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana sylvestris]
 ref|XP_009772364.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana sylvestris]
 ref|XP_009772365.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana sylvestris]
Length=768

 Score =   248 bits (633),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 118/178 (66%), Positives = 148/178 (83%), Gaps = 0/178 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
            QNWLDY QLK  RN  KRPTSKTGFLGL+GK VD+++YY  +I++  + ++ ER  I+  
Sbjct  252  QNWLDYYQLKYTRNLSKRPTSKTGFLGLFGKTVDAIDYYTSEIEKLSKEISDERTNIIGS  311

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
             K I+PAAFVSF +RWGAAVCAQTQQ++NPTLWLT WAPEPRD++W NL+I +VSLSIRR
Sbjct  312  SKSIMPAAFVSFRTRWGAAVCAQTQQARNPTLWLTEWAPEPRDVYWDNLAIPYVSLSIRR  371

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            L++A++ F L FF++IPIAFVQSLAN+EG+EK  PFL+ LIE K VKSF+QGFLPG+A
Sbjct  372  LIVAVAFFFLTFFFMIPIAFVQSLANIEGIEKALPFLKSLIEAKAVKSFIQGFLPGIA  429



>ref|XP_002271834.1| PREDICTED: CSC1-like protein At4g02900 [Vitis vinifera]
Length=756

 Score =   248 bits (633),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 148/179 (83%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWL Y Q K ERNP K+PT+KTGF GLWG  VD+V++Y  ++++       ERE+++ 
Sbjct  252  LQNWLTYYQNKYERNPEKKPTTKTGFCGLWGTNVDAVDHYAAKMEKLCEAEAEERERVIT  311

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+PAAFVSF +RWGAAVCAQTQQS+NPT+WLT WAPEPRDI+W NL+I +V L+IR
Sbjct  312  DPKAIMPAAFVSFKTRWGAAVCAQTQQSRNPTIWLTEWAPEPRDIYWDNLAIPYVELTIR  371

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL++A++VF L FF++IPIAFVQS+AN++G+EKV PFL+ L+E   +KSF+QGFLPG+A
Sbjct  372  RLLMAVAVFFLTFFFMIPIAFVQSIANIDGIEKVLPFLKSLMEMNVIKSFIQGFLPGIA  430



>gb|EMS56194.1| Uncharacterized membrane protein C2G11.09 [Triticum urartu]
Length=612

 Score =   245 bits (625),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 118/179 (66%), Positives = 147/179 (82%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNWLDY QLK ERN  KRPT KTGFLG +G KVD+VE+   +I+  ++    EREKI+K
Sbjct  95   MQNWLDYYQLKYERNTSKRPTVKTGFLGCFGSKVDAVEHCASEIERIEKEEAEEREKIVK  154

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK ++PAAFVSF +RWGAAVCAQTQQ+ NPT+WLT WAPEPRD++W NLSI  V L++R
Sbjct  155  DPKLVVPAAFVSFRTRWGAAVCAQTQQTSNPTVWLTEWAPEPRDVYWDNLSIPIVHLTVR  214

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+IA++ F L FFY+IPIAFVQSLAN+EG+EK  PFL+P+IE   +KSF+QGFLPG+A
Sbjct  215  RLIIAVAFFFLNFFYVIPIAFVQSLANIEGIEKAVPFLKPIIEMPTIKSFIQGFLPGIA  273



>gb|KJB10672.1| hypothetical protein B456_001G215500 [Gossypium raimondii]
Length=608

 Score =   244 bits (624),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 146/178 (82%), Gaps = 0/178 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
            QNWLDY Q K ERNP KRP  KTGFLGLWG+ VD+V++Y  + +   R +++EREKI  +
Sbjct  92   QNWLDYYQNKYERNPSKRPLLKTGFLGLWGESVDAVDFYTAKNERLSRDISLEREKITSN  151

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
            PK I+ AAFVSF +RWGAAVCAQTQQ +NPT+WLT WAPEPRD++W+NLSI FV L+IRR
Sbjct  152  PKSIMAAAFVSFKTRWGAAVCAQTQQCRNPTIWLTEWAPEPRDVYWENLSIPFVFLTIRR  211

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            L++A++ F L FF++IPIA VQSLAN+E +EK  PFL+P+IE K +KSF+QGFLPG+A
Sbjct  212  LIVAVAFFFLTFFFVIPIAIVQSLANIESIEKALPFLKPIIEVKVIKSFIQGFLPGIA  269



>emb|CDP03600.1| unnamed protein product [Coffea canephora]
Length=756

 Score =   248 bits (632),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 145/178 (81%), Gaps = 0/178 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
            QNW  Y Q K ERNP K+PT+KTGF GLWGK VD+++YY  +I++       ERE+++ D
Sbjct  253  QNWHTYYQTKYERNPKKKPTTKTGFWGLWGKTVDAIDYYTAEIEKLSEEEATERERVMSD  312

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
            PK IIPAAFVSF SRWGAAVCAQTQQS NPT+WLT WAPEPRD+ W NL+I +V L+IRR
Sbjct  313  PKAIIPAAFVSFKSRWGAAVCAQTQQSSNPTIWLTEWAPEPRDVHWANLAIPYVGLTIRR  372

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            L++A+ +F L FF++IPIAFVQS+AN+EG+EKV PFL+PLIE K VKS +QGFLPG+A
Sbjct  373  LLVAVVLFFLTFFFMIPIAFVQSMANIEGIEKVLPFLKPLIEAKTVKSVIQGFLPGIA  430



>gb|KDO78339.1| hypothetical protein CISIN_1g004125mg [Citrus sinensis]
Length=677

 Score =   246 bits (628),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 148/178 (83%), Gaps = 0/178 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
            QNWLDY QLK  RN  KRP  KTGFLGLWG+KVD ++Y+  +I++  + +  ERE+++ D
Sbjct  256  QNWLDYYQLKYSRNNSKRPMMKTGFLGLWGEKVDGIDYHISEIEKLSKEIAEERERVVSD  315

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
            PK I+PAAFVSF+SRWGAAVCAQTQQ++NPTLWLT WA EPRD++W+NL+I +VSLS+RR
Sbjct  316  PKAIMPAAFVSFNSRWGAAVCAQTQQTRNPTLWLTEWASEPRDVYWQNLAIPYVSLSVRR  375

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            L++ ++ F L FF++IPIA VQS A++EG+EK  PFL+P+IE KF+KS +QGFLPG+A
Sbjct  376  LIMGVAFFFLTFFFMIPIAIVQSFASIEGIEKAVPFLKPVIEAKFIKSVIQGFLPGIA  433



>emb|CDX90914.1| BnaA03g25940D [Brassica napus]
Length=769

 Score =   247 bits (631),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 140/179 (78%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNW+ Y + K ER P  RPT+KTG+ G WG  VD++++Y  +++       +EREKI+ 
Sbjct  252  MQNWVTYYENKYERKPSSRPTTKTGYGGFWGTTVDAIDFYTSKLQNLAEQEAVEREKIMN  311

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DP  I+PAAFVSF SRWG AVCAQTQQ  NPT+WLT WAPEPRD+FW NL+I +V LSIR
Sbjct  312  DPMAIVPAAFVSFRSRWGTAVCAQTQQCHNPTIWLTEWAPEPRDVFWDNLAIPYVELSIR  371

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+  I++F L+F ++IPIAFVQSLANLEG++KV PFL+PLIE K VKS +QGFLPG+A
Sbjct  372  RLLTTIALFFLIFCFMIPIAFVQSLANLEGIQKVLPFLKPLIEMKTVKSVIQGFLPGIA  430



>ref|XP_009134388.1| PREDICTED: CSC1-like protein At4g02900 [Brassica rapa]
Length=769

 Score =   247 bits (631),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 140/179 (78%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNW+ Y + K ER P  RPT+KTG+ G WG  VD++++Y  +++       +EREKI+ 
Sbjct  252  MQNWVTYYENKYERKPSSRPTTKTGYGGFWGTTVDAIDFYTSKLQNLAEQEAVEREKIMN  311

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DP  I+PAAFVSF SRWG AVCAQTQQ  NPT+WLT WAPEPRD+FW NL+I +V LSIR
Sbjct  312  DPMAIVPAAFVSFRSRWGTAVCAQTQQCHNPTIWLTEWAPEPRDVFWDNLAIPYVELSIR  371

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+  I++F L+F ++IPIAFVQSLANLEG++KV PFL+PLIE K VKS +QGFLPG+A
Sbjct  372  RLLTTIALFFLIFCFMIPIAFVQSLANLEGIQKVLPFLKPLIEMKTVKSVIQGFLPGIA  430



>dbj|BAK03311.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=767

 Score =   247 bits (631),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 148/179 (83%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNWLD+ QLK ERN  KRPT KTGFLG +G KVD+VE+Y  +I+  ++    EREKI+K
Sbjct  251  MQNWLDFYQLKYERNASKRPTVKTGFLGCFGSKVDAVEHYTSEIERIEKEEAEEREKIVK  310

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK ++PAAFVSF SRWGAAVCAQTQQ+ NPT+WLT WAPEPRD++W NLSI  V L++R
Sbjct  311  DPKLVVPAAFVSFRSRWGAAVCAQTQQTSNPTVWLTEWAPEPRDVYWDNLSIPIVHLTVR  370

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+IA++ F L FFY+IPIAFVQSLAN+EG+EK  PFL+P+IE   +KSF+QGFLPG+A
Sbjct  371  RLIIAVAFFFLNFFYVIPIAFVQSLANIEGIEKAVPFLKPIIEMPAIKSFIQGFLPGIA  429



>ref|XP_007026161.1| ERD (early-responsive to dehydration stress) family protein isoform 
1 [Theobroma cacao]
 gb|EOY28783.1| ERD (early-responsive to dehydration stress) family protein isoform 
1 [Theobroma cacao]
Length=771

 Score =   247 bits (631),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 150/177 (85%), Gaps = 0/177 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
            QNWLDY QLK  RN  KRP  KTGFLGL G+KVD+++++  +I++  + +  ERE++ KD
Sbjct  254  QNWLDYYQLKYSRNSAKRPFMKTGFLGLRGEKVDAIDHHISEIEKLSKEIAEERERVKKD  313

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
            PKCI+PAAFVSF SRWGAAVCAQTQQS+NPTLWLT WA EPRD++W+NL+I +VSL++RR
Sbjct  314  PKCIMPAAFVSFKSRWGAAVCAQTQQSRNPTLWLTEWASEPRDVYWQNLAIPYVSLAVRR  373

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGL  534
            L++A++ F L FF++IPIA VQ+LA++EGLEK APFL+PLIE KF+KS +QGFLPG+
Sbjct  374  LIMAVAFFFLTFFFMIPIASVQALASIEGLEKAAPFLKPLIEIKFIKSVIQGFLPGI  430



>gb|EMT23208.1| Putative membrane protein [Aegilops tauschii]
Length=849

 Score =   248 bits (633),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 119/193 (62%), Positives = 151/193 (78%), Gaps = 15/193 (8%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTI-------  159
            ++NWLDY Q KLER   KRPT+KTGFLG +G +VD++++ K +I++    LT+       
Sbjct  231  MRNWLDYYQNKLERK-SKRPTTKTGFLGCFGSEVDAIDHCKSEIEKIGTELTVRTQSLIH  289

Query  160  -------EREKILKDPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIF  318
                   ER+K++KDPK I+PA+FVSF SRWGAAVCAQTQQ+ NPTLWLT WAPEPRD++
Sbjct  290  DNTQEAEERKKVMKDPKSIMPASFVSFRSRWGAAVCAQTQQTSNPTLWLTEWAPEPRDVY  349

Query  319  WKNLSISFVSLSIRRLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKF  498
            W NLSI FVSL++RRL+I ++ F L FFY+IPIAFVQ+LANLEG+EK  PFL+PLIE   
Sbjct  350  WSNLSIPFVSLTVRRLIIGVAFFFLNFFYVIPIAFVQTLANLEGIEKALPFLKPLIESPP  409

Query  499  VKSFLQGFLPGLA  537
            +KSF+QGFLPGLA
Sbjct  410  IKSFIQGFLPGLA  422



>ref|XP_008675529.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Zea mays]
 ref|XP_008675530.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Zea mays]
 tpg|DAA59084.1| TPA: hypothetical protein ZEAMMB73_475653 [Zea mays]
Length=768

 Score =   247 bits (630),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 149/179 (83%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            + NWLDY QL+ ERN  KRPT+KTGFLG +G KVD++EYY  +I+  +     EREKI+K
Sbjct  251  MHNWLDYYQLRFERNASKRPTTKTGFLGCFGTKVDAIEYYTSEIERIENEEAEEREKIVK  310

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+PAAFVSF SRWGAAVCAQTQQ+ NPT+WLT WAPEPRD++W NLSI FVSL++R
Sbjct  311  DPKSIVPAAFVSFRSRWGAAVCAQTQQTSNPTVWLTEWAPEPRDVYWDNLSIPFVSLTVR  370

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+IA++ F L FFY+ PIAFVQSLANLEG+EK APFL+PLIE   +KSF+QGFLPG+A
Sbjct  371  RLIIAVAFFFLNFFYVFPIAFVQSLANLEGIEKAAPFLKPLIEEHTIKSFIQGFLPGIA  429



>ref|XP_008673458.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Zea mays]
Length=768

 Score =   247 bits (630),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 149/179 (83%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            + NWLDY QL+ ERN  KRPT+KTGFLG +G KVD++EYY  +I+  +     EREKI+K
Sbjct  251  MHNWLDYYQLRFERNASKRPTTKTGFLGCFGTKVDAIEYYTSEIERIESEEAEEREKIVK  310

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+PAAFVSF SRWGAAVCAQTQQ+ NPT+WLT WAPEPRD++W NLSI FVSL++R
Sbjct  311  DPKSIVPAAFVSFRSRWGAAVCAQTQQTSNPTVWLTEWAPEPRDVYWDNLSIPFVSLTVR  370

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+IA++ F L FFY+ PIAFVQSLANLEG+EK APFL+PLIE   +KSF+QGFLPG+A
Sbjct  371  RLIIAVAFFFLNFFYVFPIAFVQSLANLEGIEKAAPFLKPLIEEHTIKSFIQGFLPGIA  429



>gb|KHG22816.1| putative membrane C2G11.09 [Gossypium arboreum]
Length=649

 Score =   244 bits (624),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 146/179 (82%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNWLDY Q K ERNP KRP  K GFLGLWG+ VD+V++Y  + +   R +++EREKI  
Sbjct  132  IQNWLDYYQNKYERNPSKRPLLKMGFLGLWGESVDAVDFYTAKTERLSRDISLEREKITS  191

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            +PK I+ AAFVSF +RWGAAVCAQTQQ +NPT+WLT WAPEPRD++W+NLSI FV L+IR
Sbjct  192  NPKSIMAAAFVSFKTRWGAAVCAQTQQCRNPTIWLTEWAPEPRDVYWENLSIPFVFLTIR  251

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL++A++ F L FF++IPIA VQSLAN+E +EK  PFL+P+IE K +KSF+QGFLPG+A
Sbjct  252  RLIVAVAFFFLTFFFVIPIAIVQSLANIESIEKALPFLKPIIEVKVIKSFIQGFLPGIA  310



>ref|XP_006843810.1| hypothetical protein AMTR_s00007p00254340 [Amborella trichopoda]
 gb|ERN05485.1| hypothetical protein AMTR_s00007p00254340 [Amborella trichopoda]
Length=763

 Score =   246 bits (629),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 120/179 (67%), Positives = 152/179 (85%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDYNQ K  RNP +RPT KTGFLGLWG+KVDS+++Y  +I++  +    ERE+++ 
Sbjct  251  LQNWLDYNQNKYLRNPSERPTRKTGFLGLWGEKVDSIDFYTAEIEKLSKEEAAERERVMS  310

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
             PKCI+PAAFVSF +RWGAAVCAQTQQS+NPT+WLTNWAPEPRD++W NL+I FVSL+IR
Sbjct  311  SPKCIMPAAFVSFRTRWGAAVCAQTQQSRNPTIWLTNWAPEPRDVYWHNLAIPFVSLTIR  370

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL++A++ F L FF++IPI FVQSLAN+E +EKVAPFL+ +IE KF+KS +QG LPGLA
Sbjct  371  RLIVAVAFFFLTFFFMIPITFVQSLANIEDIEKVAPFLKKIIEKKFIKSLIQGVLPGLA  429



>gb|EMT22148.1| Putative membrane protein [Aegilops tauschii]
Length=770

 Score =   246 bits (629),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 146/179 (82%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            L+NWL Y + +   NP K+PT KTG  GLWG+KVD++EYYK +I+E  +   +ER+K++ 
Sbjct  263  LKNWLVYYENQHAHNPAKKPTMKTGLWGLWGRKVDAIEYYKAEIEELCKQEDVERQKVMS  322

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DP  I+PAAFVSF S+WGAAVCAQTQQ+ NPT+WLT WAPEPRD++W NL+I FV LS+R
Sbjct  323  DPNAIMPAAFVSFKSQWGAAVCAQTQQTSNPTVWLTQWAPEPRDVYWPNLAIPFVELSVR  382

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+I++++F L FF++IPIAFVQSLANL+ +E++ PFL+P+IE   +KS +QGFLPG+A
Sbjct  383  RLIISVALFFLTFFFMIPIAFVQSLANLDEIERLLPFLKPIIERNSLKSVIQGFLPGIA  441



>ref|XP_006467388.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Citrus 
sinensis]
 gb|KDO78338.1| hypothetical protein CISIN_1g004125mg [Citrus sinensis]
Length=772

 Score =   246 bits (629),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 148/178 (83%), Gaps = 0/178 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
            QNWLDY QLK  RN  KRP  KTGFLGLWG+KVD ++Y+  +I++  + +  ERE+++ D
Sbjct  256  QNWLDYYQLKYSRNNSKRPMMKTGFLGLWGEKVDGIDYHISEIEKLSKEIAEERERVVSD  315

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
            PK I+PAAFVSF+SRWGAAVCAQTQQ++NPTLWLT WA EPRD++W+NL+I +VSLS+RR
Sbjct  316  PKAIMPAAFVSFNSRWGAAVCAQTQQTRNPTLWLTEWASEPRDVYWQNLAIPYVSLSVRR  375

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            L++ ++ F L FF++IPIA VQS A++EG+EK  PFL+P+IE KF+KS +QGFLPG+A
Sbjct  376  LIMGVAFFFLTFFFMIPIAIVQSFASIEGIEKAVPFLKPVIEAKFIKSVIQGFLPGIA  433



>ref|XP_009765631.1| PREDICTED: CSC1-like protein At4g02900 isoform X2 [Nicotiana 
sylvestris]
Length=507

 Score =   241 bits (614),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 142/178 (80%), Gaps = 0/178 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
            +NWL Y Q K ERNP K+P  KTGF GLWGK VD+++YY  +I++  +    EREK++ D
Sbjct  141  RNWLTYYQTKYERNPVKKPKIKTGFWGLWGKSVDAIDYYMTEIEKLGKEEAEEREKVITD  200

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
            PK I+PAAFVSF SRWGAAVC+QTQQS+N T WLT WAPEPRD++W NLSI ++ L++RR
Sbjct  201  PKAIVPAAFVSFKSRWGAAVCSQTQQSRNSTNWLTEWAPEPRDVYWDNLSIPYIQLAVRR  260

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            L++A+++F L FF++IPI FVQ+ A+++G++KV PFL+ LIE   VKSF+QGFLPG+ 
Sbjct  261  LLMAVALFFLTFFFMIPIGFVQAFASIDGIKKVLPFLKSLIEMDVVKSFVQGFLPGIV  318



>ref|XP_007141612.1| hypothetical protein PHAVU_008G210700g [Phaseolus vulgaris]
 gb|ESW13606.1| hypothetical protein PHAVU_008G210700g [Phaseolus vulgaris]
Length=755

 Score =   246 bits (628),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 147/178 (83%), Gaps = 0/178 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
            QNWLDY +LK  RN   RP  KTG LGLWG +VD++++Y  +I      + +E++K++K+
Sbjct  254  QNWLDYYELKYSRNQSTRPYKKTGCLGLWGDRVDAIDFYTAEIDRLSEEIELEKDKVMKN  313

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
            PK I+PAAFVSF +RWGAAVCAQTQQS+NPT+WLT WAPEPRD++W N++I +VSL+IRR
Sbjct  314  PKYIMPAAFVSFRTRWGAAVCAQTQQSRNPTVWLTEWAPEPRDVYWDNMAIPYVSLTIRR  373

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            L+IA++ F L FF++IPIAFVQSLAN+EG+EK APFL+P IE K +K+F+QGFLPG+A
Sbjct  374  LIIAVAFFFLTFFFMIPIAFVQSLANIEGIEKAAPFLKPFIEMKVIKAFVQGFLPGIA  431



>ref|NP_192199.1| ERD (early-responsive to dehydration stress) family protein [Arabidopsis 
thaliana]
 sp|Q9SY14.1|CSCL2_ARATH RecName: Full=CSC1-like protein At4g02900 [Arabidopsis thaliana]
 gb|AAD15333.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB77775.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE82248.1| ERD (early-responsive to dehydration stress) family protein [Arabidopsis 
thaliana]
 gb|AIU34619.1| hyperosmolality-gated Ca2+ permeable channel 1.7 [Arabidopsis 
thaliana]
Length=785

 Score =   246 bits (629),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 140/179 (78%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNWL Y + K ER P  RPT+KTG+ G WG  VD++++Y  ++        +EREKI+ 
Sbjct  252  MQNWLTYYENKFERKPSSRPTTKTGYGGFWGTTVDAIDFYTSKMDILAEQEAVEREKIMN  311

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+PAAFVSF SRWG AVCAQTQQ  NPT+WLT WAPEPRD+FW NL+I +V LSIR
Sbjct  312  DPKAIMPAAFVSFRSRWGTAVCAQTQQCHNPTIWLTEWAPEPRDVFWDNLAIPYVELSIR  371

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+  +++F L+F ++IPIAFVQSLANLEG++KV PFL+P+IE K VKS +QGFLPG+A
Sbjct  372  RLLTTVALFFLIFCFMIPIAFVQSLANLEGIQKVLPFLKPVIEMKTVKSVIQGFLPGIA  430



>ref|XP_009592755.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana tomentosiformis]
 ref|XP_009592756.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana tomentosiformis]
Length=768

 Score =   246 bits (628),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 147/178 (83%), Gaps = 0/178 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
            QNWLDY QLK  RN  KRPT KTGFLGL+GK VD+++YY  +I++  + ++ ER  I+  
Sbjct  252  QNWLDYYQLKYTRNQSKRPTLKTGFLGLFGKTVDAIDYYTSEIEKLSKEISDERTNIIGS  311

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
             K I+PAAFVSF +RWGAAVCAQTQQ++NPTLWLT WAPEPRD++W NL+I +VSLSIRR
Sbjct  312  SKSIMPAAFVSFRTRWGAAVCAQTQQARNPTLWLTEWAPEPRDVYWDNLAIPYVSLSIRR  371

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            L++A++ F L FF++IPIAFVQSLAN+EG+EK  PFL+ LIE K VKSF+QGFLPG+A
Sbjct  372  LIVAVAFFFLTFFFMIPIAFVQSLANIEGIEKALPFLKSLIEAKAVKSFIQGFLPGIA  429



>ref|XP_010430503.1| PREDICTED: CSC1-like protein At4g02900 [Camelina sativa]
Length=770

 Score =   246 bits (628),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 140/179 (78%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWL Y + K ER P  RPT+KTG+ G WG  VD++++Y  +++        EREKI+ 
Sbjct  252  LQNWLTYYENKYERKPTNRPTTKTGYGGFWGTTVDAIDFYTSKMEVLAEKEAAEREKIMN  311

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+PAAFVSF SRWG AVCAQTQQ  NPT+WLT WAPEPRD+FW NL+I +V LSIR
Sbjct  312  DPKAIMPAAFVSFKSRWGTAVCAQTQQCHNPTIWLTEWAPEPRDVFWDNLAIPYVELSIR  371

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+  +++F L+F ++IPIAFVQSLANLEG++KV PFL+P+IE K VKS +QGFLPG+A
Sbjct  372  RLLTTVALFFLIFCFMIPIAFVQSLANLEGIQKVLPFLKPVIEMKTVKSVIQGFLPGIA  430



>ref|XP_002973564.1| hypothetical protein SELMODRAFT_442177 [Selaginella moellendorffii]
 gb|EFJ25224.1| hypothetical protein SELMODRAFT_442177 [Selaginella moellendorffii]
Length=759

 Score =   246 bits (628),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 109/179 (61%), Positives = 142/179 (79%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDY QL+ +R   +RP +KTG  GLWG+KVD+++YY   I +  +    ERE++L 
Sbjct  253  LQNWLDYYQLQFQRKNTERPMTKTGLWGLWGQKVDAIQYYTDGINQISKEAAAERERVLN  312

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            D    +P AFVSF SRWGAAVCAQTQQ+++PT+WLT WAPEPRD++W+NLS+ ++ L++R
Sbjct  313  DDSSKLPVAFVSFRSRWGAAVCAQTQQTRDPTVWLTEWAPEPRDVYWRNLSVPYLQLTMR  372

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +L I  +VF L+FFY+IP+ FVQSLANLEG+EK   FLRP+IE KF+KSFLQGFLPGLA
Sbjct  373  KLFITGAVFLLIFFYIIPVTFVQSLANLEGIEKKLTFLRPIIEAKFIKSFLQGFLPGLA  431



>ref|XP_011086200.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Sesamum indicum]
 ref|XP_011086201.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Sesamum indicum]
 ref|XP_011086202.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Sesamum indicum]
Length=775

 Score =   246 bits (628),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 146/178 (82%), Gaps = 0/178 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
            QNWLDY QLK  RN  KRP +KTGFLGLWG+KVD+++Y   +I+   + +  ERE++  D
Sbjct  256  QNWLDYYQLKYSRNQSKRPVTKTGFLGLWGEKVDAIDYQAAEIERLSKEIAEERERLKSD  315

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
            PK I+PAAFVSF SRWGAAVCAQTQQ++NPTLWLT WAPEPRD++W NL+I +VSL+IRR
Sbjct  316  PKYIMPAAFVSFRSRWGAAVCAQTQQTRNPTLWLTEWAPEPRDVYWDNLAIPYVSLTIRR  375

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            LV A++ F L FF++IP+  VQSLAN+EG+E+ APFL+P+IE  F+KS +QGFLPG+A
Sbjct  376  LVAAVAFFFLTFFFMIPVTIVQSLANIEGIERRAPFLKPIIEISFIKSVIQGFLPGIA  433



>ref|XP_010905258.1| PREDICTED: protein OSCA1-like [Elaeis guineensis]
Length=682

 Score =   244 bits (622),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 148/179 (83%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWL Y + K  RNP KRP +KTGFLGLWG+ VD+++YY  +I++  +    ERE+++ 
Sbjct  251  LQNWLVYYENKNTRNPDKRPRTKTGFLGLWGETVDAIDYYTAEIEKLLKEEATERERLVI  310

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+PAAFVSF SRWGAAVCAQTQQS NPTLWL+ WAPEPRD++W NL+I FV L++R
Sbjct  311  DPKAIMPAAFVSFRSRWGAAVCAQTQQSSNPTLWLSEWAPEPRDVYWSNLAIPFVELTMR  370

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL++A++ F L FF++IPIAFVQSLAN+EG+EKVAPFL+PLIE + V SF++GFL G+A
Sbjct  371  RLIMAVAFFFLTFFFMIPIAFVQSLANIEGIEKVAPFLKPLIEKEVVSSFIKGFLSGIA  429



>ref|XP_010422520.1| PREDICTED: CSC1-like protein At4g02900 [Camelina sativa]
Length=770

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 140/179 (78%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNWL Y + K ER P  RPT+KTG+ G WG  VD++++Y  +++        EREKI+ 
Sbjct  252  MQNWLTYYENKYERKPTDRPTTKTGYGGFWGTTVDAIDFYTSKMEVLAEKEAAEREKIMN  311

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+PAAFVSF SRWG AVCAQTQQ  NPT+WLT WAPEPRD+FW NL+I +V LSIR
Sbjct  312  DPKAIMPAAFVSFKSRWGTAVCAQTQQCHNPTIWLTEWAPEPRDVFWDNLAIPYVELSIR  371

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+  +++F L+F ++IPIAFVQSLANLEG++KV PFL+P+IE K VKS +QGFLPG+A
Sbjct  372  RLLTTVALFFLIFCFMIPIAFVQSLANLEGIQKVLPFLKPVIEMKTVKSVIQGFLPGIA  430



>emb|CDY17981.1| BnaC03g30530D [Brassica napus]
Length=769

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/179 (61%), Positives = 139/179 (78%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNW+ Y + K ER P  RPT+KTG+ G WG  VD++++Y  +++       +EREKI+ 
Sbjct  252  MQNWVTYYENKYERKPSSRPTTKTGYGGFWGTTVDAIDFYTSKLQNLAEQEAVEREKIMN  311

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DP  I+PAAFVSF SRWG AVCAQTQQ  NPT+WLT WAPEPRD+FW NL+I +V LSIR
Sbjct  312  DPMAIVPAAFVSFRSRWGTAVCAQTQQCHNPTIWLTEWAPEPRDVFWDNLAIPYVELSIR  371

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+  I++F L+F ++IPIAFVQSLANLEG++KV PFL+PLIE K VKS +QG LPG+A
Sbjct  372  RLLTTIALFFLIFCFMIPIAFVQSLANLEGIQKVLPFLKPLIEMKTVKSVIQGLLPGIA  430



>ref|XP_006287199.1| hypothetical protein CARUB_v10000374mg [Capsella rubella]
 gb|EOA20097.1| hypothetical protein CARUB_v10000374mg [Capsella rubella]
Length=685

 Score =   244 bits (622),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 139/179 (78%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNWL Y + K ER P  RPT+KTG+ G WG  VD++++Y  +++        EREKI+ 
Sbjct  252  MQNWLTYYENKYERKPTNRPTTKTGYGGFWGTTVDAIDFYTSKMEILAEQEAAEREKIMN  311

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+PAAFVSF SRWG AVCAQTQQ  NPT+WLT WAPEPRD+FW NL+I +V LSIR
Sbjct  312  DPKAIMPAAFVSFKSRWGTAVCAQTQQCHNPTIWLTEWAPEPRDVFWDNLAIPYVELSIR  371

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+   ++F L+F ++IPIAFVQSLANLEG++KV PFL+P+IE K VKS +QGFLPG+A
Sbjct  372  RLLTTTALFFLIFCFMIPIAFVQSLANLEGIQKVLPFLKPVIEMKTVKSVIQGFLPGIA  430



>ref|XP_006447608.1| hypothetical protein CICLE_v10014696mg [Citrus clementina]
 gb|ESR60848.1| hypothetical protein CICLE_v10014696mg [Citrus clementina]
Length=590

 Score =   241 bits (616),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/179 (61%), Positives = 145/179 (81%), Gaps = 9/179 (5%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNWLD+ +LK  RNP ++P+ KTGFLGLWG+ VD +++Y  +I+      T+++E    
Sbjct  91   MQNWLDFYELKYSRNPSQKPSMKTGFLGLWGETVDPIDFYTSKIE------TLKKEA---  141

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
              K +IPAAFVSF +RWGAAVCAQTQQ++NPTLWLT+WAPEPRD++W NL+I FVSL+IR
Sbjct  142  SSKSVIPAAFVSFKTRWGAAVCAQTQQTRNPTLWLTDWAPEPRDVYWDNLAIPFVSLTIR  201

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+I ++ F L FF++IPIA VQSLAN+EG+EK  PFL+P+IE K +KSF+QGFLPG+A
Sbjct  202  RLIIFVAYFFLTFFFMIPIAIVQSLANIEGIEKALPFLKPIIEVKVIKSFIQGFLPGIA  260



>ref|XP_003569164.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Brachypodium 
distachyon]
 ref|XP_010231890.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Brachypodium 
distachyon]
Length=768

 Score =   244 bits (624),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/179 (65%), Positives = 146/179 (82%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNWLDY QLK ERN   RPT KTGFLG +G KVD++E+Y  +I+  ++    EREKI+K
Sbjct  251  MQNWLDYYQLKYERNTTTRPTVKTGFLGCFGSKVDAIEHYTSEIERIEKEEAEEREKIVK  310

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK ++PAAFVSF SRWGAAVCAQTQQ+ NPT+WLT WAPEPRD++W NLSI  V L++R
Sbjct  311  DPKSVVPAAFVSFRSRWGAAVCAQTQQTSNPTVWLTEWAPEPRDVYWDNLSIPIVHLTVR  370

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+IA++ F L FFY+IPI FVQSLAN+EG+EK  PFL+P+IE   +KSF+QGFLPG+A
Sbjct  371  RLIIAVAFFFLNFFYVIPITFVQSLANIEGIEKAVPFLKPVIEMDTIKSFIQGFLPGIA  429



>ref|XP_003616997.1| Transmembrane protein [Medicago truncatula]
 gb|AES99955.1| ERD (early-responsive to dehydration stress) family protein [Medicago 
truncatula]
Length=766

 Score =   244 bits (624),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 146/178 (82%), Gaps = 0/178 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
            QNWLDY +LK  RN   RPT KTGFLGL G KVD++++Y   I+   R + +E++K+ K+
Sbjct  252  QNWLDYYELKYSRNESVRPTKKTGFLGLCGSKVDAIDFYTAAIERLSRDIELEKDKVTKN  311

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
            PK I+PAAFVSF +RWGAAVCAQTQQ++NPT+WLT WAPEPRDI+W N++I +VSLSIRR
Sbjct  312  PKSIMPAAFVSFKTRWGAAVCAQTQQTRNPTIWLTEWAPEPRDIYWDNMAIPYVSLSIRR  371

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            LVI ++ F L FF++IPIAFVQSLAN+EG+EK APFL+ +IE   +KSF+QGFLPG+A
Sbjct  372  LVIGVAFFFLTFFFMIPIAFVQSLANIEGIEKAAPFLKSIIEIDVIKSFIQGFLPGIA  429



>ref|XP_010455943.1| PREDICTED: CSC1-like protein At4g02900 isoform X3 [Camelina sativa]
Length=763

 Score =   244 bits (624),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/179 (61%), Positives = 141/179 (79%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNWL Y + K ER P  RPT+KTG+ G WG  VD++++Y  +++     ++ EREKI+ 
Sbjct  252  MQNWLTYYENKYERKPTDRPTTKTGYGGFWGTTVDAIDFYTSKMEVLAEKVSAEREKIMN  311

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+PAAFVSF SRWG AVCAQTQQ  NPT+WLT WAPEPRD+FW NL+I +V LSIR
Sbjct  312  DPKAIMPAAFVSFKSRWGTAVCAQTQQCHNPTIWLTEWAPEPRDVFWDNLAIPYVELSIR  371

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+  +++F L+F ++IPIAFVQSLANLEG++KV  FL+P+IE K VKS +QGFLPG+A
Sbjct  372  RLLTTVALFFLIFCFMIPIAFVQSLANLEGIQKVLSFLKPVIEMKTVKSVIQGFLPGIA  430



>ref|XP_010684236.1| PREDICTED: CSC1-like protein At4g02900 [Beta vulgaris subsp. 
vulgaris]
Length=755

 Score =   244 bits (624),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 142/177 (80%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            ++NWL Y Q K ER P K+PT+KTGF GLWG +VD++EYY ++I++       ERE++L 
Sbjct  252  MENWLTYYQNKYERKPSKKPTTKTGFCGLWGARVDAIEYYAQEIEKLSEQEAAERERVLS  311

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DP+ I+PAAFVSF SRWGAAVCAQTQQS+NPT+WLT WA EP D++W NL+I +V L IR
Sbjct  312  DPEAILPAAFVSFKSRWGAAVCAQTQQSRNPTIWLTKWASEPSDVYWDNLAIPYVELKIR  371

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPG  531
            RL++A  +F L+FF+++PI FVQS+AN++G+EKV PFL+ LIE   VKSF+QG+LPG
Sbjct  372  RLLMAGGLFLLIFFFMVPITFVQSVANIDGIEKVLPFLKHLIEKPVVKSFIQGYLPG  428



>ref|XP_002317144.2| early-responsive to dehydration family protein [Populus trichocarpa]
 gb|EEE97756.2| early-responsive to dehydration family protein [Populus trichocarpa]
Length=744

 Score =   244 bits (623),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 152/178 (85%), Gaps = 0/178 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
            QNWLDY QLK +RN  +RP  KTGFLGLWG+KVD+++++  +IK+    +  EREK+LKD
Sbjct  256  QNWLDYYQLKYDRNQSQRPLKKTGFLGLWGEKVDAIDHHISEIKKLSEEIEEEREKVLKD  315

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
            PK I+PAAFVSF +RWGAAVCAQTQQS+NPTLWLT WAPEPRD++W+NL+I ++SLS+RR
Sbjct  316  PKSIMPAAFVSFKTRWGAAVCAQTQQSRNPTLWLTEWAPEPRDVYWENLAIPYMSLSVRR  375

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            L+I ++ F L FF++IPIA VQ+LA++EG+EK APFL+P+IE KF+KS +QGFLPG+A
Sbjct  376  LIIGVAFFFLTFFFMIPIASVQALASIEGIEKKAPFLKPIIEIKFIKSVIQGFLPGIA  433



>ref|XP_010455942.1| PREDICTED: CSC1-like protein At4g02900 isoform X2 [Camelina sativa]
Length=770

 Score =   244 bits (624),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/179 (61%), Positives = 141/179 (79%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNWL Y + K ER P  RPT+KTG+ G WG  VD++++Y  +++     ++ EREKI+ 
Sbjct  252  MQNWLTYYENKYERKPTDRPTTKTGYGGFWGTTVDAIDFYTSKMEVLAEKVSAEREKIMN  311

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+PAAFVSF SRWG AVCAQTQQ  NPT+WLT WAPEPRD+FW NL+I +V LSIR
Sbjct  312  DPKAIMPAAFVSFKSRWGTAVCAQTQQCHNPTIWLTEWAPEPRDVFWDNLAIPYVELSIR  371

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+  +++F L+F ++IPIAFVQSLANLEG++KV  FL+P+IE K VKS +QGFLPG+A
Sbjct  372  RLLTTVALFFLIFCFMIPIAFVQSLANLEGIQKVLSFLKPVIEMKTVKSVIQGFLPGIA  430



>gb|KJB10674.1| hypothetical protein B456_001G215500 [Gossypium raimondii]
Length=729

 Score =   244 bits (622),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 146/178 (82%), Gaps = 0/178 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
            QNWLDY Q K ERNP KRP  KTGFLGLWG+ VD+V++Y  + +   R +++EREKI  +
Sbjct  213  QNWLDYYQNKYERNPSKRPLLKTGFLGLWGESVDAVDFYTAKNERLSRDISLEREKITSN  272

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
            PK I+ AAFVSF +RWGAAVCAQTQQ +NPT+WLT WAPEPRD++W+NLSI FV L+IRR
Sbjct  273  PKSIMAAAFVSFKTRWGAAVCAQTQQCRNPTIWLTEWAPEPRDVYWENLSIPFVFLTIRR  332

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            L++A++ F L FF++IPIA VQSLAN+E +EK  PFL+P+IE K +KSF+QGFLPG+A
Sbjct  333  LIVAVAFFFLTFFFVIPIAIVQSLANIESIEKALPFLKPIIEVKVIKSFIQGFLPGIA  390



>gb|KJB10673.1| hypothetical protein B456_001G215500 [Gossypium raimondii]
Length=768

 Score =   244 bits (623),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 146/178 (82%), Gaps = 0/178 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
            QNWLDY Q K ERNP KRP  KTGFLGLWG+ VD+V++Y  + +   R +++EREKI  +
Sbjct  252  QNWLDYYQNKYERNPSKRPLLKTGFLGLWGESVDAVDFYTAKNERLSRDISLEREKITSN  311

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
            PK I+ AAFVSF +RWGAAVCAQTQQ +NPT+WLT WAPEPRD++W+NLSI FV L+IRR
Sbjct  312  PKSIMAAAFVSFKTRWGAAVCAQTQQCRNPTIWLTEWAPEPRDVYWENLSIPFVFLTIRR  371

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            L++A++ F L FF++IPIA VQSLAN+E +EK  PFL+P+IE K +KSF+QGFLPG+A
Sbjct  372  LIVAVAFFFLTFFFVIPIAIVQSLANIESIEKALPFLKPIIEVKVIKSFIQGFLPGIA  429



>ref|XP_011002577.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Populus 
euphratica]
Length=772

 Score =   244 bits (623),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 152/178 (85%), Gaps = 0/178 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
            QNWLDY QLK +RN  +RP  KTGFLGLWG+KVD+++++  +IK+    +  EREK+LKD
Sbjct  256  QNWLDYYQLKYDRNQSQRPLKKTGFLGLWGEKVDAIDHHISEIKKLSEEIEEEREKVLKD  315

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
            PK ++PAAFVSF +RWGAAVCAQTQQS+NPTLWLT WAPEPRD++W+NL+I ++SLS+RR
Sbjct  316  PKSVMPAAFVSFKTRWGAAVCAQTQQSRNPTLWLTEWAPEPRDVYWENLAIPYMSLSVRR  375

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            L+IA++ F L FF++IPIA VQ+LA++EG+EK  PFL+P+IE KF+KS +QGFLPG+A
Sbjct  376  LIIAVAFFFLTFFFMIPIASVQALASIEGIEKKVPFLKPIIEIKFIKSIIQGFLPGIA  433



>emb|CDP04437.1| unnamed protein product [Coffea canephora]
Length=768

 Score =   244 bits (622),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 147/178 (83%), Gaps = 0/178 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
            QNWLDY QLK  RN  +RP  KTGFLGL G+KVD++++   +I+   + +  ERE+++ D
Sbjct  252  QNWLDYYQLKYARNQSQRPMMKTGFLGLCGEKVDAIDHQTAEIERLSKEIPEERERVIND  311

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
            PK I+PAAFVSF +RWGAAVCAQTQQS NPTLWLT WAPEPRD++W NL+I +VS+SIRR
Sbjct  312  PKSIMPAAFVSFKTRWGAAVCAQTQQSSNPTLWLTEWAPEPRDVYWPNLAIPYVSVSIRR  371

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            L+I ++ F L FF++IPIAFVQSLAN+E +EK APFL+PLI+ KF+KSF+QGFLPG+A
Sbjct  372  LIIGVAFFFLTFFFMIPIAFVQSLANIEYIEKKAPFLKPLIDIKFIKSFIQGFLPGIA  429



>ref|XP_004158583.1| PREDICTED: uncharacterized protein RSN1-like [Cucumis sativus]
Length=768

 Score =   244 bits (622),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 146/179 (82%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            ++NWLD+ QLK  R+  KR T KTGFLGLWG +VD++ YY  +I+   + +++E +K + 
Sbjct  251  MRNWLDFYQLKYSRSQSKRATVKTGFLGLWGDQVDAINYYSSKIEILSKEISLEADKTVN  310

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK ++PAAFVSF SRWGAAVCAQTQQS+NPT+WLT WAPEPRD++W NL+I FVSL+IR
Sbjct  311  DPKSVMPAAFVSFKSRWGAAVCAQTQQSRNPTIWLTEWAPEPRDVYWDNLAIPFVSLAIR  370

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+  ++ F L FF++IPIAFVQSLAN+E +EK APFLRP+IE KF+KS +QGFLPG+ 
Sbjct  371  RLIAGVAFFFLTFFFMIPIAFVQSLANIESIEKTAPFLRPIIELKFIKSVIQGFLPGIV  429



>ref|XP_004151944.1| PREDICTED: uncharacterized protein RSN1-like [Cucumis sativus]
 gb|KGN63220.1| hypothetical protein Csa_2G416110 [Cucumis sativus]
Length=768

 Score =   244 bits (622),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 146/179 (82%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            ++NWLD+ QLK  R+  KR T KTGFLGLWG +VD++ YY  +I+   + +++E +K + 
Sbjct  251  MRNWLDFYQLKYSRSQSKRATVKTGFLGLWGDQVDAINYYSSKIEILSKEISLEADKTVN  310

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK ++PAAFVSF SRWGAAVCAQTQQS+NPT+WLT WAPEPRD++W NL+I FVSL+IR
Sbjct  311  DPKSVMPAAFVSFKSRWGAAVCAQTQQSRNPTIWLTEWAPEPRDVYWDNLAIPFVSLAIR  370

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+  ++ F L FF++IPIAFVQSLAN+E +EK APFLRP+IE KF+KS +QGFLPG+ 
Sbjct  371  RLIAGVAFFFLTFFFMIPIAFVQSLANIESIEKTAPFLRPIIELKFIKSVIQGFLPGIV  429



>ref|NP_001291223.1| calcium permeable stress-gated cation channel 1 [Populus euphratica]
 gb|AEL95439.1| early-responsive to dehydration-related protein [Populus euphratica]
Length=772

 Score =   243 bits (621),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 151/178 (85%), Gaps = 0/178 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
            QNWLDY QLK +RN  +RP  KTGFLGLWG+KVD+++++  +IK+    +  EREK+LKD
Sbjct  256  QNWLDYYQLKYDRNQSQRPLKKTGFLGLWGEKVDAIDHHISEIKKLSEEIEEEREKVLKD  315

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
            PK ++PAAFVSF +RWGAAVCAQTQQS+NPTLWLT WAPEPRD++W+NL+I ++SLS+RR
Sbjct  316  PKSVMPAAFVSFKTRWGAAVCAQTQQSRNPTLWLTEWAPEPRDVYWENLAIPYMSLSVRR  375

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            L+IA++ F L FF++IPIA VQ+LA++EG+EK  PFL+P IE KF+KS +QGFLPG+A
Sbjct  376  LIIAVAFFFLTFFFMIPIASVQALASIEGIEKKVPFLKPFIEIKFIKSIIQGFLPGIA  433



>ref|XP_006654360.1| PREDICTED: uncharacterized protein C354.08c-like [Oryza brachyantha]
Length=767

 Score =   243 bits (621),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 143/179 (80%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWL Y + +  +NP K+PT KTG  GLWGK+VD++E+Y   I+E  +    ER+K++ 
Sbjct  252  LQNWLVYYENQHAKNPAKKPTMKTGLWGLWGKRVDAIEHYTTAIEELCKQEDEERQKVMT  311

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DP  I+PAAFVSF SRWGAAVCAQTQQ+ NPT+WLT WAPEPRD+FW NL+I FV LS+R
Sbjct  312  DPNAIMPAAFVSFKSRWGAAVCAQTQQTSNPTMWLTEWAPEPRDVFWPNLAIPFVELSVR  371

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL++A+++F L FF++IPIA VQSLANL+ +E++ PFL+P+IE   +KS +QGFLPG+A
Sbjct  372  RLIMAVALFFLTFFFMIPIAIVQSLANLDDIERMLPFLKPIIERNSLKSIVQGFLPGIA  430



>ref|XP_009765629.1| PREDICTED: CSC1-like protein At4g02900 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009765630.1| PREDICTED: CSC1-like protein At4g02900 isoform X1 [Nicotiana 
sylvestris]
Length=620

 Score =   241 bits (614),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 142/178 (80%), Gaps = 0/178 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
            +NWL Y Q K ERNP K+P  KTGF GLWGK VD+++YY  +I++  +    EREK++ D
Sbjct  254  RNWLTYYQTKYERNPVKKPKIKTGFWGLWGKSVDAIDYYMTEIEKLGKEEAEEREKVITD  313

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
            PK I+PAAFVSF SRWGAAVC+QTQQS+N T WLT WAPEPRD++W NLSI ++ L++RR
Sbjct  314  PKAIVPAAFVSFKSRWGAAVCSQTQQSRNSTNWLTEWAPEPRDVYWDNLSIPYIQLAVRR  373

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            L++A+++F L FF++IPI FVQ+ A+++G++KV PFL+ LIE   VKSF+QGFLPG+ 
Sbjct  374  LLMAVALFFLTFFFMIPIGFVQAFASIDGIKKVLPFLKSLIEMDVVKSFVQGFLPGIV  431



>gb|KJB69238.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
 gb|KJB69240.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
Length=610

 Score =   240 bits (613),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 147/178 (83%), Gaps = 0/178 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
            QNWLDY QLK  RN  +RP  KTGFLGL GKKVD++E+++ +I +  + +  ERE++ KD
Sbjct  92   QNWLDYYQLKYSRNNAQRPIMKTGFLGLCGKKVDAIEHHEAEIGKLSKEIAEERERVKKD  151

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
            PK I+PAAFVSF SRWGAAVCAQTQQS++PT WLT WAPEP D++W NL I +VSL+IRR
Sbjct  152  PKAIMPAAFVSFKSRWGAAVCAQTQQSRDPTSWLTEWAPEPCDVYWPNLPIPYVSLAIRR  211

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            L++A++ F L FF++IPIA VQ+LA++EGLEKVAPFL+P+I+ KF+KS +QG LPGLA
Sbjct  212  LIMAVAFFFLTFFFMIPIASVQALASIEGLEKVAPFLKPIIDMKFIKSVIQGILPGLA  269



>ref|XP_003568506.1| PREDICTED: CSC1-like protein At4g02900 [Brachypodium distachyon]
Length=767

 Score =   243 bits (620),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 143/179 (80%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWL Y + +   NP K+PT KTG  GLWG+KVD++EYY+  I+E  +    ER+K++ 
Sbjct  252  LQNWLVYYENQHAHNPAKKPTMKTGLWGLWGQKVDAIEYYREAIEELCKQEDEERQKVMT  311

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DP  I+PAAFVSF S+WGAAVCAQTQQ+ NPT+WLT WAPEPRD++W NL+I +V LS+R
Sbjct  312  DPNAIMPAAFVSFKSQWGAAVCAQTQQTSNPTVWLTEWAPEPRDVYWPNLAIPYVELSVR  371

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL++++S+F L FF++IPIAFVQSLANLE +E+  PFL+P+IE   +KS +QGFLPG+A
Sbjct  372  RLIMSVSLFFLTFFFMIPIAFVQSLANLEDIERRLPFLKPIIERNSLKSVIQGFLPGIA  430



>gb|EYU46618.1| hypothetical protein MIMGU_mgv1a001779mg [Erythranthe guttata]
Length=760

 Score =   243 bits (620),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 145/179 (81%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            L NW  Y Q + ERNP  RPT+KTG  GLWGK VD+++YY  +I++  +  ++EREK++ 
Sbjct  252  LHNWRTYYQTRYERNPKMRPTTKTGLWGLWGKTVDAIDYYTDEIEKIIQEESVEREKVMS  311

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+PAAFVSF SRWGAAVCAQTQQS NPT+WLT WAPEPRD++W NL+I +V L+++
Sbjct  312  DPKAIVPAAFVSFKSRWGAAVCAQTQQSSNPTIWLTEWAPEPRDVYWDNLAIPYVELAVK  371

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL++A+++F L FF++IPIAFVQSLA+++G+ KV PFL+ LI+ + VKS +QGFLPG+ 
Sbjct  372  RLLMAVAMFFLTFFFMIPIAFVQSLASIDGIVKVFPFLKALIQKEKVKSVVQGFLPGIV  430



>dbj|BAK05559.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=767

 Score =   243 bits (620),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 109/179 (61%), Positives = 143/179 (80%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            L+NWL Y + +   NP K PT KTG  GLWG+KVD++EYYK  I+E  +    ER+K++ 
Sbjct  252  LKNWLVYYENQHAHNPAKTPTMKTGLWGLWGRKVDAIEYYKAAIEELCKQEDEERQKVMS  311

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DP  I+PAAFVSF S+WGAAVCAQTQQ+ NPT+WLT WAPEPRD++W NL+I FV LS+R
Sbjct  312  DPNAIMPAAFVSFKSQWGAAVCAQTQQTSNPTVWLTEWAPEPRDVYWPNLAIPFVELSVR  371

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+IA+++F L FF++IPIAFVQSLANL+ +E++ PFL+P+IE   +KS +QGFLPG+A
Sbjct  372  RLIIAVALFFLTFFFMIPIAFVQSLANLDEIERLLPFLKPIIERNSLKSVIQGFLPGIA  430



>ref|XP_004491137.1| PREDICTED: uncharacterized protein RSN1-like [Cicer arietinum]
Length=766

 Score =   242 bits (618),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 147/178 (83%), Gaps = 0/178 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
            QNWLDY +LK  RN   RP  KTGFLGL G KVD++++Y  +++   R + +E++K+ ++
Sbjct  252  QNWLDYYELKYSRNESVRPCIKTGFLGLCGSKVDAIDFYTGEVERLSRDIELEKDKVTRN  311

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
            PK I+PAAFVSF +RWGAAVCAQTQQ++NPT+WLT WAPEPRD++W N++I +VSLSIRR
Sbjct  312  PKSIMPAAFVSFRTRWGAAVCAQTQQTRNPTIWLTEWAPEPRDVYWDNMAIPYVSLSIRR  371

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            LVIA++ F L FF++IPIAFVQSLAN+EG+EK APFL+  IE K +KSF+QGFLPG+A
Sbjct  372  LVIAVAFFFLTFFFMIPIAFVQSLANIEGIEKAAPFLKAFIEIKVIKSFIQGFLPGIA  429



>ref|NP_001055457.1| Os05g0393800 [Oryza sativa Japonica Group]
 gb|AAT93895.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17371.1| Os05g0393800 [Oryza sativa Japonica Group]
 dbj|BAG91241.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AIU34630.1| hyperosmolality-gated Ca2+ permeable channel 1.3 [Oryza sativa]
Length=767

 Score =   242 bits (618),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 142/179 (79%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWL Y + +  +NP K+PT KTG  GLWGK+VD++E+Y   I+E  +    ER K++ 
Sbjct  252  LQNWLVYYENQHAKNPAKKPTMKTGLWGLWGKRVDAIEHYTTAIEELCKQEDEERHKVIT  311

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DP  I+PAAFVSF SRWGAAVCAQTQQ+ NPTLWLT WAPEPRD+FW NL+I FV LS+R
Sbjct  312  DPNAIMPAAFVSFKSRWGAAVCAQTQQTSNPTLWLTEWAPEPRDVFWPNLAIPFVELSVR  371

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL++A+++F L FF++IPIA VQS+ANL+ +E++ PFL+P+IE   +KS +QGFLPG+A
Sbjct  372  RLIMAVALFFLTFFFMIPIAIVQSMANLDDIERMLPFLKPIIERNSLKSIVQGFLPGIA  430



>gb|EAY97938.1| hypothetical protein OsI_19855 [Oryza sativa Indica Group]
 gb|EEE63624.1| hypothetical protein OsJ_18441 [Oryza sativa Japonica Group]
Length=783

 Score =   242 bits (618),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 142/179 (79%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWL Y + +  +NP K+PT KTG  GLWGK+VD++E+Y   I+E  +    ER K++ 
Sbjct  252  LQNWLVYYENQHAKNPAKKPTMKTGLWGLWGKRVDAIEHYTTAIEELCKQEDEERHKVIT  311

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DP  I+PAAFVSF SRWGAAVCAQTQQ+ NPTLWLT WAPEPRD+FW NL+I FV LS+R
Sbjct  312  DPNAIMPAAFVSFKSRWGAAVCAQTQQTSNPTLWLTEWAPEPRDVFWPNLAIPFVELSVR  371

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL++A+++F L FF++IPIA VQS+ANL+ +E++ PFL+P+IE   +KS +QGFLPG+A
Sbjct  372  RLIMAVALFFLTFFFMIPIAIVQSMANLDDIERMLPFLKPIIERNSLKSIVQGFLPGIA  430



>ref|XP_009396325.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Musa acuminata subsp. malaccensis]
Length=762

 Score =   242 bits (617),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 145/179 (81%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            ++NW DY QLK  RNP KRPT KTGF GL+G KVD++++Y  +I +  +    E E I+K
Sbjct  251  MENWRDYYQLKYVRNPLKRPTRKTGFWGLYGHKVDAIDFYTSKIDKLSKEEAAEHENIIK  310

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            +PK I+PAAFVSF +RWGAAVCAQTQQ++NPTLWLT WAPEPRDI+W+NLSI FVS++IR
Sbjct  311  NPKYIMPAAFVSFRTRWGAAVCAQTQQTRNPTLWLTEWAPEPRDIYWQNLSIPFVSITIR  370

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            +L++ +S F L FF++IPIA VQSLAN+EG+EK APFL+PLIE   +KS +QGFLPG+ 
Sbjct  371  KLIVVVSFFFLTFFFMIPIALVQSLANIEGIEKAAPFLKPLIEIPVIKSVMQGFLPGIV  429



>ref|XP_010455941.1| PREDICTED: CSC1-like protein At4g02900 isoform X1 [Camelina sativa]
Length=779

 Score =   242 bits (618),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/179 (61%), Positives = 139/179 (78%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNWL Y + K ER P  RPT+KTG+ G WG  VD++++Y  +++        EREKI+ 
Sbjct  252  MQNWLTYYENKYERKPTDRPTTKTGYGGFWGTTVDAIDFYTSKMEVLAEKEAAEREKIMN  311

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+PAAFVSF SRWG AVCAQTQQ  NPT+WLT WAPEPRD+FW NL+I +V LSIR
Sbjct  312  DPKAIMPAAFVSFKSRWGTAVCAQTQQCHNPTIWLTEWAPEPRDVFWDNLAIPYVELSIR  371

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+  +++F L+F ++IPIAFVQSLANLEG++KV  FL+P+IE K VKS +QGFLPG+A
Sbjct  372  RLLTTVALFFLIFCFMIPIAFVQSLANLEGIQKVLSFLKPVIEMKTVKSVIQGFLPGIA  430



>ref|XP_011095994.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Sesamum indicum]
Length=769

 Score =   242 bits (617),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 143/178 (80%), Gaps = 0/178 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
            QNWLDY QLK  RNP +RPT KTGFLGL G KVD++ Y   +I+   + +  ERE++  D
Sbjct  256  QNWLDYYQLKYSRNPSQRPTKKTGFLGLCGDKVDAINYQTAEIERLSKEIAEERERVKTD  315

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
            PKCI+PAAFVSF +RWGAAVCAQTQQ++NPTLWLT WA EPRD++W NL+I +VSL+IRR
Sbjct  316  PKCIMPAAFVSFKTRWGAAVCAQTQQTRNPTLWLTEWASEPRDVYWDNLAIPYVSLTIRR  375

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            L++A++ F L FF++IP+  VQSLAN+EG+EK  PFL+P+IE  F+KS +QG LPG+A
Sbjct  376  LIVAVAFFFLTFFFMIPVTIVQSLANIEGIEKRVPFLKPVIETPFIKSLIQGVLPGIA  433



>gb|KJB69237.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
Length=612

 Score =   239 bits (609),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 147/178 (83%), Gaps = 0/178 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
            QNWLDY QLK  RN  +RP  KTGFLGL GKKVD++E+++ +I +  + +  ERE++ KD
Sbjct  254  QNWLDYYQLKYSRNNAQRPIMKTGFLGLCGKKVDAIEHHEAEIGKLSKEIAEERERVKKD  313

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
            PK I+PAAFVSF SRWGAAVCAQTQQS++PT WLT WAPEP D++W NL I +VSL+IRR
Sbjct  314  PKAIMPAAFVSFKSRWGAAVCAQTQQSRDPTSWLTEWAPEPCDVYWPNLPIPYVSLAIRR  373

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            L++A++ F L FF++IPIA VQ+LA++EGLEKVAPFL+P+I+ KF+KS +QG LPGLA
Sbjct  374  LIMAVAFFFLTFFFMIPIASVQALASIEGLEKVAPFLKPIIDMKFIKSVIQGILPGLA  431



>ref|XP_002518432.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43819.1| conserved hypothetical protein [Ricinus communis]
Length=773

 Score =   241 bits (616),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 152/179 (85%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNWLDY QLK  R+   RP  K+GFLGLWGKKVD++++Y  +I++  + +  ERE++ K
Sbjct  253  MQNWLDYYQLKYSRDKSLRPLLKSGFLGLWGKKVDAIDHYTSEIEKLSKEIVEERERVEK  312

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+PAAFVSF +RWGAAVCAQTQQS+NPTLWLT+WAPEPRD++W NL+I +VSL+IR
Sbjct  313  DPKAIMPAAFVSFKTRWGAAVCAQTQQSRNPTLWLTDWAPEPRDVYWHNLAIPYVSLAIR  372

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL++ ++ F L FF++IPIAFVQSLA++EG+EK APFL+P+IE KF+KS +QGFLPG+A
Sbjct  373  RLIMGVAFFFLTFFFMIPIAFVQSLASIEGIEKRAPFLKPIIEIKFIKSVIQGFLPGIA  431



>gb|KJB69239.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
Length=772

 Score =   241 bits (616),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 148/178 (83%), Gaps = 0/178 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
            QNWLDY QLK  RN  +RP  KTGFLGL GKKVD++E+++ +I +  + +T ERE++ KD
Sbjct  254  QNWLDYYQLKYSRNNAQRPIMKTGFLGLCGKKVDAIEHHEAEIGKLSKEVTEERERVKKD  313

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
            PK I+PAAFVSF SRWGAAVCAQTQQS++PT WLT WAPEP D++W NL I +VSL+IRR
Sbjct  314  PKAIMPAAFVSFKSRWGAAVCAQTQQSRDPTSWLTEWAPEPCDVYWPNLPIPYVSLAIRR  373

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            L++A++ F L FF++IPIA VQ+LA++EGLEKVAPFL+P+I+ KF+KS +QG LPGLA
Sbjct  374  LIMAVAFFFLTFFFMIPIASVQALASIEGLEKVAPFLKPIIDMKFIKSVIQGILPGLA  431



>ref|XP_003519463.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Glycine 
max]
Length=760

 Score =   241 bits (615),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 146/178 (82%), Gaps = 0/178 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
            QNWLDY +LK  RN   RP+ KTGFLGL G +VD++++Y  +IK     + +E+ K++K+
Sbjct  254  QNWLDYYELKYSRNQSTRPSKKTGFLGLCGNRVDAIDFYTDEIKRLSEEIELEKHKVMKN  313

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
             K  +PAAFVSF +RWGAAVCAQTQQS+NPT+WLT WAPEPRD++W N++I +VSL+IR+
Sbjct  314  SKYTMPAAFVSFRTRWGAAVCAQTQQSRNPTVWLTEWAPEPRDVYWDNMAIPYVSLTIRK  373

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            L+IA++ F L FF++IPIAFVQSLAN+EG+EK APFL+  IE +F+KSF+QGFLPG+A
Sbjct  374  LIIAVAFFFLTFFFMIPIAFVQSLANIEGIEKAAPFLKSFIEMQFIKSFIQGFLPGIA  431



>gb|KHN38468.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=758

 Score =   241 bits (614),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 146/178 (82%), Gaps = 0/178 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
            QNWLDY +LK  RN   RP+ KTGFLGL G +VD++++Y  +IK     + +E+ K++K+
Sbjct  252  QNWLDYYELKYSRNQSTRPSKKTGFLGLCGNRVDAIDFYTDEIKRLSEEIELEKHKVMKN  311

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
             K  +PAAFVSF +RWGAAVCAQTQQS+NPT+WLT WAPEPRD++W N++I +VSL+IR+
Sbjct  312  SKYTMPAAFVSFRTRWGAAVCAQTQQSRNPTVWLTEWAPEPRDVYWDNMAIPYVSLTIRK  371

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            L+IA++ F L FF++IPIAFVQSLAN+EG+EK APFL+  IE +F+KSF+QGFLPG+A
Sbjct  372  LIIAVAFFFLTFFFMIPIAFVQSLANIEGIEKAAPFLKSFIEMQFIKSFIQGFLPGIA  429



>dbj|BAF98597.1| CM0545.360.nc [Lotus japonicus]
Length=755

 Score =   241 bits (614),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 146/178 (82%), Gaps = 0/178 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
            QNWLDY +LK  RN   RPT KTGFLGL G  VD++++Y  +I++    + +ER+K+ K+
Sbjct  252  QNWLDYYELKHSRNQSIRPTKKTGFLGLCGSSVDAIDFYTAEIEKLSEEIELERDKVKKN  311

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
            PK I+PAAFVSF +RWGAAVCAQTQQ++NPT+WLT  APEPRD++W N++I +VSLSIRR
Sbjct  312  PKSIMPAAFVSFRTRWGAAVCAQTQQTRNPTIWLTEGAPEPRDVYWDNMAIPYVSLSIRR  371

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            L+I ++ F L FF++IPIAFVQSLAN+EG+EK APFL+  IE KF+KSF+QGFLPG+A
Sbjct  372  LIIGVAFFFLTFFFMIPIAFVQSLANIEGIEKAAPFLKSFIEIKFIKSFIQGFLPGIA  429



>ref|XP_010488177.1| PREDICTED: CSC1-like protein At3g21620 isoform X2 [Camelina sativa]
Length=682

 Score =   239 bits (610),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 143/179 (80%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDY Q K  RNP KRPT K GFLG WG++VD++++Y  +I+   R +  E+E ++ 
Sbjct  177  LQNWLDYYQNKHSRNPSKRPTIKIGFLGCWGEEVDAIDHYMEKIEGLTRKICAEKETVMS  236

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
              K ++PAAFVSF  RWGA VC+QTQQS+NPT WLT WAPEPRDI+W NL++ +V L+IR
Sbjct  237  STKSLVPAAFVSFKRRWGAVVCSQTQQSRNPTEWLTEWAPEPRDIYWDNLALPYVQLTIR  296

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RLVIA++ F L FF++IPIAFVQ+LAN+EG+EK  PFL+PLIE K VKSF+QGFLPG+A
Sbjct  297  RLVIAVAFFFLTFFFMIPIAFVQTLANIEGIEKAVPFLKPLIEVKTVKSFIQGFLPGIA  355



>ref|XP_007200309.1| hypothetical protein PRUPE_ppa001848mg [Prunus persica]
 gb|EMJ01508.1| hypothetical protein PRUPE_ppa001848mg [Prunus persica]
Length=756

 Score =   240 bits (613),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 143/178 (80%), Gaps = 0/178 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
             NWL Y Q K ERNP  RPT+KTGFLGLWG KVD++ YY  +I++  +    EREK++ D
Sbjct  253  NNWLVYYQTKYERNPKSRPTTKTGFLGLWGHKVDAINYYTEEIEKMSQEEKQEREKVVSD  312

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
            P  I+PAAFVSF +RWGAAVCAQTQQS NP LWLT WA EPRDI+W+NL+I +V L++R+
Sbjct  313  PDAIMPAAFVSFRTRWGAAVCAQTQQSSNPILWLTEWASEPRDIYWRNLAIPYVELNVRK  372

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            L++A++ F L FF++IPIAFVQSLAN+EG+ KV PFL+PL+E K +KS +QGFLPG+A
Sbjct  373  LLMAVAFFFLTFFFMIPIAFVQSLANIEGIMKVLPFLKPLLEMKSIKSVIQGFLPGIA  430



>gb|KDO68802.1| hypothetical protein CISIN_1g015063mg [Citrus sinensis]
Length=414

 Score =   233 bits (593),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 134/163 (82%), Gaps = 1/163 (1%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            L+NWL Y +   ER   K+PT+KTGF GLWG +VD+++YY  +I +       EREK++ 
Sbjct  252  LRNWLTYYKNTYERT-SKKPTTKTGFWGLWGTRVDAIDYYTAEINKLTEEENAEREKVIS  310

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            D   IIPAAFVSF SRWGAAVCAQTQQS+NPT+WLTNWAPEPRDIFW NLSI +V L+IR
Sbjct  311  DANSIIPAAFVSFKSRWGAAVCAQTQQSRNPTIWLTNWAPEPRDIFWDNLSIPYVELTIR  370

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIE  489
            RL++A+S+FAL+FF++IPIAFVQSLAN+EG++KV PFL+PLI+
Sbjct  371  RLLMAVSLFALIFFFMIPIAFVQSLANIEGIQKVLPFLKPLID  413



>ref|XP_010466416.1| PREDICTED: CSC1-like protein At3g21620 isoform X2 [Camelina sativa]
Length=682

 Score =   239 bits (609),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 143/179 (80%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDY Q K  RNP KRP  K GFLG WG++VD++++Y  +I+   R +T E+E ++ 
Sbjct  177  LQNWLDYYQNKHSRNPSKRPVIKIGFLGCWGEEVDAIDHYVEKIEGLTRKITAEKETVIS  236

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
              K ++PAAFVSF  RWGA VC+QTQQS+NPT WLT WAPEPRDI+W NL++ +V L+IR
Sbjct  237  STKSLVPAAFVSFKRRWGAVVCSQTQQSRNPTEWLTEWAPEPRDIYWDNLALPYVQLTIR  296

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RLVIA++ F L FF++IPIAFVQ+LAN+EG+EK  PFL+PLIE K VKSF+QGFLPG+A
Sbjct  297  RLVIAVAFFFLTFFFMIPIAFVQTLANIEGIEKAVPFLKPLIEVKTVKSFIQGFLPGIA  355



>gb|EPS71707.1| hypothetical protein M569_03051, partial [Genlisea aurea]
Length=744

 Score =   240 bits (612),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 145/179 (81%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            L+NWL Y +++ ERN  KRP +KTG  GL+GK VD+++YY+ ++++       ER+K+++
Sbjct  252  LKNWLTYYEMRFERNQKKRPKTKTGLWGLFGKSVDAIDYYRAELEDISNEEAAERDKLMR  311

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPKCI+PAAFVSF SRWGA+VCAQTQQ+ NP  WLT W+ EPRD+FW NL+I ++ LS+R
Sbjct  312  DPKCIVPAAFVSFRSRWGASVCAQTQQTSNPIRWLTEWSTEPRDVFWDNLAIPYIKLSVR  371

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL++A+S F L FF++IPIAFVQSLA+++G++KV PFL PLI+ + +K+ +QGFLPGLA
Sbjct  372  RLIMAVSTFFLTFFFMIPIAFVQSLASIDGIQKVFPFLTPLIKMEAIKAIVQGFLPGLA  430



>gb|KJB42870.1| hypothetical protein B456_007G171500 [Gossypium raimondii]
Length=768

 Score =   240 bits (613),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 146/179 (82%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNWLD+ Q K +RNP KRP+ KTGFLGLWG +VD++++Y   ++   R +  EREK+  
Sbjct  252  IQNWLDFYQNKYKRNPLKRPSLKTGFLGLWGNRVDAIDFYTSFVERLSRDICGEREKVSS  311

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            + K I+PAAFVSF +RWGAAVCAQTQQS+NPT WLT WAPEPRD++W+NL+I FV L+IR
Sbjct  312  NTKSIMPAAFVSFKTRWGAAVCAQTQQSRNPTTWLTEWAPEPRDVYWENLAIPFVFLTIR  371

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+ AI+ F L FF++IPIA VQSLAN+E +EK  PFL+P+IE KF+KSF+QGFLPG+A
Sbjct  372  RLIAAIAFFFLTFFFMIPIAIVQSLANIESIEKALPFLKPIIEVKFIKSFIQGFLPGIA  430



>ref|XP_004493651.1| PREDICTED: uncharacterized protein RSN1-like isoform X1 [Cicer 
arietinum]
 ref|XP_004493652.1| PREDICTED: uncharacterized protein RSN1-like isoform X2 [Cicer 
arietinum]
Length=759

 Score =   240 bits (613),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 140/179 (78%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNW  Y   K ER+P KRPT++TG +G+ G KVD++++Y   I++       ERE I+ 
Sbjct  254  LQNWYVYYHNKYERDPSKRPTTRTGMMGIMGAKVDAIDHYTALIEKLSEQEAQERENIMN  313

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DP  IIPAAFVSF +RWGAAVCAQTQQ+ NPT+WLT WAPEPRD++W+NL+I +  L+IR
Sbjct  314  DPDAIIPAAFVSFKTRWGAAVCAQTQQTSNPTVWLTEWAPEPRDVYWENLAIPYFDLNIR  373

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+ ++S+F L FF++IPIAFVQSLAN+E +EKV PFL+P+IE   VKS +QGF+PGLA
Sbjct  374  RLLTSVSMFFLTFFFMIPIAFVQSLANIEAIEKVLPFLKPIIEKPSVKSVIQGFMPGLA  432



>gb|KDP30779.1| hypothetical protein JCGZ_13722 [Jatropha curcas]
Length=770

 Score =   240 bits (613),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 148/178 (83%), Gaps = 0/178 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
            +NWLDY QLK  RN  ++P  KTGFLGLWG++VD+++YY  +I+     +++EREKI+ +
Sbjct  252  RNWLDYYQLKYSRNQSQKPLLKTGFLGLWGERVDAIDYYTSEIERLSNEISLEREKIVNN  311

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
             K I+PAAFVSF +RWGAAVCAQTQQ++NPTLWLT WAPEPRDI+W NL+I +VSL++R+
Sbjct  312  SKSIMPAAFVSFRTRWGAAVCAQTQQTRNPTLWLTEWAPEPRDIYWDNLAIPYVSLAVRK  371

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            L++AI+ F L FF++IPIAFVQSLAN+EG+EK  PFL+ LIE   VKSF+QGFLPG+A
Sbjct  372  LIVAIAFFFLAFFFMIPIAFVQSLANIEGIEKALPFLKHLIEMDVVKSFIQGFLPGIA  429



>gb|EPS60017.1| hypothetical protein M569_14787, partial [Genlisea aurea]
Length=762

 Score =   240 bits (613),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 145/178 (81%), Gaps = 0/178 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
            QNWLDY QLK  RNP +RP +K+GFLGL+G+KVD+++Y   +I+   + + +ERE++ KD
Sbjct  256  QNWLDYYQLKHRRNPEQRPMTKSGFLGLFGEKVDAIDYTISEIERLSKEIELERERVKKD  315

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
            P CI+PAAFVSF SRWGAAVCAQTQQ +NPTLWLT WAPEPR+++W NL+I + SLS+R+
Sbjct  316  PNCIMPAAFVSFKSRWGAAVCAQTQQERNPTLWLTGWAPEPRNVYWANLAIPYFSLSVRK  375

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            L+I++  F L FF++IPI FVQSLAN+ G+EK  PFL+P+IE  F+KS +QG LPG+A
Sbjct  376  LIISVVFFFLTFFFMIPITFVQSLANISGIEKAVPFLKPVIEKPFIKSLIQGVLPGIA  433



>gb|KHG01808.1| putative membrane C2G11.09 [Gossypium arboreum]
Length=772

 Score =   240 bits (613),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 148/178 (83%), Gaps = 0/178 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
            QNWLDY QLK  RN  +RP  KTGFLGL G+KVD++E+++ +IK+  + +  ERE++ KD
Sbjct  254  QNWLDYYQLKYSRNNAQRPIMKTGFLGLCGQKVDAIEHHEAEIKKLSKEIAEERERVKKD  313

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
            PK I+PAAFVSF SRWGAAVCAQTQQS++PT WLT WAPEP D++W NL I +VSL+IRR
Sbjct  314  PKAIMPAAFVSFKSRWGAAVCAQTQQSRDPTSWLTEWAPEPCDVYWPNLPIPYVSLAIRR  373

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            L++A++ F L FF++IPIA VQ+LA++EGLEKVAPFL+P+I+ KF+KS +QG LPGLA
Sbjct  374  LIMAVAFFFLTFFFIIPIASVQALASIEGLEKVAPFLKPIIDMKFIKSVIQGILPGLA  431



>gb|KJB42871.1| hypothetical protein B456_007G171500 [Gossypium raimondii]
Length=788

 Score =   240 bits (613),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 146/179 (82%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNWLD+ Q K +RNP KRP+ KTGFLGLWG +VD++++Y   ++   R +  EREK+  
Sbjct  272  IQNWLDFYQNKYKRNPLKRPSLKTGFLGLWGNRVDAIDFYTSFVERLSRDICGEREKVSS  331

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            + K I+PAAFVSF +RWGAAVCAQTQQS+NPT WLT WAPEPRD++W+NL+I FV L+IR
Sbjct  332  NTKSIMPAAFVSFKTRWGAAVCAQTQQSRNPTTWLTEWAPEPRDVYWENLAIPFVFLTIR  391

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RL+ AI+ F L FF++IPIA VQSLAN+E +EK  PFL+P+IE KF+KSF+QGFLPG+A
Sbjct  392  RLIAAIAFFFLTFFFMIPIAIVQSLANIESIEKALPFLKPIIEVKFIKSFIQGFLPGIA  450



>gb|KJB69243.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
Length=764

 Score =   239 bits (611),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 147/178 (83%), Gaps = 0/178 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
            QNWLDY QLK  RN  +RP  KTGFLGL GKKVD++E+++ +I +  + +  ERE++ KD
Sbjct  246  QNWLDYYQLKYSRNNAQRPIMKTGFLGLCGKKVDAIEHHEAEIGKLSKEIAEERERVKKD  305

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
            PK I+PAAFVSF SRWGAAVCAQTQQS++PT WLT WAPEP D++W NL I +VSL+IRR
Sbjct  306  PKAIMPAAFVSFKSRWGAAVCAQTQQSRDPTSWLTEWAPEPCDVYWPNLPIPYVSLAIRR  365

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            L++A++ F L FF++IPIA VQ+LA++EGLEKVAPFL+P+I+ KF+KS +QG LPGLA
Sbjct  366  LIMAVAFFFLTFFFMIPIASVQALASIEGLEKVAPFLKPIIDMKFIKSVIQGILPGLA  423



>gb|KJB69236.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
 gb|KJB69242.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
 gb|KJB69244.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
Length=772

 Score =   239 bits (611),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 147/178 (83%), Gaps = 0/178 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
            QNWLDY QLK  RN  +RP  KTGFLGL GKKVD++E+++ +I +  + +  ERE++ KD
Sbjct  254  QNWLDYYQLKYSRNNAQRPIMKTGFLGLCGKKVDAIEHHEAEIGKLSKEIAEERERVKKD  313

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
            PK I+PAAFVSF SRWGAAVCAQTQQS++PT WLT WAPEP D++W NL I +VSL+IRR
Sbjct  314  PKAIMPAAFVSFKSRWGAAVCAQTQQSRDPTSWLTEWAPEPCDVYWPNLPIPYVSLAIRR  373

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            L++A++ F L FF++IPIA VQ+LA++EGLEKVAPFL+P+I+ KF+KS +QG LPGLA
Sbjct  374  LIMAVAFFFLTFFFMIPIASVQALASIEGLEKVAPFLKPIIDMKFIKSVIQGILPGLA  431



>gb|EYU33878.1| hypothetical protein MIMGU_mgv1a018274mg [Erythranthe guttata]
Length=770

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 144/178 (81%), Gaps = 0/178 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
            QNWLDY QLK  RN  +RP  KTGFLGLWG+KVD++++   +I+   + ++ ERE++  D
Sbjct  257  QNWLDYYQLKYSRNQSQRPVKKTGFLGLWGEKVDAIDHQTAKIETLSKQISEERERVKTD  316

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
            PKCI+PA FVSF +RW AAVCAQTQQ++NPTLWLT WAPEPRDI+W NL+I + SL++RR
Sbjct  317  PKCIMPAGFVSFKTRWAAAVCAQTQQTRNPTLWLTEWAPEPRDIYWDNLAIPYFSLAVRR  376

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            LV +++ F L FF++IP+  VQSLAN+EG+EK APFL+P+IE  F+KS +QGFLPG+A
Sbjct  377  LVTSVAFFFLTFFFMIPVTIVQSLANIEGIEKWAPFLKPIIEVPFIKSVIQGFLPGIA  434



>ref|XP_010488175.1| PREDICTED: CSC1-like protein At3g21620 isoform X1 [Camelina sativa]
 ref|XP_010488176.1| PREDICTED: CSC1-like protein At3g21620 isoform X1 [Camelina sativa]
Length=757

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 143/179 (80%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDY Q K  RNP KRPT K GFLG WG++VD++++Y  +I+   R +  E+E ++ 
Sbjct  252  LQNWLDYYQNKHSRNPSKRPTIKIGFLGCWGEEVDAIDHYMEKIEGLTRKICAEKETVMS  311

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
              K ++PAAFVSF  RWGA VC+QTQQS+NPT WLT WAPEPRDI+W NL++ +V L+IR
Sbjct  312  STKSLVPAAFVSFKRRWGAVVCSQTQQSRNPTEWLTEWAPEPRDIYWDNLALPYVQLTIR  371

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RLVIA++ F L FF++IPIAFVQ+LAN+EG+EK  PFL+PLIE K VKSF+QGFLPG+A
Sbjct  372  RLVIAVAFFFLTFFFMIPIAFVQTLANIEGIEKAVPFLKPLIEVKTVKSFIQGFLPGIA  430



>ref|XP_010323041.1| PREDICTED: CSC1-like protein At4g02900 isoform X3 [Solanum lycopersicum]
Length=688

 Score =   238 bits (606),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 140/178 (79%), Gaps = 0/178 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
             NWL Y Q K ERNP K+   KTGF GLWGK VD+++YY  +I++  +    EREK+  +
Sbjct  254  HNWLTYYQTKNERNPEKKQKIKTGFWGLWGKSVDAIDYYTTEIEKLTKEEAEEREKVKSE  313

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
            P  I+ AAFVSF+SRWGAAVCAQTQQS+N T+WLT WAPEPRD++W NLSI ++ LS+RR
Sbjct  314  PNAIVSAAFVSFNSRWGAAVCAQTQQSRNSTIWLTEWAPEPRDVYWDNLSIPYIQLSLRR  373

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            L++A+++F L FF++IPI FVQ+ A+++G+ KV PFL+PLI+  FVKSF+QGFLPG+ 
Sbjct  374  LLMAVALFFLTFFFMIPIGFVQAFASIDGIRKVLPFLKPLIDMDFVKSFVQGFLPGIV  431



>ref|XP_004166876.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized membrane protein 
C2G11.09-like [Cucumis sativus]
Length=773

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 146/177 (82%), Gaps = 0/177 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
            QNWLD+ QLK  RN   RP  KTGFLGLWGKKVD++E+   +I++    +  ER++I  D
Sbjct  256  QNWLDFYQLKYSRNSTVRPLMKTGFLGLWGKKVDAIEFQTAEIEKLSIEIASERKRISND  315

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
            PK I+PAAFVSF SRWGAAVCAQTQQS+NPTLWLT WAPEPRD++W+NL+I +VSL++R+
Sbjct  316  PKSIMPAAFVSFKSRWGAAVCAQTQQSRNPTLWLTEWAPEPRDVYWENLAIPYVSLTVRK  375

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGL  534
            L++ ++ F L FF++IPI+FVQSLA++EG+EK+ P L+P+IE  FVKSF+QGFLPG+
Sbjct  376  LIMGVAFFFLTFFFMIPISFVQSLASIEGIEKLLPVLKPIIEGDFVKSFVQGFLPGI  432



>ref|XP_008459005.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Cucumis 
melo]
 ref|XP_008459006.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Cucumis 
melo]
Length=773

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 146/177 (82%), Gaps = 0/177 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
            QNWLD+ QLK  RN   RP  KTGFLGLWGKKVD++E+   +I++    +  ER++I  D
Sbjct  256  QNWLDFYQLKYSRNSTVRPLMKTGFLGLWGKKVDAIEFQTAEIEKLSTEIASERKRISND  315

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
            PK I+PAAFVSF SRWGAAVCAQTQQS+NPTLWLT WAPEPRD++W+NL+I +VSL++R+
Sbjct  316  PKSIMPAAFVSFKSRWGAAVCAQTQQSRNPTLWLTEWAPEPRDVYWENLAIPYVSLTVRK  375

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGL  534
            L++ ++ F L FF++IPI+FVQSLA++EG+EK+ P L+P+IE  F+KSF+QGFLPG+
Sbjct  376  LIMGVAFFFLTFFFMIPISFVQSLASIEGIEKLLPVLKPIIERDFIKSFVQGFLPGI  432



>ref|XP_010924083.1| PREDICTED: protein OSCA1-like isoform X6 [Elaeis guineensis]
Length=684

 Score =   238 bits (606),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 107/163 (66%), Positives = 139/163 (85%), Gaps = 0/163 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            +QNWLDY QLK +RNP KRPT+KTGFLGL G KVD++E+Y  +++   +    EREK+ K
Sbjct  251  MQNWLDYYQLKYDRNPSKRPTTKTGFLGLCGDKVDAIEFYTSEVERLSKKAATEREKVKK  310

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK ++PAAFVSF +RWGAAVCAQTQQ++NPTLWLT WAPEPRD++W+NL++ FVSL++R
Sbjct  311  DPKSVMPAAFVSFRTRWGAAVCAQTQQTRNPTLWLTKWAPEPRDVYWQNLAMPFVSLTVR  370

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIE  489
            RL+IA++ F L FF++IPIAFVQSLAN+EG+EK  PFL+P+IE
Sbjct  371  RLIIAVAFFFLTFFFMIPIAFVQSLANIEGIEKAVPFLKPIIE  413



>ref|XP_010466415.1| PREDICTED: CSC1-like protein At3g21620 isoform X1 [Camelina sativa]
Length=757

 Score =   239 bits (609),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 143/179 (80%), Gaps = 0/179 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDY Q K  RNP KRP  K GFLG WG++VD++++Y  +I+   R +T E+E ++ 
Sbjct  252  LQNWLDYYQNKHSRNPSKRPVIKIGFLGCWGEEVDAIDHYVEKIEGLTRKITAEKETVIS  311

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
              K ++PAAFVSF  RWGA VC+QTQQS+NPT WLT WAPEPRDI+W NL++ +V L+IR
Sbjct  312  STKSLVPAAFVSFKRRWGAVVCSQTQQSRNPTEWLTEWAPEPRDIYWDNLALPYVQLTIR  371

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            RLVIA++ F L FF++IPIAFVQ+LAN+EG+EK  PFL+PLIE K VKSF+QGFLPG+A
Sbjct  372  RLVIAVAFFFLTFFFMIPIAFVQTLANIEGIEKAVPFLKPLIEVKTVKSFIQGFLPGIA  430



>ref|XP_010323040.1| PREDICTED: CSC1-like protein At4g02900 isoform X2 [Solanum lycopersicum]
Length=704

 Score =   238 bits (607),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 140/178 (79%), Gaps = 0/178 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
             NWL Y Q K ERNP K+   KTGF GLWGK VD+++YY  +I++  +    EREK+  +
Sbjct  254  HNWLTYYQTKNERNPEKKQKIKTGFWGLWGKSVDAIDYYTTEIEKLTKEEAEEREKVKSE  313

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
            P  I+ AAFVSF+SRWGAAVCAQTQQS+N T+WLT WAPEPRD++W NLSI ++ LS+RR
Sbjct  314  PNAIVSAAFVSFNSRWGAAVCAQTQQSRNSTIWLTEWAPEPRDVYWDNLSIPYIQLSLRR  373

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            L++A+++F L FF++IPI FVQ+ A+++G+ KV PFL+PLI+  FVKSF+QGFLPG+ 
Sbjct  374  LLMAVALFFLTFFFMIPIGFVQAFASIDGIRKVLPFLKPLIDMDFVKSFVQGFLPGIV  431



>ref|XP_004242328.1| PREDICTED: CSC1-like protein At4g02900 isoform X1 [Solanum lycopersicum]
Length=766

 Score =   239 bits (609),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 140/178 (79%), Gaps = 0/178 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
             NWL Y Q K ERNP K+   KTGF GLWGK VD+++YY  +I++  +    EREK+  +
Sbjct  254  HNWLTYYQTKNERNPEKKQKIKTGFWGLWGKSVDAIDYYTTEIEKLTKEEAEEREKVKSE  313

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
            P  I+ AAFVSF+SRWGAAVCAQTQQS+N T+WLT WAPEPRD++W NLSI ++ LS+RR
Sbjct  314  PNAIVSAAFVSFNSRWGAAVCAQTQQSRNSTIWLTEWAPEPRDVYWDNLSIPYIQLSLRR  373

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            L++A+++F L FF++IPI FVQ+ A+++G+ KV PFL+PLI+  FVKSF+QGFLPG+ 
Sbjct  374  LLMAVALFFLTFFFMIPIGFVQAFASIDGIRKVLPFLKPLIDMDFVKSFVQGFLPGIV  431



>ref|XP_006299035.1| hypothetical protein CARUB_v10015172mg [Capsella rubella]
 gb|EOA31933.1| hypothetical protein CARUB_v10015172mg [Capsella rubella]
Length=756

 Score =   238 bits (608),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 144/178 (81%), Gaps = 0/178 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
            QNWLDY Q K  RNP KRP  KTGFLG +G++VD+++YY  +I+   R +++E+E ++  
Sbjct  253  QNWLDYYQNKHSRNPSKRPVIKTGFLGCFGEEVDAIDYYMEKIEGLTRKISVEKETVMSS  312

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
             K ++PAAFVSF  RWGA VC+QTQQ++NPT WLT WAPEPRDI+W NL++ +V L+IRR
Sbjct  313  TKALVPAAFVSFKRRWGAVVCSQTQQTRNPTEWLTEWAPEPRDIYWDNLALPYVQLTIRR  372

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            LVIA++ F L FF++IPIAFVQ+LAN+EG+EK  PFL+PLIE K VKSF+QGFLPG+A
Sbjct  373  LVIAVAFFFLTFFFMIPIAFVQTLANIEGIEKAVPFLKPLIEVKTVKSFIQGFLPGIA  430



>ref|XP_009601393.1| PREDICTED: CSC1-like protein At4g02900 isoform X2 [Nicotiana 
tomentosiformis]
Length=642

 Score =   236 bits (603),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 141/178 (79%), Gaps = 0/178 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
            +NWL Y Q K ERNP K+P  KTGF GLWGK VD+++YY  +I++       EREK++ D
Sbjct  141  RNWLTYYQTKYERNPVKKPKIKTGFWGLWGKSVDAIDYYMTEIEKLGEEEAEEREKVISD  200

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
            P  I+PAAFVSF SRWGAAVCAQTQQS+N T+WLT WAPEPRD++W NLSI ++ L++RR
Sbjct  201  PNAIVPAAFVSFKSRWGAAVCAQTQQSRNSTIWLTEWAPEPRDVYWDNLSIPYIQLAVRR  260

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            L++A+++F L FF++IPI FVQ+ A+++G++KV PFL+ LIE   VKSF+QGFLPG+ 
Sbjct  261  LLMAVALFFLTFFFMIPIGFVQAFASIDGIKKVLPFLKSLIEMDVVKSFVQGFLPGIV  318



>ref|XP_004145433.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Cucumis 
sativus]
 gb|KGN66856.1| hypothetical protein Csa_1G701320 [Cucumis sativus]
Length=773

 Score =   238 bits (608),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 146/177 (82%), Gaps = 0/177 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
            QNWLD+ QLK  RN   RP  KTGFLGLWGKKVD++E+   +I++    +  ER++I  D
Sbjct  256  QNWLDFYQLKYSRNSTVRPLMKTGFLGLWGKKVDAIEFQTAEIEKLSIEIASERKRISND  315

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
            PK I+PAAFVSF SRWGAAVCAQTQQS+NPTLWLT WAPEPRD++W+NL+I +VSL++R+
Sbjct  316  PKSIMPAAFVSFKSRWGAAVCAQTQQSRNPTLWLTEWAPEPRDVYWENLAIPYVSLTVRK  375

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGL  534
            L++ ++ F L FF++IPI+FVQSLA++EG+EK+ P L+P+IE  FVKSF+QGFLPG+
Sbjct  376  LIMGVAFFFLTFFFMIPISFVQSLASIEGIEKLLPALKPIIEGDFVKSFVQGFLPGI  432



>ref|XP_009619499.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Nicotiana tomentosiformis]
 ref|XP_009619500.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Nicotiana tomentosiformis]
Length=768

 Score =   238 bits (608),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 143/178 (80%), Gaps = 0/178 (0%)
 Frame = +1

Query  4    QNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILKD  183
            QNWLDY QLK  RN   RP  KTGFLG +G KVD+++Y   +++   + +  ERE++  D
Sbjct  252  QNWLDYYQLKFSRNQSNRPMMKTGFLGFFGNKVDAIDYQTAEVESLSKEIAEERERVKND  311

Query  184  PKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIRR  363
            PK I+PAAFVSF +RWGAAVCAQTQQS+NPTLWLT WAPEPRD++W+NL+I +VSL+IRR
Sbjct  312  PKSIMPAAFVSFKTRWGAAVCAQTQQSRNPTLWLTEWAPEPRDVYWRNLAIPYVSLTIRR  371

Query  364  LVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGLA  537
            L+I ++ F L FF++IPI FVQ+LA +EG+ KVAPFL+ +I+  F+KSF+QGFLPG+A
Sbjct  372  LIIGVAFFFLTFFFMIPITFVQTLATIEGIRKVAPFLKVIIDIPFIKSFIQGFLPGIA  429



>ref|XP_010539247.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Tarenaya 
hassleriana]
 ref|XP_010539248.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Tarenaya 
hassleriana]
Length=771

 Score =   238 bits (606),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 145/178 (81%), Gaps = 0/178 (0%)
 Frame = +1

Query  1    LQNWLDYNQLKLERNPGKRPTSKTGFLGLWGKKVDSVEYYKRQIKEFDRMLTIEREKILK  180
            LQNWLDY QL+  RN  KRP  K GFLGLWG++VD++E+Y  +I++  + +  ERE ++ 
Sbjct  255  LQNWLDYYQLRYSRNNTKRPLVKLGFLGLWGQQVDAIEHYAAEIEKTSKEIAEERETVVN  314

Query  181  DPKCIIPAAFVSFDSRWGAAVCAQTQQSKNPTLWLTNWAPEPRDIFWKNLSISFVSLSIR  360
            DPK I+PAAFVSF +RW AAVCAQTQQ++NPT WLT WAPEPRD+FW NL++ +VSL+IR
Sbjct  315  DPKSIMPAAFVSFKTRWAAAVCAQTQQTRNPTEWLTEWAPEPRDVFWPNLAMPYVSLTIR  374

Query  361  RLVIAISVFALVFFYLIPIAFVQSLANLEGLEKVAPFLRPLIEWKFVKSFLQGFLPGL  534
            RL++ ++ F L FF++IPI FVQSLA +EG+EKVAPFL+ +IE KF+KS +QGFLPG+
Sbjct  375  RLIMHVAFFFLTFFFMIPITFVQSLATIEGIEKVAPFLKVIIEKKFIKSVIQGFLPGI  432



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 829366762230