BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001F15

Length=494
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008792950.1|  PREDICTED: 40S ribosomal protein S8                207   4e-64   Phoenix dactylifera
gb|AFW66128.1|  putative ribosomal protein S8e family protein           204   7e-64   
ref|XP_009378162.1|  PREDICTED: 40S ribosomal protein S8-like           206   1e-63   Pyrus x bretschneideri [bai li]
ref|XP_009373606.1|  PREDICTED: 40S ribosomal protein S8                206   2e-63   Pyrus x bretschneideri [bai li]
ref|NP_001105391.1|  40S ribosomal protein S8                           205   3e-63   Zea mays [maize]
gb|KDP45274.1|  hypothetical protein JCGZ_15139                         205   3e-63   Jatropha curcas
ref|XP_006833291.1|  hypothetical protein AMTR_s00109p00031400          205   4e-63   Amborella trichopoda
gb|KDP39216.1|  hypothetical protein JCGZ_00973                         205   5e-63   Jatropha curcas
ref|XP_009349000.1|  PREDICTED: 40S ribosomal protein S8-like           204   8e-63   Pyrus x bretschneideri [bai li]
gb|KJB22170.1|  hypothetical protein B456_004G033000                    204   8e-63   Gossypium raimondii
ref|XP_009416597.1|  PREDICTED: 40S ribosomal protein S8                204   1e-62   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG18510.1|  40S ribosomal S8                                        204   1e-62   Gossypium arboreum [tree cotton]
gb|KHM99496.1|  40S ribosomal protein S8                                204   1e-62   Glycine soja [wild soybean]
ref|XP_003532158.1|  PREDICTED: 40S ribosomal protein S8-like           204   1e-62   Glycine max [soybeans]
ref|XP_007146564.1|  hypothetical protein PHAVU_006G051300g             203   2e-62   Phaseolus vulgaris [French bean]
ref|XP_006373483.1|  hypothetical protein POPTR_0017s14180g             203   2e-62   Populus trichocarpa [western balsam poplar]
ref|XP_011021175.1|  PREDICTED: 40S ribosomal protein S8 isoform X1     203   2e-62   Populus euphratica
ref|XP_008679876.1|  PREDICTED: 40S ribosomal protein S8 isoform X1     204   2e-62   Zea mays [maize]
ref|XP_008337490.1|  PREDICTED: 40S ribosomal protein S8                203   3e-62   Malus domestica [apple tree]
ref|XP_006437243.1|  hypothetical protein CICLE_v10032694mg             203   3e-62   Citrus clementina [clementine]
ref|XP_007134162.1|  hypothetical protein PHAVU_010G024600g             202   3e-62   Phaseolus vulgaris [French bean]
ref|XP_008679872.1|  PREDICTED: 40S ribosomal protein S8-like           205   3e-62   
ref|XP_010060252.1|  PREDICTED: 40S ribosomal protein S8                202   4e-62   Eucalyptus grandis [rose gum]
gb|KHG09566.1|  40S ribosomal protein S8                                201   4e-62   Gossypium arboreum [tree cotton]
gb|KJB13805.1|  hypothetical protein B456_002G095300                    202   5e-62   Gossypium raimondii
gb|KHF98591.1|  40S ribosomal S8                                        202   6e-62   Gossypium arboreum [tree cotton]
ref|NP_001132384.1|  uncharacterized protein LOC100193830               202   6e-62   Zea mays [maize]
gb|KJB22659.1|  hypothetical protein B456_004G059300                    202   7e-62   Gossypium raimondii
ref|XP_009778867.1|  PREDICTED: 40S ribosomal protein S8-like           202   7e-62   Nicotiana sylvestris
ref|XP_011095494.1|  PREDICTED: 40S ribosomal protein S8                201   8e-62   Sesamum indicum [beniseed]
ref|XP_008657369.1|  PREDICTED: uncharacterized protein LOC100193...    201   1e-61   Zea mays [maize]
gb|KDO36309.1|  hypothetical protein CISIN_1g045444mg                   200   2e-61   Citrus sinensis [apfelsine]
ref|XP_009619873.1|  PREDICTED: 40S ribosomal protein S8-like           201   2e-61   Nicotiana tomentosiformis
ref|XP_009770276.1|  PREDICTED: 40S ribosomal protein S8-like           200   3e-61   Nicotiana sylvestris
ref|XP_006484807.1|  PREDICTED: 40S ribosomal protein S8-like           200   4e-61   Citrus sinensis [apfelsine]
gb|ACJ86093.1|  unknown                                                 200   4e-61   Medicago truncatula
gb|AFK40150.1|  unknown                                                 200   4e-61   Lotus japonicus
ref|XP_002534344.1|  40S ribosomal protein S8, putative                 200   4e-61   Ricinus communis
ref|XP_004510234.1|  PREDICTED: 40S ribosomal protein S8-like           199   6e-61   Cicer arietinum [garbanzo]
ref|XP_004148331.1|  PREDICTED: 40S ribosomal protein S8-like           199   6e-61   Cucumis sativus [cucumbers]
ref|XP_011069406.1|  PREDICTED: 40S ribosomal protein S8                199   6e-61   Sesamum indicum [beniseed]
ref|XP_009371092.1|  PREDICTED: 40S ribosomal protein S8-like           199   7e-61   Pyrus x bretschneideri [bai li]
ref|XP_008778380.1|  PREDICTED: 40S ribosomal protein S8-like           199   9e-61   Phoenix dactylifera
ref|XP_011021176.1|  PREDICTED: 40S ribosomal protein S8 isoform X2     199   9e-61   Populus euphratica
ref|XP_009783183.1|  PREDICTED: 40S ribosomal protein S8                199   1e-60   Nicotiana sylvestris
ref|XP_006373482.1|  hypothetical protein POPTR_0017s14180g             199   1e-60   Populus trichocarpa [western balsam poplar]
ref|XP_009610547.1|  PREDICTED: 40S ribosomal protein S8                199   1e-60   Nicotiana tomentosiformis
gb|AFK47179.1|  unknown                                                 198   1e-60   Medicago truncatula
ref|XP_009403610.1|  PREDICTED: 40S ribosomal protein S8-like           198   1e-60   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY45095.1|  BnaA02g04810D                                          199   2e-60   Brassica napus [oilseed rape]
ref|NP_001240243.1|  uncharacterized protein LOC100813170               198   2e-60   Glycine max [soybeans]
ref|NP_001274851.1|  uncharacterized protein LOC102577693               197   3e-60   Solanum tuberosum [potatoes]
ref|XP_009406344.1|  PREDICTED: 40S ribosomal protein S8-like           197   3e-60   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAA07207.1|  ribosomal protein S8                                   197   4e-60   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009413565.1|  PREDICTED: 40S ribosomal protein S8-like           197   5e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008799563.1|  PREDICTED: 40S ribosomal protein S8-like           194   6e-60   
emb|CDY60374.1|  BnaCnng36150D                                          197   8e-60   Brassica napus [oilseed rape]
ref|XP_006601753.1|  PREDICTED: uncharacterized protein LOC100500...    196   1e-59   
ref|XP_002446216.1|  hypothetical protein SORBIDRAFT_06g004770          196   2e-59   Sorghum bicolor [broomcorn]
ref|XP_006400597.1|  hypothetical protein EUTSA_v10014589mg             196   2e-59   Eutrema salsugineum [saltwater cress]
ref|XP_009126438.1|  PREDICTED: 40S ribosomal protein S8-1-like         196   2e-59   Brassica rapa
gb|EYU33688.1|  hypothetical protein MIMGU_mgv1a013525mg                195   2e-59   Erythranthe guttata [common monkey flower]
ref|XP_006409551.1|  hypothetical protein EUTSA_v10022838mg             195   2e-59   Eutrema salsugineum [saltwater cress]
ref|XP_009131790.1|  PREDICTED: 40S ribosomal protein S8-1              196   2e-59   Brassica rapa
ref|XP_010905161.1|  PREDICTED: 40S ribosomal protein S8-like           195   3e-59   Elaeis guineensis
gb|KHG04827.1|  40S ribosomal S8                                        195   3e-59   Gossypium arboreum [tree cotton]
ref|XP_007049644.1|  40S ribosomal protein S8 isoform 1                 195   3e-59   Theobroma cacao [chocolate]
gb|KJB84080.1|  hypothetical protein B456_N005000                       195   3e-59   Gossypium raimondii
ref|XP_009765854.1|  PREDICTED: 40S ribosomal protein S8-like           195   3e-59   Nicotiana sylvestris
ref|XP_010252680.1|  PREDICTED: 40S ribosomal protein S8                195   4e-59   Nelumbo nucifera [Indian lotus]
ref|XP_011008256.1|  PREDICTED: 40S ribosomal protein S8-like           195   4e-59   Populus euphratica
ref|XP_006452497.1|  hypothetical protein CICLE_v10009415mg             195   4e-59   Citrus clementina [clementine]
ref|XP_006286561.1|  hypothetical protein CARUB_v10001914mg             195   4e-59   Capsella rubella
gb|EYU33690.1|  hypothetical protein MIMGU_mgv1a013952mg                194   5e-59   Erythranthe guttata [common monkey flower]
gb|KHG08050.1|  40S ribosomal S8                                        194   5e-59   Gossypium arboreum [tree cotton]
gb|AFW61714.1|  putative ribosomal protein S8e family protein           192   5e-59   
ref|XP_010646836.1|  PREDICTED: 40S ribosomal protein S8                194   5e-59   
ref|XP_002873989.1|  ribosomal protein S8                               194   6e-59   Arabidopsis lyrata subsp. lyrata
gb|KJB62959.1|  hypothetical protein B456_009G445800                    194   6e-59   Gossypium raimondii
ref|XP_002269042.2|  PREDICTED: 40S ribosomal protein S8                194   7e-59   Vitis vinifera
ref|XP_011025495.1|  PREDICTED: 40S ribosomal protein S8-like           194   7e-59   Populus euphratica
ref|NP_001236970.1|  uncharacterized protein LOC100500112               194   8e-59   
ref|XP_004242427.1|  PREDICTED: 40S ribosomal protein S8                194   9e-59   Solanum lycopersicum
gb|KJB81679.1|  hypothetical protein B456_013G156600                    193   1e-58   Gossypium raimondii
ref|XP_002299926.1|  40S ribosomal protein S8                           193   1e-58   Populus trichocarpa [western balsam poplar]
gb|AGV54796.1|  40S ribosomal protein S8                                193   2e-58   Phaseolus vulgaris [French bean]
gb|KJB81680.1|  hypothetical protein B456_013G156600                    191   2e-58   Gossypium raimondii
gb|EYU39185.1|  hypothetical protein MIMGU_mgv1a013531mg                192   2e-58   Erythranthe guttata [common monkey flower]
ref|XP_007020644.1|  40S ribosomal protein S8 isoform 1                 193   2e-58   
gb|ACJ83894.1|  unknown                                                 192   3e-58   Medicago truncatula
ref|XP_010926672.1|  PREDICTED: 40S ribosomal protein S8-like iso...    192   3e-58   
gb|KJB81683.1|  hypothetical protein B456_013G156600                    193   3e-58   Gossypium raimondii
ref|NP_200732.2|  40S ribosomal protein S8-2                            192   3e-58   Arabidopsis thaliana [mouse-ear cress]
gb|EAY93669.1|  hypothetical protein OsI_15456                          192   3e-58   Oryza sativa Indica Group [Indian rice]
ref|NP_001052526.1|  Os04g0349500                                       192   3e-58   
ref|NP_001046866.1|  Os02g0489400                                       192   3e-58   
gb|KCW58021.1|  hypothetical protein EUGRSUZ_H00750                     192   3e-58   Eucalyptus grandis [rose gum]
ref|XP_010069614.1|  PREDICTED: 40S ribosomal protein S8-like           192   3e-58   Eucalyptus grandis [rose gum]
ref|XP_010926670.1|  PREDICTED: 40S ribosomal protein S8-like iso...    192   4e-58   
gb|KHN25148.1|  40S ribosomal protein S8                                192   4e-58   Glycine soja [wild soybean]
ref|XP_010278451.1|  PREDICTED: 40S ribosomal protein S8-like           192   4e-58   Nelumbo nucifera [Indian lotus]
ref|XP_009594581.1|  PREDICTED: 40S ribosomal protein S8-2-like         192   4e-58   Nicotiana tomentosiformis
ref|XP_010907235.1|  PREDICTED: 40S ribosomal protein S8-like           192   4e-58   Elaeis guineensis
ref|XP_002313320.1|  40S ribosomal protein S8                           192   5e-58   Populus trichocarpa [western balsam poplar]
ref|XP_002452585.1|  hypothetical protein SORBIDRAFT_04g028530          192   5e-58   Sorghum bicolor [broomcorn]
ref|XP_003547779.1|  PREDICTED: 40S ribosomal protein S8                192   5e-58   Glycine max [soybeans]
gb|EYU39184.1|  hypothetical protein MIMGU_mgv1a013531mg                192   5e-58   Erythranthe guttata [common monkey flower]
ref|XP_010913108.1|  PREDICTED: 40S ribosomal protein S8 isoform X1     192   5e-58   Elaeis guineensis
ref|XP_010693327.1|  PREDICTED: 40S ribosomal protein S8-like           192   5e-58   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008809644.1|  PREDICTED: 40S ribosomal protein S8                192   5e-58   Phoenix dactylifera
ref|XP_004953910.1|  PREDICTED: 40S ribosomal protein S8-like           192   6e-58   Setaria italica
ref|XP_004975334.1|  PREDICTED: 40S ribosomal protein S8-like           192   6e-58   Setaria italica
ref|XP_002529032.1|  40S ribosomal protein S8, putative                 192   6e-58   Ricinus communis
gb|KFK26269.1|  hypothetical protein AALP_AA8G225000                    192   7e-58   Arabis alpina [alpine rockcress]
gb|ACN31997.1|  unknown                                                 191   7e-58   Zea mays [maize]
ref|XP_006346168.1|  PREDICTED: 40S ribosomal protein S8-like           191   7e-58   Solanum tuberosum [potatoes]
ref|XP_003520991.1|  PREDICTED: 40S ribosomal protein S8-like           191   8e-58   Glycine max [soybeans]
ref|XP_010541736.1|  PREDICTED: 40S ribosomal protein S8-1-like         191   9e-58   Tarenaya hassleriana [spider flower]
gb|KFK31870.1|  hypothetical protein AALP_AA6G169300                    191   9e-58   Arabis alpina [alpine rockcress]
gb|ACU16800.1|  unknown                                                 192   1e-57   Glycine max [soybeans]
ref|XP_008647178.1|  PREDICTED: 40S ribosomal protein S8-like           189   1e-57   
ref|XP_002275094.1|  PREDICTED: 40S ribosomal protein S8                191   1e-57   Vitis vinifera
ref|XP_010913109.1|  PREDICTED: 40S ribosomal protein S8 isoform X2     191   1e-57   Elaeis guineensis
ref|XP_010535902.1|  PREDICTED: 40S ribosomal protein S8-1-like         191   1e-57   Tarenaya hassleriana [spider flower]
ref|XP_010675861.1|  PREDICTED: 40S ribosomal protein S8                191   1e-57   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010483522.1|  PREDICTED: 40S ribosomal protein S8-2-like         191   1e-57   Camelina sativa [gold-of-pleasure]
ref|XP_006352667.1|  PREDICTED: 40S ribosomal protein S8-like           191   1e-57   Solanum tuberosum [potatoes]
ref|XP_009361080.1|  PREDICTED: 40S ribosomal protein S8-like           191   2e-57   Pyrus x bretschneideri [bai li]
ref|XP_008366424.1|  PREDICTED: 40S ribosomal protein S8                191   2e-57   Malus domestica [apple tree]
gb|KJB84081.1|  hypothetical protein B456_N005000                       192   2e-57   Gossypium raimondii
ref|XP_008451649.1|  PREDICTED: 40S ribosomal protein S8-like           190   2e-57   Cucumis melo [Oriental melon]
ref|XP_010454644.1|  PREDICTED: 40S ribosomal protein S8-2              190   2e-57   Camelina sativa [gold-of-pleasure]
ref|XP_003626942.1|  Ribosomal protein S8                               200   2e-57   
ref|XP_008466734.1|  PREDICTED: 40S ribosomal protein S8-2              190   3e-57   Cucumis melo [Oriental melon]
sp|O81361.1|RS8_PRUAR  RecName: Full=40S ribosomal protein S8           190   3e-57   Prunus armeniaca
ref|XP_008222788.1|  PREDICTED: 40S ribosomal protein S8                190   3e-57   Prunus mume [ume]
gb|ACU19111.1|  unknown                                                 190   3e-57   Glycine max [soybeans]
ref|XP_003551567.1|  PREDICTED: 40S ribosomal protein S8                190   4e-57   Glycine max [soybeans]
ref|XP_007223947.1|  hypothetical protein PRUPE_ppa011148mg             190   4e-57   Prunus persica
gb|EYU27406.1|  hypothetical protein MIMGU_mgv1a013520mg                189   4e-57   Erythranthe guttata [common monkey flower]
ref|XP_007211997.1|  hypothetical protein PRUPE_ppa011067mg             189   5e-57   
ref|XP_010270147.1|  PREDICTED: 40S ribosomal protein S8-like           189   5e-57   Nelumbo nucifera [Indian lotus]
ref|XP_008227073.1|  PREDICTED: 40S ribosomal protein S8-like           189   6e-57   Prunus mume [ume]
gb|KJB81681.1|  hypothetical protein B456_013G156600                    187   6e-57   Gossypium raimondii
ref|XP_002864608.1|  40S ribosomal protein S8                           189   6e-57   
ref|XP_004290159.1|  PREDICTED: 40S ribosomal protein S8-like           189   7e-57   Fragaria vesca subsp. vesca
ref|XP_004492266.1|  PREDICTED: 40S ribosomal protein S8-like           189   7e-57   Cicer arietinum [garbanzo]
ref|XP_008364326.1|  PREDICTED: 40S ribosomal protein S8-like           189   8e-57   
ref|XP_004240435.1|  PREDICTED: 40S ribosomal protein S8-2              189   9e-57   Solanum lycopersicum
ref|XP_010519957.1|  PREDICTED: 40S ribosomal protein S8-1              189   9e-57   Tarenaya hassleriana [spider flower]
ref|XP_007149668.1|  hypothetical protein PHAVU_005G089100g             189   9e-57   Phaseolus vulgaris [French bean]
emb|CDP03936.1|  unnamed protein product                                188   1e-56   Coffea canephora [robusta coffee]
emb|CAA03954.1|  ribosomal protein S8                                   185   1e-56   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB13806.1|  hypothetical protein B456_002G095300                    188   1e-56   Gossypium raimondii
gb|AFK37035.1|  unknown                                                 188   1e-56   Lotus japonicus
ref|XP_006856815.1|  hypothetical protein AMTR_s00055p00155570          188   1e-56   Amborella trichopoda
gb|ACU16398.1|  unknown                                                 189   1e-56   Glycine max [soybeans]
gb|AFW61715.1|  putative ribosomal protein S8e family protein           189   1e-56   
gb|KHG07290.1|  40S ribosomal S8                                        186   1e-56   Gossypium arboreum [tree cotton]
gb|AFK33351.1|  unknown                                                 188   1e-56   Lotus japonicus
ref|XP_010327196.1|  PREDICTED: 40S ribosomal protein S8                188   1e-56   Solanum lycopersicum
ref|XP_009405538.1|  PREDICTED: 40S ribosomal protein S8-like           188   1e-56   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACI15738.1|  putative 40S ribosomal protein S8-like protein          188   1e-56   Picrorhiza kurrooa
ref|XP_004160707.1|  PREDICTED: 40S ribosomal protein S8-like           188   2e-56   
ref|XP_004149800.1|  PREDICTED: 40S ribosomal protein S8-like           188   2e-56   Cucumis sativus [cucumbers]
emb|CDP15136.1|  unnamed protein product                                190   2e-56   Coffea canephora [robusta coffee]
ref|XP_006281069.1|  hypothetical protein CARUB_v10027092mg             188   2e-56   Capsella rubella
gb|KJB22660.1|  hypothetical protein B456_004G059300                    187   2e-56   Gossypium raimondii
gb|ABL85034.1|  ribosomal subunit 8E protein                            187   3e-56   Brachypodium sylvaticum
ref|XP_010235437.1|  PREDICTED: 40S ribosomal protein S8 isoform X2     187   3e-56   Brachypodium distachyon [annual false brome]
ref|XP_003574981.1|  PREDICTED: 40S ribosomal protein S8 isoform X1     187   4e-56   Brachypodium distachyon [annual false brome]
ref|XP_010243156.1|  PREDICTED: 40S ribosomal protein S8-like iso...    187   4e-56   Nelumbo nucifera [Indian lotus]
ref|XP_003557224.1|  PREDICTED: 40S ribosomal protein S8                187   4e-56   Brachypodium distachyon [annual false brome]
ref|XP_010243157.1|  PREDICTED: 40S ribosomal protein S8-like iso...    187   5e-56   Nelumbo nucifera [Indian lotus]
emb|CDY35814.1|  BnaC09g37460D                                          188   5e-56   Brassica napus [oilseed rape]
emb|CDX92472.1|  BnaA10g15110D                                          187   5e-56   
ref|XP_009771719.1|  PREDICTED: 40S ribosomal protein S8                186   7e-56   Nicotiana sylvestris
ref|XP_009120819.1|  PREDICTED: 40S ribosomal protein S8-1              186   9e-56   Brassica rapa
emb|CDX88842.1|  BnaA03g08070D                                          187   1e-55   
ref|XP_009596732.1|  PREDICTED: 40S ribosomal protein S8                186   1e-55   Nicotiana tomentosiformis
ref|XP_010493138.1|  PREDICTED: 40S ribosomal protein S8-1              186   1e-55   Camelina sativa [gold-of-pleasure]
ref|XP_004247043.1|  PREDICTED: 40S ribosomal protein S8                186   2e-55   Solanum lycopersicum
ref|XP_010420870.1|  PREDICTED: 40S ribosomal protein S8-1-like         185   2e-55   Camelina sativa [gold-of-pleasure]
gb|EMT18438.1|  40S ribosomal protein S8                                186   2e-55   
ref|XP_006344091.1|  PREDICTED: 40S ribosomal protein S8-like           185   2e-55   Solanum tuberosum [potatoes]
ref|XP_011461093.1|  PREDICTED: 40S ribosomal protein S8                185   2e-55   Fragaria vesca subsp. vesca
ref|XP_009602561.1|  PREDICTED: 40S ribosomal protein S8-like           185   3e-55   Nicotiana tomentosiformis
ref|XP_006352532.1|  PREDICTED: 40S ribosomal protein S8                185   3e-55   
ref|NP_001275100.1|  putative 40S ribosomal protein S8-like protein     184   4e-55   Solanum tuberosum [potatoes]
gb|AFW73090.1|  putative ribosomal protein S8e family protein           190   4e-55   
dbj|BAJ89904.1|  predicted protein                                      184   7e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010520566.1|  PREDICTED: 40S ribosomal protein S8-1-like         183   1e-54   Tarenaya hassleriana [spider flower]
gb|ABK21933.1|  unknown                                                 183   2e-54   Picea sitchensis
gb|ABK22298.1|  unknown                                                 183   2e-54   Picea sitchensis
gb|ABK21921.1|  unknown                                                 183   2e-54   Picea sitchensis
ref|XP_010097296.1|  40S ribosomal protein S8                           181   5e-54   
ref|NP_197529.1|  40S ribosomal protein S8-1                            182   5e-54   Arabidopsis thaliana [mouse-ear cress]
gb|EMS65111.1|  40S ribosomal protein S8                                183   8e-54   Triticum urartu
gb|ABR16896.1|  unknown                                                 181   9e-54   Picea sitchensis
ref|XP_007049645.1|  40S ribosomal protein S8 isoform 3                 180   1e-53   
gb|KJB62960.1|  hypothetical protein B456_009G445800                    181   1e-53   Gossypium raimondii
gb|EPS68663.1|  hypothetical protein M569_06106                         181   1e-53   Genlisea aurea
emb|CBI39377.3|  unnamed protein product                                181   1e-53   Vitis vinifera
ref|XP_004244061.1|  PREDICTED: 40S ribosomal protein S8-like           181   1e-53   Solanum lycopersicum
gb|KJB81682.1|  hypothetical protein B456_013G156600                    180   1e-53   Gossypium raimondii
ref|XP_006369983.1|  hypothetical protein POPTR_0001s37140g             179   2e-53   
ref|XP_008660669.1|  PREDICTED: 40S ribosomal protein S8-like           177   3e-53   
gb|AET01418.2|  40S ribosomal protein S8                                182   3e-53   Medicago truncatula
gb|KHG14255.1|  40S ribosomal S8                                        178   6e-53   Gossypium arboreum [tree cotton]
gb|AFW85401.1|  putative ribosomal protein S8e family protein           177   9e-53   
ref|XP_006652189.1|  PREDICTED: 40S ribosomal protein S8-like           178   9e-53   
gb|EPS68749.1|  hypothetical protein M569_06019                         183   1e-52   Genlisea aurea
ref|XP_006648644.1|  PREDICTED: 40S ribosomal protein S8-like           177   1e-52   
emb|CBI26725.3|  unnamed protein product                                177   2e-52   Vitis vinifera
tpg|DAA42540.1|  TPA: putative ribosomal protein S8e family protein     178   2e-52   
gb|AAT08014.1|  putative 40S ribosomal protein S8                       178   3e-52   Zea mays [maize]
ref|XP_008676011.1|  PREDICTED: 40S ribosomal protein S8-like           179   1e-51   
ref|XP_011089042.1|  PREDICTED: 40S ribosomal protein S8-like           175   2e-51   Sesamum indicum [beniseed]
gb|AFW85400.1|  putative ribosomal protein S8e family protein           180   2e-51   
gb|AES86897.2|  40S ribosomal S8-like protein                           174   6e-51   Medicago truncatula
ref|XP_003604700.1|  Ribosomal protein S8                               174   3e-50   
ref|XP_001761026.1|  predicted protein                                  171   1e-49   
ref|XP_001773385.1|  predicted protein                                  169   3e-49   
ref|XP_004513783.1|  PREDICTED: 40S ribosomal protein S8-like           166   4e-49   Cicer arietinum [garbanzo]
gb|ABR13294.1|  putative 40S ribosomal protein S8                       166   6e-49   Prunus dulcis [sweet almond]
ref|XP_001777587.1|  predicted protein                                  169   6e-49   
ref|XP_005648786.1|  40S ribosomal protein S8                           168   7e-49   Coccomyxa subellipsoidea C-169
ref|XP_005844426.1|  hypothetical protein CHLNCDRAFT_139122             169   7e-49   Chlorella variabilis
ref|XP_001780988.1|  predicted protein                                  168   7e-49   
ref|XP_001777813.1|  predicted protein                                  168   1e-48   
emb|CEG02139.1|  Ribosomal protein S8e/ribosomal biogenesis NSA2        166   4e-48   Ostreococcus tauri
ref|XP_011397165.1|  40S ribosomal protein S8                           165   7e-48   Auxenochlorella protothecoides
ref|XP_001696201.1|  ribosomal protein S8, component of cytosolic...    166   8e-48   Chlamydomonas reinhardtii
gb|ABA01100.1|  40S ribosomal protein S8                                164   2e-47   Chlamydomonas incerta
gb|KDD75705.1|  ribosomal protein S8e                                   167   7e-47   Helicosporidium sp. ATCC 50920
ref|XP_002945874.1|  component of cytosolic 80S ribosome and 40S ...    162   9e-47   Volvox carteri f. nagariensis
ref|XP_001422585.1|  Ribosomal protein S8, component of cytosolic...    163   9e-47   Ostreococcus lucimarinus CCE9901
ref|XP_002963298.1|  hypothetical protein SELMODRAFT_80565              162   1e-46   
gb|EPZ31448.1|  40S ribosomal protein S8-B                              161   4e-46   Rozella allomycis CSF55
emb|CCA22399.1|  40S ribosomal protein S82 putative                     159   3e-45   Albugo laibachii Nc14
gb|AFW62789.1|  putative ribosomal protein S8e family protein           159   7e-45   
ref|XP_004516802.1|  PREDICTED: 40S ribosomal protein S8-like           160   7e-45   
ref|XP_010539242.1|  PREDICTED: 40S ribosomal protein S8-1-like         156   2e-44   Tarenaya hassleriana [spider flower]
ref|XP_005702569.1|  40S ribosomal protein S8e                          156   4e-44   Galdieria sulphuraria
ref|XP_008676181.1|  PREDICTED: thioredoxin domain-containing pro...    157   5e-44   
ref|XP_005708143.1|  40S ribosomal protein S8                           154   7e-44   Galdieria sulphuraria
ref|XP_004367925.1|  ribosomal protein S8e, putative                    155   3e-43   Acanthamoeba castellanii str. Neff
emb|CCI48864.1|  unnamed protein product                                154   3e-43   Albugo candida
gb|AGH70192.1|  40S ribosomal protein S8                                152   7e-43   Placozoa sp. H4
ref|XP_003083062.1|  RS8_MAIZE 40S ribosomal protein S8 pir||T040...    156   2e-42   
gb|KGG52480.1|  40S ribosomal protein S8                                151   2e-42   Mitosporidium daphniae
ref|XP_001622696.1|  hypothetical protein NEMVEDRAFT_v1g195152          151   3e-42   Nematostella vectensis
ref|XP_003059699.1|  predicted protein                                  150   5e-42   Micromonas pusilla CCMP1545
ref|XP_005539190.1|  40S ribosomal protein S8                           150   5e-42   Cyanidioschyzon merolae strain 10D
gb|ABR25841.1|  40S ribosomal protein S8                                149   6e-42   Oryza sativa Indica Group [Indian rice]
ref|XP_001487630.1|  hypothetical protein PGUG_01007                    149   9e-42   Meyerozyma guilliermondii ATCC 6260
gb|AGE46026.1|  40S ribosomal protein S8                                148   1e-41   Elaeis guineensis
ref|XP_002142692.1|  40S ribosomal protein S8                           149   1e-41   Cryptosporidium muris RN66
gb|KIW06343.1|  40S ribosomal protein S8-A                              149   1e-41   Verruconis gallopava
gb|ETL40555.1|  40S ribosomal protein S8                                149   1e-41   Phytophthora parasitica
ref|XP_001745896.1|  hypothetical protein                               149   3e-41   Monosiga brevicollis MX1
ref|XP_002602335.1|  hypothetical protein BRAFLDRAFT_268377             148   3e-41   Branchiostoma floridae
gb|KFH71035.1|  40S ribosomal protein S8                                148   3e-41   Mortierella verticillata NRRL 6337
gb|ETP45024.1|  40S ribosomal protein S8                                147   5e-41   Phytophthora parasitica P10297
ref|XP_002505425.1|  predicted protein                                  148   5e-41   Micromonas commoda
ref|XP_008905363.1|  40S ribosomal protein S8                           147   6e-41   Phytophthora parasitica INRA-310
emb|CEP60259.1|  LALA0S01e06612g1_1                                     147   7e-41   Lachancea lanzarotensis
tpg|DAA53686.1|  TPA: putative ribosomal protein S8e family protein     150   7e-41   
ref|XP_668115.1|  ribosomal protein S8                                  147   7e-41   Cryptosporidium hominis TU502
ref|XP_009831251.1|  40S ribosomal protein S8                           147   1e-40   Aphanomyces astaci
ref|XP_009524162.1|  hypothetical protein PHYSODRAFT_285611             147   1e-40   Phytophthora sojae
ref|XP_007873882.1|  30S ribosomal protein S8e                          146   2e-40   
gb|EMG50668.1|  Ribosomal protein S8                                    146   2e-40   Candida maltosa Xu316
gb|KDO22073.1|  40S ribosomal protein S8                                146   2e-40   Saprolegnia parasitica CBS 223.65
gb|EYE94457.1|  40S ribosomal protein S8e                               145   3e-40   Aspergillus ruber CBS 135680
gb|AAN05595.1|  ribosomal protein S8                                    146   3e-40   Argopecten irradians
ref|XP_002787865.1|  40S ribosomal protein S8, putative                 145   3e-40   Perkinsus marinus ATCC 50983
emb|CBJ28525.1|  conserved unknown protein                              145   3e-40   Ectocarpus siliculosus
ref|XP_627792.1|  40S ribosomal protein S8                              145   3e-40   Cryptosporidium parvum Iowa II
emb|CAD91426.1|  ribosomal protein S8                                   146   3e-40   
ref|XP_005783873.1|  hypothetical protein EMIHUDRAFT_442198             145   3e-40   
ref|XP_011444203.1|  PREDICTED: 40S ribosomal protein S8-like           145   4e-40   
ref|XP_008608971.1|  40S ribosomal protein S8                           145   4e-40   
ref|XP_003291144.1|  40S ribosomal protein S8                           145   4e-40   
ref|XP_005781609.1|  hypothetical protein EMIHUDRAFT_415402             145   4e-40   
gb|KEY66979.1|  hypothetical protein S7711_05099                        145   4e-40   
ref|XP_008871313.1|  40S ribosomal protein S8                           145   5e-40   
gb|EXX59187.1|  ribosomal 40S subunit protein S8B                       143   5e-40   
ref|XP_008021780.1|  hypothetical protein SETTUDRAFT_166951             145   5e-40   
gb|EXX59184.1|  ribosomal 40S subunit protein S8B                       143   5e-40   
ref|NP_001187073.1|  40S ribosomal protein S8                           145   6e-40   
ref|XP_002771622.1|  40S ribosomal protein S8, putative                 145   6e-40   
emb|CEG65019.1|  Putative 40S ribosomal protein S8                      145   6e-40   
ref|XP_007690253.1|  hypothetical protein COCMIDRAFT_28285              144   8e-40   
ref|XP_007694147.1|  hypothetical protein COCSADRAFT_31906              144   8e-40   
ref|XP_007397269.1|  hypothetical protein PHACADRAFT_258531             145   9e-40   
ref|XP_001805801.1|  hypothetical protein SNOG_15657                    144   9e-40   
ref|NP_001128155.1|  40S ribosomal protein S8                           144   1e-39   
gb|KIK09143.1|  hypothetical protein K443DRAFT_447984                   144   1e-39   
ref|XP_002117056.1|  expressed hypothetical protein                     144   1e-39   
ref|XP_005717008.1|  40S ribosomal protein S8                           144   1e-39   
gb|EXX59185.1|  ribosomal 40S subunit protein S8B                       142   1e-39   
gb|AFR96425.1|  small subunit ribosomal protein S8e                     144   1e-39   
gb|AAX62461.1|  ribosomal protein S8                                    144   1e-39   
ref|XP_006691073.1|  ribosomal protein S8-like protein                  144   1e-39   
gb|EFX81462.1|  hypothetical protein DAPPUDRAFT_303431                  144   1e-39   
ref|XP_001936528.1|  40S ribosomal protein S8                           144   1e-39   
gb|ABZ04260.1|  ribosomal protein rps8                                  144   1e-39   
gb|EXX59183.1|  ribosomal 40S subunit protein S8B                       144   1e-39   
ref|XP_002552513.1|  40S ribosomal protein S8                           144   2e-39   
gb|KFA47399.1|  hypothetical protein S40293_05376                       144   2e-39   
ref|XP_009039782.1|  hypothetical protein AURANDRAFT_30589              144   2e-39   
ref|XP_009227358.1|  40S ribosomal protein S8                           144   2e-39   
ref|XP_005815191.1|  PREDICTED: 40S ribosomal protein S8-like iso...    144   2e-39   
emb|CEG73596.1|  Putative 40S ribosomal protein S8                      144   2e-39   
dbj|BAM17705.1|  ribosomal protein S8                                   144   2e-39   
emb|CEG71688.1|  Putative 40S ribosomal protein S8                      144   2e-39   
tpg|DAA53687.1|  TPA: putative ribosomal protein S8e family protein     150   2e-39   
gb|ADO27837.1|  40S ribosomal protein s8                                144   2e-39   
gb|EHJ65952.1|  40S ribosomal protein S8                                146   2e-39   
ref|XP_007374865.1|  hypothetical protein SPAPADRAFT_60688              143   2e-39   
ref|XP_001384365.1|  40S ribosomal protein S8                           143   3e-39   
gb|AAX48884.1|  S8                                                      143   3e-39   
gb|EHK46355.1|  hypothetical protein TRIATDRAFT_299044                  143   3e-39   
ref|XP_003836452.1|  similar to 40S ribosomal protein S8                143   3e-39   
gb|KEZ46043.1|  40S ribosomal protein S8-B                              143   3e-39   
ref|XP_003054439.1|  40S ribosomal protein S8                           143   3e-39   
ref|XP_572078.1|  40S ribosomal protein S8                              143   3e-39   
gb|KFA61130.1|  hypothetical protein S40285_02177                       143   3e-39   
emb|CCQ18591.1|  40S ribosomal protein S8                               143   3e-39   
ref|XP_007266897.1|  40S ribosomal protein S8                           143   3e-39   
ref|XP_003975488.1|  PREDICTED: 40S ribosomal protein S8-like           143   3e-39   
ref|XP_004197370.1|  Piso0_004620                                       143   3e-39   
dbj|BAM18930.1|  ribosomal protein S8                                   143   4e-39   
gb|EJU03954.1|  40S ribosomal protein S8                                143   4e-39   
gb|EPS27920.1|  hypothetical protein PDE_02864                          142   4e-39   
ref|NP_987041.1|  40S ribosomal protein S8                              142   4e-39   
ref|XP_009257798.1|  hypothetical protein FPSE_06405                    143   4e-39   
ref|XP_003716723.1|  40S ribosomal protein S8                           142   5e-39   
ref|NP_001037263.1|  ribosomal protein S8                               142   5e-39   
gb|KIJ26939.1|  hypothetical protein M422DRAFT_76964                    143   5e-39   
ref|XP_008290025.1|  PREDICTED: 40S ribosomal protein S8                142   5e-39   
ref|XP_007567486.1|  PREDICTED: 40S ribosomal protein S8                142   5e-39   
ref|XP_004995866.1|  40S ribosomal protein S8                           142   6e-39   
gb|EMT61450.1|  40S ribosomal protein S8-B                              142   6e-39   
emb|CAH57693.1|  40S ribosomal protein S8                               142   6e-39   
gb|KIY49072.1|  hypothetical protein FISHEDRAFT_65531                   144   6e-39   
ref|XP_001376099.1|  PREDICTED: 40S ribosomal protein S8                142   6e-39   
gb|KGB76549.1|  40S ribosomal protein S8                                142   7e-39   
gb|ABJ98605.1|  40S ribosomal protein S8                                141   7e-39   
gb|ACY95327.1|  ribosomal protein S8                                    142   7e-39   
ref|XP_002547240.1|  40S ribosomal protein S8                           142   7e-39   
ref|XP_001269730.1|  40S ribosomal protein S8                           142   7e-39   
gb|ACD65100.1|  putative 40S ribosomal protein RPS8                     141   7e-39   
ref|XP_004343838.1|  40S ribosomal protein S8                           142   7e-39   
ref|XP_003029339.1|  40S ribosomal protein S8                           142   8e-39   
ref|XP_008432867.1|  PREDICTED: 40S ribosomal protein S8                142   8e-39   
ref|XP_011123171.1|  hypothetical protein AOL_s00081g50                 142   8e-39   
ref|XP_010714500.1|  PREDICTED: 40S ribosomal protein S8                144   8e-39   
gb|KDR75758.1|  hypothetical protein GALMADRAFT_226405                  142   9e-39   
ref|XP_009026500.1|  hypothetical protein HELRODRAFT_193555             142   9e-39   
dbj|GAD92768.1|  hypothetical protein AN0465.2                          142   9e-39   
ref|XP_004078646.1|  PREDICTED: 40S ribosomal protein S8                142   1e-38   
ref|XP_003195106.1|  40S ribosomal protein S8                           142   1e-38   
ref|NP_001239055.1|  40S ribosomal protein S8                           142   1e-38   
gb|KIR49123.1|  ribosomal protein S8.e                                  142   1e-38   
sp|Q9ZT56.1|RS8_GRIJA  RecName: Full=40S ribosomal protein S8           142   1e-38   
gb|AGO10734.1|  AaceriAGR375Wp                                          141   1e-38   
ref|XP_010746502.1|  PREDICTED: 40S ribosomal protein S8                141   1e-38   
gb|ABY87394.1|  ribosomal protein S8                                    141   1e-38   
ref|XP_005303088.1|  PREDICTED: 40S ribosomal protein S8                141   1e-38   
ref|XP_003699508.1|  PREDICTED: 40S ribosomal protein S8-like           141   1e-38   
gb|ACH44382.1|  putative 40S ribosomal protein S8                       141   2e-38   
ref|XP_003707560.1|  PREDICTED: 40S ribosomal protein S8-like           141   2e-38   
ref|XP_007001047.1|  hypothetical protein TREMEDRAFT_55820              141   2e-38   
ref|XP_006273333.1|  PREDICTED: 40S ribosomal protein S8                141   2e-38   
ref|XP_001212958.1|  40S ribosomal protein S8                           141   2e-38   
ref|NP_001232282.1|  putative 40S ribosomal protein S8                  141   2e-38   
ref|XP_003397407.1|  PREDICTED: 40S ribosomal protein S8-like           141   2e-38   
ref|XP_008107755.1|  PREDICTED: 40S ribosomal protein S8                141   2e-38   
gb|AFM88001.1|  40S ribosomal protein S8                                141   2e-38   
gb|ACH44381.1|  putative 40S ribosomal protein S8                       141   2e-38   
gb|EKD00868.1|  40S ribosomal protein S8                                141   2e-38   
emb|CEJ01458.1|  Putative 40S ribosomal protein S8                      142   2e-38   
dbj|BAF45896.1|  ribosomal protein S8                                   141   2e-38   
ref|XP_006963273.1|  hypothetical protein TRIREDRAFT_120779             141   2e-38   
gb|ELU12655.1|  hypothetical protein CAPTEDRAFT_218947                  141   2e-38   
ref|XP_006114784.1|  PREDICTED: 40S ribosomal protein S8                141   2e-38   
gb|AEL28852.1|  ribosomal protein S8                                    141   2e-38   
gb|EHK16758.1|  hypothetical protein TRIVIDRAFT_217060                  141   2e-38   
sp|Q8WQI5.1|RS8_SPOFR  RecName: Full=40S ribosomal protein S8           141   2e-38   
gb|KDQ27658.1|  hypothetical protein PLEOSDRAFT_1089421                 141   2e-38   
ref|XP_001645909.1|  hypothetical protein Kpol_1045p37                  141   2e-38   
gb|ABX44780.1|  putative 40S ribosomal protein RPS8                     141   2e-38   
ref|XP_001880116.1|  40S ribosomal protein S8                           141   2e-38   
ref|XP_008333134.1|  PREDICTED: 40S ribosomal protein S8                141   2e-38   
ref|XP_001265233.1|  40S ribosomal protein S8                           140   2e-38   
ref|XP_011271561.1|  40S ribosomal protein                              140   3e-38   
ref|XP_750180.1|  40S ribosomal protein S8e                             140   3e-38   
ref|XP_658069.1|  hypothetical protein AN0465.2                         140   3e-38   
ref|XP_003319908.2|  40S ribosomal protein S8                           141   3e-38   
ref|XP_002129681.1|  PREDICTED: 40S ribosomal protein S8                140   3e-38   
ref|XP_005103315.1|  PREDICTED: 40S ribosomal protein S8-like           140   3e-38   
ref|XP_003448492.1|  PREDICTED: 40S ribosomal protein S8-like           140   3e-38   
dbj|BAN20524.1|  ribosomal protein S8                                   140   3e-38   
ref|XP_007783051.1|  40S ribosomal protein S8                           140   3e-38   
ref|XP_006561561.1|  PREDICTED: 40S ribosomal protein S8 isoform X1     140   3e-38   
ref|XP_003690352.1|  PREDICTED: 40S ribosomal protein S8-like           140   3e-38   
ref|XP_002293544.1|  RS8, ribosomal protein 8                           140   3e-38   
emb|CEP18703.1|  hypothetical protein                                   140   3e-38   
ref|NP_001011604.2|  40S ribosomal protein S8                           140   3e-38   
ref|XP_006634805.1|  PREDICTED: 40S ribosomal protein S8-like           141   4e-38   
gb|AJG43845.1|  ribosomal protein rps8                                  140   4e-38   
gb|ESW98222.1|  40S ribosomal protein S8-A                              140   4e-38   
dbj|BAD26659.1|  Ribosomal protein S8                                   140   4e-38   
emb|CCK68675.1|  hypothetical protein KNAG_0B02330                      140   4e-38   
ref|XP_011141954.1|  PREDICTED: 40S ribosomal protein S8                140   4e-38   
ref|XP_007361817.1|  ribosomal protein S8e                              140   4e-38   
gb|EKC20023.1|  40S ribosomal protein S8                                141   4e-38   
ref|XP_629872.1|  40S ribosomal protein S8                              140   4e-38   
gb|EMC77472.1|  40S ribosomal protein S8                                138   4e-38   
gb|AFM90620.1|  40S ribosomal protein S8                                140   4e-38   
dbj|GAM17360.1|  hypothetical protein SAMD00019534_005350               140   5e-38   
ref|XP_003234179.1|  40S ribosomal protein S8                           140   5e-38   
gb|AFM90919.1|  40S ribosomal protein S8                                140   5e-38   
ref|XP_002561215.1|  Pc16g08960                                         140   5e-38   
ref|XP_002908634.1|  40S ribosomal protein S8-2                         140   5e-38   
gb|KIL83870.1|  40s ribosomal protein s8                                140   5e-38   
gb|EJT41679.1|  hypothetical protein SKUD_188904                        140   5e-38   
gb|EHN03767.1|  Rps8bp                                                  140   5e-38   
gb|AFM85641.1|  40S ribosomal protein S8                                140   5e-38   
gb|KGO67126.1|  Ribosomal protein S8e                                   140   5e-38   
ref|XP_003386813.1|  PREDICTED: 40S ribosomal protein S8-like           140   5e-38   
gb|KIL68834.1|  hypothetical protein M378DRAFT_157968                   140   5e-38   
ref|XP_458360.1|  40S ribosomal protein S8                              140   5e-38   
ref|XP_001388750.1|  40S ribosomal protein S8                           140   5e-38   
gb|KIW58114.1|  40S ribosomal protein S8-B                              140   5e-38   
gb|AFM90684.1|  40S ribosomal protein S8                                140   6e-38   
ref|NP_001279579.1|  ribosomal protein S8                               140   6e-38   
gb|ACQ57870.1|  40S ribosomal protein S8                                140   6e-38   
gb|AFM89547.1|  40S ribosomal protein S8                                140   6e-38   
emb|CDM26487.1|  40S ribosomal protein S8-B                             140   6e-38   
ref|XP_006675830.1|  hypothetical protein BATDEDRAFT_36328              140   6e-38   
ref|XP_002583604.1|  40S ribosomal protein S8-A                         140   6e-38   
ref|XP_009637143.1|  PREDICTED: 40S ribosomal protein S8                140   6e-38   
emb|CEI89824.1|  Putative 40S ribosomal protein S8                      140   7e-38   
ref|XP_006006303.1|  PREDICTED: 40S ribosomal protein S8                140   7e-38   
ref|XP_001820035.1|  40S ribosomal protein S8                           139   7e-38   
dbj|GAM84432.1|  hypothetical protein ANO11243_024280                   139   7e-38   
ref|XP_011258954.1|  PREDICTED: 40S ribosomal protein S8                140   7e-38   
ref|NP_593100.1|  40S ribosomal protein S8                              139   7e-38   
ref|XP_011338463.1|  PREDICTED: 40S ribosomal protein S8                140   7e-38   
gb|EIE77931.1|  40S ribosomal protein S8                                139   7e-38   
ref|XP_444964.1|  40S ribosomal protein S8                              139   7e-38   
ref|XP_005924603.1|  PREDICTED: 40S ribosomal protein S8-like           140   7e-38   
gb|KIK27780.1|  hypothetical protein PISMIDRAFT_169173                  140   7e-38   
gb|ADX97198.1|  40S ribosomal protein s8                                139   7e-38   
gb|ADT80672.1|  ribosomal protein S8                                    139   8e-38   
ref|XP_005729057.1|  PREDICTED: 40S ribosomal protein S8-like           139   8e-38   
gb|AAV84252.1|  ribosomal protein S8                                    140   8e-38   
ref|XP_003959673.1|  hypothetical protein KAFR_0K01840                  139   8e-38   
dbj|BAE27059.1|  unnamed protein product                                137   8e-38   
dbj|BAC56421.1|  similar to ribosomal protein S8                        137   8e-38   
gb|EHH27002.1|  hypothetical protein EGK_17096                          137   8e-38   
ref|XP_009991314.1|  PREDICTED: 40S ribosomal protein S8                140   9e-38   
dbj|BAB26839.1|  unnamed protein product                                137   9e-38   
emb|CCE30096.1|  probable ribosomal protein Rps8bp                      139   9e-38   
ref|XP_010132709.1|  PREDICTED: 40S ribosomal protein S8                140   9e-38   
ref|XP_007725772.1|  40S ribosomal protein S8                           139   9e-38   
emb|CCK69459.1|  hypothetical protein KNAG_0C03550                      139   9e-38   
ref|XP_010152828.1|  PREDICTED: 40S ribosomal protein S8                140   9e-38   
ref|XP_009863870.1|  PREDICTED: 40S ribosomal protein S8                140   9e-38   
ref|XP_009571612.1|  PREDICTED: 40S ribosomal protein S8                140   1e-37   
gb|KIK67276.1|  hypothetical protein GYMLUDRAFT_861869                  139   1e-37   
ref|XP_011102403.1|  rps8ap                                             139   1e-37   
ref|XP_009970295.1|  PREDICTED: 40S ribosomal protein S8                140   1e-37   
gb|KHN95841.1|  40S ribosomal protein S8                                139   1e-37   
ref|XP_003646518.1|  hypothetical protein Ecym_4680                     139   1e-37   
gb|ABV60330.1|  40S ribosomal protein S8-like protein                   139   1e-37   
gb|KFO20861.1|  40S ribosomal protein S8                                140   1e-37   
gb|EOA94872.1|  40S ribosomal protein S8                                139   1e-37   
ref|XP_003857049.1|  40S ribosomal protein S8                           139   1e-37   
ref|XP_003012389.1|  hypothetical protein ARB_01348                     139   1e-37   
gb|KIM64970.1|  hypothetical protein SCLCIDRAFT_1212646                 139   1e-37   
gb|KDR14766.1|  40S ribosomal protein S8                                139   1e-37   
ref|XP_011167792.1|  PREDICTED: 40S ribosomal protein S8                139   1e-37   
gb|EFX06643.1|  40S ribosomal protein s8e                               139   1e-37   
ref|XP_008365334.1|  PREDICTED: 40S ribosomal protein S8-like           138   1e-37   
ref|XP_009943981.1|  PREDICTED: 40S ribosomal protein S8                139   1e-37   
dbj|GAN00733.1|  40S ribosomal protein S8                               139   1e-37   
gb|KHJ83273.1|  ribosomal protein S8.e                                  139   1e-37   
ref|XP_008550312.1|  PREDICTED: 40S ribosomal protein S8                139   1e-37   
ref|XP_010206685.1|  PREDICTED: 40S ribosomal protein S8                139   1e-37   
ref|XP_010292800.1|  PREDICTED: 40S ribosomal protein S8                139   1e-37   
ref|XP_010021976.1|  PREDICTED: 40S ribosomal protein S8                139   1e-37   
ref|XP_010126964.1|  PREDICTED: 40S ribosomal protein S8                139   1e-37   
gb|ABV44734.1|  40S ribosomal protein S8-like protein                   139   1e-37   
ref|XP_005815192.1|  PREDICTED: 40S ribosomal protein S8-like iso...    139   1e-37   
dbj|BAE30490.1|  unnamed protein product                                137   1e-37   
ref|XP_011107810.1|  hypothetical protein H072_1819                     139   1e-37   



>ref|XP_008792950.1| PREDICTED: 40S ribosomal protein S8 [Phoenix dactylifera]
Length=222

 Score =   207 bits (528),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWY+QHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYIQHYGV  120

Query  443  DIGRKKKSAAAKKETNE  493
            +IGRKKK+ AAKKE  E
Sbjct  121  EIGRKKKTPAAKKEATE  137



>gb|AFW66128.1| putative ribosomal protein S8e family protein [Zea mays]
 gb|AFW66141.1| putative ribosomal protein S8e family protein [Zea mays]
Length=153

 Score =   204 bits (520),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  443  DIGRKKKSAAAKKETNE  493
            DIGRKKK+ AAKK+  E
Sbjct  121  DIGRKKKTPAAKKDNAE  137



>ref|XP_009378162.1| PREDICTED: 40S ribosomal protein S8-like [Pyrus x bretschneideri]
Length=221

 Score =   206 bits (524),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 134/135 (99%), Gaps = 0/135 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGRKKKSAAAKKET  487
            +IGRKKKS AAKK+T
Sbjct  121  EIGRKKKSGAAKKDT  135



>ref|XP_009373606.1| PREDICTED: 40S ribosomal protein S8 [Pyrus x bretschneideri]
Length=221

 Score =   206 bits (523),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 134/135 (99%), Gaps = 0/135 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGRKKKSAAAKKET  487
            +IGRKKKSA AKK+T
Sbjct  121  EIGRKKKSAVAKKDT  135



>ref|NP_001105391.1| 40S ribosomal protein S8 [Zea mays]
 ref|XP_008679873.1| PREDICTED: 40S ribosomal protein S8 [Zea mays]
 ref|XP_008679875.1| PREDICTED: 40S ribosomal protein S8 [Zea mays]
 ref|XP_008679877.1| PREDICTED: 40S ribosomal protein S8 isoform X2 [Zea mays]
 sp|Q08069.2|RS8_MAIZE RecName: Full=40S ribosomal protein S8 [Zea mays]
 gb|AAB06330.1| ribosomal protein S8 [Zea mays]
 gb|ACF80433.1| unknown [Zea mays]
 gb|ACG24637.1| 40S ribosomal protein S8 [Zea mays]
 gb|AFW66125.1| putative ribosomal protein S8e family protein [Zea mays]
 gb|AFW66129.1| putative ribosomal protein S8e family protein [Zea mays]
 gb|AFW66130.1| putative ribosomal protein S8e family protein [Zea mays]
 gb|AFW66138.1| putative ribosomal protein S8e family protein [Zea mays]
 gb|AFW66142.1| putative ribosomal protein S8e family protein [Zea mays]
Length=221

 Score =   205 bits (522),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  443  DIGRKKKSAAAKKETNE  493
            DIGRKKK+ AAKK+  E
Sbjct  121  DIGRKKKTPAAKKDNAE  137



>gb|KDP45274.1| hypothetical protein JCGZ_15139 [Jatropha curcas]
Length=221

 Score =   205 bits (522),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGRKKKSAAAKKETNE  493
            DIGRKKK+ A K+ T E
Sbjct  121  DIGRKKKTVAKKETTEE  137



>ref|XP_006833291.1| hypothetical protein AMTR_s00109p00031400 [Amborella trichopoda]
 gb|ERM98569.1| hypothetical protein AMTR_s00109p00031400 [Amborella trichopoda]
Length=218

 Score =   205 bits (521),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 129/133 (97%), Positives = 132/133 (99%), Gaps = 0/133 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPF+QWYLQHYG+
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFRQWYLQHYGI  120

Query  443  DIGRKKKSAAAKK  481
            DIGRKKK+ AAKK
Sbjct  121  DIGRKKKTGAAKK  133



>gb|KDP39216.1| hypothetical protein JCGZ_00973 [Jatropha curcas]
Length=219

 Score =   205 bits (521),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 130/133 (98%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGRKKKSAAAKK  481
            DIGRKKK AA KK
Sbjct  121  DIGRKKKVAATKK  133



>ref|XP_009349000.1| PREDICTED: 40S ribosomal protein S8-like [Pyrus x bretschneideri]
Length=221

 Score =   204 bits (519),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 128/134 (96%), Positives = 133/134 (99%), Gaps = 0/134 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGRKKKSAAAKKE  484
            +IGRKKKS AAKK+
Sbjct  121  EIGRKKKSGAAKKD  134



>gb|KJB22170.1| hypothetical protein B456_004G033000 [Gossypium raimondii]
Length=216

 Score =   204 bits (519),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 129/132 (98%), Positives = 131/132 (99%), Gaps = 0/132 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGRKKKSAAAK  478
            DIGRKKK+AA K
Sbjct  121  DIGRKKKTAAKK  132



>ref|XP_009416597.1| PREDICTED: 40S ribosomal protein S8 [Musa acuminata subsp. malaccensis]
Length=223

 Score =   204 bits (518),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LD GNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAI+QVDAAPFKQWYLQHYGV
Sbjct  61   LDHGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGV  120

Query  443  DIGRKKKSAAAKKETNE  493
            +IGRKKK+ A KKE  E
Sbjct  121  EIGRKKKAPAVKKEATE  137



>gb|KHG18510.1| 40S ribosomal S8 [Gossypium arboreum]
Length=216

 Score =   204 bits (518),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 129/132 (98%), Positives = 131/132 (99%), Gaps = 0/132 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGRKKKSAAAK  478
            DIGRKKK+AA K
Sbjct  121  DIGRKKKTAAKK  132



>gb|KHM99496.1| 40S ribosomal protein S8 [Glycine soja]
Length=219

 Score =   204 bits (518),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 134/136 (99%), Gaps = 2/136 (1%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGRKKKSAAA--KKE  484
            ++GRKKKSAAA  KKE
Sbjct  121  EVGRKKKSAAASVKKE  136



>ref|XP_003532158.1| PREDICTED: 40S ribosomal protein S8-like [Glycine max]
Length=219

 Score =   204 bits (518),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 130/136 (96%), Positives = 134/136 (99%), Gaps = 2/136 (1%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKK+WRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKSWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGRKKKSAAA--KKE  484
            ++GRKKKSAAA  KKE
Sbjct  121  EVGRKKKSAAASVKKE  136



>ref|XP_007146564.1| hypothetical protein PHAVU_006G051300g [Phaseolus vulgaris]
 gb|ESW18558.1| hypothetical protein PHAVU_006G051300g [Phaseolus vulgaris]
Length=218

 Score =   203 bits (517),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 128/137 (93%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKT+RR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTIRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGRKKKSAAAKKETNE  493
            DIGRKKK  A+ K+  E
Sbjct  121  DIGRKKKIVASAKKEGE  137



>ref|XP_006373483.1| hypothetical protein POPTR_0017s14180g [Populus trichocarpa]
 gb|ERP51280.1| hypothetical protein POPTR_0017s14180g [Populus trichocarpa]
Length=220

 Score =   203 bits (517),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 133/137 (97%), Gaps = 1/137 (1%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPA+TKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGRKKKSAAAKKETNE  493
            DIGRKKK A  KKET E
Sbjct  121  DIGRKKK-AVVKKETPE  136



>ref|XP_011021175.1| PREDICTED: 40S ribosomal protein S8 isoform X1 [Populus euphratica]
Length=218

 Score =   203 bits (517),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 133/137 (97%), Gaps = 1/137 (1%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPA+TKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGRKKKSAAAKKETNE  493
            DIGRKKK A  KKET E
Sbjct  121  DIGRKKK-AVVKKETPE  136



>ref|XP_008679876.1| PREDICTED: 40S ribosomal protein S8 isoform X1 [Zea mays]
Length=258

 Score =   204 bits (520),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  443  DIGRKKKSAAAKKETNE  493
            DIGRKKK+ AAKK+  E
Sbjct  121  DIGRKKKTPAAKKDNAE  137



>ref|XP_008337490.1| PREDICTED: 40S ribosomal protein S8 [Malus domestica]
Length=221

 Score =   203 bits (516),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVK AIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKGAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGRKKKSAAAKKET  487
            +IGR+KKSA AKK+T
Sbjct  121  EIGRRKKSAVAKKDT  135



>ref|XP_006437243.1| hypothetical protein CICLE_v10032694mg [Citrus clementina]
 gb|ESR50483.1| hypothetical protein CICLE_v10032694mg [Citrus clementina]
Length=223

 Score =   203 bits (516),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 131/135 (97%), Positives = 132/135 (98%), Gaps = 1/135 (1%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGRKKKSAAAKKET  487
            DIGRKKK A  KKET
Sbjct  121  DIGRKKK-AVTKKET  134



>ref|XP_007134162.1| hypothetical protein PHAVU_010G024600g [Phaseolus vulgaris]
 gb|ESW06156.1| hypothetical protein PHAVU_010G024600g [Phaseolus vulgaris]
Length=218

 Score =   202 bits (515),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 128/132 (97%), Positives = 131/132 (99%), Gaps = 0/132 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG+
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGL  120

Query  443  DIGRKKKSAAAK  478
            DIGRKKK+AA K
Sbjct  121  DIGRKKKTAAKK  132



>ref|XP_008679872.1| PREDICTED: 40S ribosomal protein S8-like [Zea mays]
Length=301

 Score =   205 bits (522),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 130/141 (92%), Positives = 133/141 (94%), Gaps = 0/141 (0%)
 Frame = +2

Query  71   TNAAMGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKW  250
                MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKW
Sbjct  77   CQGTMGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKW  136

Query  251  RALRLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQ  430
            RALRLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL 
Sbjct  137  RALRLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLT  196

Query  431  HYGVDIGRKKKSAAAKKETNE  493
            HYGVDIGRKKK+ AAKK+  E
Sbjct  197  HYGVDIGRKKKTPAAKKDNAE  217



>ref|XP_010060252.1| PREDICTED: 40S ribosomal protein S8 [Eucalyptus grandis]
 gb|KCW66870.1| hypothetical protein EUGRSUZ_F00627 [Eucalyptus grandis]
Length=219

 Score =   202 bits (515),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 128/134 (96%), Positives = 132/134 (99%), Gaps = 0/134 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGRKKKSAAAKKE  484
            DIGRKKK+ A+ K+
Sbjct  121  DIGRKKKNQASAKK  134



>gb|KHG09566.1| 40S ribosomal protein S8 [Gossypium arboreum]
Length=163

 Score =   201 bits (510),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 123/137 (90%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRR+TGGK+KAWRKKRK+ELGRQP NTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRSTGGKQKAWRKKRKHELGRQPGNTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSE+VTRKTRILDVVYNASNNELVRTQTLVKSAI+QVDAAPFKQWYLQHYG+
Sbjct  61   LDTGNYSWGSESVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGI  120

Query  443  DIGRKKKSAAAKKETNE  493
            DIGRKKK A+ K+ T E
Sbjct  121  DIGRKKKMASKKEATEE  137



>gb|KJB13805.1| hypothetical protein B456_002G095300 [Gossypium raimondii]
 gb|KJB13807.1| hypothetical protein B456_002G095300 [Gossypium raimondii]
Length=219

 Score =   202 bits (514),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 134/139 (96%), Gaps = 2/139 (1%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGRKKKS--AAAKKETNE  493
            D+GRKKK+  AA KK+  E
Sbjct  121  DLGRKKKTLAAATKKDGEE  139



>gb|KHF98591.1| 40S ribosomal S8 [Gossypium arboreum]
Length=219

 Score =   202 bits (513),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 134/139 (96%), Gaps = 2/139 (1%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDS+HKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSVHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGRKKKSAAA--KKETNE  493
            D+GRKKK+ AA  KKE  E
Sbjct  121  DLGRKKKTPAAATKKEGEE  139



>ref|NP_001132384.1| uncharacterized protein LOC100193830 [Zea mays]
 gb|ACF81204.1| unknown [Zea mays]
Length=221

 Score =   202 bits (513),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 128/137 (93%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEA+TRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEALTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  443  DIGRKKKSAAAKKETNE  493
            DIGRKKK   AKK+  E
Sbjct  121  DIGRKKKVPVAKKDATE  137



>gb|KJB22659.1| hypothetical protein B456_004G059300 [Gossypium raimondii]
Length=219

 Score =   202 bits (513),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 124/137 (91%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRR+TGGK+KAWRKKRKYELGRQP NTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRSTGGKQKAWRKKRKYELGRQPGNTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSE+VTRKTRILDVVYNASNNELVRTQTLVKSAI+QVDAAPFKQWYLQHYG+
Sbjct  61   LDTGNYSWGSESVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGI  120

Query  443  DIGRKKKSAAAKKETNE  493
            DIGRKKK A+ K+ T E
Sbjct  121  DIGRKKKMASKKEATEE  137



>ref|XP_009778867.1| PREDICTED: 40S ribosomal protein S8-like [Nicotiana sylvestris]
Length=223

 Score =   202 bits (513),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 132/137 (96%), Gaps = 1/137 (1%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTK+S NKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKISGNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEA TRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEATTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGRKKKSAAAKKETNE  493
            DIGRKKK  A+KKET E
Sbjct  121  DIGRKKK-GASKKETTE  136



>ref|XP_011095494.1| PREDICTED: 40S ribosomal protein S8 [Sesamum indicum]
Length=219

 Score =   201 bits (512),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 127/132 (96%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGN+SWGSEAVTRKTRILDVVYNASNNELVRTQTLVK AI+QVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKGAIIQVDAAPFKQWYLQHYGV  120

Query  443  DIGRKKKSAAAK  478
            DIGRKKK+AA K
Sbjct  121  DIGRKKKTAAKK  132



>ref|XP_008657369.1| PREDICTED: uncharacterized protein LOC100193830 isoform X1 [Zea 
mays]
Length=223

 Score =   201 bits (512),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 128/137 (93%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEA+TRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEALTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  443  DIGRKKKSAAAKKETNE  493
            DIGRKKK   AKK+  E
Sbjct  121  DIGRKKKVPVAKKDATE  137



>gb|KDO36309.1| hypothetical protein CISIN_1g045444mg, partial [Citrus sinensis]
 gb|KDO60870.1| hypothetical protein CISIN_1g044642mg, partial [Citrus sinensis]
Length=217

 Score =   200 bits (509),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 127/132 (96%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGRKKKSAAAK  478
            DIGRKKK+   K
Sbjct  121  DIGRKKKAVTKK  132



>ref|XP_009619873.1| PREDICTED: 40S ribosomal protein S8-like [Nicotiana tomentosiformis]
Length=220

 Score =   201 bits (510),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 128/138 (93%), Positives = 133/138 (96%), Gaps = 1/138 (1%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSN-KTvrrvrvrggnvKWRAL  259
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKL  N KTVRR+RVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLVPNAKTVRRIRVRGGNVKWRAL  60

Query  260  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  439
            RLDTGNYSWGSEA+TRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG
Sbjct  61   RLDTGNYSWGSEAITRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  120

Query  440  VDIGRKKKSAAAKKETNE  493
            VDIGRKKK+AA+KKE  E
Sbjct  121  VDIGRKKKTAASKKEGEE  138



>ref|XP_009770276.1| PREDICTED: 40S ribosomal protein S8-like [Nicotiana sylvestris]
Length=220

 Score =   200 bits (509),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 128/138 (93%), Positives = 133/138 (96%), Gaps = 1/138 (1%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSN-KTvrrvrvrggnvKWRAL  259
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKL  N KTVRR+RVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLVPNAKTVRRIRVRGGNVKWRAL  60

Query  260  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  439
            RLDTGNYSWGSEA+TRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG
Sbjct  61   RLDTGNYSWGSEAITRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  120

Query  440  VDIGRKKKSAAAKKETNE  493
            VDIGRKKK+AA+KKE  E
Sbjct  121  VDIGRKKKTAASKKEGEE  138



>ref|XP_006484807.1| PREDICTED: 40S ribosomal protein S8-like [Citrus sinensis]
Length=223

 Score =   200 bits (509),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 127/132 (96%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGRKKKSAAAK  478
            DIGRKKK+   K
Sbjct  121  DIGRKKKAVTKK  132



>gb|ACJ86093.1| unknown [Medicago truncatula]
 gb|AFK33939.1| unknown [Medicago truncatula]
 gb|KEH22555.1| 40S ribosomal S8-like protein [Medicago truncatula]
Length=217

 Score =   200 bits (508),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 131/132 (99%), Gaps = 0/132 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKK+WRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKSWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGRKKKSAAAK  478
            ++GRKKK+AA K
Sbjct  121  EVGRKKKTAAKK  132



>gb|AFK40150.1| unknown [Lotus japonicus]
Length=217

 Score =   200 bits (508),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 124/137 (91%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGK+K WRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKTWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGN+SWGSE VTRKTR+LDVVYNASNNELVRTQTLVK AIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSETVTRKTRLLDVVYNASNNELVRTQTLVKGAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGRKKKSAAAKKETNE  493
            +IGRKKK+AA K  T E
Sbjct  121  EIGRKKKTAAKKDSTEE  137



>ref|XP_002534344.1| 40S ribosomal protein S8, putative [Ricinus communis]
 gb|EEF28038.1| 40S ribosomal protein S8, putative [Ricinus communis]
Length=221

 Score =   200 bits (508),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 130/135 (96%), Positives = 132/135 (98%), Gaps = 1/135 (1%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQAANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGRKKKSAAAKKET  487
            DIGRKKK+  AKKET
Sbjct  121  DIGRKKKT-VAKKET  134



>ref|XP_004510234.1| PREDICTED: 40S ribosomal protein S8-like [Cicer arietinum]
Length=217

 Score =   199 bits (507),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 125/132 (95%), Positives = 131/132 (99%), Gaps = 0/132 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGRKKKSAAAK  478
            +IGRKKK+A+ K
Sbjct  121  EIGRKKKTASKK  132



>ref|XP_004148331.1| PREDICTED: 40S ribosomal protein S8-like [Cucumis sativus]
 ref|XP_004162922.1| PREDICTED: 40S ribosomal protein S8-like [Cucumis sativus]
 gb|KGN61144.1| hypothetical protein Csa_2G059750 [Cucumis sativus]
Length=219

 Score =   199 bits (507),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 123/137 (90%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRR TGGKKKAWRKKRKYELGRQPANTKLSS+K++RR+RVRGGNVKWRA R
Sbjct  1    MGISRDSMHKRRETGGKKKAWRKKRKYELGRQPANTKLSSDKSIRRIRVRGGNVKWRAFR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGRKKKSAAAKKETNE  493
            DIGRKKK++A+ K+  E
Sbjct  121  DIGRKKKTSASVKKEEE  137



>ref|XP_011069406.1| PREDICTED: 40S ribosomal protein S8 [Sesamum indicum]
Length=219

 Score =   199 bits (507),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 126/128 (98%), Positives = 128/128 (100%), Gaps = 0/128 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAI+QVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGV  120

Query  443  DIGRKKKS  466
            DIGRKKK+
Sbjct  121  DIGRKKKT  128



>ref|XP_009371092.1| PREDICTED: 40S ribosomal protein S8-like [Pyrus x bretschneideri]
Length=220

 Score =   199 bits (506),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 133/135 (99%), Gaps = 1/135 (1%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGRKKKSAAAKKET  487
            +IGR KKSA AKK+T
Sbjct  121  EIGR-KKSAVAKKDT  134



>ref|XP_008778380.1| PREDICTED: 40S ribosomal protein S8-like [Phoenix dactylifera]
Length=222

 Score =   199 bits (506),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 127/134 (95%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEA+TRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEALTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGRKKKSAAAKKE  484
            +IGRKKK+ A  K+
Sbjct  121  EIGRKKKAPAGTKK  134



>ref|XP_011021176.1| PREDICTED: 40S ribosomal protein S8 isoform X2 [Populus euphratica]
Length=217

 Score =   199 bits (505),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPA+TKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGRKKKSAAAK  478
            DIGRKKK+   K
Sbjct  121  DIGRKKKAVVKK  132



>ref|XP_009783183.1| PREDICTED: 40S ribosomal protein S8 [Nicotiana sylvestris]
Length=224

 Score =   199 bits (506),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTK+S+NKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKISTNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGRKKKSAAAK  478
            DIGRKKK  A K
Sbjct  121  DIGRKKKGPAKK  132



>ref|XP_006373482.1| hypothetical protein POPTR_0017s14180g [Populus trichocarpa]
 gb|ERP51279.1| hypothetical protein POPTR_0017s14180g [Populus trichocarpa]
Length=219

 Score =   199 bits (505),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPA+TKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGRKKKSAAAK  478
            DIGRKKK+   K
Sbjct  121  DIGRKKKAVVKK  132



>ref|XP_009610547.1| PREDICTED: 40S ribosomal protein S8 [Nicotiana tomentosiformis]
Length=224

 Score =   199 bits (505),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTK+S+NKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKISANKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGRKKKSAAAK  478
            DIGRKKK  A K
Sbjct  121  DIGRKKKGPAKK  132



>gb|AFK47179.1| unknown [Medicago truncatula]
 gb|KEH18114.1| 40S ribosomal S8-like protein [Medicago truncatula]
Length=215

 Score =   198 bits (504),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRR TGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRETGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGRKKKSAAAK  478
            DIGRKKK+ + K
Sbjct  121  DIGRKKKNVSKK  132



>ref|XP_009403610.1| PREDICTED: 40S ribosomal protein S8-like [Musa acuminata subsp. 
malaccensis]
Length=220

 Score =   198 bits (504),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 126/134 (94%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LD+GNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPF+QWYLQHYGV
Sbjct  61   LDSGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFRQWYLQHYGV  120

Query  443  DIGRKKKSAAAKKE  484
            +IGRKKK+  A K+
Sbjct  121  EIGRKKKAPTASKK  134



>emb|CDY45095.1| BnaA02g04810D [Brassica napus]
Length=244

 Score =   199 bits (506),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 136/144 (94%), Gaps = 2/144 (1%)
 Frame = +2

Query  68   STNAAMGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvK  247
            S  A MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRR+RVRGGNVK
Sbjct  14   SLKATMGISRDSIHKRRATGGKQKGWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVK  73

Query  248  WRALRLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL  427
            WRALRLDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYL
Sbjct  74   WRALRLDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYL  133

Query  428  QHYGVDIGRKKKSA--AAKKETNE  493
            QHYGV++GRKKK+A  AAKKE  +
Sbjct  134  QHYGVEVGRKKKTAPSAAKKEGED  157



>ref|NP_001240243.1| uncharacterized protein LOC100813170 [Glycine max]
 gb|ACU18370.1| unknown [Glycine max]
 gb|KHN10948.1| 40S ribosomal protein S8 [Glycine soja]
Length=217

 Score =   198 bits (503),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 126/135 (93%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQ ANTKLSSNKT+RR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQAANTKLSSNKTIRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPF+QWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFRQWYLQHYGV  120

Query  443  DIGRKKKSAAAKKET  487
            +IGRKKK AA K  T
Sbjct  121  EIGRKKKVAAKKDST  135



>ref|NP_001274851.1| uncharacterized protein LOC102577693 [Solanum tuberosum]
 gb|ABA46755.1| unknown [Solanum tuberosum]
Length=224

 Score =   197 bits (502),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 125/132 (95%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLS+NKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSNNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAI+QVDAAPFKQWYLQHYG 
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGA  120

Query  443  DIGRKKKSAAAK  478
            DIGRKKK  A K
Sbjct  121  DIGRKKKGPAKK  132



>ref|XP_009406344.1| PREDICTED: 40S ribosomal protein S8-like [Musa acuminata subsp. 
malaccensis]
Length=221

 Score =   197 bits (502),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 125/133 (94%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPA+TKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LD GNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAI+QVDAAPFKQWYLQHYGV
Sbjct  61   LDHGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGV  120

Query  443  DIGRKKKSAAAKK  481
            +IGRKKK+ +AKK
Sbjct  121  EIGRKKKAPSAKK  133



>dbj|BAA07207.1| ribosomal protein S8 [Oryza sativa Japonica Group]
Length=220

 Score =   197 bits (501),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  443  DIGRKKK  463
            DIGRKKK
Sbjct  121  DIGRKKK  127



>ref|XP_009413565.1| PREDICTED: 40S ribosomal protein S8-like [Musa acuminata subsp. 
malaccensis]
Length=222

 Score =   197 bits (501),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LD+GNYSWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWY QHYG+
Sbjct  61   LDSGNYSWGSEAVTRKTRVLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYFQHYGI  120

Query  443  DIGRKKKSAAAKKE  484
            +IGRKKK+  A K+
Sbjct  121  EIGRKKKAPTASKK  134



>ref|XP_008799563.1| PREDICTED: 40S ribosomal protein S8-like [Phoenix dactylifera]
Length=146

 Score =   194 bits (493),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 134/137 (98%), Positives = 136/137 (99%), Gaps = 0/137 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGRKKKSAAAKKETNE  493
            +IGRKKK+AAAKKET E
Sbjct  121  EIGRKKKAAAAKKETTE  137



>emb|CDY60374.1| BnaCnng36150D, partial [Brassica napus]
Length=228

 Score =   197 bits (500),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  77   AAMGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRA  256
            A MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRR+RVRGGNVKWRA
Sbjct  1    ATMGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRA  60

Query  257  LRLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY  436
            LRLDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYLQHY
Sbjct  61   LRLDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQHY  120

Query  437  GVDIGRKKKSAAA  475
            GV++GRKKK+A+A
Sbjct  121  GVEVGRKKKNASA  133



>ref|XP_006601753.1| PREDICTED: uncharacterized protein LOC100500112 isoform X1 [Glycine 
max]
 gb|KHN21285.1| 40S ribosomal protein S8 [Glycine soja]
Length=217

 Score =   196 bits (498),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 125/135 (93%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQ ANTKLSSNKT+RR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQAANTKLSSNKTIRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVK+AIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKNAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGRKKKSAAAKKET  487
            +IGRKKK A+ K  T
Sbjct  121  EIGRKKKVASKKDST  135



>ref|XP_002446216.1| hypothetical protein SORBIDRAFT_06g004770 [Sorghum bicolor]
 gb|EES10544.1| hypothetical protein SORBIDRAFT_06g004770 [Sorghum bicolor]
Length=220

 Score =   196 bits (497),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 125/132 (95%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEA+TRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEALTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  443  DIGRKKKSAAAK  478
            DIGRKK   A K
Sbjct  121  DIGRKKVPVAKK  132



>ref|XP_006400597.1| hypothetical protein EUTSA_v10014589mg [Eutrema salsugineum]
 gb|ESQ42050.1| hypothetical protein EUTSA_v10014589mg [Eutrema salsugineum]
Length=226

 Score =   196 bits (497),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 123/136 (90%), Positives = 132/136 (97%), Gaps = 2/136 (1%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGRKKKSAAA--KKE  484
            ++GRKKK+A A  KKE
Sbjct  121  EVGRKKKNAGASTKKE  136



>ref|XP_009126438.1| PREDICTED: 40S ribosomal protein S8-1-like [Brassica rapa]
Length=226

 Score =   196 bits (497),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 134/139 (96%), Gaps = 2/139 (1%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKGWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGRKKKS--AAAKKETNE  493
            ++GRKKK+  +AAKKE  +
Sbjct  121  EVGRKKKTVPSAAKKEGED  139



>gb|EYU33688.1| hypothetical protein MIMGU_mgv1a013525mg [Erythranthe guttata]
Length=218

 Score =   195 bits (496),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 123/129 (95%), Positives = 127/129 (98%), Gaps = 0/129 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRR TGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRETGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGN+SWGSEAVTRKTRILDVVYNASNNELVRT+TLVKSAI+QVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRILDVVYNASNNELVRTKTLVKSAIIQVDAAPFKQWYLQHYGV  120

Query  443  DIGRKKKSA  469
            DI RKKK+A
Sbjct  121  DISRKKKAA  129



>ref|XP_006409551.1| hypothetical protein EUTSA_v10022838mg [Eutrema salsugineum]
 gb|ESQ51004.1| hypothetical protein EUTSA_v10022838mg [Eutrema salsugineum]
Length=225

 Score =   195 bits (496),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 123/136 (90%), Positives = 132/136 (97%), Gaps = 2/136 (1%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGRKKK--SAAAKKE  484
            ++GRKKK  S+A KKE
Sbjct  121  EVGRKKKNASSATKKE  136



>ref|XP_009131790.1| PREDICTED: 40S ribosomal protein S8-1 [Brassica rapa]
Length=226

 Score =   196 bits (497),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 130/131 (99%), Gaps = 0/131 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGRKKKSAAA  475
            ++GRKKK+A+A
Sbjct  121  EVGRKKKNASA  131



>ref|XP_010905161.1| PREDICTED: 40S ribosomal protein S8-like [Elaeis guineensis]
Length=224

 Score =   195 bits (496),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 133/137 (97%), Positives = 135/137 (99%), Gaps = 0/137 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGRKKKSAAAKKETNE  493
            +IGRKKK+A AKKET E
Sbjct  121  EIGRKKKAAVAKKETAE  137



>gb|KHG04827.1| 40S ribosomal S8 [Gossypium arboreum]
Length=219

 Score =   195 bits (495),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 123/124 (99%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGR  454
            DIGR
Sbjct  121  DIGR  124



>ref|XP_007049644.1| 40S ribosomal protein S8 isoform 1 [Theobroma cacao]
 gb|EOX93801.1| 40S ribosomal protein S8 isoform 1 [Theobroma cacao]
Length=219

 Score =   195 bits (495),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 123/124 (99%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGR  454
            DIGR
Sbjct  121  DIGR  124



>gb|KJB84080.1| hypothetical protein B456_N005000 [Gossypium raimondii]
Length=219

 Score =   195 bits (495),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 123/124 (99%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGR  454
            DIGR
Sbjct  121  DIGR  124



>ref|XP_009765854.1| PREDICTED: 40S ribosomal protein S8-like [Nicotiana sylvestris]
Length=221

 Score =   195 bits (495),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 126/133 (95%), Positives = 130/133 (98%), Gaps = 1/133 (1%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSN-KTvrrvrvrggnvKWRAL  259
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKL +N KTVRR+RVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLVTNAKTVRRIRVRGGNVKWRAL  60

Query  260  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  439
            RLDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG
Sbjct  61   RLDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  120

Query  440  VDIGRKKKSAAAK  478
            VDIGRKKKSAA K
Sbjct  121  VDIGRKKKSAAKK  133



>ref|XP_010252680.1| PREDICTED: 40S ribosomal protein S8 [Nelumbo nucifera]
Length=220

 Score =   195 bits (495),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 124/124 (100%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGR  454
            DIGR
Sbjct  121  DIGR  124



>ref|XP_011008256.1| PREDICTED: 40S ribosomal protein S8-like [Populus euphratica]
 ref|XP_011015899.1| PREDICTED: 40S ribosomal protein S8-like [Populus euphratica]
Length=220

 Score =   195 bits (495),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 123/124 (99%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGR  454
            DIGR
Sbjct  121  DIGR  124



>ref|XP_006452497.1| hypothetical protein CICLE_v10009415mg [Citrus clementina]
 ref|XP_006474961.1| PREDICTED: 40S ribosomal protein S8-like [Citrus sinensis]
 gb|ESR65737.1| hypothetical protein CICLE_v10009415mg [Citrus clementina]
Length=223

 Score =   195 bits (495),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 123/124 (99%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGR  454
            DIGR
Sbjct  121  DIGR  124



>ref|XP_006286561.1| hypothetical protein CARUB_v10001914mg [Capsella rubella]
 gb|EOA19459.1| hypothetical protein CARUB_v10001914mg [Capsella rubella]
Length=221

 Score =   195 bits (495),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 119/130 (92%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNY+WGSEAVTRKTR+LDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYAWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGRKKKSAA  472
            ++GRKKK+AA
Sbjct  121  EVGRKKKNAA  130



>gb|EYU33690.1| hypothetical protein MIMGU_mgv1a013952mg [Erythranthe guttata]
Length=205

 Score =   194 bits (493),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 123/130 (95%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRR TGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRETGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGN+SWGSEAVTRKTRILDVVYNASNNELVRT+TLVKSAI+QVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRILDVVYNASNNELVRTKTLVKSAIIQVDAAPFKQWYLQHYGV  120

Query  443  DIGRKKKSAA  472
            DI RKKK+A 
Sbjct  121  DISRKKKAAV  130



>gb|KHG08050.1| 40S ribosomal S8 [Gossypium arboreum]
Length=218

 Score =   194 bits (494),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 123/124 (99%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGR  454
            DIGR
Sbjct  121  DIGR  124



>gb|AFW61714.1| putative ribosomal protein S8e family protein [Zea mays]
Length=154

 Score =   192 bits (488),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKR+AT GK+KAWRKKRKYELGRQPANTKLSSNKTVRRV VRGG VKWRAL+
Sbjct  1    MGISRDSMHKRQATSGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVYVRGGYVKWRALQ  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDT NYSWGSEA+TRKT ILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTCNYSWGSEALTRKTGILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  443  DIGRKKKSAAAKKETNE  493
            DIGRKKK   AKK+  E
Sbjct  121  DIGRKKKVIIAKKDATE  137



>ref|XP_010646836.1| PREDICTED: 40S ribosomal protein S8 [Vitis vinifera]
Length=220

 Score =   194 bits (494),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 123/124 (99%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATG KKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGSKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGR  454
            DIGR
Sbjct  121  DIGR  124



>ref|XP_002873989.1| ribosomal protein S8 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50248.1| ribosomal protein S8 [Arabidopsis lyrata subsp. lyrata]
Length=220

 Score =   194 bits (494),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 120/134 (90%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLSHYGV  120

Query  443  DIGRKKKSAAAKKE  484
            ++GRKKK+AA+ K+
Sbjct  121  EVGRKKKNAASTKK  134



>gb|KJB62959.1| hypothetical protein B456_009G445800 [Gossypium raimondii]
Length=218

 Score =   194 bits (493),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 123/124 (99%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGR  454
            DIGR
Sbjct  121  DIGR  124



>ref|XP_002269042.2| PREDICTED: 40S ribosomal protein S8 [Vitis vinifera]
 emb|CAN64937.1| hypothetical protein VITISV_011515 [Vitis vinifera]
Length=221

 Score =   194 bits (493),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 124/124 (100%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGR  454
            DIGR
Sbjct  121  DIGR  124



>ref|XP_011025495.1| PREDICTED: 40S ribosomal protein S8-like [Populus euphratica]
Length=219

 Score =   194 bits (493),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 123/124 (99%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGR  454
            DIGR
Sbjct  121  DIGR  124



>ref|NP_001236970.1| uncharacterized protein LOC100500112 [Glycine max]
 gb|ACU14990.1| unknown [Glycine max]
Length=217

 Score =   194 bits (493),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQ ANTKLSSNKT+RR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQAANTKLSSNKTIRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTR LDVVYNASNNELVRTQTLVK+AIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRTLDVVYNASNNELVRTQTLVKNAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGRKKKSAAAKKET  487
            +IGRKKK A+ K  T
Sbjct  121  EIGRKKKVASKKDST  135



>ref|XP_004242427.1| PREDICTED: 40S ribosomal protein S8 [Solanum lycopersicum]
Length=220

 Score =   194 bits (492),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGK+K WRKKRKYELGRQPANTK+SSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKTWRKKRKYELGRQPANTKISSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEA TRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEATTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGRKKKSAAAKKETNE  493
            DIGRKKK AAAKKET E
Sbjct  121  DIGRKKKGAAAKKETAE  137



>gb|KJB81679.1| hypothetical protein B456_013G156600 [Gossypium raimondii]
Length=217

 Score =   193 bits (491),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG+
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGI  120

Query  443  DIGR  454
            DIGR
Sbjct  121  DIGR  124



>ref|XP_002299926.1| 40S ribosomal protein S8 [Populus trichocarpa]
 gb|ABK92677.1| unknown [Populus trichocarpa]
 gb|EEE84731.1| 40S ribosomal protein S8 [Populus trichocarpa]
Length=220

 Score =   193 bits (491),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPA+TKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGR  454
            DIGR
Sbjct  121  DIGR  124



>gb|AGV54796.1| 40S ribosomal protein S8 [Phaseolus vulgaris]
Length=218

 Score =   193 bits (491),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 125/132 (95%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELG  PANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGPPPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQ YG+
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQPYGL  120

Query  443  DIGRKKKSAAAK  478
            DIGRKKK+AA K
Sbjct  121  DIGRKKKTAAKK  132



>gb|KJB81680.1| hypothetical protein B456_013G156600 [Gossypium raimondii]
Length=155

 Score =   191 bits (485),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 132/134 (99%), Positives = 134/134 (100%), Gaps = 0/134 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG+
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGI  120

Query  443  DIGRKKKSAAAKKE  484
            DIGRKKKSAAAKKE
Sbjct  121  DIGRKKKSAAAKKE  134



>gb|EYU39185.1| hypothetical protein MIMGU_mgv1a013531mg [Erythranthe guttata]
Length=194

 Score =   192 bits (488),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 122/138 (88%), Positives = 129/138 (93%), Gaps = 1/138 (1%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSS-NKTvrrvrvrggnvKWRAL  259
            MGISRDSMHKRR TGGKKKAWRKKRKYELGRQPANTKL + NKTVRR+RVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRETGGKKKAWRKKRKYELGRQPANTKLDTVNKTVRRIRVRGGNVKWRAL  60

Query  260  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  439
            RL+TGNYSWGSEA+TRKTR+LDVVYNASNNELVRT+TLVKSAI+QVDAAPFKQWYL HYG
Sbjct  61   RLNTGNYSWGSEAITRKTRVLDVVYNASNNELVRTKTLVKSAIIQVDAAPFKQWYLTHYG  120

Query  440  VDIGRKKKSAAAKKETNE  493
            VDIGRKKK  A KKE  E
Sbjct  121  VDIGRKKKGGADKKEETE  138



>ref|XP_007020644.1| 40S ribosomal protein S8 isoform 1 [Theobroma cacao]
 ref|XP_007020645.1| 40S ribosomal protein S8 isoform 1 [Theobroma cacao]
 gb|EOY12169.1| 40S ribosomal protein S8 isoform 1 [Theobroma cacao]
 gb|EOY12170.1| 40S ribosomal protein S8 isoform 1 [Theobroma cacao]
Length=220

 Score =   193 bits (490),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPA+TKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGR  454
            DIGR
Sbjct  121  DIGR  124



>gb|ACJ83894.1| unknown [Medicago truncatula]
Length=216

 Score =   192 bits (489),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 126/132 (95%), Gaps = 1/132 (1%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKK   +K++ YELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKSWRKKRK-YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  59

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            L TGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  60   LGTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  119

Query  443  DIGRKKKSAAAK  478
            ++GRKKK+AA K
Sbjct  120  EVGRKKKTAAKK  131



>ref|XP_010926672.1| PREDICTED: 40S ribosomal protein S8-like isoform X2 [Elaeis guineensis]
Length=207

 Score =   192 bits (488),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 104/111 (94%), Positives = 108/111 (97%), Gaps = 0/111 (0%)
 Frame = +2

Query  161  YELGRQPANTKLSSNKTvrrvrvrggnvKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  340
            YELGR+PANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTR+LDVVYNA
Sbjct  10   YELGRRPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRVLDVVYNA  69

Query  341  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKSAAAKKETNE  493
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV+IGRKKK+ AAKKE  E
Sbjct  70   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEIGRKKKTLAAKKEATE  120



>gb|KJB81683.1| hypothetical protein B456_013G156600 [Gossypium raimondii]
Length=245

 Score =   193 bits (491),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG+
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGI  120

Query  443  DIGR  454
            DIGR
Sbjct  121  DIGR  124



>ref|NP_200732.2| 40S ribosomal protein S8-2 [Arabidopsis thaliana]
 sp|Q9FIF3.1|RS82_ARATH RecName: Full=40S ribosomal protein S8-2 [Arabidopsis thaliana]
 dbj|BAB09769.1| 40S ribosomal protein S8 [Arabidopsis thaliana]
 gb|AAO42849.1| At5g59240 [Arabidopsis thaliana]
 dbj|BAE99897.1| 40S ribosomal protein S8 - like [Arabidopsis thaliana]
 gb|AED97161.1| 40S ribosomal protein S8-2 [Arabidopsis thaliana]
Length=210

 Score =   192 bits (488),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 122/134 (91%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDS+HKRRATGGK+K WRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKMWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGN+SWGSEAVTRKTRILDV YNASNNELVRTQTLVKSAIVQVDAAPFKQ YLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRILDVAYNASNNELVRTQTLVKSAIVQVDAAPFKQGYLQHYGV  120

Query  443  DIGRKKKSAAAKKE  484
            DIGRKKK  A   E
Sbjct  121  DIGRKKKGEAVTTE  134



>gb|EAY93669.1| hypothetical protein OsI_15456 [Oryza sativa Indica Group]
Length=221

 Score =   192 bits (489),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGN+KWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNLKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  443  DIGR  454
            DIGR
Sbjct  121  DIGR  124



>ref|NP_001052526.1| Os04g0349500 [Oryza sativa Japonica Group]
 emb|CAE05511.1| OSJNBa0038P21.4 [Oryza sativa Japonica Group]
 dbj|BAF14440.1| Os04g0349500 [Oryza sativa Japonica Group]
 gb|EAZ30323.1| hypothetical protein OsJ_14370 [Oryza sativa Japonica Group]
 dbj|BAG90858.1| unnamed protein product [Oryza sativa Japonica Group]
Length=221

 Score =   192 bits (489),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGN+KWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNLKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  443  DIGR  454
            DIGR
Sbjct  121  DIGR  124



>ref|NP_001046866.1| Os02g0489400 [Oryza sativa Japonica Group]
 sp|P49199.2|RS8_ORYSJ RecName: Full=40S ribosomal protein S8 [Oryza sativa Japonica 
Group]
 pdb|3J60|I Chain I, Localization Of The Small Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 dbj|BAD21871.1| putative 40S ribosomal protein S8 [Oryza sativa Japonica Group]
 dbj|BAD21876.1| putative 40S ribosomal protein S8 [Oryza sativa Japonica Group]
 dbj|BAF08780.1| Os02g0489400 [Oryza sativa Japonica Group]
 dbj|BAG95703.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC73196.1| hypothetical protein OsI_07259 [Oryza sativa Indica Group]
 gb|EEE57012.1| hypothetical protein OsJ_06781 [Oryza sativa Japonica Group]
Length=220

 Score =   192 bits (489),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  443  DIGR  454
            DIGR
Sbjct  121  DIGR  124



>gb|KCW58021.1| hypothetical protein EUGRSUZ_H00750 [Eucalyptus grandis]
Length=221

 Score =   192 bits (489),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYN+SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNSSNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGR  454
            DIGR
Sbjct  121  DIGR  124



>ref|XP_010069614.1| PREDICTED: 40S ribosomal protein S8-like [Eucalyptus grandis]
 gb|KCW58022.1| hypothetical protein EUGRSUZ_H00750 [Eucalyptus grandis]
Length=222

 Score =   192 bits (489),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYN+SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNSSNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGR  454
            DIGR
Sbjct  121  DIGR  124



>ref|XP_010926670.1| PREDICTED: 40S ribosomal protein S8-like isoform X1 [Elaeis guineensis]
 ref|XP_010926671.1| PREDICTED: 40S ribosomal protein S8-like isoform X1 [Elaeis guineensis]
Length=212

 Score =   192 bits (487),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 104/111 (94%), Positives = 108/111 (97%), Gaps = 0/111 (0%)
 Frame = +2

Query  161  YELGRQPANTKLSSNKTvrrvrvrggnvKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  340
            YELGR+PANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTR+LDVVYNA
Sbjct  15   YELGRRPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRVLDVVYNA  74

Query  341  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKSAAAKKETNE  493
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV+IGRKKK+ AAKKE  E
Sbjct  75   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEIGRKKKTLAAKKEATE  125



>gb|KHN25148.1| 40S ribosomal protein S8 [Glycine soja]
Length=219

 Score =   192 bits (488),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGR  454
            +IGR
Sbjct  121  EIGR  124



>ref|XP_010278451.1| PREDICTED: 40S ribosomal protein S8-like [Nelumbo nucifera]
Length=219

 Score =   192 bits (488),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 123/124 (99%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSE VTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEHVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGR  454
            DIGR
Sbjct  121  DIGR  124



>ref|XP_009594581.1| PREDICTED: 40S ribosomal protein S8-2-like [Nicotiana tomentosiformis]
Length=221

 Score =   192 bits (488),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 124/130 (95%), Positives = 128/130 (98%), Gaps = 1/130 (1%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSN-KTvrrvrvrggnvKWRAL  259
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKL +N KTVRR+RVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLVTNAKTVRRIRVRGGNVKWRAL  60

Query  260  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  439
            RLDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG
Sbjct  61   RLDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  120

Query  440  VDIGRKKKSA  469
            VDIGRKKKSA
Sbjct  121  VDIGRKKKSA  130



>ref|XP_010907235.1| PREDICTED: 40S ribosomal protein S8-like [Elaeis guineensis]
Length=223

 Score =   192 bits (488),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAI+QVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGV  120

Query  443  DIGR  454
            +IGR
Sbjct  121  EIGR  124



>ref|XP_002313320.1| 40S ribosomal protein S8 [Populus trichocarpa]
 gb|ABK92635.1| unknown [Populus trichocarpa]
 gb|EEE87275.1| 40S ribosomal protein S8 [Populus trichocarpa]
Length=219

 Score =   192 bits (488),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPA+TKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGR  454
            DIGR
Sbjct  121  DIGR  124



>ref|XP_002452585.1| hypothetical protein SORBIDRAFT_04g028530 [Sorghum bicolor]
 gb|EES05561.1| hypothetical protein SORBIDRAFT_04g028530 [Sorghum bicolor]
Length=221

 Score =   192 bits (488),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  443  DIGR  454
            DIGR
Sbjct  121  DIGR  124



>ref|XP_003547779.1| PREDICTED: 40S ribosomal protein S8 [Glycine max]
Length=219

 Score =   192 bits (487),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGR  454
            +IGR
Sbjct  121  EIGR  124



>gb|EYU39184.1| hypothetical protein MIMGU_mgv1a013531mg [Erythranthe guttata]
Length=218

 Score =   192 bits (487),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 122/138 (88%), Positives = 129/138 (93%), Gaps = 1/138 (1%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSS-NKTvrrvrvrggnvKWRAL  259
            MGISRDSMHKRR TGGKKKAWRKKRKYELGRQPANTKL + NKTVRR+RVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRETGGKKKAWRKKRKYELGRQPANTKLDTVNKTVRRIRVRGGNVKWRAL  60

Query  260  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  439
            RL+TGNYSWGSEA+TRKTR+LDVVYNASNNELVRT+TLVKSAI+QVDAAPFKQWYL HYG
Sbjct  61   RLNTGNYSWGSEAITRKTRVLDVVYNASNNELVRTKTLVKSAIIQVDAAPFKQWYLTHYG  120

Query  440  VDIGRKKKSAAAKKETNE  493
            VDIGRKKK  A KKE  E
Sbjct  121  VDIGRKKKGGADKKEETE  138



>ref|XP_010913108.1| PREDICTED: 40S ribosomal protein S8 isoform X1 [Elaeis guineensis]
Length=224

 Score =   192 bits (488),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAI+QVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGV  120

Query  443  DIGR  454
            +IGR
Sbjct  121  EIGR  124



>ref|XP_010693327.1| PREDICTED: 40S ribosomal protein S8-like [Beta vulgaris subsp. 
vulgaris]
Length=217

 Score =   192 bits (487),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGR  454
            D+GR
Sbjct  121  DVGR  124



>ref|XP_008809644.1| PREDICTED: 40S ribosomal protein S8 [Phoenix dactylifera]
Length=223

 Score =   192 bits (487),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAI+Q+DAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQIDAAPFKQWYLQHYGV  120

Query  443  DIGR  454
            +IGR
Sbjct  121  EIGR  124



>ref|XP_004953910.1| PREDICTED: 40S ribosomal protein S8-like [Setaria italica]
Length=221

 Score =   192 bits (487),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  443  DIGR  454
            DIGR
Sbjct  121  DIGR  124



>ref|XP_004975334.1| PREDICTED: 40S ribosomal protein S8-like [Setaria italica]
Length=221

 Score =   192 bits (487),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  443  DIGR  454
            DIGR
Sbjct  121  DIGR  124



>ref|XP_002529032.1| 40S ribosomal protein S8, putative [Ricinus communis]
 gb|EEF33343.1| 40S ribosomal protein S8, putative [Ricinus communis]
Length=219

 Score =   192 bits (487),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPA+TKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAI+QVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGV  120

Query  443  DIGR  454
            DIGR
Sbjct  121  DIGR  124



>gb|KFK26269.1| hypothetical protein AALP_AA8G225000 [Arabis alpina]
Length=223

 Score =   192 bits (487),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 121/136 (89%), Positives = 130/136 (96%), Gaps = 2/136 (1%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLS NKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSGNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLSHYGV  120

Query  443  DIGRKKKSA--AAKKE  484
            ++GRKKK+A  A KKE
Sbjct  121  EVGRKKKAAVSATKKE  136



>gb|ACN31997.1| unknown [Zea mays]
 gb|AFW66127.1| putative ribosomal protein S8e family protein [Zea mays]
 gb|AFW66131.1| putative ribosomal protein S8e family protein isoform 1 [Zea 
mays]
 gb|AFW66132.1| putative ribosomal protein S8e family protein isoform 2 [Zea 
mays]
 gb|AFW66139.1| putative ribosomal protein S8e family protein isoform 1 [Zea 
mays]
 gb|AFW66140.1| putative ribosomal protein S8e family protein isoform 2 [Zea 
mays]
Length=214

 Score =   191 bits (486),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 105/111 (95%), Positives = 107/111 (96%), Gaps = 0/111 (0%)
 Frame = +2

Query  161  YELGRQPANTKLSSNKTvrrvrvrggnvKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  340
            YELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  20   YELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  79

Query  341  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKSAAAKKETNE  493
            SNNELVRTQTLVKSAIVQVDAAPFKQWYL HYGVDIGRKKK+ AAKK+  E
Sbjct  80   SNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGVDIGRKKKTPAAKKDNAE  130



>ref|XP_006346168.1| PREDICTED: 40S ribosomal protein S8-like [Solanum tuberosum]
Length=220

 Score =   191 bits (486),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 130/133 (98%), Gaps = 1/133 (1%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSN-KTvrrvrvrggnvKWRAL  259
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKL  N KTVRR+RVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLVPNAKTVRRIRVRGGNVKWRAL  60

Query  260  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  439
            RLDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAI+QVDAAPFKQWYLQHYG
Sbjct  61   RLDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYG  120

Query  440  VDIGRKKKSAAAK  478
            V+IGRKKK+AA+K
Sbjct  121  VEIGRKKKTAASK  133



>ref|XP_003520991.1| PREDICTED: 40S ribosomal protein S8-like [Glycine max]
 gb|KHN05782.1| 40S ribosomal protein S8 [Glycine soja]
Length=220

 Score =   191 bits (486),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGR  454
            +IGR
Sbjct  121  EIGR  124



>ref|XP_010541736.1| PREDICTED: 40S ribosomal protein S8-1-like [Tarenaya hassleriana]
Length=222

 Score =   191 bits (486),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 130/139 (94%), Gaps = 2/139 (1%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDS+HKRRATGGK+K WRKKRKYELGR  ANTKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYELGRVAANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGRKKKSAA--AKKETNE  493
            +IGRKKK+ A   KKE  E
Sbjct  121  EIGRKKKTPATSGKKEGEE  139



>gb|KFK31870.1| hypothetical protein AALP_AA6G169300 [Arabis alpina]
Length=219

 Score =   191 bits (485),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 121/136 (89%), Positives = 129/136 (95%), Gaps = 2/136 (1%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLS NKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSGNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLSHYGV  120

Query  443  DIGRKKKSA--AAKKE  484
            ++GRKKK A  A KKE
Sbjct  121  EVGRKKKPAPSATKKE  136



>gb|ACU16800.1| unknown [Glycine max]
Length=243

 Score =   192 bits (487),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAW KKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWGKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGR  454
            +IGR
Sbjct  121  EIGR  124



>ref|XP_008647178.1| PREDICTED: 40S ribosomal protein S8-like [Zea mays]
Length=177

 Score =   189 bits (481),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 102/111 (92%), Positives = 105/111 (95%), Gaps = 0/111 (0%)
 Frame = +2

Query  161  YELGRQPANTKLSSNKTvrrvrvrggnvKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  340
            YELGRQPANTKLSSNKTVRRV VRGGNVKWRALRLDTGNYSWGSEA+TRKTRILDVVYNA
Sbjct  15   YELGRQPANTKLSSNKTVRRVCVRGGNVKWRALRLDTGNYSWGSEALTRKTRILDVVYNA  74

Query  341  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKSAAAKKETNE  493
            SNNELVRTQTLVKSAIVQVDAAPFKQWYL HYGVDIGRKKK + AKK+  E
Sbjct  75   SNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGVDIGRKKKVSVAKKDATE  125



>ref|XP_002275094.1| PREDICTED: 40S ribosomal protein S8 [Vitis vinifera]
Length=219

 Score =   191 bits (485),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPA+TKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAI+QVDAAPFKQWYLQHYG+
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGL  120

Query  443  DIGR  454
            DIGR
Sbjct  121  DIGR  124



>ref|XP_010913109.1| PREDICTED: 40S ribosomal protein S8 isoform X2 [Elaeis guineensis]
Length=222

 Score =   191 bits (485),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAI+QVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGV  120

Query  443  DIGR  454
            +IGR
Sbjct  121  EIGR  124



>ref|XP_010535902.1| PREDICTED: 40S ribosomal protein S8-1-like [Tarenaya hassleriana]
Length=220

 Score =   191 bits (485),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 130/139 (94%), Gaps = 2/139 (1%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDS+HKRRATGGK+K WRKKRKYELGR  ANTKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYELGRVAANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRT+TLVKSAIVQVD APFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTKTLVKSAIVQVDVAPFKQWYLQHYGV  120

Query  443  DIGRKKKSAA--AKKETNE  493
            ++GRKKK+AA   KKE  E
Sbjct  121  EVGRKKKTAATSGKKEGEE  139



>ref|XP_010675861.1| PREDICTED: 40S ribosomal protein S8 [Beta vulgaris subsp. vulgaris]
Length=217

 Score =   191 bits (484),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGR  454
            +IGR
Sbjct  121  EIGR  124



>ref|XP_010483522.1| PREDICTED: 40S ribosomal protein S8-2-like [Camelina sativa]
Length=220

 Score =   191 bits (484),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 127/137 (93%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDS+HKRRATGGK+K WRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKMWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTR+LDV YNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRVLDVAYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGRKKKSAAAKKETNE  493
            DIGRKKK+AA+KKE  E
Sbjct  121  DIGRKKKAAASKKEGEE  137



>ref|XP_006352667.1| PREDICTED: 40S ribosomal protein S8-like [Solanum tuberosum]
Length=221

 Score =   191 bits (484),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 119/124 (96%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGK+K WRKKRKYELGRQPANTK+SSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKTWRKKRKYELGRQPANTKISSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEA TRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEATTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGR  454
            DIGR
Sbjct  121  DIGR  124



>ref|XP_009361080.1| PREDICTED: 40S ribosomal protein S8-like [Pyrus x bretschneideri]
 ref|XP_009348460.1| PREDICTED: 40S ribosomal protein S8-like [Pyrus x bretschneideri]
Length=222

 Score =   191 bits (484),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGR  454
            +IGR
Sbjct  121  EIGR  124



>ref|XP_008366424.1| PREDICTED: 40S ribosomal protein S8 [Malus domestica]
 ref|XP_009364625.1| PREDICTED: 40S ribosomal protein S8-like [Pyrus x bretschneideri]
 ref|XP_009364657.1| PREDICTED: 40S ribosomal protein S8-like [Pyrus x bretschneideri]
 ref|XP_009335423.1| PREDICTED: 40S ribosomal protein S8-like [Pyrus x bretschneideri]
Length=222

 Score =   191 bits (484),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGR  454
            +IGR
Sbjct  121  EIGR  124



>gb|KJB84081.1| hypothetical protein B456_N005000 [Gossypium raimondii]
Length=259

 Score =   192 bits (487),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  86   GISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALRL  265
            GISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALRL
Sbjct  42   GISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRL  101

Query  266  DTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVD  445
            DTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVD
Sbjct  102  DTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVD  161

Query  446  IGR  454
            IGR
Sbjct  162  IGR  164



>ref|XP_008451649.1| PREDICTED: 40S ribosomal protein S8-like [Cucumis melo]
Length=219

 Score =   190 bits (483),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 118/124 (95%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRR TGGKKKAWRKKRKYELGRQPANTKLSS+K++RR+RVRGGNVKWRA R
Sbjct  1    MGISRDSMHKRRETGGKKKAWRKKRKYELGRQPANTKLSSDKSIRRIRVRGGNVKWRAFR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGR  454
            DIGR
Sbjct  121  DIGR  124



>ref|XP_010454644.1| PREDICTED: 40S ribosomal protein S8-2 [Camelina sativa]
Length=218

 Score =   190 bits (483),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 118/124 (95%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDS+HKRRATGGK+K WRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKMWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTR+LDV YNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRVLDVAYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGR  454
            DIGR
Sbjct  121  DIGR  124



>ref|XP_003626942.1| Ribosomal protein S8 [Medicago truncatula]
Length=605

 Score =   200 bits (508),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRR TGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  391  MGISRDSMHKRRETGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  450

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  451  LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  510

Query  443  DIGRKKKSAAAK  478
            DIGRKKK+ + K
Sbjct  511  DIGRKKKNVSKK  522


 Score =   174 bits (442),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +2

Query  161  YELGRQPANTKLSSNKTvrrvrvrggnvKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  340
            YELGRQPANTKLSSNKTVR +RVRGGN+K RALRLDTGN SWGSEAVTRK+R+L+VVYNA
Sbjct  128  YELGRQPANTKLSSNKTVRSIRVRGGNLKCRALRLDTGNISWGSEAVTRKSRLLNVVYNA  187

Query  341  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKSAA  472
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV+IG KKK+AA
Sbjct  188  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEIGNKKKTAA  231



>ref|XP_008466734.1| PREDICTED: 40S ribosomal protein S8-2 [Cucumis melo]
Length=220

 Score =   190 bits (482),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 119/124 (96%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSS+K++RR+RVRGGNVKWRA R
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSDKSIRRIRVRGGNVKWRAFR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGR  454
            DIGR
Sbjct  121  DIGR  124



>sp|O81361.1|RS8_PRUAR RecName: Full=40S ribosomal protein S8 [Prunus armeniaca]
 gb|AAC24583.1| 40S ribosomal protein S8 [Prunus armeniaca]
Length=221

 Score =   190 bits (482),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGR  454
            +IGR
Sbjct  121  EIGR  124



>ref|XP_008222788.1| PREDICTED: 40S ribosomal protein S8 [Prunus mume]
Length=221

 Score =   190 bits (482),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 135/135 (100%), Gaps = 0/135 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGRKKKSAAAKKET  487
            +IGRKKK+AAAKK+T
Sbjct  121  EIGRKKKTAAAKKDT  135



>gb|ACU19111.1| unknown [Glycine max]
Length=220

 Score =   190 bits (482),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPA+TKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGR  454
            +IGR
Sbjct  121  EIGR  124



>ref|XP_003551567.1| PREDICTED: 40S ribosomal protein S8 [Glycine max]
 gb|KHN28407.1| 40S ribosomal protein S8 [Glycine soja]
Length=219

 Score =   190 bits (482),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEA TRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAATRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGR  454
            ++GR
Sbjct  121  EVGR  124



>ref|XP_007223947.1| hypothetical protein PRUPE_ppa011148mg [Prunus persica]
 gb|EMJ25146.1| hypothetical protein PRUPE_ppa011148mg [Prunus persica]
Length=222

 Score =   190 bits (482),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGR  454
            +IGR
Sbjct  121  EIGR  124



>gb|EYU27406.1| hypothetical protein MIMGU_mgv1a013520mg [Erythranthe guttata]
Length=218

 Score =   189 bits (481),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 119/124 (96%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGK KAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKMKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGN+SWGSEAVTRKTRILDVVYNASNNELVRTQTLVK AI+QVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKGAIIQVDAAPFKQWYLQHYGV  120

Query  443  DIGR  454
            +IGR
Sbjct  121  EIGR  124



>ref|XP_007211997.1| hypothetical protein PRUPE_ppa011067mg [Prunus persica]
 ref|XP_007211998.1| hypothetical protein PRUPE_ppa011067mg [Prunus persica]
 gb|EMJ13196.1| hypothetical protein PRUPE_ppa011067mg [Prunus persica]
 gb|EMJ13197.1| hypothetical protein PRUPE_ppa011067mg [Prunus persica]
Length=225

 Score =   189 bits (481),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 119/124 (96%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVK AIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKGAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGR  454
            +IGR
Sbjct  121  EIGR  124



>ref|XP_010270147.1| PREDICTED: 40S ribosomal protein S8-like [Nelumbo nucifera]
Length=221

 Score =   189 bits (481),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 126/129 (98%), Positives = 128/129 (99%), Gaps = 0/129 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVK AIVQVDAAPFKQWYLQHYG+
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKGAIVQVDAAPFKQWYLQHYGL  120

Query  443  DIGRKKKSA  469
            DIGRKKKS+
Sbjct  121  DIGRKKKSS  129



>ref|XP_008227073.1| PREDICTED: 40S ribosomal protein S8-like [Prunus mume]
Length=225

 Score =   189 bits (481),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 119/124 (96%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVK AIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKGAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGR  454
            +IGR
Sbjct  121  EIGR  124



>gb|KJB81681.1| hypothetical protein B456_013G156600 [Gossypium raimondii]
Length=153

 Score =   187 bits (474),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 120/122 (98%), Positives = 122/122 (100%), Gaps = 0/122 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG+
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGI  120

Query  443  DI  448
            DI
Sbjct  121  DI  122



>ref|XP_002864608.1| 40S ribosomal protein S8 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40867.1| 40S ribosomal protein S8 [Arabidopsis lyrata subsp. lyrata]
Length=210

 Score =   189 bits (479),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 121/134 (90%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDS+HKRRATGGK+K WRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKMWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGN+SWGSEAVTRKTRILDV YNASNNELVRTQTLVKSAIV VDAAPFKQ YLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRILDVAYNASNNELVRTQTLVKSAIVLVDAAPFKQGYLQHYGV  120

Query  443  DIGRKKKSAAAKKE  484
            DIGRKKK  A   E
Sbjct  121  DIGRKKKGDAVTTE  134



>ref|XP_004290159.1| PREDICTED: 40S ribosomal protein S8-like [Fragaria vesca subsp. 
vesca]
Length=224

 Score =   189 bits (480),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 119/124 (96%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTK+SSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKISSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGN+SWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPF+QWYLQHY V
Sbjct  61   LDTGNFSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFRQWYLQHYNV  120

Query  443  DIGR  454
            DIGR
Sbjct  121  DIGR  124



>ref|XP_004492266.1| PREDICTED: 40S ribosomal protein S8-like [Cicer arietinum]
Length=218

 Score =   189 bits (479),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 119/124 (96%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVK AIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKGAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGR  454
            +IGR
Sbjct  121  EIGR  124



>ref|XP_008364326.1| PREDICTED: 40S ribosomal protein S8-like [Malus domestica]
 ref|XP_008345024.1| PREDICTED: 40S ribosomal protein S8 [Malus domestica]
 ref|XP_008355313.1| PREDICTED: 40S ribosomal protein S8 [Malus domestica]
Length=222

 Score =   189 bits (479),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 119/124 (96%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGN+SWGSE VTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSETVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGR  454
            +IGR
Sbjct  121  EIGR  124



>ref|XP_004240435.1| PREDICTED: 40S ribosomal protein S8-2 [Solanum lycopersicum]
Length=220

 Score =   189 bits (479),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 117/122 (96%), Positives = 121/122 (99%), Gaps = 0/122 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGK+K WRKKRKYELGRQPANTK+SSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKTWRKKRKYELGRQPANTKISSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG+
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGI  120

Query  443  DI  448
            DI
Sbjct  121  DI  122



>ref|XP_010519957.1| PREDICTED: 40S ribosomal protein S8-1 [Tarenaya hassleriana]
Length=222

 Score =   189 bits (479),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 131/139 (94%), Gaps = 2/139 (1%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDS+HKRRATGGK+K WRKKRKYE+GR  ANTKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRVAANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLSHYGV  120

Query  443  DIGRKKKSAA--AKKETNE  493
            ++GRKKK++A   KKE +E
Sbjct  121  EVGRKKKTSATSGKKEGDE  139



>ref|XP_007149668.1| hypothetical protein PHAVU_005G089100g [Phaseolus vulgaris]
 gb|ESW21662.1| hypothetical protein PHAVU_005G089100g [Phaseolus vulgaris]
Length=217

 Score =   189 bits (479),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQ ANTKLSSNKT+RR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQSANTKLSSNKTIRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGR  454
            +IGR
Sbjct  121  EIGR  124



>emb|CDP03936.1| unnamed protein product [Coffea canephora]
Length=213

 Score =   188 bits (478),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 103/111 (93%), Positives = 105/111 (95%), Gaps = 0/111 (0%)
 Frame = +2

Query  161  YELGRQPANTKLSSNKTvrrvrvrggnvKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  340
            YELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDV+YNA
Sbjct  20   YELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVMYNA  79

Query  341  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKSAAAKKETNE  493
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKK  A K  T +
Sbjct  80   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKGPAKKDATED  130



>emb|CAA03954.1| ribosomal protein S8 [Hordeum vulgare subsp. vulgare]
Length=126

 Score =   185 bits (470),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 118/126 (94%), Positives = 124/126 (98%), Gaps = 0/126 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGN+SWGSEA TRKTR+LDVVYN+SNNELVRTQTLVK+AIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNFSWGSEATTRKTRLLDVVYNSSNNELVRTQTLVKNAIVQVDAAPFKQWYLTHYGV  120

Query  443  DIGRKK  460
            +IGRKK
Sbjct  121  EIGRKK  126



>gb|KJB13806.1| hypothetical protein B456_002G095300 [Gossypium raimondii]
Length=212

 Score =   188 bits (478),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 104/113 (92%), Positives = 108/113 (96%), Gaps = 2/113 (2%)
 Frame = +2

Query  161  YELGRQPANTKLSSNKTvrrvrvrggnvKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  340
            YELGRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  20   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  79

Query  341  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKS--AAAKKETNE  493
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVD+GRKKK+  AA KK+  E
Sbjct  80   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDLGRKKKTLAAATKKDGEE  132



>gb|AFK37035.1| unknown [Lotus japonicus]
Length=218

 Score =   188 bits (478),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 118/124 (95%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGN+SWGSE VTRKTRILDVVYNASNNELVRTQTLVK AI+QVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSETVTRKTRILDVVYNASNNELVRTQTLVKGAIIQVDAAPFKQWYLQHYGV  120

Query  443  DIGR  454
            D+GR
Sbjct  121  DLGR  124



>ref|XP_006856815.1| hypothetical protein AMTR_s00055p00155570 [Amborella trichopoda]
 gb|ERN18282.1| hypothetical protein AMTR_s00055p00155570 [Amborella trichopoda]
Length=218

 Score =   188 bits (478),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 120/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKK+WRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKSWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGN SWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNCSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIG  451
            D+G
Sbjct  121  DLG  123



>gb|ACU16398.1| unknown [Glycine max]
Length=256

 Score =   189 bits (481),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEA TRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAATRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGR  454
            ++GR
Sbjct  121  EVGR  124



>gb|AFW61715.1| putative ribosomal protein S8e family protein [Zea mays]
Length=241

 Score =   189 bits (480),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 120/136 (88%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +2

Query  86   GISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALRL  265
            GISRDSMHKR+AT GK+KAWRKKRKYELGRQPANTKLSSNKTVRRV VRGG VKWRAL+L
Sbjct  37   GISRDSMHKRQATSGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVYVRGGYVKWRALQL  96

Query  266  DTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVD  445
            DT NYSWGSEA+TRKT ILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HYGVD
Sbjct  97   DTCNYSWGSEALTRKTGILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGVD  156

Query  446  IGRKKKSAAAKKETNE  493
            IGRKKK   AKK+  E
Sbjct  157  IGRKKKVIIAKKDATE  172



>gb|KHG07290.1| 40S ribosomal S8 [Gossypium arboreum]
 gb|KHG09567.1| 40S ribosomal protein S8 [Gossypium arboreum]
Length=156

 Score =   186 bits (472),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/111 (89%), Positives = 106/111 (95%), Gaps = 0/111 (0%)
 Frame = +2

Query  161  YELGRQPANTKLSSNKTvrrvrvrggnvKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  340
            +ELGRQP NTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSE+VTRKTRILDVVYNA
Sbjct  20   HELGRQPGNTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSESVTRKTRILDVVYNA  79

Query  341  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKSAAAKKETNE  493
            SNNELVRTQTLVKSAI+QVDAAPFKQWYLQHYG+DIGRKKK A+ K+ T E
Sbjct  80   SNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGIDIGRKKKMASKKEATEE  130



>gb|AFK33351.1| unknown [Lotus japonicus]
Length=218

 Score =   188 bits (478),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 117/124 (94%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWR+KRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRRKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGN+SWGSE VTRKTRILDVVYNASNNELVRTQTLVK AI+QVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSETVTRKTRILDVVYNASNNELVRTQTLVKGAIIQVDAAPFKQWYLQHYGV  120

Query  443  DIGR  454
            D+GR
Sbjct  121  DLGR  124



>ref|XP_010327196.1| PREDICTED: 40S ribosomal protein S8 [Solanum lycopersicum]
Length=221

 Score =   188 bits (478),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 127/131 (97%), Gaps = 1/131 (1%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSN-KTvrrvrvrggnvKWRAL  259
            MGISRDSMHKRRATGGKKKAWRKKRKYE+GRQ ANTKL  N KTVRR+RVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYEMGRQSANTKLVPNAKTVRRIRVRGGNVKWRAL  60

Query  260  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  439
            RLDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG
Sbjct  61   RLDTGNYSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  120

Query  440  VDIGRKKKSAA  472
            V+IGRKKKSAA
Sbjct  121  VEIGRKKKSAA  131



>ref|XP_009405538.1| PREDICTED: 40S ribosomal protein S8-like [Musa acuminata subsp. 
malaccensis]
Length=224

 Score =   188 bits (478),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDA PFK WYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDATPFKHWYLQHYGV  120

Query  443  DIGR  454
            +IGR
Sbjct  121  EIGR  124



>gb|ACI15738.1| putative 40S ribosomal protein S8-like protein [Picrorhiza kurrooa]
Length=216

 Score =   188 bits (477),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            M  S  SMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MSTSLLSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGN+SWGSEAVTRKTRILDVVYNASNNELVRTQTLVK AI+QVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKGAIIQVDAAPFKQWYLQHYGV  120

Query  443  DIGRKKKSAAAK  478
            +IGRKKK+AA K
Sbjct  121  EIGRKKKTAAKK  132



>ref|XP_004160707.1| PREDICTED: 40S ribosomal protein S8-like [Cucumis sativus]
Length=221

 Score =   188 bits (478),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 117/124 (94%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSS+K++RR+RVRGGNVKWRA R
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSDKSIRRIRVRGGNVKWRAFR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAV+RKTRILDVVYNASNNELVRTQTLVKSA+VQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVSRKTRILDVVYNASNNELVRTQTLVKSAVVQVDAAPFKQWYLQHYGV  120

Query  443  DIGR  454
            DIGR
Sbjct  121  DIGR  124



>ref|XP_004149800.1| PREDICTED: 40S ribosomal protein S8-like [Cucumis sativus]
 gb|KGN47709.1| hypothetical protein Csa_6G382970 [Cucumis sativus]
Length=222

 Score =   188 bits (478),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 117/124 (94%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSS+K++RR+RVRGGNVKWRA R
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSDKSIRRIRVRGGNVKWRAFR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAV+RKTRILDVVYNASNNELVRTQTLVKSA+VQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVSRKTRILDVVYNASNNELVRTQTLVKSAVVQVDAAPFKQWYLQHYGV  120

Query  443  DIGR  454
            DIGR
Sbjct  121  DIGR  124



>emb|CDP15136.1| unnamed protein product [Coffea canephora]
Length=275

 Score =   190 bits (482),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQ ANTKLSS+KTVRR+RVRGGNVKWRALR
Sbjct  55   MGISRDSMHKRRATGGKKKAWRKKRKYELGRQAANTKLSSDKTVRRIRVRGGNVKWRALR  114

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  115  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  174

Query  443  DIGR  454
            DIGR
Sbjct  175  DIGR  178



>ref|XP_006281069.1| hypothetical protein CARUB_v10027092mg [Capsella rubella]
 gb|EOA13967.1| hypothetical protein CARUB_v10027092mg [Capsella rubella]
Length=220

 Score =   188 bits (477),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 117/124 (94%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDS+HKRRATGGK+K WRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKKWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGN+SWGSE VTRKTRILDV YNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNFSWGSETVTRKTRILDVAYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGR  454
            DIGR
Sbjct  121  DIGR  124



>gb|KJB22660.1| hypothetical protein B456_004G059300 [Gossypium raimondii]
Length=212

 Score =   187 bits (476),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 100/111 (90%), Positives = 106/111 (95%), Gaps = 0/111 (0%)
 Frame = +2

Query  161  YELGRQPANTKLSSNKTvrrvrvrggnvKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  340
            YELGRQP NTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSE+VTRKTRILDVVYNA
Sbjct  20   YELGRQPGNTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSESVTRKTRILDVVYNA  79

Query  341  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKSAAAKKETNE  493
            SNNELVRTQTLVKSAI+QVDAAPFKQWYLQHYG+DIGRKKK A+ K+ T E
Sbjct  80   SNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGIDIGRKKKMASKKEATEE  130



>gb|ABL85034.1| ribosomal subunit 8E protein [Brachypodium sylvaticum]
Length=223

 Score =   187 bits (476),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 119/124 (96%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTR+LDVVYN+SNNELVRTQTLVK+AIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRLLDVVYNSSNNELVRTQTLVKNAIVQVDAAPFKQWYLAHYGV  120

Query  443  DIGR  454
            DIGR
Sbjct  121  DIGR  124



>ref|XP_010235437.1| PREDICTED: 40S ribosomal protein S8 isoform X2 [Brachypodium 
distachyon]
Length=226

 Score =   187 bits (476),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 119/124 (96%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTR+LDVVYN+SNNELVRTQTLVK+AIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRLLDVVYNSSNNELVRTQTLVKNAIVQVDAAPFKQWYLTHYGV  120

Query  443  DIGR  454
            DIGR
Sbjct  121  DIGR  124



>ref|XP_003574981.1| PREDICTED: 40S ribosomal protein S8 isoform X1 [Brachypodium 
distachyon]
Length=229

 Score =   187 bits (476),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 119/124 (96%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTR+LDVVYN+SNNELVRTQTLVK+AIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRLLDVVYNSSNNELVRTQTLVKNAIVQVDAAPFKQWYLTHYGV  120

Query  443  DIGR  454
            DIGR
Sbjct  121  DIGR  124



>ref|XP_010243156.1| PREDICTED: 40S ribosomal protein S8-like isoform X1 [Nelumbo 
nucifera]
Length=219

 Score =   187 bits (475),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 120/122 (98%), Positives = 121/122 (99%), Gaps = 0/122 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSE VTRKTRILDVVYNASNNELVRTQTLV+SAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEHVTRKTRILDVVYNASNNELVRTQTLVRSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DI  448
            DI
Sbjct  121  DI  122



>ref|XP_003557224.1| PREDICTED: 40S ribosomal protein S8 [Brachypodium distachyon]
Length=226

 Score =   187 bits (475),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 119/124 (96%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTR+LDVVYN+SNNELVRTQTLVK+AIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRLLDVVYNSSNNELVRTQTLVKNAIVQVDAAPFKQWYLTHYGV  120

Query  443  DIGR  454
            DIGR
Sbjct  121  DIGR  124



>ref|XP_010243157.1| PREDICTED: 40S ribosomal protein S8-like isoform X2 [Nelumbo 
nucifera]
Length=217

 Score =   187 bits (474),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 120/122 (98%), Positives = 121/122 (99%), Gaps = 0/122 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSE VTRKTRILDVVYNASNNELVRTQTLV+SAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEHVTRKTRILDVVYNASNNELVRTQTLVRSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DI  448
            DI
Sbjct  121  DI  122



>emb|CDY35814.1| BnaC09g37460D [Brassica napus]
Length=258

 Score =   188 bits (477),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 118/134 (88%), Positives = 128/134 (96%), Gaps = 3/134 (2%)
 Frame = +2

Query  62   LYSTN---AAMGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvr  232
            L++T    A MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRR+RVR
Sbjct  23   LFATKGIIATMGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVR  82

Query  233  ggnvKWRALRLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPF  412
            GGNVKWRALRLDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRT+TLVKSAIVQVDAAPF
Sbjct  83   GGNVKWRALRLDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPF  142

Query  413  KQWYLQHYGVDIGR  454
            KQWYLQHYGV++GR
Sbjct  143  KQWYLQHYGVEVGR  156



>emb|CDX92472.1| BnaA10g15110D [Brassica napus]
Length=246

 Score =   187 bits (476),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 116/126 (92%), Positives = 124/126 (98%), Gaps = 0/126 (0%)
 Frame = +2

Query  77   AAMGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRA  256
            A MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRR+RVRGGNVKWRA
Sbjct  18   ATMGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRA  77

Query  257  LRLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY  436
            LRLDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYLQHY
Sbjct  78   LRLDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQHY  137

Query  437  GVDIGR  454
            GV++GR
Sbjct  138  GVEVGR  143



>ref|XP_009771719.1| PREDICTED: 40S ribosomal protein S8 [Nicotiana sylvestris]
Length=224

 Score =   186 bits (473),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 119/122 (98%), Positives = 121/122 (99%), Gaps = 0/122 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTK+SSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKISSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEA TRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEATTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DI  448
            DI
Sbjct  121  DI  122



>ref|XP_009120819.1| PREDICTED: 40S ribosomal protein S8-1 [Brassica rapa]
Length=227

 Score =   186 bits (473),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 115/124 (93%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGR  454
            ++GR
Sbjct  121  EVGR  124



>emb|CDX88842.1| BnaA03g08070D [Brassica napus]
Length=239

 Score =   187 bits (474),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +2

Query  59   NLYSTNAAMGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrgg  238
            +L   ++ +GISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRR+RVRGG
Sbjct  5    SLLRLDSVLGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGG  64

Query  239  nvKWRALRLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQ  418
            NVKWRALRLDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQ
Sbjct  65   NVKWRALRLDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQ  124

Query  419  WYLQHYGVDIGR  454
            WYLQHYGV++GR
Sbjct  125  WYLQHYGVEVGR  136



>ref|XP_009596732.1| PREDICTED: 40S ribosomal protein S8 [Nicotiana tomentosiformis]
Length=223

 Score =   186 bits (472),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 118/122 (97%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTK+S NKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKISGNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEA TRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEATTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DI  448
            DI
Sbjct  121  DI  122



>ref|XP_010493138.1| PREDICTED: 40S ribosomal protein S8-1 [Camelina sativa]
Length=223

 Score =   186 bits (471),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 114/124 (92%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNY+WGSEAVTRKTR+LDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYAWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGR  454
            ++GR
Sbjct  121  EVGR  124



>ref|XP_004247043.1| PREDICTED: 40S ribosomal protein S8 [Solanum lycopersicum]
Length=222

 Score =   186 bits (471),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 117/122 (96%), Positives = 121/122 (99%), Gaps = 0/122 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKK+WRKKRKYELGRQPANTKLS+NKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKSWRKKRKYELGRQPANTKLSNNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAI+QVDAAPFKQWYLQHYG 
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGA  120

Query  443  DI  448
            DI
Sbjct  121  DI  122



>ref|XP_010420870.1| PREDICTED: 40S ribosomal protein S8-1-like [Camelina sativa]
Length=223

 Score =   185 bits (470),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 114/124 (92%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNY+WGSEAVTRKTR+LDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYAWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DIGR  454
            ++GR
Sbjct  121  EVGR  124



>gb|EMT18438.1| 40S ribosomal protein S8 [Aegilops tauschii]
Length=225

 Score =   186 bits (471),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 117/124 (94%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGN+SWGSEAVTRKTR+LDVVYN+SNNELVRTQTLVK+AIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNSSNNELVRTQTLVKNAIVQVDAAPFKQWYLTHYGV  120

Query  443  DIGR  454
            +IGR
Sbjct  121  EIGR  124



>ref|XP_006344091.1| PREDICTED: 40S ribosomal protein S8-like [Solanum tuberosum]
Length=223

 Score =   185 bits (470),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 117/122 (96%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGK+K WRKKRKYELGRQ ANTK+SSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKTWRKKRKYELGRQSANTKISSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DI  448
            DI
Sbjct  121  DI  122



>ref|XP_011461093.1| PREDICTED: 40S ribosomal protein S8 [Fragaria vesca subsp. vesca]
 ref|XP_011461096.1| PREDICTED: 40S ribosomal protein S8 [Fragaria vesca subsp. vesca]
Length=225

 Score =   185 bits (470),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 118/124 (95%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWY  HYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYSTHYGV  120

Query  443  DIGR  454
            +IGR
Sbjct  121  EIGR  124



>ref|XP_009602561.1| PREDICTED: 40S ribosomal protein S8-like [Nicotiana tomentosiformis]
Length=224

 Score =   185 bits (469),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 118/122 (97%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTK+S NKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKISGNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEA TRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV
Sbjct  61   LDTGNYSWGSEATTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  443  DI  448
            DI
Sbjct  121  DI  122



>ref|XP_006352532.1| PREDICTED: 40S ribosomal protein S8 [Solanum tuberosum]
Length=221

 Score =   185 bits (469),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 121/129 (94%), Positives = 125/129 (97%), Gaps = 1/129 (1%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSN-KTvrrvrvrggnvKWRAL  259
            MGISRDSMHKRRATGGKKKAWRKKRKYE+GRQ ANTKL  N KTVRR+RVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYEMGRQSANTKLVPNAKTVRRIRVRGGNVKWRAL  60

Query  260  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  439
            RLDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG
Sbjct  61   RLDTGNYSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  120

Query  440  VDIGRKKKS  466
            V+IGRKKKS
Sbjct  121  VEIGRKKKS  129



>ref|NP_001275100.1| putative 40S ribosomal protein S8-like protein [Solanum tuberosum]
 gb|ABB72814.1| putative 40S ribosomal protein S8-like protein [Solanum tuberosum]
Length=221

 Score =   184 bits (468),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 120/129 (93%), Positives = 125/129 (97%), Gaps = 1/129 (1%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSN-KTvrrvrvrggnvKWRAL  259
            MGISRDSMHKRRATGGKKK+WRKKRKYE+GRQ ANTKL  N KTVRR+RVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRATGGKKKSWRKKRKYEMGRQSANTKLVPNAKTVRRIRVRGGNVKWRAL  60

Query  260  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  439
            RLDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG
Sbjct  61   RLDTGNYSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  120

Query  440  VDIGRKKKS  466
            V+IGRKKKS
Sbjct  121  VEIGRKKKS  129



>gb|AFW73090.1| putative ribosomal protein S8e family protein [Zea mays]
Length=423

 Score =   190 bits (483),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 102/111 (92%), Positives = 105/111 (95%), Gaps = 0/111 (0%)
 Frame = +2

Query  161  YELGRQPANTKLSSNKTvrrvrvrggnvKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  340
            YELGRQPANTKLSSNKTVRRV VRGGNVKWRALRLDTGNYSWGSEA+TRKTRILDVVYNA
Sbjct  193  YELGRQPANTKLSSNKTVRRVCVRGGNVKWRALRLDTGNYSWGSEALTRKTRILDVVYNA  252

Query  341  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKSAAAKKETNE  493
            SNNELVRTQTLVKSAIVQVDAAPFKQWYL HYGVDIGRKKK + AKK+  E
Sbjct  253  SNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGVDIGRKKKVSVAKKDATE  303



>dbj|BAJ89904.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=225

 Score =   184 bits (467),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 116/124 (94%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGN+SWGSEA TRKTR+LDVVYN+SNNELVRTQTLVK+AIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNFSWGSEATTRKTRLLDVVYNSSNNELVRTQTLVKNAIVQVDAAPFKQWYLTHYGV  120

Query  443  DIGR  454
            +IGR
Sbjct  121  EIGR  124



>ref|XP_010520566.1| PREDICTED: 40S ribosomal protein S8-1-like [Tarenaya hassleriana]
Length=224

 Score =   183 bits (465),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDS+HKRRATGGK+K WRKKRKYELGR  ANTKLSSNKTVRR+RVRGGN+KWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYELGRVAANTKLSSNKTVRRLRVRGGNIKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGN+SWGSEA TRK+RILDVVYNASNNELVRT+TLVKSAIVQ+DAAPFKQWYL HYGV
Sbjct  61   LDTGNFSWGSEAATRKSRILDVVYNASNNELVRTKTLVKSAIVQIDAAPFKQWYLSHYGV  120

Query  443  DIGRKKKSAAAKKETNE  493
            ++GRKKK++A+  +  E
Sbjct  121  EVGRKKKASASSGKKEE  137



>gb|ABK21933.1| unknown [Picea sitchensis]
Length=221

 Score =   183 bits (464),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 115/124 (93%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDS+HK+RATGGKKK WRKKRKYELGRQP+ TKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSLHKKRATGGKKKVWRKKRKYELGRQPSMTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAI+QVDAAPF+QWY QHYG+
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFRQWYEQHYGL  120

Query  443  DIGR  454
            DIGR
Sbjct  121  DIGR  124



>gb|ABK22298.1| unknown [Picea sitchensis]
Length=222

 Score =   183 bits (464),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 115/124 (93%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDS+HK+RATGGKKK WRKKRKYELGRQP+ TKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSLHKKRATGGKKKVWRKKRKYELGRQPSMTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAI+QVDAAPF+QWY QHYG+
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFRQWYEQHYGL  120

Query  443  DIGR  454
            DIGR
Sbjct  121  DIGR  124



>gb|ABK21921.1| unknown [Picea sitchensis]
Length=221

 Score =   183 bits (464),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 115/124 (93%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDS+HK+RATGGKKK WRKKRKYELGRQP+ TKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSLHKKRATGGKKKVWRKKRKYELGRQPSMTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAI+QVDAAPF+QWY QHYG+
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFRQWYEQHYGL  120

Query  443  DIGR  454
            DIGR
Sbjct  121  DIGR  124



>ref|XP_010097296.1| 40S ribosomal protein S8 [Morus notabilis]
 gb|EXB67448.1| 40S ribosomal protein S8 [Morus notabilis]
Length=215

 Score =   181 bits (460),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 98/103 (95%), Positives = 102/103 (99%), Gaps = 0/103 (0%)
 Frame = +2

Query  161  YELGRQPANTKLSSNKTvrrvrvrggnvKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  340
            YELGRQ ANTKLSS+KTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  20   YELGRQSANTKLSSDKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  79

Query  341  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKSA  469
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKK++
Sbjct  80   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKTS  122



>ref|NP_197529.1| 40S ribosomal protein S8-1 [Arabidopsis thaliana]
 sp|Q93VG5.1|RS81_ARATH RecName: Full=40S ribosomal protein S8-1 [Arabidopsis thaliana]
 gb|AAK93614.1| unknown protein [Arabidopsis thaliana]
 gb|AAK96530.1| AT5g20290/F5O24_180 [Arabidopsis thaliana]
 gb|AAL31236.1| AT5g20290/F5O24_180 [Arabidopsis thaliana]
 gb|AAM14111.1| unknown protein [Arabidopsis thaliana]
 gb|AAM64526.1| 40S ribosomal protein S8-like [Arabidopsis thaliana]
 dbj|BAE98439.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED92825.1| 40S ribosomal protein S8-1 [Arabidopsis thaliana]
Length=222

 Score =   182 bits (461),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 113/124 (91%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDS+HKRRATGGK+K WRKKRKYE+GRQPANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEA TRKTR+LDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYL HYGV
Sbjct  61   LDTGNYSWGSEATTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLSHYGV  120

Query  443  DIGR  454
            ++GR
Sbjct  121  ELGR  124



>gb|EMS65111.1| 40S ribosomal protein S8 [Triticum urartu]
Length=274

 Score =   183 bits (464),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 117/126 (93%), Positives = 123/126 (98%), Gaps = 0/126 (0%)
 Frame = +2

Query  77   AAMGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRA  256
            A  GISRDSMHKRRATGGK+KAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRA
Sbjct  48   AGAGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRA  107

Query  257  LRLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY  436
            LRLDTGN+SWGSEAVTRKTR+LDVVYN+SNNELVRTQTLVK+AIVQVDAAPFKQWYL HY
Sbjct  108  LRLDTGNFSWGSEAVTRKTRLLDVVYNSSNNELVRTQTLVKNAIVQVDAAPFKQWYLTHY  167

Query  437  GVDIGR  454
            GV+IGR
Sbjct  168  GVEIGR  173



>gb|ABR16896.1| unknown [Picea sitchensis]
Length=221

 Score =   181 bits (459),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 114/124 (92%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDS+HK+RATGGKKK WRKKRKYELGRQP+ TKLSSNKTVRRVRVRGGNVKWRALR
Sbjct  1    MGISRDSLHKKRATGGKKKVWRKKRKYELGRQPSMTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSE VTRKTRILDVVYNASNNELVRTQTLVKSAI+QVDAAPF+QWY QHYG+
Sbjct  61   LDTGNYSWGSEPVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFRQWYEQHYGL  120

Query  443  DIGR  454
            DIGR
Sbjct  121  DIGR  124



>ref|XP_007049645.1| 40S ribosomal protein S8 isoform 3 [Theobroma cacao]
 gb|EOX93802.1| 40S ribosomal protein S8 isoform 3 [Theobroma cacao]
Length=195

 Score =   180 bits (457),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/98 (99%), Positives = 98/98 (100%), Gaps = 0/98 (0%)
 Frame = +2

Query  161  YELGRQPANTKLSSNKTvrrvrvrggnvKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  340
            YELGRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  9    YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  68

Query  341  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGR  454
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGR
Sbjct  69   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGR  106



>gb|KJB62960.1| hypothetical protein B456_009G445800 [Gossypium raimondii]
Length=211

 Score =   181 bits (458),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/98 (99%), Positives = 98/98 (100%), Gaps = 0/98 (0%)
 Frame = +2

Query  161  YELGRQPANTKLSSNKTvrrvrvrggnvKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  340
            YELGRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  20   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  79

Query  341  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGR  454
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGR
Sbjct  80   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGR  117



>gb|EPS68663.1| hypothetical protein M569_06106, partial [Genlisea aurea]
Length=217

 Score =   181 bits (458),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 127/137 (93%), Gaps = 1/137 (1%)
 Frame = +2

Query  86   GISRDSMHkrratggkkkawrkkrkYELGRQPANTKL-SSNKTvrrvrvrggnvKWRALR  262
            GISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKL ++ KTVRRVRVRGGNVKWRALR
Sbjct  1    GISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLDTTQKTVRRVRVRGGNVKWRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            L+TGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIV VDAAPFKQWY  HYGV
Sbjct  61   LNTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVMVDAAPFKQWYSTHYGV  120

Query  443  DIGRKKKSAAAKKETNE  493
            +IG+KKKS A + E  E
Sbjct  121  EIGKKKKSNAKRDEPTE  137



>emb|CBI39377.3| unnamed protein product [Vitis vinifera]
Length=214

 Score =   181 bits (458),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/98 (100%), Positives = 98/98 (100%), Gaps = 0/98 (0%)
 Frame = +2

Query  161  YELGRQPANTKLSSNKTvrrvrvrggnvKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  340
            YELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  20   YELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  79

Query  341  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGR  454
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGR
Sbjct  80   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGR  117



>ref|XP_004244061.1| PREDICTED: 40S ribosomal protein S8-like [Solanum lycopersicum]
Length=221

 Score =   181 bits (458),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 121/125 (97%), Gaps = 1/125 (1%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSN-KTvrrvrvrggnvKWRAL  259
            MGISRDSMHKRRATGGK+K WRKKRKYELGRQPANTKL  N KTVRR+RVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRATGGKQKTWRKKRKYELGRQPANTKLVPNAKTVRRIRVRGGNVKWRAL  60

Query  260  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  439
            RLDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAI+QVDAAPFKQWYLQHYG
Sbjct  61   RLDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYG  120

Query  440  VDIGR  454
            V+IGR
Sbjct  121  VEIGR  125



>gb|KJB81682.1| hypothetical protein B456_013G156600 [Gossypium raimondii]
Length=196

 Score =   180 bits (456),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 96/98 (98%), Positives = 98/98 (100%), Gaps = 0/98 (0%)
 Frame = +2

Query  161  YELGRQPANTKLSSNKTvrrvrvrggnvKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  340
            YELGRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  6    YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  65

Query  341  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGR  454
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG+DIGR
Sbjct  66   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGIDIGR  103



>ref|XP_006369983.1| hypothetical protein POPTR_0001s37140g [Populus trichocarpa]
 gb|ERP66552.1| hypothetical protein POPTR_0001s37140g [Populus trichocarpa]
Length=199

 Score =   179 bits (455),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 104/111 (94%), Positives = 108/111 (97%), Gaps = 0/111 (0%)
 Frame = +2

Query  161  YELGRQPANTKLSSNKTvrrvrvrggnvKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  340
            YELGRQPA+TKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  8    YELGRQPASTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  67

Query  341  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKSAAAKKETNE  493
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG+DIGRKKK+ AAKKE  E
Sbjct  68   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGIDIGRKKKTTAAKKEGEE  118



>ref|XP_008660669.1| PREDICTED: 40S ribosomal protein S8-like [Zea mays]
Length=152

 Score =   177 bits (450),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = +2

Query  161  YELGRQPANTKLSSNKTvrrvrvrggnvKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  340
            YELGRQPANTKLSSNKTVRRVRVRGGN KWRALR DT NYSWGSEA+TRKTRILDVVY A
Sbjct  31   YELGRQPANTKLSSNKTVRRVRVRGGNTKWRALRFDTCNYSWGSEALTRKTRILDVVYIA  90

Query  341  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKSAAAKKE  484
            +NNELVRTQTLVKSAIVQVDAAPFKQWYL HYGVDIGRKKK + AKK+
Sbjct  91   TNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGVDIGRKKKVSVAKKD  138



>gb|AET01418.2| 40S ribosomal protein S8 [Medicago truncatula]
Length=288

 Score =   182 bits (461),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = +2

Query  68   STNAAMGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvK  247
             ++A   ISRDS  KR ATGGK+K   KKRKYELGRQPANTKLSSNKTVR +RVRGGN+K
Sbjct  67   CSSACACISRDSRDKRLATGGKRKTCIKKRKYELGRQPANTKLSSNKTVRSIRVRGGNLK  126

Query  248  WRALRLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL  427
             RALRLDTGN SWGSEAVTRK+R+L+VVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL
Sbjct  127  CRALRLDTGNISWGSEAVTRKSRLLNVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL  186

Query  428  QHYGVDIGRKKKSAA  472
            QHYGV+IG KKK+AA
Sbjct  187  QHYGVEIGNKKKTAA  201



>gb|KHG14255.1| 40S ribosomal S8 [Gossypium arboreum]
Length=210

 Score =   178 bits (452),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 95/98 (97%), Positives = 98/98 (100%), Gaps = 0/98 (0%)
 Frame = +2

Query  161  YELGRQPANTKLSSNKTvrrvrvrggnvKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  340
            YELGRQPANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEA+TRKTRILDVVYNA
Sbjct  20   YELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEALTRKTRILDVVYNA  79

Query  341  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGR  454
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG+DIGR
Sbjct  80   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGIDIGR  117



>gb|AFW85401.1| putative ribosomal protein S8e family protein [Zea mays]
Length=191

 Score =   177 bits (450),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = +2

Query  161  YELGRQPANTKLSSNKTvrrvrvrggnvKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  340
            YELGRQPANTKLSSNKTVRRVRVRGGN KWRALR DT NYSWGSEA+TRKTRILDVVY A
Sbjct  70   YELGRQPANTKLSSNKTVRRVRVRGGNTKWRALRFDTCNYSWGSEALTRKTRILDVVYIA  129

Query  341  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKSAAAKKE  484
            +NNELVRTQTLVKSAIVQVDAAPFKQWYL HYGVDIGRKKK + AKK+
Sbjct  130  TNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGVDIGRKKKVSVAKKD  177



>ref|XP_006652189.1| PREDICTED: 40S ribosomal protein S8-like [Oryza brachyantha]
Length=214

 Score =   178 bits (452),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 97/98 (99%), Positives = 97/98 (99%), Gaps = 0/98 (0%)
 Frame = +2

Query  161  YELGRQPANTKLSSNKTvrrvrvrggnvKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  340
            YELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  20   YELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  79

Query  341  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGR  454
            SNNELVRTQTLVKSAIVQVDAAPFKQWYL HYGVDIGR
Sbjct  80   SNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGVDIGR  117



>gb|EPS68749.1| hypothetical protein M569_06019 [Genlisea aurea]
Length=411

 Score =   183 bits (465),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 128/137 (93%), Gaps = 1/137 (1%)
 Frame = +2

Query  86   GISRDSMHkrratggkkkawrkkrkYELGRQPANTKL-SSNKTvrrvrvrggnvKWRALR  262
            GISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKL ++ KTVRR+RVRGGNVKWRALR
Sbjct  194  GISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLDTTTKTVRRIRVRGGNVKWRALR  253

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            L+TGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIV VDA PFKQWYL HYGV
Sbjct  254  LNTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVMVDATPFKQWYLTHYGV  313

Query  443  DIGRKKKSAAAKKETNE  493
            DIG+K+K  AAKK+  E
Sbjct  314  DIGKKRKLPAAKKDEAE  330



>ref|XP_006648644.1| PREDICTED: 40S ribosomal protein S8-like [Oryza brachyantha]
Length=213

 Score =   177 bits (450),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 96/98 (98%), Positives = 97/98 (99%), Gaps = 0/98 (0%)
 Frame = +2

Query  161  YELGRQPANTKLSSNKTvrrvrvrggnvKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  340
            YELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTR+LDVVYNA
Sbjct  20   YELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRVLDVVYNA  79

Query  341  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGR  454
            SNNELVRTQTLVKSAIVQVDAAPFKQWYL HYGVDIGR
Sbjct  80   SNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGVDIGR  117



>emb|CBI26725.3| unnamed protein product [Vitis vinifera]
Length=212

 Score =   177 bits (449),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/98 (97%), Positives = 98/98 (100%), Gaps = 0/98 (0%)
 Frame = +2

Query  161  YELGRQPANTKLSSNKTvrrvrvrggnvKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  340
            YELGRQPA+TKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  20   YELGRQPASTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  79

Query  341  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGR  454
            SNNELVRTQTLVKSAI+QVDAAPFKQWYLQHYG+DIGR
Sbjct  80   SNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGLDIGR  117



>tpg|DAA42540.1| TPA: putative ribosomal protein S8e family protein [Zea mays]
Length=245

 Score =   178 bits (452),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = +2

Query  161  YELGRQPANTKLSSNKTvrrvrvrggnvKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  340
            YELGR PANTKLSSNKTVRRV VRGGNVKWRALRLDT NYSWGSEA+TRKTRILDVVYNA
Sbjct  120  YELGRHPANTKLSSNKTVRRVCVRGGNVKWRALRLDTCNYSWGSEALTRKTRILDVVYNA  179

Query  341  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKSAAAKKE  484
            SNNELVRTQTLVKSAIVQVDAAPFKQWYL HYGVDIGRKKK   A ++
Sbjct  180  SNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGVDIGRKKKVHVANED  227



>gb|AAT08014.1| putative 40S ribosomal protein S8 [Zea mays]
Length=245

 Score =   178 bits (451),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = +2

Query  161  YELGRQPANTKLSSNKTvrrvrvrggnvKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  340
            YELGRQPANTKLSSNKTVRRVRVRGGN KWRALR DT NYSWGSEA+TRKTRILDVVY A
Sbjct  124  YELGRQPANTKLSSNKTVRRVRVRGGNTKWRALRFDTCNYSWGSEALTRKTRILDVVYIA  183

Query  341  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKSAAAKKE  484
            +NNELVRTQTLVKSAIVQVDAAPFKQWYL HYGVDIGRKKK + AKK+
Sbjct  184  TNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGVDIGRKKKVSVAKKD  231



>ref|XP_008676011.1| PREDICTED: 40S ribosomal protein S8-like [Zea mays]
Length=335

 Score =   179 bits (454),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 97/111 (87%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = +2

Query  161  YELGRQPANTKLSSNKTvrrvrvrggnvKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  340
            YELGRQPANTKLSSN+TVRRV VRGGN KWRALRLDTGN SWGSEA+ RKT ILDVVYNA
Sbjct  149  YELGRQPANTKLSSNETVRRVHVRGGNAKWRALRLDTGNCSWGSEALIRKTHILDVVYNA  208

Query  341  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKSAAAKKETNE  493
            SNNELVRTQTLVKSAIVQVDAAPFKQWYL HYGVDIGRKKK   AKK+  E
Sbjct  209  SNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGVDIGRKKKVHVAKKDDTE  259



>ref|XP_011089042.1| PREDICTED: 40S ribosomal protein S8-like [Sesamum indicum]
Length=220

 Score =   175 bits (443),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 124/138 (90%), Positives = 129/138 (93%), Gaps = 1/138 (1%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSS-NKTvrrvrvrggnvKWRAL  259
            MGISRDSMHKRRATGGKKK+WRKKRKYELGRQPANTKL +  KTVRR+RVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRATGGKKKSWRKKRKYELGRQPANTKLDTLQKTVRRIRVRGGNVKWRAL  60

Query  260  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  439
            RL+TGNYSWGSEA+TRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HYG
Sbjct  61   RLNTGNYSWGSEAITRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYG  120

Query  440  VDIGRKKKSAAAKKETNE  493
            VDIGRKKK AA K E  E
Sbjct  121  VDIGRKKKGAAKKDEAEE  138



>gb|AFW85400.1| putative ribosomal protein S8e family protein [Zea mays]
Length=397

 Score =   180 bits (456),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = +2

Query  161  YELGRQPANTKLSSNKTvrrvrvrggnvKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  340
            YELGRQPANTKLSSNKTVRRVRVRGGN KWRALR DT NYSWGSEA+TRKTRILDVVY A
Sbjct  276  YELGRQPANTKLSSNKTVRRVRVRGGNTKWRALRFDTCNYSWGSEALTRKTRILDVVYIA  335

Query  341  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKSAAAKKE  484
            +NNELVRTQTLVKSAIVQVDAAPFKQWYL HYGVDIGRKKK + AKK+
Sbjct  336  TNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGVDIGRKKKVSVAKKD  383



>gb|AES86897.2| 40S ribosomal S8-like protein [Medicago truncatula]
Length=218

 Score =   174 bits (440),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 93/111 (84%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = +2

Query  161  YELGRQPANTKLSSNKTvrrvrvrggnvKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  340
            YELGRQPANTKLSSNKT+R +RVRGGNVK RALRLDTGN SWGSEAVTRKTR+L+VVYNA
Sbjct  27   YELGRQPANTKLSSNKTLRTIRVRGGNVKCRALRLDTGNCSWGSEAVTRKTRLLNVVYNA  86

Query  341  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKSAAAKKETNE  493
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV+IG  KK++  K    E
Sbjct  87   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEIGSAKKTSGKKDSAEE  137



>ref|XP_003604700.1| Ribosomal protein S8 [Medicago truncatula]
Length=280

 Score =   174 bits (440),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 93/111 (84%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = +2

Query  161  YELGRQPANTKLSSNKTvrrvrvrggnvKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  340
            YELGRQPANTKLSSNKT+R +RVRGGNVK RALRLDTGN SWGSEAVTRKTR+L+VVYNA
Sbjct  8    YELGRQPANTKLSSNKTLRTIRVRGGNVKCRALRLDTGNCSWGSEAVTRKTRLLNVVYNA  67

Query  341  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKSAAAKKETNE  493
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV+IG  KK++  K    E
Sbjct  68   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEIGSAKKTSGKKDSAEE  118



>ref|XP_001761026.1| predicted protein [Physcomitrella patens]
 gb|EDQ74093.1| predicted protein [Physcomitrella patens]
Length=216

 Score =   171 bits (432),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 110/123 (89%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDS HKRRATGGKKK+WRKKRKYELGRQ A TKLSSNKTVRR+RVRGGN K+RALR
Sbjct  1    MGISRDSTHKRRATGGKKKSWRKKRKYELGRQGAMTKLSSNKTVRRIRVRGGNSKFRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRTQTLVK+AIVQVDAAPF+ WY QHYGV
Sbjct  61   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTQTLVKNAIVQVDAAPFRTWYSQHYGV  120

Query  443  DIG  451
            +IG
Sbjct  121  EIG  123



>ref|XP_001773385.1| predicted protein [Physcomitrella patens]
 gb|EDQ61758.1| predicted protein [Physcomitrella patens]
Length=216

 Score =   169 bits (428),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 109/123 (89%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDS HKRRATGGKKK+WRKKRKYELGRQ A TKLSSNKTVRR+RVRGGN K+RALR
Sbjct  1    MGISRDSTHKRRATGGKKKSWRKKRKYELGRQGAMTKLSSNKTVRRIRVRGGNSKFRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGN+SWGSEAVTRKTRILDVVYNASNNELVRTQTLVK+AI+QVDAAPF+ WY QHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKNAIIQVDAAPFRTWYSQHYGV  120

Query  443  DIG  451
            +IG
Sbjct  121  EIG  123



>ref|XP_004513783.1| PREDICTED: 40S ribosomal protein S8-like [Cicer arietinum]
Length=112

 Score =   166 bits (419),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +2

Query  161  YELGRQPANTKLSSNKTvrrvrvrggnvKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  340
            YELGRQP NTKLS NKT+RR+RV+G  VKW+ LRL+TGN+SWGSE VTRKTR+LDVVYN 
Sbjct  9    YELGRQPTNTKLSINKTIRRIRVQGSTVKWKTLRLNTGNFSWGSEVVTRKTRLLDVVYNP  68

Query  341  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKSAA  472
             NNELVRT TLVKSAIVQVD APF+QWYLQHYGV+IGRKKKSAA
Sbjct  69   LNNELVRTHTLVKSAIVQVDDAPFRQWYLQHYGVEIGRKKKSAA  112



>gb|ABR13294.1| putative 40S ribosomal protein S8 [Prunus dulcis]
Length=140

 Score =   166 bits (420),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 110/116 (95%), Positives = 114/116 (98%), Gaps = 0/116 (0%)
 Frame = +2

Query  74   NAAMGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWR  253
            +  MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRR+RVRGGNVKWR
Sbjct  25   SGTMGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWR  84

Query  254  ALRLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQW  421
            ALRLDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQW
Sbjct  85   ALRLDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQW  140



>ref|XP_001777587.1| predicted protein [Physcomitrella patens]
 gb|EDQ57630.1| predicted protein [Physcomitrella patens]
Length=216

 Score =   169 bits (427),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 108/123 (88%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDS HKRRATGGKKK+WRKKRKYELGRQ A TKLSSNKTVRR+RVRGGN K+RALR
Sbjct  1    MGISRDSTHKRRATGGKKKSWRKKRKYELGRQGAMTKLSSNKTVRRIRVRGGNSKFRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVK+AI+QVDAAPF+ WY QHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRVLDVVYNASNNELVRTQTLVKNAIIQVDAAPFRTWYSQHYGV  120

Query  443  DIG  451
            +IG
Sbjct  121  EIG  123



>ref|XP_005648786.1| 40S ribosomal protein S8 [Coccomyxa subellipsoidea C-169]
 gb|EIE24242.1| 40S ribosomal protein S8 [Coccomyxa subellipsoidea C-169]
Length=214

 Score =   168 bits (426),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 107/123 (87%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDS+HKRR TGGK+K WRKKRK+ELGRQPANTKLSSN TVRRVRVRGGN K+RALR
Sbjct  1    MGISRDSLHKRRLTGGKQKTWRKKRKFELGRQPANTKLSSNVTVRRVRVRGGNFKFRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LD+GN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDA PFKQ+Y QHYGV
Sbjct  61   LDSGNFSWGSEAVTRKTRVLDVVYNASNNELVRTQTLVKSAIVQVDATPFKQFYTQHYGV  120

Query  443  DIG  451
            + G
Sbjct  121  EAG  123



>ref|XP_005844426.1| hypothetical protein CHLNCDRAFT_139122 [Chlorella variabilis]
 gb|EFN52324.1| hypothetical protein CHLNCDRAFT_139122 [Chlorella variabilis]
Length=233

 Score =   169 bits (427),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +2

Query  86   GISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALRL  265
            GISRDS+HKRRATGGK+K WRKKRKYELGRQPA TKLSSN  VRRVRVRGGN K+RALRL
Sbjct  19   GISRDSLHKRRATGGKQKPWRKKRKYELGRQPAMTKLSSNVCVRRVRVRGGNSKFRALRL  78

Query  266  DTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVD  445
            D GN+SWGSEAVTRK RILDV YNASNNELVRTQTLVKSAI+Q+DAAPFKQWY QHYG++
Sbjct  79   DHGNFSWGSEAVTRKVRILDVSYNASNNELVRTQTLVKSAIIQIDAAPFKQWYQQHYGLE  138

Query  446  IGRKKKS  466
            +G+KKKS
Sbjct  139  VGQKKKS  145



>ref|XP_001780988.1| predicted protein [Physcomitrella patens]
 gb|EDQ54172.1| predicted protein [Physcomitrella patens]
Length=216

 Score =   168 bits (426),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 108/123 (88%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDS HKRRATGGKKK+WRKKRKYELGRQ A TKLSSNKTVRR+RVRGGN K+RALR
Sbjct  1    MGISRDSTHKRRATGGKKKSWRKKRKYELGRQGAMTKLSSNKTVRRIRVRGGNSKFRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVK+AI+QVDAAPF+ WY QHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRVLDVVYNASNNELVRTQTLVKNAIIQVDAAPFRTWYSQHYGV  120

Query  443  DIG  451
            +IG
Sbjct  121  EIG  123



>ref|XP_001777813.1| predicted protein [Physcomitrella patens]
 gb|EDQ57351.1| predicted protein [Physcomitrella patens]
Length=216

 Score =   168 bits (425),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 108/123 (88%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDS HKRRATGGKKK+WRKKRKYELGRQ A TKLSSNKTVRR+RVRGGN K+RALR
Sbjct  1    MGISRDSTHKRRATGGKKKSWRKKRKYELGRQGAMTKLSSNKTVRRIRVRGGNFKFRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVK+AI+QVDAAPF+ WY QHYGV
Sbjct  61   LDTGNFSWGSEAVTRKTRVLDVVYNASNNELVRTQTLVKNAIIQVDAAPFRTWYSQHYGV  120

Query  443  DIG  451
            +IG
Sbjct  121  EIG  123



>emb|CEG02139.1| Ribosomal protein S8e/ribosomal biogenesis NSA2 [Ostreococcus 
tauri]
Length=217

 Score =   166 bits (421),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 110/136 (81%), Positives = 119/136 (88%), Gaps = 0/136 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDS+HKRRATGGK+K WRKKRKYELGRQPANTKLSSN TVR+VR RGGNVK RALR
Sbjct  1    MGISRDSLHKRRATGGKQKPWRKKRKYELGRQPANTKLSSNVTVRQVRCRGGNVKHRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSE  TRKTRILDVVYNASNNELVRT+TLVKSA+V VDAAPF+ WY QHYG 
Sbjct  61   LDTGNYSWGSENCTRKTRILDVVYNASNNELVRTKTLVKSAVVAVDAAPFRAWYAQHYGK  120

Query  443  DIGRKKKSAAAKKETN  490
             IG K K+ A  +E +
Sbjct  121  KIGIKVKNGAKVEEED  136



>ref|XP_011397165.1| 40S ribosomal protein S8 [Auxenochlorella protothecoides]
 gb|KFM24278.1| 40S ribosomal protein S8 [Auxenochlorella protothecoides]
Length=191

 Score =   165 bits (417),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDS+HKRRATGGK+KAWRKKRKYELGRQPANTKLSSN TVRRVRVRGGN K+RALR
Sbjct  1    MGISRDSLHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNVTVRRVRVRGGNSKFRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LD+GN+SWGSEA TRKTRILDV YNASNNELVRTQTLVK+AI+Q+DAAPFKQWY QHYGV
Sbjct  61   LDSGNFSWGSEATTRKTRILDVSYNASNNELVRTQTLVKNAIIQIDAAPFKQWYQQHYGV  120

Query  443  D  445
            +
Sbjct  121  E  121



>ref|XP_001696201.1| ribosomal protein S8, component of cytosolic 80S ribosome and 
40S small subunit [Chlamydomonas reinhardtii]
 gb|EDP08178.1| ribosomal protein S8 [Chlamydomonas reinhardtii]
Length=208

 Score =   166 bits (419),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDS+HKRRATGG+KK WRKK+KYE+GR PANTKLS+N  VR VRVRGG+ K+RALR
Sbjct  1    MGISRDSLHKRRATGGRKKHWRKKKKYEMGRVPANTKLSTNVAVRTVRVRGGHTKFRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRK RILDVVYNASNNELVRTQTLVK+AIVQVDA PFKQWY +HY V
Sbjct  61   LDTGNYSWGSEAVTRKVRILDVVYNASNNELVRTQTLVKNAIVQVDATPFKQWYQKHYNV  120

Query  443  DIGRKKKSAAAKK  481
            ++G K ++    K
Sbjct  121  ELGAKNQAEIVPK  133



>gb|ABA01100.1| 40S ribosomal protein S8 [Chlamydomonas incerta]
Length=208

 Score =   164 bits (415),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDS+HKRR TGG+KK WRKK+KYE+GR PANTKLS+N  VR VRVRGG+ K+RALR
Sbjct  1    MGISRDSLHKRRDTGGRKKHWRKKKKYEMGRVPANTKLSTNVAVRTVRVRGGHTKFRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRK RILDVVYNASNNELVRTQTLVK+AIVQVDA PFKQWY +HY V
Sbjct  61   LDTGNYSWGSEAVTRKVRILDVVYNASNNELVRTQTLVKNAIVQVDATPFKQWYQKHYNV  120

Query  443  DIGRK  457
            ++G K
Sbjct  121  ELGAK  125



>gb|KDD75705.1| ribosomal protein S8e [Helicosporidium sp. ATCC 50920]
Length=353

 Score =   167 bits (423),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 117/137 (85%), Gaps = 0/137 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDS+HKRRA+G +   WRKKRK+ELGRQPANTKLSSN TVR VR RGGN+K+RALR
Sbjct  1    MGISRDSIHKRRASGARPNIWRKKRKFELGRQPANTKLSSNVTVRPVRCRGGNMKYRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LD+GN+SWGSEA TR+TRIL V YNASNNELVRTQTLVKSAIVQVDAAPFK WY Q YG 
Sbjct  61   LDSGNFSWGSEATTRRTRILSVSYNASNNELVRTQTLVKSAIVQVDAAPFKAWYSQRYGT  120

Query  443  DIGRKKKSAAAKKETNE  493
            ++GRKK +   K+  +E
Sbjct  121  ELGRKKAAEEEKEPVSE  137



>ref|XP_002945874.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ52869.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
Length=209

 Score =   162 bits (411),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDS+HKRRATGG+KK WRKK+KYE+GR PANTKLSSN  VR VRVRGG+ K+RALR
Sbjct  1    MGISRDSLHKRRATGGRKKHWRKKKKYEMGRVPANTKLSSNVAVRTVRVRGGHTKFRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGNYSWGSEAVTRK RILDVVYNASNNELVRTQTLVK+AIVQVDA  FKQWY +HY V
Sbjct  61   LDTGNYSWGSEAVTRKVRILDVVYNASNNELVRTQTLVKNAIVQVDATQFKQWYQKHYNV  120

Query  443  DIGRKK  460
            ++G KK
Sbjct  121  ELGAKK  126



>ref|XP_001422585.1| Ribosomal protein S8, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABP00902.1| Ribosomal protein S8, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
Length=220

 Score =   163 bits (412),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDS+HKRRATGGK+K WRKKRKYELGRQPANTKLSSN TVR+VR RGGN+K RALR
Sbjct  1    MGISRDSLHKRRATGGKQKPWRKKRKYELGRQPANTKLSSNVTVRQVRCRGGNIKHRALR  60

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGN++WGSE  TRKTRILDVVYNASNNELVRT+TLVKSA++ VDAAPF+ WY QHYG 
Sbjct  61   LDTGNFAWGSENCTRKTRILDVVYNASNNELVRTKTLVKSAVIAVDAAPFRAWYAQHYGK  120

Query  443  DIGRKKKSAA  472
             IG K K+ A
Sbjct  121  KIGIKVKNGA  130



>ref|XP_002963298.1| hypothetical protein SELMODRAFT_80565, partial [Selaginella moellendorffii]
 ref|XP_002974597.1| hypothetical protein SELMODRAFT_101634, partial [Selaginella 
moellendorffii]
 gb|EFJ24117.1| hypothetical protein SELMODRAFT_101634, partial [Selaginella 
moellendorffii]
 gb|EFJ35169.1| hypothetical protein SELMODRAFT_80565, partial [Selaginella moellendorffii]
Length=214

 Score =   162 bits (411),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 109/129 (84%), Positives = 118/129 (91%), Gaps = 1/129 (1%)
 Frame = +2

Query  86   GISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALRL  265
            GISRDS+HKRRATGGKKKAWRKKRKYELGRQPA TKL++ KTVRR+RVRGGN K RALRL
Sbjct  1    GISRDSLHKRRATGGKKKAWRKKRKYELGRQPAMTKLAA-KTVRRIRVRGGNFKLRALRL  59

Query  266  DTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVD  445
            D GNYSWG+EAV RKTRIL+VVYNASNNELVRTQTLVKSAIVQVDA PF+ WY QHYGVD
Sbjct  60   DAGNYSWGTEAVARKTRILEVVYNASNNELVRTQTLVKSAIVQVDATPFRAWYNQHYGVD  119

Query  446  IGRKKKSAA  472
            + RKKK +A
Sbjct  120  LSRKKKPSA  128



>gb|EPZ31448.1| 40S ribosomal protein S8-B [Rozella allomycis CSF55]
Length=205

 Score =   161 bits (407),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 114/137 (83%), Gaps = 1/137 (1%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDS HKR  TG K+  +RKKRK+ELGRQPANTKL + K +  VRVRGGN K+RA+R
Sbjct  1    MGISRDSRHKRSHTGAKRAQYRKKRKFELGRQPANTKLGA-KRIHPVRVRGGNTKFRAMR  59

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGN+SWGSEA+TRKTRI+DVVYNASNNELVRT+TLVKSAIVQ+DA PF+QWY  HYG 
Sbjct  60   LDTGNFSWGSEAITRKTRIIDVVYNASNNELVRTKTLVKSAIVQIDATPFRQWYEAHYGS  119

Query  443  DIGRKKKSAAAKKETNE  493
             +G+KK + AA  E  +
Sbjct  120  LLGKKKLAKAASTEAGD  136



>emb|CCA22399.1| 40S ribosomal protein S82 putative [Albugo laibachii Nc14]
Length=206

 Score =   159 bits (401),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 102/137 (74%), Positives = 116/137 (85%), Gaps = 1/137 (1%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDS HKRR TGGK+K +RKKRK+ELGRQPANTKL   K V RVRVRGG+ K+RALR
Sbjct  1    MGISRDSRHKRRDTGGKRKQYRKKRKFELGRQPANTKLG-GKRVHRVRVRGGHFKFRALR  59

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            L+TGN+SWGSEAV+RKTRILDVVYNASNNELVRT+TLVKSAIV +DA PF+QWY  HYGV
Sbjct  60   LETGNFSWGSEAVSRKTRILDVVYNASNNELVRTKTLVKSAIVSIDATPFRQWYETHYGV  119

Query  443  DIGRKKKSAAAKKETNE  493
             IG+KK +   +K   E
Sbjct  120  KIGQKKNAETTEKVEQE  136



>gb|AFW62789.1| putative ribosomal protein S8e family protein [Zea mays]
Length=238

 Score =   159 bits (401),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 88/91 (97%), Positives = 89/91 (98%), Gaps = 0/91 (0%)
 Frame = +2

Query  161  YELGRQPANTKLSSNKTvrrvrvrggnvKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  340
            YELGRQPANTKLSSNKTVRRVRVRGGN KWRALRLDTGNYSWGSEA+TRKTRILDVVYNA
Sbjct  139  YELGRQPANTKLSSNKTVRRVRVRGGNTKWRALRLDTGNYSWGSEALTRKTRILDVVYNA  198

Query  341  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQH  433
            SNNELVRTQTLVKSAIVQVDAAPFKQWYL H
Sbjct  199  SNNELVRTQTLVKSAIVQVDAAPFKQWYLTH  229



>ref|XP_004516802.1| PREDICTED: 40S ribosomal protein S8-like [Cicer arietinum]
Length=312

 Score =   160 bits (406),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 86/98 (88%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = +2

Query  161  YELGRQPANTKLSSNKTvrrvrvrggnvKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  340
            YELGRQ A+TKLSSNKT+RR+RVRGGNVKWR LR DTGN+SWGSEAVTRKTR+LD+VYNA
Sbjct  21   YELGRQLASTKLSSNKTIRRIRVRGGNVKWRDLRWDTGNFSWGSEAVTRKTRLLDMVYNA  80

Query  341  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGR  454
            SNNELVRTQTLVK+AIVQVD APFKQWYLQHYGV+IGR
Sbjct  81   SNNELVRTQTLVKNAIVQVDVAPFKQWYLQHYGVEIGR  118



>ref|XP_010539242.1| PREDICTED: 40S ribosomal protein S8-1-like, partial [Tarenaya 
hassleriana]
Length=180

 Score =   156 bits (394),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/85 (88%), Positives = 80/85 (94%), Gaps = 2/85 (2%)
 Frame = +2

Query  245  KWRALRLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWY  424
            KWRALRLDTGNYSWGSEAVTRKTRILDVVYN+SNNELVRT+TLVKSAIVQVDAAPFKQWY
Sbjct  14   KWRALRLDTGNYSWGSEAVTRKTRILDVVYNSSNNELVRTKTLVKSAIVQVDAAPFKQWY  73

Query  425  LQHYGVDIGRKKKSA--AAKKETNE  493
            LQHYGV++GRKKK+A  A KKE  E
Sbjct  74   LQHYGVEVGRKKKTAATAGKKEGEE  98



>ref|XP_005702569.1| 40S ribosomal protein S8e [Galdieria sulphuraria]
 gb|EME26049.1| 40S ribosomal protein S8e [Galdieria sulphuraria]
Length=207

 Score =   156 bits (394),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 116/137 (85%), Gaps = 1/137 (1%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGI+RD++HKRR TGGKK  WRKKRKY LGRQPANTKL   K VR VRVRGGN K+RALR
Sbjct  1    MGITRDTLHKRRLTGGKKAVWRKKRKYNLGRQPANTKLGP-KAVRPVRVRGGNYKFRALR  59

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGN+SWGSE+ +RKTRI+ VVYNASNNELVRT TLVK  IVQ+DA PF+QWY QHYG+
Sbjct  60   LDTGNFSWGSESTSRKTRIVAVVYNASNNELVRTNTLVKGCIVQIDATPFRQWYSQHYGI  119

Query  443  DIGRKKKSAAAKKETNE  493
            +IG+KKK  A ++E ++
Sbjct  120  EIGKKKKDDAQQEEQSQ  136



>ref|XP_008676181.1| PREDICTED: thioredoxin domain-containing protein 9 homolog [Zea 
mays]
Length=264

 Score =   157 bits (397),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 88/96 (92%), Gaps = 5/96 (5%)
 Frame = +2

Query  161  YELGRQPANTKLSSNKTvrrvrvrggnvKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  340
            YELGRQPANTKLSSNKTVRRV VRGGN KWRALRLDTGNYSWGSEA+TRKTRILDVVYNA
Sbjct  46   YELGRQPANTKLSSNKTVRRVCVRGGNTKWRALRLDTGNYSWGSEALTRKTRILDVVYNA  105

Query  341  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDI  448
            S     RTQTLVKSAIVQVDAAPFKQWYL HYGVDI
Sbjct  106  S-----RTQTLVKSAIVQVDAAPFKQWYLTHYGVDI  136



>ref|XP_005708143.1| 40S ribosomal protein S8 [Galdieria sulphuraria]
 gb|EME31623.1| 40S ribosomal protein S8 [Galdieria sulphuraria]
Length=175

 Score =   154 bits (389),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 116/137 (85%), Gaps = 1/137 (1%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGI+RD++HKRR TGGKK  WRKKRKY LGRQPANTKL   K VR VRVRGGN K+RALR
Sbjct  1    MGITRDTLHKRRLTGGKKAVWRKKRKYNLGRQPANTKLGP-KAVRPVRVRGGNYKFRALR  59

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            LDTGN+SWGSE+ +RKTRI+ VVYNASNNELVRT TLVK  IVQ+DA PF+QWY QHYG+
Sbjct  60   LDTGNFSWGSESTSRKTRIVAVVYNASNNELVRTNTLVKGCIVQIDATPFRQWYSQHYGI  119

Query  443  DIGRKKKSAAAKKETNE  493
            +IG+KKK  A ++E ++
Sbjct  120  EIGKKKKDDAQQEEQSQ  136



>ref|XP_004367925.1| ribosomal protein S8e, putative [Acanthamoeba castellanii str. 
Neff]
 gb|ELR25170.1| ribosomal protein S8e, putative [Acanthamoeba castellanii str. 
Neff]
Length=250

 Score =   155 bits (391),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 107/135 (79%), Gaps = 1/135 (1%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDS HKRRATGGK+K  RKKRK+ELGR PA TKL S +        G   K+RALR
Sbjct  1    MGISRDSKHKRRATGGKRKIHRKKRKFELGRPPALTKLGSQRIHPVRCRGGRI-KYRALR  59

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            L+TGNY+W SEAVTRKTR+L VVYNASNNELVRT TLVKSAIVQ+DA PF+QWY QHYG+
Sbjct  60   LETGNYAWPSEAVTRKTRVLGVVYNASNNELVRTNTLVKSAIVQIDATPFRQWYEQHYGI  119

Query  443  DIGRKKKSAAAKKET  487
            ++G+ K  AAA  +T
Sbjct  120  NLGKAKTGAAAPAKT  134



>emb|CCI48864.1| unnamed protein product [Albugo candida]
Length=206

 Score =   154 bits (388),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 115/137 (84%), Gaps = 1/137 (1%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDS HKRR TGGK+K +RKKRK+ELGRQPANTKL   K V RVRVRGG+ K+RALR
Sbjct  1    MGISRDSRHKRRETGGKRKQFRKKRKFELGRQPANTKLG-GKRVHRVRVRGGHFKFRALR  59

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            L+TGN+SWGSEAV+RKTRILDVVYNASNNELVRT+TLVKSA+V +DA PF+ WY  HYGV
Sbjct  60   LETGNFSWGSEAVSRKTRILDVVYNASNNELVRTKTLVKSAVVSIDATPFRHWYETHYGV  119

Query  443  DIGRKKKSAAAKKETNE  493
             IG KK + + +K   E
Sbjct  120  KIGVKKNTESTEKVEQE  136



>gb|AGH70192.1| 40S ribosomal protein S8 [Placozoa sp. H4]
Length=206

 Score =   152 bits (385),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 110/137 (80%), Gaps = 1/137 (1%)
 Frame = +2

Query  83   MGISRDSMHkrratggkkkawrkkrkYELGRQPANTKLSSNKTvrrvrvrggnvKWRALR  262
            MGISRDS HKRR+T G+K   RKKRK+ELGRQPA TK+ + K +  VR RGGN K+RALR
Sbjct  1    MGISRDSWHKRRSTSGRKAPLRKKRKFELGRQPAMTKMGA-KRIHTVRTRGGNYKYRALR  59

Query  263  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  442
            L+TGNYSW SE+VTRK+RILDVVYNASNNELVRT+TLVK+ IVQ+DA PFKQWY  HY V
Sbjct  60   LETGNYSWASESVTRKSRILDVVYNASNNELVRTKTLVKNCIVQIDATPFKQWYESHYNV  119

Query  443  DIGRKKKSAAAKKETNE  493
             I RKK    A +ET E
Sbjct  120  PIIRKKGKQQAAEETEE  136



>ref|XP_003083062.1| RS8_MAIZE 40S ribosomal protein S8 pir||T04088 ribosomal protein 
S8-maize (ISS) [Ostreococcus tauri]
Length=388

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = +2

Query  161  YELGRQPANTKLSSNKTvrrvrvrggnvKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  340
            YELGRQPANTKLSSN TVR+VR RGGNVK RALRLDTGNYSWGSE  TRKTRILDVVYNA
Sbjct  33   YELGRQPANTKLSSNVTVRQVRCRGGNVKHRALRLDTGNYSWGSENCTRKTRILDVVYNA  92

Query  341  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKKSAAAKKETN  490
            SNNELVRT+TLVKSA+V VDAAPF+ WY QHYG  IG K K+ A  +E +
Sbjct  93   SNNELVRTKTLVKSAVVAVDAAPFRAWYAQHYGKKIGIKVKNGAKVEEED  142



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 555143417780