BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001F13

Length=500
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009766983.1|  PREDICTED: RING-H2 finger protein ATL67-like       153   4e-43   Nicotiana sylvestris
ref|XP_009597583.1|  PREDICTED: RING-H2 finger protein ATL67-like       153   5e-43   Nicotiana tomentosiformis
ref|XP_010326706.1|  PREDICTED: RING-H2 finger protein ATL67-like       149   5e-41   Solanum lycopersicum
ref|XP_006339638.1|  PREDICTED: RING-H2 finger protein ATL67-like       149   6e-41   Solanum tuberosum [potatoes]
ref|XP_011093078.1|  PREDICTED: RING-H2 finger protein ATL68            144   2e-39   Sesamum indicum [beniseed]
gb|EPS71501.1|  hypothetical protein M569_03256                         136   7e-37   Genlisea aurea
ref|XP_011093041.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    140   2e-35   
gb|EYU32179.1|  hypothetical protein MIMGU_mgv1a014108mg                131   9e-35   Erythranthe guttata [common monkey flower]
gb|EPS68076.1|  hypothetical protein M569_06695                         130   4e-34   Genlisea aurea
emb|CDP08747.1|  unnamed protein product                                123   2e-31   Coffea canephora [robusta coffee]
gb|KJB24638.1|  hypothetical protein B456_004G154800                    116   5e-29   Gossypium raimondii
gb|KJB09703.1|  hypothetical protein B456_001G157500                    118   6e-29   Gossypium raimondii
ref|XP_006491198.1|  PREDICTED: RING-H2 finger protein ATL67-like       116   6e-29   
ref|XP_004248065.1|  PREDICTED: RING-H2 finger protein ATL67-like       114   4e-28   Solanum lycopersicum
ref|XP_011037158.1|  PREDICTED: RING-H2 finger protein ATL67            114   5e-28   Populus euphratica
emb|CBI40419.3|  unnamed protein product                                115   7e-28   Vitis vinifera
ref|XP_010559104.1|  PREDICTED: RING-H2 finger protein ATL67-like       113   1e-27   Tarenaya hassleriana [spider flower]
emb|CAN73279.1|  hypothetical protein VITISV_040608                     115   1e-26   Vitis vinifera
ref|XP_010661826.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    115   1e-26   
gb|KDP28554.1|  hypothetical protein JCGZ_14325                         110   2e-26   Jatropha curcas
gb|EYU35114.1|  hypothetical protein MIMGU_mgv1a020271mg                108   4e-26   Erythranthe guttata [common monkey flower]
ref|XP_002320162.1|  zinc finger family protein                         108   5e-26   Populus trichocarpa [western balsam poplar]
gb|KJB41423.1|  hypothetical protein B456_007G103900                    108   5e-26   Gossypium raimondii
ref|XP_010261407.1|  PREDICTED: RING-H2 finger protein ATL67-like       108   8e-26   Nelumbo nucifera [Indian lotus]
ref|XP_009349321.1|  PREDICTED: RING-H2 finger protein ATL67-like       107   2e-25   Pyrus x bretschneideri [bai li]
gb|KFK35351.1|  hypothetical protein AALP_AA5G273400                    106   5e-25   Arabis alpina [alpine rockcress]
ref|XP_010669733.1|  PREDICTED: RING-H2 finger protein ATL67-like       105   7e-25   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007051690.1|  S-adenosyl-L-methionine-dependent methyltran...    110   9e-25   
ref|XP_006291847.1|  hypothetical protein CARUB_v10018022mg             105   9e-25   Capsella rubella
emb|CDY65206.1|  BnaAnng20290D                                          102   2e-23   Brassica napus [oilseed rape]
ref|XP_009142411.1|  PREDICTED: RING-H2 finger protein ATL67-like       102   2e-23   Brassica rapa
emb|CDX71732.1|  BnaC08g31420D                                          102   3e-23   
gb|KEH18782.1|  zinc finger, C3HC4 type (RING finger) protein           101   3e-23   Medicago truncatula
ref|XP_009338797.1|  PREDICTED: uncharacterized protein LOC103931112    105   5e-23   
ref|NP_191714.1|  RING-H2 finger protein ATL68                          100   7e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010512505.1|  PREDICTED: RING-H2 finger protein ATL68 isof...  99.8    2e-22   
ref|XP_010469090.1|  PREDICTED: RING-H2 finger protein ATL68-like...  99.4    3e-22   Camelina sativa [gold-of-pleasure]
ref|XP_006402471.1|  hypothetical protein EUTSA_v10006504mg           99.4    3e-22   
ref|XP_007135149.1|  hypothetical protein PHAVU_010G105200g           97.8    7e-22   Phaseolus vulgaris [French bean]
ref|XP_002876620.1|  zinc finger family protein                       97.8    9e-22   Arabidopsis lyrata subsp. lyrata
ref|XP_010251603.1|  PREDICTED: RING-H2 finger protein ATL67          97.4    1e-21   Nelumbo nucifera [Indian lotus]
emb|CDY27329.1|  BnaC04g50760D                                        97.4    1e-21   Brassica napus [oilseed rape]
ref|XP_006358653.1|  PREDICTED: RING-H2 finger protein ATL67-like     97.1    2e-21   Solanum tuberosum [potatoes]
ref|XP_009116820.1|  PREDICTED: RING-H2 finger protein ATL68          97.1    3e-21   Brassica rapa
ref|XP_009341125.1|  PREDICTED: RING-H2 finger protein ATL67          95.9    4e-21   Pyrus x bretschneideri [bai li]
ref|XP_009607421.1|  PREDICTED: RING-H2 finger protein ATL67-like     94.4    6e-21   
emb|CDY11361.1|  BnaA09g39270D                                        95.5    7e-21   Brassica napus [oilseed rape]
ref|XP_009345625.1|  PREDICTED: RING-H2 finger protein ATL67-like     94.4    1e-20   Pyrus x bretschneideri [bai li]
ref|XP_008343409.1|  PREDICTED: RING-H2 finger protein ATL67-like     94.0    2e-20   
ref|XP_006294928.1|  hypothetical protein CARUB_v10023982mg           93.6    5e-20   
ref|XP_011468973.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  96.3    1e-19   Fragaria vesca subsp. vesca
ref|XP_008375945.1|  PREDICTED: uncharacterized protein LOC103439174  95.9    1e-19   
ref|XP_008232965.1|  PREDICTED: RING-H2 finger protein ATL67          90.1    4e-19   Prunus mume [ume]
ref|NP_182139.1|  RING-H2 finger protein ATL67                        90.1    7e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006397800.1|  hypothetical protein EUTSA_v10001804mg           89.7    9e-19   Eutrema salsugineum [saltwater cress]
ref|XP_009345627.1|  PREDICTED: RING-H2 finger protein ATL67-like     89.0    1e-18   Pyrus x bretschneideri [bai li]
emb|CDX79992.1|  BnaA05g01640D                                        89.4    1e-18   
emb|CDY42011.1|  BnaC04g00890D                                        89.4    1e-18   Brassica napus [oilseed rape]
ref|XP_009142683.1|  PREDICTED: RING-H2 finger protein ATL67          89.0    2e-18   Brassica rapa
ref|XP_002301380.1|  hypothetical protein POPTR_0002s16670g           88.2    2e-18   
ref|XP_004492810.1|  PREDICTED: RING-H2 finger protein ATL67-like     88.2    2e-18   Cicer arietinum [garbanzo]
ref|XP_010506614.1|  PREDICTED: RING-H2 finger protein ATL67          87.4    6e-18   Camelina sativa [gold-of-pleasure]
gb|KFK37394.1|  hypothetical protein AALP_AA4G251500                  87.0    1e-17   Arabis alpina [alpine rockcress]
ref|XP_006583264.1|  PREDICTED: RING-H2 finger protein ATL67-like     85.1    3e-17   
ref|XP_006842923.1|  hypothetical protein AMTR_s00075p00134690        84.0    7e-17   
ref|XP_002880221.1|  zinc finger family protein                       83.6    2e-16   Arabidopsis lyrata subsp. lyrata
ref|XP_010508059.1|  PREDICTED: RING-H2 finger protein ATL67-like     82.8    3e-16   Camelina sativa [gold-of-pleasure]
gb|ABD28581.1|  Zinc finger, RING-type                                81.6    5e-16   Medicago truncatula
ref|XP_003624102.1|  Ring finger protein                              81.6    1e-15   
ref|XP_010518279.1|  PREDICTED: RING-H2 finger protein ATL67-like     79.3    5e-15   
ref|XP_007139765.1|  hypothetical protein PHAVU_008G057200g           77.0    2e-14   Phaseolus vulgaris [French bean]
ref|XP_010092874.1|  RING-H2 finger protein ATL68                     77.4    3e-14   Morus notabilis
ref|XP_008680882.1|  PREDICTED: RING-H2 finger protein ATL67-like     77.0    3e-14   Zea mays [maize]
ref|XP_008650149.1|  PREDICTED: RING-H2 finger protein ATL67-like     77.4    4e-14   
ref|XP_003534530.1|  PREDICTED: RING-H2 finger protein ATL67-like     76.3    5e-14   Glycine max [soybeans]
ref|XP_010054857.1|  PREDICTED: uncharacterized protein LOC104443218  79.7    5e-14   
ref|XP_008671136.1|  PREDICTED: RING-H2 finger protein ATL67-like     75.5    1e-13   Zea mays [maize]
ref|XP_010916932.1|  PREDICTED: RING-H2 finger protein ATL67-like     75.5    1e-13   Elaeis guineensis
ref|XP_008671143.1|  PREDICTED: RING-H2 finger protein ATL67-like     75.9    1e-13   Zea mays [maize]
ref|XP_002511929.1|  ATRAD3, putative                                 77.0    3e-13   
ref|XP_008665968.1|  PREDICTED: RING-H2 finger protein ATL67-like     73.9    4e-13   
gb|AFW57001.1|  putative RING zinc finger domain superfamily protein  73.9    4e-13   
ref|XP_009381057.1|  PREDICTED: RING-H2 finger protein ATL67-like     73.6    5e-13   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB49432.1|  hypothetical protein B456_008G119400                  73.6    5e-13   Gossypium raimondii
ref|XP_008663969.1|  PREDICTED: RING-H2 finger protein ATL67-like     73.2    7e-13   
gb|AFW57002.1|  putative RING zinc finger domain superfamily protein  73.6    9e-13   
ref|XP_009409038.1|  PREDICTED: RING-H2 finger protein ATL67          70.9    4e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002992199.1|  hypothetical protein SELMODRAFT_186618           66.6    9e-11   
ref|NP_001147642.1|  RING-H2 finger protein ATL2M                     66.2    1e-10   
ref|NP_001147253.1|  RING-H2 finger protein ATL2M                     66.2    2e-10   Zea mays [maize]
emb|CDX89121.1|  BnaA04g00650D                                        66.2    2e-10   
emb|CDX99014.1|  BnaC09g48210D                                        65.5    3e-10   
ref|XP_009122386.1|  PREDICTED: putative RING-H2 finger protein A...  65.1    3e-10   Brassica rapa
emb|CDM81763.1|  unnamed protein product                              64.7    5e-10   Triticum aestivum [Canadian hard winter wheat]
gb|KFK25096.1|  hypothetical protein AALP_AA8G065900                  64.7    6e-10   Arabis alpina [alpine rockcress]
gb|EMS59911.1|  RING-H2 finger protein ATL68                          64.7    1e-09   Triticum urartu
ref|XP_008246264.1|  PREDICTED: putative RING-H2 finger protein A...  62.4    3e-09   Prunus mume [ume]
ref|XP_001754650.1|  predicted protein                                62.4    3e-09   
ref|XP_001760297.1|  predicted protein                                62.0    4e-09   
ref|XP_002871246.1|  zinc finger family protein                       61.6    5e-09   
ref|XP_003552426.1|  PREDICTED: RING-H2 finger protein ATL67-like     61.6    6e-09   Glycine max [soybeans]
gb|KJB67866.1|  hypothetical protein B456_010G215700                  61.2    8e-09   Gossypium raimondii
gb|EAY75741.1|  hypothetical protein OsI_03653                        61.2    1e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_004133841.1|  PREDICTED: RING-H2 finger protein ATL67-like     60.8    1e-08   Cucumis sativus [cucumbers]
ref|NP_001044176.2|  Os01g0736600                                     60.5    2e-08   
ref|XP_006654677.1|  PREDICTED: RING-H2 finger protein ATL67-like     60.5    2e-08   Oryza brachyantha
ref|XP_002525544.1|  ring finger protein, putative                    59.7    2e-08   Ricinus communis
ref|XP_002982100.1|  hypothetical protein SELMODRAFT_59303            59.3    3e-08   
ref|XP_008437981.1|  PREDICTED: RING-H2 finger protein ATL67          59.3    3e-08   Cucumis melo [Oriental melon]
ref|XP_004308667.1|  PREDICTED: putative RING-H2 finger protein A...  58.9    5e-08   Fragaria vesca subsp. vesca
ref|XP_010534324.1|  PREDICTED: putative RING-H2 finger protein A...  58.5    6e-08   Tarenaya hassleriana [spider flower]
ref|XP_006399182.1|  hypothetical protein EUTSA_v10014903mg           58.2    7e-08   Eutrema salsugineum [saltwater cress]
ref|XP_010247223.1|  PREDICTED: putative RING-H2 finger protein A...  58.2    9e-08   Nelumbo nucifera [Indian lotus]
ref|XP_010036586.1|  PREDICTED: RING-H2 finger protein ATL70          56.6    3e-07   Eucalyptus grandis [rose gum]
ref|XP_009403522.1|  PREDICTED: RING-H2 finger protein ATL67-like     56.6    3e-07   
ref|XP_010545157.1|  PREDICTED: RING-H2 finger protein ATL67          56.2    5e-07   Tarenaya hassleriana [spider flower]
ref|XP_008384425.1|  PREDICTED: LOW QUALITY PROTEIN: RING-H2 fing...  55.1    7e-07   
ref|XP_010232275.1|  PREDICTED: RING-H2 finger protein ATL67-like     55.8    8e-07   Brachypodium distachyon [annual false brome]
ref|XP_011020460.1|  PREDICTED: putative RING-H2 finger protein A...  55.5    9e-07   Populus euphratica
ref|XP_008810939.1|  PREDICTED: RING-H2 finger protein ATL67-like     55.1    2e-06   Phoenix dactylifera
ref|XP_006646300.1|  PREDICTED: RING-H2 finger protein ATL67-like     55.1    2e-06   Oryza brachyantha
ref|XP_006432382.1|  hypothetical protein CICLE_v10003203mg           53.5    3e-06   Citrus clementina [clementine]
ref|XP_004961430.1|  PREDICTED: RING-H2 finger protein ATL67-like...  53.9    4e-06   Setaria italica
ref|XP_006494565.1|  PREDICTED: putative RING-H2 finger protein A...  53.5    4e-06   Citrus sinensis [apfelsine]
ref|XP_004961429.1|  PREDICTED: RING-H2 finger protein ATL67-like...  53.9    5e-06   Setaria italica
ref|XP_002458455.1|  hypothetical protein SORBIDRAFT_03g033910        52.4    1e-05   Sorghum bicolor [broomcorn]
gb|KDP40569.1|  hypothetical protein JCGZ_24568                       51.6    2e-05   Jatropha curcas
ref|XP_002440115.1|  hypothetical protein SORBIDRAFT_09g026220        51.2    3e-05   
ref|XP_002316476.1|  hypothetical protein POPTR_0010s24960g           50.1    5e-05   
ref|XP_009395264.1|  PREDICTED: putative RING-H2 finger protein A...  50.1    8e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009348829.1|  PREDICTED: RING-H2 finger protein ATL70-like     49.7    1e-04   Pyrus x bretschneideri [bai li]
ref|XP_010491212.1|  PREDICTED: putative RING-H2 finger protein A...  50.1    1e-04   Camelina sativa [gold-of-pleasure]
ref|NP_196267.1|  putative RING-H2 finger protein ATL71               50.1    1e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002873260.1|  zinc finger family protein                       49.7    1e-04   Arabidopsis lyrata subsp. lyrata
ref|XP_003522850.1|  PREDICTED: putative RING-H2 finger protein A...  48.9    2e-04   Glycine max [soybeans]
ref|XP_011034693.1|  PREDICTED: putative RING-H2 finger protein A...  48.9    2e-04   Populus euphratica
ref|XP_009397427.1|  PREDICTED: RING-H2 finger protein ATL70-like     48.5    4e-04   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAY98765.1|  hypothetical protein OsI_20699                        48.5    4e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_008780209.1|  PREDICTED: RING-H2 finger protein ATL68-like     46.6    6e-04   Phoenix dactylifera
ref|XP_010557977.1|  PREDICTED: putative RING-H2 finger protein A...  47.8    6e-04   Tarenaya hassleriana [spider flower]
gb|KJB46372.1|  hypothetical protein B456_007G363500                  47.4    7e-04   Gossypium raimondii
ref|XP_004969874.1|  PREDICTED: RING-H2 finger protein ATL67-like     47.8    7e-04   Setaria italica
ref|NP_001056103.1|  Os05g0526600                                     47.8    8e-04   



>ref|XP_009766983.1| PREDICTED: RING-H2 finger protein ATL67-like [Nicotiana sylvestris]
Length=208

 Score =   153 bits (387),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 99/130 (76%), Gaps = 7/130 (5%)
 Frame = +2

Query  110  NSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHP  289
            NS   N +TIGLGYAIAIA GFLVL STVLLASYICCRS AARRRRR+    +   N+  
Sbjct  24   NSLSQNLSTIGLGYAIAIALGFLVLLSTVLLASYICCRSAAARRRRRQAQHNSQNLNN--  81

Query  290  DDNGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDT  469
             +NG+YLPRIIFVAEDDEEND VS QN  LGLDQ VINSYPKLVYSKR+GN     GN  
Sbjct  82   SENGIYLPRIIFVAEDDEENDEVSSQNATLGLDQVVINSYPKLVYSKRNGN-----GNGN  136

Query  470  LCSICLCEYK  499
             C ICLCEYK
Sbjct  137  DCPICLCEYK  146



>ref|XP_009597583.1| PREDICTED: RING-H2 finger protein ATL67-like [Nicotiana tomentosiformis]
Length=211

 Score =   153 bits (387),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 99/130 (76%), Gaps = 7/130 (5%)
 Frame = +2

Query  110  NSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHP  289
            NS   N +TIGLGYAIAIA GFLVL STVLLASYICCRS AARRRRR+    +   N+  
Sbjct  27   NSLSQNLSTIGLGYAIAIALGFLVLLSTVLLASYICCRSAAARRRRRQAQHNSQNLNN--  84

Query  290  DDNGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDT  469
             +NG+YLPRIIFVAEDDEEND VS QN  LGLDQ VINSYPKLVYSKR+GN     GN  
Sbjct  85   SENGIYLPRIIFVAEDDEENDDVSSQNATLGLDQVVINSYPKLVYSKRNGN-----GNGN  139

Query  470  LCSICLCEYK  499
             C ICLCEYK
Sbjct  140  DCPICLCEYK  149



>ref|XP_010326706.1| PREDICTED: RING-H2 finger protein ATL67-like [Solanum lycopersicum]
Length=259

 Score =   149 bits (377),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 99/125 (79%), Gaps = 3/125 (2%)
 Frame = +2

Query  125  NFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGV  304
            N +TIGLGYAIAIA GFLVL STVLLASYICCRS AARRRRR+  A +   N++  +NG+
Sbjct  76   NLSTIGLGYAIAIALGFLVLLSTVLLASYICCRSAAARRRRRQARANSRNPNNN-IENGI  134

Query  305  YLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSIC  484
            YLPRIIFVAEDDEEND    QN  LGLDQ VINSYPKL+YSKR+G  G   GND +C IC
Sbjct  135  YLPRIIFVAEDDEENDDGLSQNATLGLDQVVINSYPKLIYSKRNG--GSGNGNDVVCPIC  192

Query  485  LCEYK  499
            LCEYK
Sbjct  193  LCEYK  197



>ref|XP_006339638.1| PREDICTED: RING-H2 finger protein ATL67-like [Solanum tuberosum]
Length=260

 Score =   149 bits (377),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 99/125 (79%), Gaps = 3/125 (2%)
 Frame = +2

Query  125  NFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGV  304
            N +TIGLGYAIAIA GFLVL STVLLASYICCRS AARRRRR+  A +   N++  +NG+
Sbjct  77   NLSTIGLGYAIAIALGFLVLLSTVLLASYICCRSAAARRRRRQARANSRNPNNN-IENGI  135

Query  305  YLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSIC  484
            YLPRIIFVAEDDEEND    QN  LGLDQ VINSYPKL+YSKR+G  G   GND +C IC
Sbjct  136  YLPRIIFVAEDDEENDDGLSQNATLGLDQVVINSYPKLIYSKRNG--GSGNGNDVVCPIC  193

Query  485  LCEYK  499
            LCEYK
Sbjct  194  LCEYK  198



>ref|XP_011093078.1| PREDICTED: RING-H2 finger protein ATL68 [Sesamum indicum]
Length=207

 Score =   144 bits (362),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 97/125 (78%), Gaps = 9/125 (7%)
 Frame = +2

Query  125  NFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGV  304
            + T+IGLGYAIAIA GFLVLFST+LLASYICCRS AARRRRR    E    N   ++N +
Sbjct  30   SLTSIGLGYAIAIALGFLVLFSTILLASYICCRSAAARRRRRNQQRENSNPNRS-NENSI  88

Query  305  YLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSIC  484
            YLPRIIFVAEDDE       QNV +GLDQAVINSYPKLVYSKR+GN     GNDT+C+IC
Sbjct  89   YLPRIIFVAEDDEN----ESQNVVVGLDQAVINSYPKLVYSKRNGN----WGNDTVCAIC  140

Query  485  LCEYK  499
            LCEY+
Sbjct  141  LCEYR  145



>gb|EPS71501.1| hypothetical protein M569_03256, partial [Genlisea aurea]
Length=182

 Score =   136 bits (343),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 95/125 (76%), Gaps = 10/125 (8%)
 Frame = +2

Query  125  NFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGV  304
            N ++IGLGYAIAIA GFLVLFSTVLLASYICCRS A+RRR R        R+S   +N +
Sbjct  6    NLSSIGLGYAIAIALGFLVLFSTVLLASYICCRSAASRRRIRHRSENRDRRDS--GENSI  63

Query  305  YLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSIC  484
            YLPR+IFVAEDD+       Q+VA+GLDQAVINSYPKLV+SKR  N     G+DT+CSIC
Sbjct  64   YLPRVIFVAEDDDSE----AQSVAVGLDQAVINSYPKLVFSKRHSN----WGDDTVCSIC  115

Query  485  LCEYK  499
            LCEY+
Sbjct  116  LCEYR  120



>ref|XP_011093041.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105173085 
[Sesamum indicum]
Length=685

 Score =   140 bits (354),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 77/140 (55%), Positives = 93/140 (66%), Gaps = 19/140 (14%)
 Frame = +2

Query  95   TTV--KPNSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaea  268
            TTV  +P+S   N ++IGLGYAIA A GFLV FST+LLASYICC      R         
Sbjct  4    TTVPTRPSSLSQNLSSIGLGYAIAFALGFLVFFSTILLASYICC------RSVADRRRRR  57

Query  269  gyrNSHPD---DNGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSG  439
              RN +PD   DN +YLPRIIFVAED+E +     QN   GLDQAVINSYPK V++KR+G
Sbjct  58   LARNQNPDNSNDNSIYLPRIIFVAEDEESD----AQNAVAGLDQAVINSYPKFVFTKRNG  113

Query  440  NPGGTTGNDTLCSICLCEYK  499
            +  G    D++CSICLCEY+
Sbjct  114  DGAG----DSVCSICLCEYR  129



>gb|EYU32179.1| hypothetical protein MIMGU_mgv1a014108mg [Erythranthe guttata]
Length=200

 Score =   131 bits (330),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 95/132 (72%), Gaps = 9/132 (7%)
 Frame = +2

Query  104  KPNSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNS  283
            K +S   N  +IGLGYAIAIA GFLVLFST+LLASYICCRS A+RRRRR          +
Sbjct  16   KSSSFSQNLNSIGLGYAIAIALGFLVLFSTILLASYICCRSAASRRRRRDNRDRNP---N  72

Query  284  HPDDNGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGN  463
            H ++N +YLPRIIFVAEDD+ +     QN  +GLD+A INSYPK V+ KR+G  GG  G 
Sbjct  73   HSNENSIYLPRIIFVAEDDDND----SQNAVVGLDEAAINSYPKFVFGKRNGISGG--GG  126

Query  464  DTLCSICLCEYK  499
            D +CSICLCEY+
Sbjct  127  DAVCSICLCEYR  138



>gb|EPS68076.1| hypothetical protein M569_06695, partial [Genlisea aurea]
Length=200

 Score =   130 bits (326),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 89/134 (66%), Gaps = 16/134 (12%)
 Frame = +2

Query  107  PNSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSH  286
            P S   N   IG+GYA+AIA GFLVLFST+LLASYIC      R    R  +     N  
Sbjct  18   PLSFSENLNAIGIGYAVAIALGFLVLFSTLLLASYIC-----IRSAASRRRSRHQSENRR  72

Query  287  PDD---NGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTT  457
             DD   N +YLPR+IFVAEDD+       QNV +GLDQAVINSYPKLV+SKR+ N    +
Sbjct  73   RDDAGENSIYLPRVIFVAEDDDSE----VQNVVVGLDQAVINSYPKLVFSKRNLN----S  124

Query  458  GNDTLCSICLCEYK  499
            GNDT+CSICLCEY+
Sbjct  125  GNDTVCSICLCEYR  138



>emb|CDP08747.1| unnamed protein product [Coffea canephora]
Length=216

 Score =   123 bits (309),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 91/123 (74%), Gaps = 3/123 (2%)
 Frame = +2

Query  134  TIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSH-PDDNGVYL  310
            ++GLGYAIAIAFGFLVL STVLLASYICCRS AARRRRR       +  S+ P++  +YL
Sbjct  34   SVGLGYAIAIAFGFLVLLSTVLLASYICCRSAAARRRRRFDSQSGPHNPSNNPNETSIYL  93

Query  311  PRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLC  490
            PRIIFV ED+ +++  S +N  +GLDQAVINSYPK  +SK   N     GND +CSICLC
Sbjct  94   PRIIFVTEDENDDEVSSSENAVVGLDQAVINSYPKFHFSKI--NASFCAGNDPVCSICLC  151

Query  491  EYK  499
            +YK
Sbjct  152  DYK  154



>gb|KJB24638.1| hypothetical protein B456_004G154800 [Gossypium raimondii]
Length=187

 Score =   116 bits (291),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 83/128 (65%), Gaps = 8/128 (6%)
 Frame = +2

Query  116  APTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDD  295
            +P   T +GLGY+IAIA GFLVL ST+LLASYICCRS ++     R  +      S  D 
Sbjct  5    SPNYLTNLGLGYSIAIALGFLVLLSTILLASYICCRSSSSSSSSPRAFSPNATVASASD-  63

Query  296  NGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLC  475
             G+ LPRIIFVAEDD+       +N A+GLDQAVINSYPK  +SK       ++  +T C
Sbjct  64   -GINLPRIIFVAEDDD------NENAAVGLDQAVINSYPKFQFSKDRSAAVDSSNVNTTC  116

Query  476  SICLCEYK  499
            SICLCEYK
Sbjct  117  SICLCEYK  124



>gb|KJB09703.1| hypothetical protein B456_001G157500 [Gossypium raimondii]
Length=256

 Score =   118 bits (295),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 83/130 (64%), Gaps = 18/130 (14%)
 Frame = +2

Query  110  NSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHP  289
            +S+P  FT +GLGY+IAIA  FLVL S VLLASYICC             + +   N  P
Sbjct  6    HSSPLYFTNLGLGYSIAIALAFLVLLSIVLLASYICC-----------RPSSSFSPNPTP  54

Query  290  DDNGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDT  469
              +G+ LPR++FVAED+++      +NV +GLDQAVINSYPK  ++K +   G T  N T
Sbjct  55   VSDGIILPRVVFVAEDEDD------ENVVVGLDQAVINSYPKFQFTKEAAAVGSTNVNTT  108

Query  470  LCSICLCEYK  499
             CSICLCEY+
Sbjct  109  -CSICLCEYR  117



>ref|XP_006491198.1| PREDICTED: RING-H2 finger protein ATL67-like [Citrus sinensis]
 gb|KDO86329.1| hypothetical protein CISIN_1g029203mg [Citrus sinensis]
Length=197

 Score =   116 bits (291),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 82/131 (63%), Gaps = 6/131 (5%)
 Frame = +2

Query  116  APTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDD  295
            +P   T IGLGY+IAIA GFLVL STVLLASYICC            +A     N+   +
Sbjct  8    SPNYLTNIGLGYSIAIALGFLVLLSTVLLASYICC---RRNNSSHNSNANPHENNNSVSN  64

Query  296  NGVYLPRIIFVAEDD--EENDGVSGQNVALGLDQAVINSYPKLVYSKRS-GNPGGTTGND  466
            +G+ LPRIIFVAEDD  EEN      N+ +GLDQAVINSYPK  ++K S      +   +
Sbjct  65   DGIILPRIIFVAEDDGQEENRNQDDDNLVVGLDQAVINSYPKFQFTKESVSGNNNSNNIN  124

Query  467  TLCSICLCEYK  499
            T CSICLCEYK
Sbjct  125  TTCSICLCEYK  135



>ref|XP_004248065.1| PREDICTED: RING-H2 finger protein ATL67-like [Solanum lycopersicum]
Length=205

 Score =   114 bits (285),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 87/127 (69%), Gaps = 10/127 (8%)
 Frame = +2

Query  125  NFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGV  304
            +   IGLGYAIAIA  FL L ST++L+SY+CCRS A RRR+ +         S   + G+
Sbjct  25   SLNKIGLGYAIAIALAFLFLLSTLILSSYLCCRSAAYRRRQAQS-------QSRNPNTGI  77

Query  305  YLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKR--SGNPGGTTGNDTLCS  478
            Y+P +IFVAE+DE ND VS QN   GL+QAVINSYPKL+YS R  +   G  + ND +C+
Sbjct  78   YIPSVIFVAEEDE-NDDVSSQNTFAGLNQAVINSYPKLIYSSRNGNWGNGNGSRNDVVCA  136

Query  479  ICLCEYK  499
            ICLC+YK
Sbjct  137  ICLCDYK  143



>ref|XP_011037158.1| PREDICTED: RING-H2 finger protein ATL67 [Populus euphratica]
Length=205

 Score =   114 bits (285),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 85/128 (66%), Gaps = 5/128 (4%)
 Frame = +2

Query  119  PTNF-TTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDD  295
            PTN+ T +GLGY+IAIA  FLVL ST+LLASYICCR+   R R    +      ++    
Sbjct  20   PTNYLTNLGLGYSIAIALFFLVLLSTILLASYICCRTTRHRSRNSNNNNSNYSNSTA---  76

Query  296  NGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLC  475
            +G+ LPRIIFVAEDDEE +    ++ ALGL+QAVINSYPKL +SK  G    T      C
Sbjct  77   DGIILPRIIFVAEDDEEQER-DLESAALGLNQAVINSYPKLQFSKDGGFSERTNNFCNTC  135

Query  476  SICLCEYK  499
            SICLCEYK
Sbjct  136  SICLCEYK  143



>emb|CBI40419.3| unnamed protein product [Vitis vinifera]
Length=279

 Score =   115 bits (288),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 82/126 (65%), Gaps = 16/126 (13%)
 Frame = +2

Query  122  TNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNG  301
            T  + +GLGYAIAIAF FLVL STVLLASY+CCR         R  A A   +     +G
Sbjct  83   TYLSNLGLGYAIAIAFAFLVLLSTVLLASYLCCRRRPLSPHHSRNPASAANSS-----DG  137

Query  302  VYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSI  481
            + LPRIIFVAED++E+     QNV +GLDQAVI+SYPK  +SK        T  D++CSI
Sbjct  138  IVLPRIIFVAEDEDED-----QNVVVGLDQAVIDSYPKFPFSK------SNTHLDSVCSI  186

Query  482  CLCEYK  499
            CLCEYK
Sbjct  187  CLCEYK  192



>ref|XP_010559104.1| PREDICTED: RING-H2 finger protein ATL67-like [Tarenaya hassleriana]
Length=197

 Score =   113 bits (282),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 82/124 (66%), Gaps = 13/124 (10%)
 Frame = +2

Query  128  FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGVY  307
             T IGLGY+IAIA GFLVL ST+LL+SY+CCR+   R       + A        D G+ 
Sbjct  20   LTGIGLGYSIAIALGFLVLLSTILLSSYVCCRASRRRSSSSATASAAV-------DGGII  72

Query  308  LPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICL  487
            LPRIIFVAEDD++ +  +G+N+ +GLDQ+VINSYPK  +SK S       G D  CSICL
Sbjct  73   LPRIIFVAEDDDDLEA-NGENIVVGLDQSVINSYPKFQFSKESDG-----GGDATCSICL  126

Query  488  CEYK  499
            CEY+
Sbjct  127  CEYR  130



>emb|CAN73279.1| hypothetical protein VITISV_040608 [Vitis vinifera]
Length=641

 Score =   115 bits (289),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 68/126 (54%), Positives = 83/126 (66%), Gaps = 16/126 (13%)
 Frame = +2

Query  122  TNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNG  301
            T  + +GLGYAIAIAF FLVL STVLLASY+CCR         R  A A   +     +G
Sbjct  26   TYLSNLGLGYAIAIAFAFLVLLSTVLLASYLCCRRRPLSPHHSRNPASAANSS-----DG  80

Query  302  VYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSI  481
            + LPRIIFVAED++E+     QNV +GLDQAVI+SYPK  +SK +      T  D++CSI
Sbjct  81   IVLPRIIFVAEDEDED-----QNVVVGLDQAVIDSYPKFPFSKSN------THLDSVCSI  129

Query  482  CLCEYK  499
            CLCEYK
Sbjct  130  CLCEYK  135



>ref|XP_010661826.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC100263595 
[Vitis vinifera]
Length=682

 Score =   115 bits (289),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 68/126 (54%), Positives = 83/126 (66%), Gaps = 16/126 (13%)
 Frame = +2

Query  122  TNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNG  301
            T  + +GLGYAIAIAF FLVL STVLLASY+CCR         R  A A   +     +G
Sbjct  26   TYLSNLGLGYAIAIAFAFLVLLSTVLLASYLCCRRRPLSPHHSRNPASAANSS-----DG  80

Query  302  VYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSI  481
            + LPRIIFVAED++E+     QNV +GLDQAVI+SYPK  +SK +      T  D++CSI
Sbjct  81   IVLPRIIFVAEDEDED-----QNVVVGLDQAVIDSYPKFPFSKSN------THLDSVCSI  129

Query  482  CLCEYK  499
            CLCEYK
Sbjct  130  CLCEYK  135



>gb|KDP28554.1| hypothetical protein JCGZ_14325 [Jatropha curcas]
Length=209

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 84/128 (66%), Gaps = 11/128 (9%)
 Frame = +2

Query  128  FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSH----PDD  295
             T +GLGY+IAIA GFLVL STVLLASY+CCR+   R      +   G  N +    PD 
Sbjct  27   ITNLGLGYSIAIALGFLVLLSTVLLASYMCCRASRNRSFNSNDNDNNGNDNDNSNSVPD-  85

Query  296  NGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLC  475
             G+ LPRIIFVAED+++ +    +  A+GLDQAVINSYPK  ++K     G + GN T C
Sbjct  86   -GILLPRIIFVAEDEDDQER-DLETSAVGLDQAVINSYPKFQFTK----DGSSNGNSTTC  139

Query  476  SICLCEYK  499
            SICLCEYK
Sbjct  140  SICLCEYK  147



>gb|EYU35114.1| hypothetical protein MIMGU_mgv1a020271mg [Erythranthe guttata]
Length=198

 Score =   108 bits (271),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 86/126 (68%), Gaps = 12/126 (10%)
 Frame = +2

Query  125  NFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrr-ldaeagyrNSHPDDNG  301
            N  +IG GY+ AIA GFLVLFS+++LA YICCRS AA RRRR  L  +   R +   ++ 
Sbjct  23   NLRSIGFGYSFAIALGFLVLFSSIVLAFYICCRSSAAARRRRHDLQIQNQNRRNRSGEHS  82

Query  302  VYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSI  481
            +YLP  IFV E +        QN  +GLDQAVINSYPKLV++KRSGN     GND +CSI
Sbjct  83   IYLPSTIFVDESEP-------QNGVIGLDQAVINSYPKLVFAKRSGN----WGNDAVCSI  131

Query  482  CLCEYK  499
            CLCEY+
Sbjct  132  CLCEYR  137



>ref|XP_002320162.1| zinc finger family protein [Populus trichocarpa]
 gb|EEE98477.1| zinc finger family protein [Populus trichocarpa]
Length=205

 Score =   108 bits (271),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 83/128 (65%), Gaps = 5/128 (4%)
 Frame = +2

Query  119  PTNF-TTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDD  295
            P N+ T +GLGY+IAIA  FLVL ST+LLASYICCR+   R R    +      ++    
Sbjct  20   PANYLTNLGLGYSIAIALFFLVLLSTILLASYICCRTNRHRSRNSNNNNNNYANSTA---  76

Query  296  NGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLC  475
            +G+ LPRIIFVAEDDEE +    ++ A+GL+QAVINSYPK  +SK  G    T      C
Sbjct  77   DGIILPRIIFVAEDDEEQER-DLESAAVGLNQAVINSYPKFQFSKDGGFSERTNNFCNTC  135

Query  476  SICLCEYK  499
            SICLCEYK
Sbjct  136  SICLCEYK  143



>gb|KJB41423.1| hypothetical protein B456_007G103900 [Gossypium raimondii]
Length=183

 Score =   108 bits (270),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 85/136 (63%), Gaps = 15/136 (11%)
 Frame = +2

Query  92   LTTVKPNSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeag  271
            ++T  P S+PT  T +GLGY+IAIA GFLVL ST+LLASYIC RS  + R      +   
Sbjct  1    MSTPSP-SSPTYLTNLGLGYSIAIAVGFLVLLSTILLASYICFRSSTSPRAFSSNPSAIP  59

Query  272  yrNSHPDDNGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGG  451
              NS    +G+ LP IIFVAED+  +      NV LGLDQAVINSYPK  + K S     
Sbjct  60   ASNS----DGILLPTIIFVAEDEATD------NVVLGLDQAVINSYPKFQFCKDS----A  105

Query  452  TTGNDTLCSICLCEYK  499
             +  +T CSICLCEYK
Sbjct  106  ASNLNTTCSICLCEYK  121



>ref|XP_010261407.1| PREDICTED: RING-H2 finger protein ATL67-like [Nelumbo nucifera]
Length=205

 Score =   108 bits (270),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 81/128 (63%), Gaps = 15/128 (12%)
 Frame = +2

Query  125  NFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDD---  295
            N T +G GYAIAIA GFLVL STV+L+SYICC       R R   +     +S+PD    
Sbjct  29   NLTNLGFGYAIAIALGFLVLLSTVVLSSYICC----RASRNRHRSSNPDNSDSNPDSSNP  84

Query  296  NGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLC  475
            NG+ LPRIIFVAEDD+ +     ++V +GLDQ+VINSYPK  + K           D++C
Sbjct  85   NGIILPRIIFVAEDDDGSR--DDESVVVGLDQSVINSYPKFPFCK------SKDRGDSVC  136

Query  476  SICLCEYK  499
            SICLC+YK
Sbjct  137  SICLCDYK  144



>ref|XP_009349321.1| PREDICTED: RING-H2 finger protein ATL67-like [Pyrus x bretschneideri]
Length=191

 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 78/131 (60%), Gaps = 12/131 (9%)
 Frame = +2

Query  110  NSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHP  289
            +S P   TT+GLGY IAI+ GFLVLFST+LLASY+CCR    R  + R            
Sbjct  9    HSPPNYLTTLGLGYGIAISLGFLVLFSTLLLASYLCCRVSRHRPPQPRNPNPNPNP----  64

Query  290  DDNGVYLPRIIFVAEDDEENDGV-SGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGND  466
               GV LPRIIFVAEDD E +     +N  +GL  + INSYPK  +SK +  P  +T   
Sbjct  65   --EGVILPRIIFVAEDDNEQEQQDDDENAVVGLHPSAINSYPKFPFSKEAAIPDSST---  119

Query  467  TLCSICLCEYK  499
              CSICLC+YK
Sbjct  120  --CSICLCDYK  128



>gb|KFK35351.1| hypothetical protein AALP_AA5G273400 [Arabis alpina]
Length=221

 Score =   106 bits (265),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 82/131 (63%), Gaps = 7/131 (5%)
 Frame = +2

Query  122  TNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNG  301
            T  T++GLGY+IAIA GFLVL ST++L+SYICCR+   R      +       S   +  
Sbjct  23   TYITSLGLGYSIAIALGFLVLISTIILSSYICCRASRLRFSTSAANTNTNANASF-GNRS  81

Query  302  VYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKR-----SGNPGGTTGN-  463
            + +PRIIFVAEDD+    VSG  V  GLDQ +INSYPK  Y+K      +G+ G   G+ 
Sbjct  82   IIVPRIIFVAEDDDLESAVSGNVVVGGLDQPIINSYPKFHYTKETAVSVAGDNGFHGGDG  141

Query  464  DTLCSICLCEY  496
            DT CSICLCEY
Sbjct  142  DTTCSICLCEY  152



>ref|XP_010669733.1| PREDICTED: RING-H2 finger protein ATL67-like [Beta vulgaris subsp. 
vulgaris]
Length=206

 Score =   105 bits (263),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 85/149 (57%), Gaps = 24/149 (16%)
 Frame = +2

Query  92   LTTVKPNSAPT---NFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrlda  262
            ++ + P S+P    +   +GLGYAIAI+ GFLVLFS +LL+SYICC              
Sbjct  1    MSAISPPSSPHFTLSLQNLGLGYAIAISLGFLVLFSALLLSSYICC-----------RAN  49

Query  263  eagyrNSHPDD--NGVYLPRIIFVAEDD--EENDGVSGQNVALGLDQAVINSYPKLVY--  424
                   H  D  N + +PRIIFVAEDD  +E +     N  +GLD+AVINSYPK  +  
Sbjct  50   RRRITRQHVSDNSNAIIVPRIIFVAEDDDNDEENQNRASNGVVGLDRAVINSYPKFQFFK  109

Query  425  ----SKRSGNPGGTTGNDTLCSICLCEYK  499
                SK + N   + G++ +CSICLC+YK
Sbjct  110  KNLESKDNNNNYYSNGDNLMCSICLCDYK  138



>ref|XP_007051690.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOX95847.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=680

 Score =   110 bits (275),  Expect = 9e-25, Method: Composition-based stats.
 Identities = 68/136 (50%), Positives = 90/136 (66%), Gaps = 11/136 (8%)
 Frame = +2

Query  92   LTTVKPNSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeag  271
            ++T  P S+P   T +GLGY+IAIA GFLVL ST+LLASYICCRS ++ R        A 
Sbjct  1    MSTPAP-SSPNYLTNLGLGYSIAIALGFLVLLSTILLASYICCRSSSSPRAFSPNPTTAV  59

Query  272  yrNSHPDDNGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGG  451
              +   + +G+ LPRIIFVAED++       ++V +GLDQAVINSYPK  +SK +     
Sbjct  60   AAS---NSDGIILPRIIFVAEDEDN------ESVVVGLDQAVINSYPKFQFSKEA-AAAN  109

Query  452  TTGNDTLCSICLCEYK  499
            +T  +T CSICLCEY+
Sbjct  110  STNANTTCSICLCEYR  125



>ref|XP_006291847.1| hypothetical protein CARUB_v10018022mg [Capsella rubella]
 gb|EOA24745.1| hypothetical protein CARUB_v10018022mg [Capsella rubella]
Length=211

 Score =   105 bits (263),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 81/132 (61%), Gaps = 16/132 (12%)
 Frame = +2

Query  122  TNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNG  301
            T  T++GLGY+IAIA GFLVL ST++L+SYICC     R  R R  A A   NS   D G
Sbjct  20   TYITSLGLGYSIAIALGFLVLISTIILSSYICC-----RASRLRFSASAATTNSSFRDRG  74

Query  302  VYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKR-------SGNPGGTTG  460
            V +PRIIFVAEDD   D  SG  V  GLD ++INSYPK  ++K         G   G  G
Sbjct  75   VIVPRIIFVAEDD---DLESGNVVVGGLDHSIINSYPKFPFTKDITSVVDGDGFHDG-EG  130

Query  461  NDTLCSICLCEY  496
             DT CSICLCEY
Sbjct  131  RDTTCSICLCEY  142



>emb|CDY65206.1| BnaAnng20290D [Brassica napus]
Length=210

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 75/133 (56%), Gaps = 13/133 (10%)
 Frame = +2

Query  110  NSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHP  289
             S  ++ TT+G GY IAI  GFLVL S VLL+SYICC        R           +  
Sbjct  20   ESNHSHLTTLGFGYTIAIGLGFLVLISIVLLSSYICC--------RDSRRRTTAVETTEE  71

Query  290  DDNGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGG---TTG  460
                V LPR+IFV+E+D  N+ +   +V +GLDQAVINSYPK  +SK +          G
Sbjct  72   RGRSVNLPRVIFVSEED--NEDLEAGDVIVGLDQAVINSYPKFHFSKETSAASSDGFGGG  129

Query  461  NDTLCSICLCEYK  499
             DT C+ICLCEYK
Sbjct  130  GDTSCTICLCEYK  142



>ref|XP_009142411.1| PREDICTED: RING-H2 finger protein ATL67-like [Brassica rapa]
Length=210

 Score =   102 bits (253),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 75/133 (56%), Gaps = 13/133 (10%)
 Frame = +2

Query  110  NSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHP  289
            +S  ++ TT+G GY IAI  GFLVL S VLL+SYICC        R           +  
Sbjct  20   DSNNSHLTTLGFGYTIAIGLGFLVLISIVLLSSYICC--------RDSRRRTTAVETTEE  71

Query  290  DDNGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGG---TTG  460
                V LPR+IFV+E+D  N+ +    V +GLDQAVINSYPK  +SK +          G
Sbjct  72   RGRSVNLPRVIFVSEED--NEDLEAGEVIVGLDQAVINSYPKFHFSKETSAASSDGFGGG  129

Query  461  NDTLCSICLCEYK  499
             DT C+ICLCEYK
Sbjct  130  GDTSCTICLCEYK  142



>emb|CDX71732.1| BnaC08g31420D [Brassica napus]
Length=216

 Score =   102 bits (253),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 80/126 (63%), Gaps = 7/126 (6%)
 Frame = +2

Query  122  TNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNG  301
            T  T++GLGY+IAIA GFLVL ST++L+SYICCR+   R      + ++ + N       
Sbjct  24   TYITSLGLGYSIAIALGFLVLISTIILSSYICCRASRLRFSTSAANLDSSFGN-----RS  78

Query  302  VYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGN-DTLCS  478
            + +PRI+FVAE D+     SG  V  GLDQ +INSYPK  Y + SG+     G+ DT CS
Sbjct  79   IIVPRIMFVAEGDDLESAPSGNVVVGGLDQPIINSYPKFRY-RASGDDELQGGDGDTTCS  137

Query  479  ICLCEY  496
            ICLCEY
Sbjct  138  ICLCEY  143



>gb|KEH18782.1| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula]
Length=203

 Score =   101 bits (252),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 79/124 (64%), Gaps = 17/124 (14%)
 Frame = +2

Query  128  FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGVY  307
             T +G GY+IAIA GFL L ST++L+SY+CCR+   R      + +     +H  D GV 
Sbjct  16   LTNLGFGYSIAIALGFLFLLSTLILSSYLCCRTFRNRNNHLNGNNQL----NHNHD-GVV  70

Query  308  LPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICL  487
            LPR+IFVAED+E+      ++V LGLDQ VINSYP+L Y K         G+D+ CSICL
Sbjct  71   LPRVIFVAEDEEDR-----EDVVLGLDQNVINSYPRLQYCK-------DLGHDSTCSICL  118

Query  488  CEYK  499
            CEYK
Sbjct  119  CEYK  122



>ref|XP_009338797.1| PREDICTED: uncharacterized protein LOC103931112, partial [Pyrus 
x bretschneideri]
Length=697

 Score =   105 bits (263),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 62/125 (50%), Positives = 75/125 (60%), Gaps = 12/125 (10%)
 Frame = +2

Query  128  FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGVY  307
             TT+GLGY IAI+ GFLVLFST+LLASY+CCR    R  + R               GV 
Sbjct  2    LTTLGLGYGIAISLGFLVLFSTLLLASYLCCRVSRHRPPQPRNPNPNPNP------EGVI  55

Query  308  LPRIIFVAEDDEENDGV-SGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSIC  484
            LPRIIFVAEDD E +     +N  +GL  + INSYPK  +SK +  P  +T     CSIC
Sbjct  56   LPRIIFVAEDDNEQEQQDDDENAVVGLHPSAINSYPKFPFSKEAAIPDSST-----CSIC  110

Query  485  LCEYK  499
            LC+YK
Sbjct  111  LCDYK  115



>ref|NP_191714.1| RING-H2 finger protein ATL68 [Arabidopsis thaliana]
 sp|Q9M313.1|ATL68_ARATH RecName: Full=RING-H2 finger protein ATL68 [Arabidopsis thaliana]
 gb|AAL16112.1|AF428280_1 AT3g61550/F2A19_150 [Arabidopsis thaliana]
 emb|CAB71085.1| putative protein [Arabidopsis thaliana]
 gb|AAM51602.1| AT3g61550/F2A19_150 [Arabidopsis thaliana]
 dbj|BAD95337.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE80221.1| RING-H2 finger protein ATL68 [Arabidopsis thaliana]
Length=212

 Score =   100 bits (250),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 81/132 (61%), Gaps = 14/132 (11%)
 Frame = +2

Query  122  TNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNG  301
            T  T++GLGY+IAIA GFLVL ST++L+SYICCR+   R      +A A    S   D G
Sbjct  19   TYITSLGLGYSIAIALGFLVLISTIILSSYICCRASRLRFSASAANANANASFS---DRG  75

Query  302  VYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKR-------SGNPGGTTG  460
            V +PRIIFVAEDD   D  SG  V  GLD +VINSYPK  ++K         G   G  G
Sbjct  76   VIVPRIIFVAEDD---DLESGNVVVGGLDHSVINSYPKFHFTKDITAVVNGDGFHDG-EG  131

Query  461  NDTLCSICLCEY  496
             +T CSICLCEY
Sbjct  132  RETTCSICLCEY  143



>ref|XP_010512505.1| PREDICTED: RING-H2 finger protein ATL68 isoform X1 [Camelina 
sativa]
 ref|XP_010512506.1| PREDICTED: RING-H2 finger protein ATL68 isoform X2 [Camelina 
sativa]
Length=214

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 81/132 (61%), Gaps = 15/132 (11%)
 Frame = +2

Query  122  TNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNG  301
            T  T++GLGY+IAIA GFLVL ST++L+SYICCR+   R       A + +R     D  
Sbjct  22   TYITSLGLGYSIAIALGFLVLISTIILSSYICCRASRLRFSASAATANSSFR-----DRS  76

Query  302  VYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGN--PGGT-----TG  460
            V +PRIIFVAEDD   D  SG  V  GLD ++INSYPK  ++K   +   GG       G
Sbjct  77   VIVPRIIFVAEDD---DLESGNVVVGGLDHSIINSYPKFHFTKDIASVVVGGDGFHDGEG  133

Query  461  NDTLCSICLCEY  496
             DT CSICLCEY
Sbjct  134  RDTTCSICLCEY  145



>ref|XP_010469090.1| PREDICTED: RING-H2 finger protein ATL68-like isoform X1 [Camelina 
sativa]
 ref|XP_010469091.1| PREDICTED: RING-H2 finger protein ATL68-like isoform X2 [Camelina 
sativa]
Length=214

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 81/132 (61%), Gaps = 15/132 (11%)
 Frame = +2

Query  122  TNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNG  301
            T  T++GLGY+IAIA GFLVL ST++L+SYICCR+   R       A + +R     D  
Sbjct  22   TYITSLGLGYSIAIALGFLVLISTIILSSYICCRASRLRFSASAATANSSFR-----DRS  76

Query  302  VYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSK--RSGNPGGT-----TG  460
            V +PRIIFVAEDD   D  SG  V  GLD ++INSYPK  ++K   S   GG       G
Sbjct  77   VIVPRIIFVAEDD---DLESGNVVVGGLDHSIINSYPKFHFTKDITSVVVGGDGFHDGEG  133

Query  461  NDTLCSICLCEY  496
             DT CSICLCEY
Sbjct  134  RDTTCSICLCEY  145



>ref|XP_006402471.1| hypothetical protein EUTSA_v10006504mg [Eutrema salsugineum]
 gb|ESQ43924.1| hypothetical protein EUTSA_v10006504mg [Eutrema salsugineum]
Length=215

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 80/132 (61%), Gaps = 12/132 (9%)
 Frame = +2

Query  122  TNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNG  301
            T  T++GLGY+IAIA GFLVL ST++L+SYICC     R  R R  AE    N+   +  
Sbjct  20   TYITSLGLGYSIAIALGFLVLISTIILSSYICC-----RASRLRFSAETENANASFGNRS  74

Query  302  VYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGT-------TG  460
            + +PRIIFVAEDD+    VSG  V  GLDQ +INSYPK  ++K      G         G
Sbjct  75   IIVPRIIFVAEDDDLESAVSGGVVVGGLDQPIINSYPKFRFTKDISLAAGDGFQGVDGEG  134

Query  461  NDTLCSICLCEY  496
             DT CSICLCEY
Sbjct  135  GDTTCSICLCEY  146



>ref|XP_007135149.1| hypothetical protein PHAVU_010G105200g [Phaseolus vulgaris]
 gb|ESW07143.1| hypothetical protein PHAVU_010G105200g [Phaseolus vulgaris]
Length=190

 Score = 97.8 bits (242),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 77/124 (62%), Gaps = 12/124 (10%)
 Frame = +2

Query  128  FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGVY  307
            FT +G GY+IAIA G L L ST++L+SY+CCR++  R             ++ PD  G+ 
Sbjct  16   FTNLGFGYSIAIALGVLFLISTLILSSYLCCRTLRHRNNNHHRRRHRHNLHA-PD--GIV  72

Query  308  LPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICL  487
            LPR+IFVAEDD+  DG    +   GL+QAVINSYPK  ++K         G DT CSICL
Sbjct  73   LPRVIFVAEDDD--DGARQNDAVSGLEQAVINSYPKFPFTKDG-------GYDTTCSICL  123

Query  488  CEYK  499
            C+YK
Sbjct  124  CDYK  127



>ref|XP_002876620.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52879.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=211

 Score = 97.8 bits (242),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 78/132 (59%), Gaps = 14/132 (11%)
 Frame = +2

Query  122  TNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNG  301
            T  T++GLGY+IAIA GFLVL ST++L+SYICCR+   R       A A        D  
Sbjct  18   TYITSLGLGYSIAIALGFLVLISTIILSSYICCRASRLRFSASAATANANASFR---DRS  74

Query  302  VYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKR-------SGNPGGTTG  460
            V +PRIIFVAEDD   D  SG  V  GLD ++INSYPK  ++K         G   G  G
Sbjct  75   VIVPRIIFVAEDD---DLESGNVVVGGLDHSIINSYPKFHFTKDITAVVDGDGFHDGERG  131

Query  461  NDTLCSICLCEY  496
             DT CSICLCEY
Sbjct  132  -DTTCSICLCEY  142



>ref|XP_010251603.1| PREDICTED: RING-H2 finger protein ATL67 [Nelumbo nucifera]
Length=211

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 82/128 (64%), Gaps = 14/128 (11%)
 Frame = +2

Query  125  NFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPD---D  295
            N + IGLGYAIAIA GFLVL STVLLASY+CC       R R   ++     S+PD    
Sbjct  34   NLSNIGLGYAIAIALGFLVLLSTVLLASYVCC----RSSRNRSRSSDPENPGSNPDSSHS  89

Query  296  NGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLC  475
            NG+ LPRIIFVAE D+++D     ++ +GL+QAVINSYPK  + K           D++C
Sbjct  90   NGIILPRIIFVAE-DDDDDSRDDDSLVVGLNQAVINSYPKFPFCKSKDR------GDSVC  142

Query  476  SICLCEYK  499
            SICLC+YK
Sbjct  143  SICLCDYK  150



>emb|CDY27329.1| BnaC04g50760D [Brassica napus]
Length=212

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 76/135 (56%), Gaps = 15/135 (11%)
 Frame = +2

Query  110  NSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHP  289
            +S  ++ +T+G GY IAI  GFLVL S VLL+SYICC        R           +  
Sbjct  20   DSNHSHLSTLGFGYTIAIGLGFLVLISIVLLSSYICC--------RDSRRRTTAVETTEE  71

Query  290  DDNGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKR-----SGNPGGT  454
                V LPR+IFV+E+D  N+ +   +V +GLDQAVINSYPK  +S       S    G 
Sbjct  72   RGRSVNLPRVIFVSEED--NEDLEAGDVIVGLDQAVINSYPKFHFSNETSVASSDGFAGG  129

Query  455  TGNDTLCSICLCEYK  499
             G DT CSICLC+YK
Sbjct  130  GGGDTSCSICLCQYK  144



>ref|XP_006358653.1| PREDICTED: RING-H2 finger protein ATL67-like [Solanum tuberosum]
Length=200

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 86/125 (69%), Gaps = 15/125 (12%)
 Frame = +2

Query  125  NFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGV  304
            +   IGLGYAIAIA  FL L ST+LL+SY+CCRS A RRR+ +         +   + G+
Sbjct  29   SLNKIGLGYAIAIALAFLFLLSTLLLSSYLCCRSTAYRRRQAQS-------QTRNPNTGI  81

Query  305  YLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSIC  484
            Y+P +IFVAE DE ND VS QN   GLDQAVINSYPKL+YSKR+       GND +CSIC
Sbjct  82   YIPSVIFVAEADE-NDDVSSQNTFAGLDQAVINSYPKLIYSKRN-------GNDVVCSIC  133

Query  485  LCEYK  499
            LC+YK
Sbjct  134  LCDYK  138



>ref|XP_009116820.1| PREDICTED: RING-H2 finger protein ATL68 [Brassica rapa]
Length=219

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 80/130 (62%), Gaps = 12/130 (9%)
 Frame = +2

Query  128  FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGVY  307
             T++GLGY+IAIA GFL+L ST++L+SYICCR+   R      + ++ + N       + 
Sbjct  22   ITSLGLGYSIAIALGFLILISTIILSSYICCRASRLRFSTSAANLDSSFGN-----RSII  76

Query  308  LPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSK------RSGNPGGTTGN-D  466
            +PRI+FVA+ D+     SG  V  GL+Q +INSYPK  Y+K       SG+     G+ D
Sbjct  77   VPRIMFVADGDDLESAPSGNIVVGGLEQPIINSYPKFRYTKGITVDASSGDDELQGGDGD  136

Query  467  TLCSICLCEY  496
            T CSICLCEY
Sbjct  137  TTCSICLCEY  146



>ref|XP_009341125.1| PREDICTED: RING-H2 finger protein ATL67 [Pyrus x bretschneideri]
Length=197

 Score = 95.9 bits (237),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 80/130 (62%), Gaps = 12/130 (9%)
 Frame = +2

Query  116  APTNF-TTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPD  292
            +PTN+ TT+GLGY IAI+ GFLVLFST+LLASYICC    +R R          +N +P 
Sbjct  15   SPTNYLTTLGLGYGIAISLGFLVLFSTLLLASYICC--RVSRHRHHHHHQPPQRQNQNPS  72

Query  293  DNGVYLPRIIFVAEDDEENDGVSGQNVA-LGLDQAVINSYPKLVYSKRSGNPGGTTGNDT  469
              GV LPRIIFVAEDD E         A +GL  +VINSYPK  +SK          + +
Sbjct  73   PEGVILPRIIFVAEDDNEQQQQDDDENAVVGLHPSVINSYPKFPFSKE--------ASSS  124

Query  470  LCSICLCEYK  499
             CSICLC+YK
Sbjct  125  TCSICLCDYK  134



>ref|XP_009607421.1| PREDICTED: RING-H2 finger protein ATL67-like, partial [Nicotiana 
tomentosiformis]
Length=154

 Score = 94.4 bits (233),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 58/74 (78%), Gaps = 6/74 (8%)
 Frame = +2

Query  278  NSHPDDNGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTT  457
            N++ ++N +YLPR+IFVA D+EEND VS QN  LG+DQAVINSYPKLVYSKR+G     +
Sbjct  74   NANTENNRIYLPRLIFVA-DEEENDDVSSQNTILGIDQAVINSYPKLVYSKRNG-----S  127

Query  458  GNDTLCSICLCEYK  499
            G D +C I LCEYK
Sbjct  128  GKDVVCFIFLCEYK  141



>emb|CDY11361.1| BnaA09g39270D [Brassica napus]
Length=207

 Score = 95.5 bits (236),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 75/123 (61%), Gaps = 10/123 (8%)
 Frame = +2

Query  128  FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGVY  307
             T++GLGY+IAIA GFL+L ST++L+SYICCR+   R      + ++ + N       + 
Sbjct  22   ITSLGLGYSIAIALGFLILISTIILSSYICCRASRLRFSTSAANLDSSFGN-----RSII  76

Query  308  LPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICL  487
            +PRI+FVA+ D+     SG  V  GL+Q +INSYPK    +  G  G     DT CSICL
Sbjct  77   VPRIMFVADGDDLESAPSGNIVVGGLEQPIINSYPKFRDDELQGGDG-----DTTCSICL  131

Query  488  CEY  496
            CEY
Sbjct  132  CEY  134



>ref|XP_009345625.1| PREDICTED: RING-H2 finger protein ATL67-like, partial [Pyrus 
x bretschneideri]
Length=178

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 75/122 (61%), Gaps = 8/122 (7%)
 Frame = +2

Query  137  IGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGVYLPR  316
            +GLGY IAI+ GFLVLFST+LLASYICC    +R R          +N +P   GV LPR
Sbjct  1    LGLGYGIAISLGFLVLFSTLLLASYICC--RVSRHRHHHHHQPPQRQNPNPSPEGVILPR  58

Query  317  IIFVAEDDEENDGVSGQNVA-LGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCE  493
            IIFVAEDD E         A +GL  +VINSYPK  +SK +  P  +T     CSICLC+
Sbjct  59   IIFVAEDDNEQQQQDDDENAVVGLHPSVINSYPKFPFSKEASTPDSST-----CSICLCD  113

Query  494  YK  499
            YK
Sbjct  114  YK  115



>ref|XP_008343409.1| PREDICTED: RING-H2 finger protein ATL67-like [Malus domestica]
Length=199

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 77/130 (59%), Gaps = 10/130 (8%)
 Frame = +2

Query  116  APTNF-TTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPD  292
            +PTN+ TT+GLGY IAI+ GFLVLFST+LLASYICCR    R              S   
Sbjct  15   SPTNYLTTLGLGYGIAISLGFLVLFSTLLLASYICCRVSRHRHHHHHPPQPQNPNPS---  71

Query  293  DNGVYLPRIIFVAEDDEENDGVSGQ-NVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDT  469
              GV LPRIIFVAEDD E        N  +GL  +VINSYP   +SK +  P  +T    
Sbjct  72   PEGVILPRIIFVAEDDNEQQQQDDDGNAVVGLHPSVINSYPXFPFSKEASTPDSST----  127

Query  470  LCSICLCEYK  499
             CSICLC+YK
Sbjct  128  -CSICLCDYK  136



>ref|XP_006294928.1| hypothetical protein CARUB_v10023982mg, partial [Capsella rubella]
 gb|EOA27826.1| hypothetical protein CARUB_v10023982mg, partial [Capsella rubella]
Length=233

 Score = 93.6 bits (231),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 80/128 (63%), Gaps = 16/128 (13%)
 Frame = +2

Query  128  FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNG-V  304
             TT+G GY+IAIA GFLVL STVLL+SYICC         R          S  D  G V
Sbjct  50   LTTLGFGYSIAIALGFLVLLSTVLLSSYICC---------RDSRRRTTAVESTGDRGGSV  100

Query  305  YLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNP---GGTTGNDTLC  475
             LPRIIFVAE+D  ND  +G +V +GLDQAVINSYPK  +SK S      G  +G DT C
Sbjct  101  ILPRIIFVAEED--NDLEAG-DVVVGLDQAVINSYPKFHFSKESSAASLDGFGSGGDTTC  157

Query  476  SICLCEYK  499
            SICLCEYK
Sbjct  158  SICLCEYK  165



>ref|XP_011468973.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101302880 
[Fragaria vesca subsp. vesca]
Length=689

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 66/128 (52%), Positives = 78/128 (61%), Gaps = 15/128 (12%)
 Frame = +2

Query  128  FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGVY  307
             TT+GLGYAIAIA GFLVL ST+LLASYICC       RR +       +N +    GV 
Sbjct  13   LTTLGLGYAIAIALGFLVLLSTLLLASYICC----RVSRRSQTQTRTRTQNPNSSSEGVI  68

Query  308  LPRIIFVAEDDE----ENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLC  475
            LPRIIFVAEDD+    +ND     N A GL   VINSYPK  +SK  G      G+ + C
Sbjct  69   LPRIIFVAEDDDLENPQND--DDNNSAAGLHHNVINSYPKFPFSKELGG-----GDASTC  121

Query  476  SICLCEYK  499
            SICLC+Y+
Sbjct  122  SICLCDYR  129



>ref|XP_008375945.1| PREDICTED: uncharacterized protein LOC103439174 [Malus domestica]
Length=672

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 64/129 (50%), Positives = 79/129 (61%), Gaps = 13/129 (10%)
 Frame = +2

Query  119  PTNF-TTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDD  295
            PTN+ TT+GLGY IAI+ GFLVLFST+LLASY+CCR    R  + R              
Sbjct  11   PTNYLTTLGLGYGIAISLGFLVLFSTLLLASYLCCRVSRHRPPQPRNPNPNPNP------  64

Query  296  NGVYLPRIIFVAEDDEENDGVSGQNVA-LGLDQAVINSYPKLVYSKRSGNPGGTTGNDTL  472
             GV LPRIIFV+EDD + +       A +GL  +VINSYPK  +SK +  P  +T     
Sbjct  65   EGVILPRIIFVSEDDNDQEQQDDDENAVVGLHPSVINSYPKFPFSKEAATPDSST-----  119

Query  473  CSICLCEYK  499
            CSICLC+YK
Sbjct  120  CSICLCDYK  128



>ref|XP_008232965.1| PREDICTED: RING-H2 finger protein ATL67 [Prunus mume]
Length=193

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 72/125 (58%), Gaps = 11/125 (9%)
 Frame = +2

Query  128  FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGVY  307
             TT+GLGY IAIA GFLVLFST+LLASYICCR                  +     +G+ 
Sbjct  16   LTTLGLGYGIAIALGFLVLFSTLLLASYICCRVSRHHHHPPPNPNRNPNNS-----DGII  70

Query  308  LPRIIFVAEDDEENDGVSGQNVA-LGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSIC  484
            LPRIIFVAEDD +         A +G+ Q+VINSYPK  +SK       +T     CSIC
Sbjct  71   LPRIIFVAEDDNDQQQQDDDENAVVGIHQSVINSYPKFSFSKDVAAADSST-----CSIC  125

Query  485  LCEYK  499
            LC+YK
Sbjct  126  LCDYK  130



>ref|NP_182139.1| RING-H2 finger protein ATL67 [Arabidopsis thaliana]
 sp|O82353.1|ATL67_ARATH RecName: Full=RING-H2 finger protein ATL67 [Arabidopsis thaliana]
 gb|AAC62890.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAL69457.1| At2g46160/T3F17.19 [Arabidopsis thaliana]
 gb|AEC10650.1| RING-H2 finger protein ATL67 [Arabidopsis thaliana]
Length=214

 Score = 90.1 bits (222),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 77/128 (60%), Gaps = 15/128 (12%)
 Frame = +2

Query  128  FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNG-V  304
             TT+G GY+IAIA GFLVL STVLL+SYICC         R          S  D  G V
Sbjct  30   LTTLGFGYSIAIALGFLVLLSTVLLSSYICC---------RDSRRRTTAVESTGDRGGSV  80

Query  305  YLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGG---TTGNDTLC  475
             LPRIIFVAE+D  N+ +   +V +GLDQAVINSYPK  +SK +          G DT C
Sbjct  81   ILPRIIFVAEED--NEDLEAGDVVVGLDQAVINSYPKFHFSKDTSAASSDGFGGGGDTTC  138

Query  476  SICLCEYK  499
            SICLCEYK
Sbjct  139  SICLCEYK  146



>ref|XP_006397800.1| hypothetical protein EUTSA_v10001804mg [Eutrema salsugineum]
 gb|ESQ39253.1| hypothetical protein EUTSA_v10001804mg [Eutrema salsugineum]
Length=214

 Score = 89.7 bits (221),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 77/129 (60%), Gaps = 13/129 (10%)
 Frame = +2

Query  122  TNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNG  301
            T  TT+G GY+IAIA GFLVL STVLL+SYICC        R          ++      
Sbjct  28   TYLTTLGFGYSIAIALGFLVLLSTVLLSSYICC--------RDSRRRTTAVESTGERGGS  79

Query  302  VYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGG---TTGNDTL  472
            V LPRIIFVAE+D  N+ +   +V +GLDQAVINSYPK  +SK +          G DT 
Sbjct  80   VILPRIIFVAEED--NEDLEAGDVIVGLDQAVINSYPKFHFSKETSAASSDGFGGGGDTT  137

Query  473  CSICLCEYK  499
            CSICLCEY+
Sbjct  138  CSICLCEYR  146



>ref|XP_009345627.1| PREDICTED: RING-H2 finger protein ATL67-like, partial [Pyrus 
x bretschneideri]
Length=174

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 72/118 (61%), Gaps = 8/118 (7%)
 Frame = +2

Query  149  YAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGVYLPRIIFV  328
            YA+AI+ GFLVLFST+LLASYICC    +R R          +N +P   GV LPRIIFV
Sbjct  1    YALAISLGFLVLFSTLLLASYICC--RVSRHRHHHHHQPPQRQNPNPSPEGVILPRIIFV  58

Query  329  AEDDEENDGVSGQNVA-LGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYK  499
            AEDD E         A +GL  +VINSYPK  +SK +  P  +T     CSICLC+YK
Sbjct  59   AEDDNEQQQQDDDENAVVGLHPSVINSYPKFPFSKEASTPDSST-----CSICLCDYK  111



>emb|CDX79992.1| BnaA05g01640D [Brassica napus]
Length=208

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 77/127 (61%), Gaps = 19/127 (15%)
 Frame = +2

Query  128  FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGVY  307
             TT+G GY+IAIA GFLVL STVLL+SYICCR    R       +             V 
Sbjct  30   LTTLGFGYSIAIALGFLVLLSTVLLSSYICCRDSRRRTTAVESTSA-----------SVI  78

Query  308  LPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKR---SGNPGGTTGNDTLCS  478
            LPR+IFVAE+D E       +V +GLDQAVINSYPK  +SK    + + G  +G DT CS
Sbjct  79   LPRVIFVAEEDLE-----AGDVNVGLDQAVINSYPKFHFSKETSAASSDGLGSGGDTTCS  133

Query  479  ICLCEYK  499
            ICLCEY+
Sbjct  134  ICLCEYR  140



>emb|CDY42011.1| BnaC04g00890D [Brassica napus]
Length=208

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 77/127 (61%), Gaps = 19/127 (15%)
 Frame = +2

Query  128  FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGVY  307
             TT+G GY+IAIA GFLVL STVLL+SYICCR    R       +             V 
Sbjct  30   LTTLGFGYSIAIALGFLVLLSTVLLSSYICCRDSRRRTTAVESTSA-----------SVI  78

Query  308  LPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKR---SGNPGGTTGNDTLCS  478
            LPR+IFVAE+D E       +V +GLDQAVINSYPK  +SK    + + G  +G DT CS
Sbjct  79   LPRVIFVAEEDLE-----AGDVNVGLDQAVINSYPKFHFSKETSAASSDGFGSGGDTTCS  133

Query  479  ICLCEYK  499
            ICLCEY+
Sbjct  134  ICLCEYR  140



>ref|XP_009142683.1| PREDICTED: RING-H2 finger protein ATL67 [Brassica rapa]
Length=208

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 77/127 (61%), Gaps = 19/127 (15%)
 Frame = +2

Query  128  FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGVY  307
             TT+G GY+IAIA GFLVL STVLL+SYICCR    R       +             V 
Sbjct  30   LTTLGFGYSIAIALGFLVLLSTVLLSSYICCRGSRRRTTAVESTSA-----------SVI  78

Query  308  LPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKR---SGNPGGTTGNDTLCS  478
            LPR+IFVAE+D E       +V +GLDQAVINSYPK  +SK    + + G  +G DT CS
Sbjct  79   LPRVIFVAEEDLE-----AGDVNVGLDQAVINSYPKFHFSKETSAASSDGFGSGGDTTCS  133

Query  479  ICLCEYK  499
            ICLCEY+
Sbjct  134  ICLCEYR  140



>ref|XP_002301380.1| hypothetical protein POPTR_0002s16670g [Populus trichocarpa]
 gb|EEE80653.1| hypothetical protein POPTR_0002s16670g [Populus trichocarpa]
Length=171

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 74/137 (54%), Gaps = 35/137 (26%)
 Frame = +2

Query  98   TVKPNSAPTN---FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaea  268
            TV  +++P +    T +GLGY+IAIA GFLVL ST+LLASYICCR+              
Sbjct  5    TVTTSTSPPSSNYLTNLGLGYSIAIALGFLVLVSTILLASYICCRATRN-----------  53

Query  269  gyrNSHPDDNGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPG  448
                SH                D+E+   + G   A+GLDQAVINSYPK  +S+  G   
Sbjct  54   ---RSH----------------DEEQERDLEG--AAVGLDQAVINSYPKFQFSRDGGFCE  92

Query  449  GTTGNDTLCSICLCEYK  499
             T   ++ CSICLCEYK
Sbjct  93   RTDNLNSTCSICLCEYK  109



>ref|XP_004492810.1| PREDICTED: RING-H2 finger protein ATL67-like [Cicer arietinum]
Length=178

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 69/127 (54%), Gaps = 21/127 (17%)
 Frame = +2

Query  128  FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDN---  298
            FT  G GY+IAIA  FLVLF+T++L+ Y CCR+                   H   N   
Sbjct  8    FTNFGFGYSIAIALAFLVLFATLILSFYFCCRTNNNPNNNHNSI--------HDTPNYSL  59

Query  299  GVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCS  478
            GV + R IFV EDDEE       N  +GLD+ VINSYP+  +++   N     G ++ CS
Sbjct  60   GVVVSRDIFVTEDDEE-------NTVVGLDENVINSYPRFQFNR---NNATVLGQNSTCS  109

Query  479  ICLCEYK  499
            ICLCEYK
Sbjct  110  ICLCEYK  116



>ref|XP_010506614.1| PREDICTED: RING-H2 finger protein ATL67 [Camelina sativa]
Length=214

 Score = 87.4 bits (215),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 80/128 (63%), Gaps = 16/128 (13%)
 Frame = +2

Query  128  FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNG-V  304
             TT+G GY+IAIA GFLVL STVLL+SYICC         R          S  D  G V
Sbjct  31   LTTLGFGYSIAIALGFLVLLSTVLLSSYICC---------RDSRRRTTAVESVGDRGGSV  81

Query  305  YLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVY---SKRSGNPGGTTGNDTLC  475
             LPRIIFVAE+D  ND  +G +V +GLDQAVINSYPK  Y   S  + + G  +G DT C
Sbjct  82   ILPRIIFVAEED--NDLEAG-DVVVGLDQAVINSYPKFHYSKDSSAASSDGFGSGGDTTC  138

Query  476  SICLCEYK  499
            SICLCEYK
Sbjct  139  SICLCEYK  146



>gb|KFK37394.1| hypothetical protein AALP_AA4G251500 [Arabis alpina]
Length=215

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 76/129 (59%), Gaps = 16/129 (12%)
 Frame = +2

Query  128  FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNG--  301
             TT+G GY+IAI  GFLVL STVLL+SYICC         R          S  D  G  
Sbjct  30   LTTLGFGYSIAITLGFLVLLSTVLLSSYICC---------RDSRRRTTAVESTGDRGGGS  80

Query  302  VYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGG---TTGNDTL  472
            V LPRIIFVAE+D  N+ +   ++ +GLDQ VINSYPK  +SK +          G DT+
Sbjct  81   VVLPRIIFVAEED--NEDLEAGDLIIGLDQNVINSYPKFHFSKETSAASSDGFGGGGDTM  138

Query  473  CSICLCEYK  499
            CSICLCEYK
Sbjct  139  CSICLCEYK  147



>ref|XP_006583264.1| PREDICTED: RING-H2 finger protein ATL67-like [Glycine max]
Length=190

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 74/122 (61%), Gaps = 17/122 (14%)
 Frame = +2

Query  137  IGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGVYLPR  316
            +G GY+IAIA G L L ST++L+SY+CC        R            H  D GV LPR
Sbjct  23   LGFGYSIAIALGVLFLLSTLILSSYLCC--------RTLRRRNNNNNRRHTPD-GVVLPR  73

Query  317  IIFVAEDDEENDGVSGQN-VALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCE  493
            +IFV ED++++D  + QN VA GLDQAVINSYPK  + K  GN       D+ CSICLCE
Sbjct  74   VIFVPEDEDDDDDDTRQNDVATGLDQAVINSYPKFPFVK-EGN------YDSTCSICLCE  126

Query  494  YK  499
            YK
Sbjct  127  YK  128



>ref|XP_006842923.1| hypothetical protein AMTR_s00075p00134690 [Amborella trichopoda]
 gb|ERN04598.1| hypothetical protein AMTR_s00075p00134690 [Amborella trichopoda]
Length=178

 Score = 84.0 bits (206),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 77/127 (61%), Gaps = 26/127 (20%)
 Frame = +2

Query  125  NFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDN--  298
            NF+++GLGY+IAIA G LVL ST+LLASYICC                  R S P  N  
Sbjct  13   NFSSLGLGYSIAIALGLLVLLSTILLASYICC----------------RGRRSPPPSNVE  56

Query  299  GVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCS  478
             + LPRIIFVAE +E+       +V +GLDQ +INSYPK  +SK       + GN+ +CS
Sbjct  57   TIVLPRIIFVAEGEEDE--GDEHSVVVGLDQNMINSYPKFAFSK------ASKGNEAMCS  108

Query  479  ICLCEYK  499
            ICLCEYK
Sbjct  109  ICLCEYK  115



>ref|XP_002880221.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56480.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=214

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 78/128 (61%), Gaps = 15/128 (12%)
 Frame = +2

Query  128  FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNG-V  304
             TT+G GY+IAIA GFLVL STVLL+SYICC         R          S  D  G V
Sbjct  30   LTTLGFGYSIAIALGFLVLLSTVLLSSYICC---------RDSRRRTTAVESAGDHGGSV  80

Query  305  YLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVY---SKRSGNPGGTTGNDTLC  475
             LPRIIFVAE+D  N+ +   +V +GLDQAVINSYPK  +   S  + + G   G DT C
Sbjct  81   ILPRIIFVAEED--NEDLEAGDVVVGLDQAVINSYPKFHFSKDSSAASSDGFGGGGDTTC  138

Query  476  SICLCEYK  499
            SICLCEYK
Sbjct  139  SICLCEYK  146



>ref|XP_010508059.1| PREDICTED: RING-H2 finger protein ATL67-like [Camelina sativa]
Length=214

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 79/128 (62%), Gaps = 16/128 (13%)
 Frame = +2

Query  128  FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNG-V  304
             TT+G GY+IAIA GFLVL STVLL+SYICC         R          S  D  G V
Sbjct  31   LTTLGFGYSIAIALGFLVLLSTVLLSSYICC---------RDSRRRTTAVESVGDRGGSV  81

Query  305  YLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVY---SKRSGNPGGTTGNDTLC  475
             LPRIIFVAE+D  ND  +G +V +GLDQAVINSYPK  Y   S  + + G   G DT C
Sbjct  82   ILPRIIFVAEED--NDLEAG-DVVVGLDQAVINSYPKFHYSKDSSAASSDGFGGGGDTTC  138

Query  476  SICLCEYK  499
            SICLCEYK
Sbjct  139  SICLCEYK  146



>gb|ABD28581.1| Zinc finger, RING-type [Medicago truncatula]
 gb|AES80320.2| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula]
Length=179

 Score = 81.6 bits (200),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 67/124 (54%), Gaps = 15/124 (12%)
 Frame = +2

Query  128  FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGVY  307
            FT +GLGY+IAI   FLVL +T++L+ Y+CCR           +             GV 
Sbjct  8    FTNLGLGYSIAITLAFLVLLATLILSFYLCCRKNNNPNNNLNNNTNTLNYT-----EGVI  62

Query  308  LPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICL  487
            +   IF+AE+DEE       N  +GL+  +INSYP+  +S+ S       G +T CSICL
Sbjct  63   VRTDIFIAENDEE-------NAVVGLEDNMINSYPRFQFSRDSAT---VLGQNTTCSICL  112

Query  488  CEYK  499
            CEYK
Sbjct  113  CEYK  116



>ref|XP_003624102.1| Ring finger protein [Medicago truncatula]
Length=298

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 67/124 (54%), Gaps = 15/124 (12%)
 Frame = +2

Query  128  FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGVY  307
            FT +GLGY+IAI   FLVL +T++L+ Y+CCR           +             GV 
Sbjct  8    FTNLGLGYSIAITLAFLVLLATLILSFYLCCRKNNNPNNNLNNNTNTLNYT-----EGVI  62

Query  308  LPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICL  487
            +   IF+AE+DEEN  V       GL+  +INSYP+  +S+ S       G +T CSICL
Sbjct  63   VRTDIFIAENDEENAVV-------GLEDNMINSYPRFQFSRDSAT---VLGQNTTCSICL  112

Query  488  CEYK  499
            CEYK
Sbjct  113  CEYK  116



>ref|XP_010518279.1| PREDICTED: RING-H2 finger protein ATL67-like [Camelina sativa]
 ref|XP_010518280.1| PREDICTED: RING-H2 finger protein ATL67-like [Camelina sativa]
 ref|XP_010518281.1| PREDICTED: RING-H2 finger protein ATL67-like [Camelina sativa]
Length=214

 Score = 79.3 bits (194),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 77/128 (60%), Gaps = 16/128 (13%)
 Frame = +2

Query  128  FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNG-V  304
             T +G GY+IAIA GFLVL STVLL+SYICC         R          S  D  G V
Sbjct  31   LTNLGFGYSIAIALGFLVLLSTVLLSSYICC---------RDSRRRTTAVESVGDRGGSV  81

Query  305  YLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVY---SKRSGNPGGTTGNDTLC  475
             LPRIIFVAE+D  ND  +G +V +G DQAVINSYPK  Y   S  + + G   G DT C
Sbjct  82   ILPRIIFVAEED--NDLEAG-DVVVGFDQAVINSYPKFHYSKDSSAASSDGFGGGGDTTC  138

Query  476  SICLCEYK  499
            SICLCEYK
Sbjct  139  SICLCEYK  146



>ref|XP_007139765.1| hypothetical protein PHAVU_008G057200g [Phaseolus vulgaris]
 gb|ESW11759.1| hypothetical protein PHAVU_008G057200g [Phaseolus vulgaris]
Length=186

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 90/133 (68%), Gaps = 10/133 (8%)
 Frame = +2

Query  101  VKPNSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrN  280
            + P+    +FT +GLGY+IAIA  FL L ST+LL+SY+CCR+   R +   +   A    
Sbjct  1    MSPSIPSPHFTHLGLGYSIAIALAFLFLLSTLLLSSYLCCRATRHRNQTTAVATAA----  56

Query  281  SHPDDNGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTG  460
            ++P D GV LPR+IFVAEDDEE++  S   VALGLDQ+VINSYP+  + +  G+   + G
Sbjct  57   ANPSD-GVVLPRVIFVAEDDEEDEEAS---VALGLDQSVINSYPRFQFDR--GSARNSNG  110

Query  461  NDTLCSICLCEYK  499
            N+  CSICLCEYK
Sbjct  111  NNNTCSICLCEYK  123



>ref|XP_010092874.1| RING-H2 finger protein ATL68 [Morus notabilis]
 gb|EXB52692.1| RING-H2 finger protein ATL68 [Morus notabilis]
Length=207

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 77/128 (60%), Gaps = 10/128 (8%)
 Frame = +2

Query  128  FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGVY  307
            FT +GLGY IAIA GFLVL S +LLASYICC   +         +     N +P+ +G+ 
Sbjct  23   FTNLGLGYPIAIALGFLVLLSILLLASYICC-RASRASYHSSSSSVPSNLNPNPNHDGII  81

Query  308  LPRIIFVAEDDEENDGVSGQNV----ALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLC  475
            LPRIIFVAED++++      ++     +GL Q+VINSYPK  Y +      G    ++ C
Sbjct  82   LPRIIFVAEDEDDDADGRRGDLDDGAVVGLHQSVINSYPKFPYER-----DGAGIKESTC  136

Query  476  SICLCEYK  499
            SICLCEYK
Sbjct  137  SICLCEYK  144



>ref|XP_008680882.1| PREDICTED: RING-H2 finger protein ATL67-like [Zea mays]
Length=191

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 52/141 (37%), Positives = 72/141 (51%), Gaps = 18/141 (13%)
 Frame = +2

Query  98   TVKPNSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyr  277
            +V   +A    + +GLGY+IAIA GFL+LF++ LLA Y C       R       EA   
Sbjct  12   SVSSTTARPQLSNLGLGYSIAIALGFLILFASFLLAFYFC-----FGRGGDYWAGEAVTT  66

Query  278  NSHPDDNGVYLPRIIFVAEDDE--ENDG-----VSGQNVALGLDQAVINSYPKLVYSKRS  436
             S      + +PR++FVAE  E  E+D       +     +GLD A I SYPK+ +S R+
Sbjct  67   ASSSGHLSITVPRVLFVAEGSESPEDDAYPSSSAAAACSPVGLDAAAIASYPKVAFSSRA  126

Query  437  GNPGGTTGNDTLCSICLCEYK  499
                     D +CSICL EY+
Sbjct  127  AE------ADAMCSICLSEYR  141



>ref|XP_008650149.1| PREDICTED: RING-H2 finger protein ATL67-like [Zea mays]
Length=246

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 52/141 (37%), Positives = 73/141 (52%), Gaps = 18/141 (13%)
 Frame = +2

Query  98   TVKPNSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyr  277
            +V   +A    + +GLGY+IAIA GFL+LF++ LLA Y C       R       EA   
Sbjct  67   SVSSTTARPQLSNLGLGYSIAIALGFLILFASFLLAFYFC-----FGRGGDYWAGEAVTT  121

Query  278  NSHPDDNGVYLPRIIFVAEDDE--ENDG-----VSGQNVALGLDQAVINSYPKLVYSKRS  436
             S      + +PR++FVAE  E  E+D       +     +GLD A I SYPK+V+S ++
Sbjct  122  ASSSGHLSITVPRVLFVAEGSESPEDDAYPSSSAAAACSPVGLDAAAIASYPKVVFSSKA  181

Query  437  GNPGGTTGNDTLCSICLCEYK  499
                     D +CSICL EY+
Sbjct  182  AE------ADAMCSICLSEYR  196



>ref|XP_003534530.1| PREDICTED: RING-H2 finger protein ATL67-like [Glycine max]
 gb|KHN29298.1| RING-H2 finger protein ATL68 [Glycine soja]
Length=184

 Score = 76.3 bits (186),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 79/125 (63%), Gaps = 15/125 (12%)
 Frame = +2

Query  125  NFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGV  304
            +F  +GLGY+IAIA  FL L ST+LL+SY+CCR    R R     A +        D G+
Sbjct  12   HFPHLGLGYSIAIALAFLFLLSTLLLSSYLCCRHNRRRLRHTTAAATS--------DGGI  63

Query  305  YLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSIC  484
             LPR+IFVAED++E DG    +VA+G DQ+VINSYP+  +++   N       +T CSIC
Sbjct  64   VLPRVIFVAEDEDE-DG----SVAVGFDQSVINSYPRFQFNR--DNARNNNIINTTCSIC  116

Query  485  LCEYK  499
            LCEYK
Sbjct  117  LCEYK  121



>ref|XP_010054857.1| PREDICTED: uncharacterized protein LOC104443218 [Eucalyptus grandis]
Length=699

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 47/68 (69%), Gaps = 5/68 (7%)
 Frame = +2

Query  296  NGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLC  475
            +G+ LPRIIFVAEDD E      Q  A+GLD +VINSYPK  +S+ +G  GG+    T C
Sbjct  75   DGIILPRIIFVAEDDNEGSEAE-QGAAVGLDPSVINSYPKFAFSREAGGVGGS----TTC  129

Query  476  SICLCEYK  499
            SICLCEYK
Sbjct  130  SICLCEYK  137



>ref|XP_008671136.1| PREDICTED: RING-H2 finger protein ATL67-like [Zea mays]
 ref|XP_008660621.1| PREDICTED: RING-H2 finger protein ATL67-like [Zea mays]
Length=191

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 72/141 (51%), Gaps = 18/141 (13%)
 Frame = +2

Query  98   TVKPNSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyr  277
            +V   +A    + +GLGY+IAIA GFL+LF++ LLA Y C       R       EA   
Sbjct  12   SVSSTTARPQLSNLGLGYSIAIALGFLILFASFLLAFYFC-----FGRGGDYWAGEAVTT  66

Query  278  NSHPDDNGVYLPRIIFVAEDDE--ENDG-----VSGQNVALGLDQAVINSYPKLVYSKRS  436
             S      + +PR++FVAE  E  E+D       +     +GLD A I SYPK+ +S ++
Sbjct  67   ASSSGHLSITVPRVLFVAEGSESPEDDAYPSSSAAAACSPVGLDAAAIASYPKVAFSSKA  126

Query  437  GNPGGTTGNDTLCSICLCEYK  499
                     D +CSICL EY+
Sbjct  127  AE------ADAMCSICLSEYR  141



>ref|XP_010916932.1| PREDICTED: RING-H2 finger protein ATL67-like [Elaeis guineensis]
Length=210

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 75/129 (58%), Gaps = 16/129 (12%)
 Frame = +2

Query  125  NFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGV  304
            N + +GLGYAIAIA G LVL STVLLASY+CCR+ +            G  ++      V
Sbjct  28   NLSNLGLGYAIAIALGVLVLLSTVLLASYVCCRARSRNTNPNPNGGGTGGNSNG-----V  82

Query  305  YLPRIIFVAED--DEENDGVSGQN--VALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTL  472
             LPRIIFVAED  DE+N+G  G       GLD A I+SYP+  +S          G DT+
Sbjct  83   VLPRIIFVAEDDNDEDNNGEEGGRGSAPTGLDPAAISSYPRFPFS-------AAKGGDTV  135

Query  473  CSICLCEYK  499
            CSICL EY+
Sbjct  136  CSICLGEYR  144



>ref|XP_008671143.1| PREDICTED: RING-H2 finger protein ATL67-like [Zea mays]
 ref|XP_008671172.1| PREDICTED: RING-H2 finger protein ATL67-like [Zea mays]
 ref|XP_008657436.1| PREDICTED: RING-H2 finger protein ATL67-like [Zea mays]
Length=276

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 72/141 (51%), Gaps = 18/141 (13%)
 Frame = +2

Query  98   TVKPNSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyr  277
            +V   +A    + +GLGY+IAIA GFL+LF++ LLA Y C       R       EA   
Sbjct  97   SVSSTTARPQLSNLGLGYSIAIALGFLILFASFLLAFYFC-----FGRGGDYWAGEAVTT  151

Query  278  NSHPDDNGVYLPRIIFVAEDDE--ENDG-----VSGQNVALGLDQAVINSYPKLVYSKRS  436
             S      + +PR++FVAE  E  E+D       +     +GLD A I SYPK+ +S ++
Sbjct  152  ASSSGHLSITVPRVLFVAEGSESPEDDAYPSSSAAAACSPVGLDAAAIASYPKVAFSSKA  211

Query  437  GNPGGTTGNDTLCSICLCEYK  499
                     D +CSICL EY+
Sbjct  212  AE------ADAMCSICLSEYR  226



>ref|XP_002511929.1| ATRAD3, putative [Ricinus communis]
 gb|EEF50598.1| ATRAD3, putative [Ricinus communis]
Length=615

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 48/100 (48%), Positives = 61/100 (61%), Gaps = 7/100 (7%)
 Frame = +2

Query  107  PNSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsi--aarrrrrrldaeagyrN  280
            P++     T +GLGY+IAIA GFLVL ST+LLASYICCR+            +      N
Sbjct  20   PSNPSGYLTNLGLGYSIAIALGFLVLLSTILLASYICCRASRNRTSNSNNDNNNNNNNSN  79

Query  281  SHPDDNGVYLPRIIFVAEDDE--ENDGVSGQNVALGLDQA  394
             +   +G+ LPRIIFVAEDDE  E D    ++ A+GLDQA
Sbjct  80   PNSGTDGIILPRIIFVAEDDEALERD---QESAAIGLDQA  116



>ref|XP_008665968.1| PREDICTED: RING-H2 finger protein ATL67-like [Zea mays]
Length=191

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 50/141 (35%), Positives = 72/141 (51%), Gaps = 18/141 (13%)
 Frame = +2

Query  98   TVKPNSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyr  277
            +V   +A    + +GLGY+IAIA GFL+LF++ LLA Y C       R       EA   
Sbjct  12   SVSSTTARPQLSNLGLGYSIAIALGFLILFASFLLAFYFC-----FGRGGDYWAGEAVTT  66

Query  278  NSHPDDNGVYLPRIIFVAEDDE--ENDG-----VSGQNVALGLDQAVINSYPKLVYSKRS  436
             S      + +PR++FVAE  E  ++D       +     +GLD A I SYPK+ +S ++
Sbjct  67   ASSSGHLSITVPRVLFVAEGSESPKDDAYPSSSAAAACSPVGLDAAAIASYPKVAFSSKA  126

Query  437  GNPGGTTGNDTLCSICLCEYK  499
                     D +CSICL EY+
Sbjct  127  AE------ADAMCSICLSEYR  141



>gb|AFW57001.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=208

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 72/141 (51%), Gaps = 18/141 (13%)
 Frame = +2

Query  98   TVKPNSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyr  277
            +V   +A    + +GLGY+IAIA GFL+LF++ LLA Y C       R       EA   
Sbjct  12   SVSSMTARRQLSNLGLGYSIAIALGFLILFASFLLAFYFC-----FGRGGDYWAGEAVTT  66

Query  278  NSHPDDNGVYLPRIIFVAEDDE--ENDG-----VSGQNVALGLDQAVINSYPKLVYSKRS  436
             S      + +PR++FVAE  E  E+D       +     +GLD A I SYPK+ +S R+
Sbjct  67   ASSSGHLSITVPRVLFVAEGSESPEDDAYPSSSAAAACSPVGLDAAAIASYPKVAFSSRA  126

Query  437  GNPGGTTGNDTLCSICLCEYK  499
                     + +CSICL EY+
Sbjct  127  AE------ANAMCSICLSEYR  141



>ref|XP_009381057.1| PREDICTED: RING-H2 finger protein ATL67-like [Musa acuminata 
subsp. malaccensis]
Length=188

 Score = 73.6 bits (179),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 76/129 (59%), Gaps = 17/129 (13%)
 Frame = +2

Query  113  SAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPD  292
            S+ ++FTT+ L  AIA++ G LVL S +L+ASY+CCR  +           +        
Sbjct  10   SSSSHFTTLSLPLAIAVSLGLLVLLSALLVASYVCCRRQSRDPDPDPGPGPSPAIA----  65

Query  293  DNGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTL  472
             +G+ LPRIIFVAEDDE + G      A GLDQA I+SYPK  +S  S       G DT+
Sbjct  66   -DGIVLPRIIFVAEDDEGDGG-----RASGLDQAAISSYPKFPFSVAS-------GGDTV  112

Query  473  CSICLCEYK  499
            CSICLCEY+
Sbjct  113  CSICLCEYR  121



>gb|KJB49432.1| hypothetical protein B456_008G119400 [Gossypium raimondii]
Length=199

 Score = 73.6 bits (179),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 83/136 (61%), Gaps = 8/136 (6%)
 Frame = +2

Query  107  PNSAPTNFTT-IGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNS  283
            P S+PT  TT +G+GYAI +A GFL+L ST+LLASYIC RS +    R           +
Sbjct  5    PLSSPTYLTTNLGVGYAIVVALGFLLLLSTLLLASYICFRSSSPLPPRAISPNPISTPTA  64

Query  284  HPDDNGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPG----G  451
              + NG+ LPRI+F+ E+D   +      V  GLD+AVINSYPK  +SK   +      G
Sbjct  65   A-NSNGIVLPRIVFIGEEDH--EHDEENVVVFGLDRAVINSYPKFRFSKEEVSTAVEVTG  121

Query  452  TTGNDTLCSICLCEYK  499
            ++  +T+CSICLCEY+
Sbjct  122  SSARNTICSICLCEYR  137



>ref|XP_008663969.1| PREDICTED: RING-H2 finger protein ATL67-like [Zea mays]
Length=193

 Score = 73.2 bits (178),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 50/136 (37%), Positives = 70/136 (51%), Gaps = 18/136 (13%)
 Frame = +2

Query  113  SAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPD  292
            +A    + +GLGY+IAIA GFL+LF++ LLA Y C       R       EA    S   
Sbjct  2    TARRQLSNLGLGYSIAIALGFLILFASFLLAFYFC-----FGRGGDYWAGEAVTTASSSG  56

Query  293  DNGVYLPRIIFVAEDDE--ENDG-----VSGQNVALGLDQAVINSYPKLVYSKRSGNPGG  451
               + +PR++FVAE  E  E+D       +     +GLD A I SYPK+ +S R+     
Sbjct  57   HLSITVPRVLFVAEGSESPEDDAYPSSSAAAACSPVGLDAAAIASYPKVAFSSRAAE---  113

Query  452  TTGNDTLCSICLCEYK  499
                + +CSICL EY+
Sbjct  114  ---ANAMCSICLSEYR  126



>gb|AFW57002.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=273

 Score = 73.6 bits (179),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 72/141 (51%), Gaps = 18/141 (13%)
 Frame = +2

Query  98   TVKPNSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyr  277
            +V   +A    + +GLGY+IAIA GFL+LF++ LLA Y C       R       EA   
Sbjct  12   SVSSMTARRQLSNLGLGYSIAIALGFLILFASFLLAFYFC-----FGRGGDYWAGEAVTT  66

Query  278  NSHPDDNGVYLPRIIFVAEDDE--ENDG-----VSGQNVALGLDQAVINSYPKLVYSKRS  436
             S      + +PR++FVAE  E  E+D       +     +GLD A I SYPK+ +S R+
Sbjct  67   ASSSGHLSITVPRVLFVAEGSESPEDDAYPSSSAAAACSPVGLDAAAIASYPKVAFSSRA  126

Query  437  GNPGGTTGNDTLCSICLCEYK  499
                     + +CSICL EY+
Sbjct  127  AE------ANAMCSICLSEYR  141



>ref|XP_009409038.1| PREDICTED: RING-H2 finger protein ATL67 [Musa acuminata subsp. 
malaccensis]
Length=188

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 58/116 (50%), Gaps = 20/116 (17%)
 Frame = +2

Query  152  AIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGVYLPRIIFVA  331
            AIA++ G L   S +L+ SYICCR              A          GV    IIFVA
Sbjct  26   AIAVSLGLL---SALLVVSYICCRRRPQNPGSAPGPIPA---------EGVLQRHIIFVA  73

Query  332  EDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYK  499
            EDD+  D   G   A GLDQA I+SYPK  +S          G DT+CSICLCEY+
Sbjct  74   EDDDGEDS-EGGGRASGLDQAAISSYPKFPFS-------AAKGGDTVCSICLCEYR  121



>ref|XP_002992199.1| hypothetical protein SELMODRAFT_186618 [Selaginella moellendorffii]
 gb|EFJ06696.1| hypothetical protein SELMODRAFT_186618 [Selaginella moellendorffii]
Length=160

 Score = 66.6 bits (161),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 55/125 (44%), Gaps = 39/125 (31%)
 Frame = +2

Query  125  NFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGV  304
            + + +GLGY IAIA G LVL ST++LASY+C                             
Sbjct  14   SMSRVGLGYGIAIAVGILVLVSTIMLASYVC-----------------------------  44

Query  305  YLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSIC  484
                   V +     D   G+    GLDQ  + SYP++V+S +   P      DT C+IC
Sbjct  45   -------VRQQSSSRDRSDGEWTISGLDQVTLESYPRIVFSAQQPLPH---PQDTACAIC  94

Query  485  LCEYK  499
            L +Y+
Sbjct  95   LADYR  99



>ref|NP_001147642.1| RING-H2 finger protein ATL2M [Zea mays]
 gb|ACG28231.1| RING-H2 finger protein ATL2M [Zea mays]
Length=193

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 63/124 (51%), Gaps = 18/124 (15%)
 Frame = +2

Query  149  YAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGVYLPRIIFV  328
            Y+IAIA GFL+LF++ LLA Y C       R       EA    S      + +PR++FV
Sbjct  14   YSIAIALGFLILFASFLLAFYFC-----FGRGGDYWAGEAVTTASSSGHLSITVPRVLFV  68

Query  329  AEDDE--ENDGVSGQNVA-----LGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICL  487
            AE  E  E+D       A     +GLD A I SYPK+ +S R+         D +CSICL
Sbjct  69   AEGSESPEDDAYPSSAAAAACSPVGLDAAAIASYPKVAFSSRAAE------ADAMCSICL  122

Query  488  CEYK  499
             EY+
Sbjct  123  SEYR  126



>ref|NP_001147253.1| RING-H2 finger protein ATL2M [Zea mays]
 gb|ACG26390.1| RING-H2 finger protein ATL2M [Zea mays]
 gb|ACN27082.1| unknown [Zea mays]
 gb|AFW78795.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=206

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 71/135 (53%), Gaps = 15/135 (11%)
 Frame = +2

Query  128  FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDN---  298
              ++GLGYAIAIAFGFLVL ++VLLASY C R  AA +              H   +   
Sbjct  7    LASLGLGYAIAIAFGFLVLLASVLLASYFCLRRGAASQGFGTGAGVGVGSTRHAASSASS  66

Query  299  ----GVYLPRIIFVAED----DEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGT  454
                 + +PR++FVAED       + G +     +GLD +VI SYP + +SK     G  
Sbjct  67   SGHISITVPRVVFVAEDYDSPGSSSRGPAAAASPVGLDASVIASYPMVPFSKA----GAG  122

Query  455  TGNDTLCSICLCEYK  499
               +  CSICLCEYK
Sbjct  123  ADTEVACSICLCEYK  137



>emb|CDX89121.1| BnaA04g00650D [Brassica napus]
Length=191

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 58/106 (55%), Gaps = 8/106 (8%)
 Frame = +2

Query  122  TNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNG  301
            T  TT+GLGY IAIA GFL     +     ICCR+   R     ++      +S   +  
Sbjct  20   TYITTLGLGYPIAIALGFL---LLISTIILICCRASRLRFSASAVNG-----DSSFGNRS  71

Query  302  VYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSG  439
            + +PRIIFVA DD+    VS   V  GLDQA+INSYPK  Y+K  G
Sbjct  72   IIVPRIIFVAADDDLESPVSSNVVVGGLDQAIINSYPKFPYTKEDG  117



>emb|CDX99014.1| BnaC09g48210D [Brassica napus]
Length=157

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 62/134 (46%), Gaps = 43/134 (32%)
 Frame = +2

Query  119  PTN--FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPD  292
            PTN   T +GLGY IAIA   L+L ST++LASYIC                         
Sbjct  3    PTNPPATGVGLGYGIAIAVSILILISTIMLASYICI------------------------  38

Query  293  DNGVYLPRIIFVAEDDEENDGV---SGQNVALGLDQAVINSYPKLVY--SKRSGNPGGTT  457
                   R+     D   ++GV       V LGLD+ VI SYP++V   S+R   P    
Sbjct  39   -------RLKSAPRDGATSEGVLDSPAAEVKLGLDRPVIESYPRIVLGESRRLPRP----  87

Query  458  GNDTLCSICLCEYK  499
             N+  CSICLC+Y+
Sbjct  88   -NNGPCSICLCDYE  100



>ref|XP_009122386.1| PREDICTED: putative RING-H2 finger protein ATL69 [Brassica rapa]
Length=157

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 61/133 (46%), Gaps = 43/133 (32%)
 Frame = +2

Query  119  PTN--FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPD  292
            PTN   T +GLGY IAIA   L+L ST++LASYIC                     S P 
Sbjct  3    PTNPPATGVGLGYGIAIAVSILILISTIMLASYIC-----------------IRSKSAPR  45

Query  293  DNGVYLPRIIFVAEDDEENDGV---SGQNVALGLDQAVINSYPKLVY--SKRSGNPGGTT  457
            D                 +DGV       V LGLD+ VI SYP++V   S+R   P    
Sbjct  46   DGAT--------------SDGVLDSPAAEVKLGLDRPVIESYPRIVLGESRRLPRP----  87

Query  458  GNDTLCSICLCEY  496
             N+  CSICLC+Y
Sbjct  88   -NNGPCSICLCDY  99



>emb|CDM81763.1| unnamed protein product [Triticum aestivum]
Length=177

 Score = 64.7 bits (156),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 69/129 (53%), Gaps = 14/129 (11%)
 Frame = +2

Query  122  TNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNG  301
            ++  T+GLGY+IAIA GFLVL ++VLLASY C R   +              +SH     
Sbjct  8    SSLATLGLGYSIAIALGFLVLLASVLLASYFCFRHGESAGGHFAGAITPTSSSSH---LS  64

Query  302  VYLPRIIFVAEDDEENDGVSGQNVA----LGLDQAVINSYPKLVYSKRSGNPGGTTGNDT  469
            + +PR++FVAE  E  +  S    A    +GLD A I SYPK  +S+         G D 
Sbjct  65   ITVPRVLFVAEGSESPEAYSSAAAAASSPVGLDPAAIASYPKAPFSR-------AAGGDA  117

Query  470  LCSICLCEY  496
            +CSICL EY
Sbjct  118  MCSICLSEY  126



>gb|KFK25096.1| hypothetical protein AALP_AA8G065900 [Arabis alpina]
Length=196

 Score = 64.7 bits (156),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 63/135 (47%), Gaps = 34/135 (25%)
 Frame = +2

Query  101  VKPNSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrN  280
            + P S P N   +GLGY IAIA   LVL ST++LASYIC           R  +   Y +
Sbjct  37   MSPTSPPAN--GVGLGYGIAIAVSILVLISTIMLASYIC----------IRSKSGRRYHH  84

Query  281  SHPDDNGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVY--SKRSGNPGGT  454
                  GV                G     V LGLD+ VI SYP++V   S+R   P   
Sbjct  85   QEATSEGVL---------------GSPATEVKLGLDRPVIESYPRIVLGDSRRLPRP---  126

Query  455  TGNDTLCSICLCEYK  499
              N+  CSICLC+Y+
Sbjct  127  --NNGPCSICLCDYE  139



>gb|EMS59911.1| RING-H2 finger protein ATL68 [Triticum urartu]
Length=282

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 69/129 (53%), Gaps = 14/129 (11%)
 Frame = +2

Query  122  TNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNG  301
            ++  T+GLGY+IAIA GFLVL ++VLLASY C R                  +SH     
Sbjct  8    SSLATLGLGYSIAIALGFLVLLASVLLASYFCFRHGEGAGGHFAGAITPTSSSSH---LS  64

Query  302  VYLPRIIFVAEDDEENDGVSGQNVA----LGLDQAVINSYPKLVYSKRSGNPGGTTGNDT  469
            + +PR++FVAE  E  +  S    A    +GLD A I SYPK ++S+         G D 
Sbjct  65   ITVPRVLFVAEGSESPEAYSSAAAAASSPVGLDLAAIASYPKALFSR-------AAGGDA  117

Query  470  LCSICLCEY  496
            +CSICL EY
Sbjct  118  MCSICLSEY  126



>ref|XP_008246264.1| PREDICTED: putative RING-H2 finger protein ATL69 isoform X1 [Prunus 
mume]
Length=176

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 61/130 (47%), Gaps = 20/130 (15%)
 Frame = +2

Query  119  PTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDN  298
            P + T +G+GY IAIA   L L S ++LASY C           ++   +     H D N
Sbjct  7    PVSATGVGIGYGIAIAVSILFLISAIMLASYAC----------VKVKGASATTRPHEDRN  56

Query  299  GVYLPRIIFVAEDDEENDGVSGQN---VALGLDQAVINSYPKLVYSKRSGNPGGTTGNDT  469
              Y      V E    ++ V+  +   V +GLD   INSYPK+V  +    P     N T
Sbjct  57   VAYN----NVYEHRNRSEAVNSNDPVVVVMGLDGPTINSYPKMVLGESRRLP---QRNYT  109

Query  470  LCSICLCEYK  499
            +C ICL EYK
Sbjct  110  VCCICLSEYK  119



>ref|XP_001754650.1| predicted protein [Physcomitrella patens]
 gb|EDQ80620.1| predicted protein [Physcomitrella patens]
Length=175

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 59/125 (47%), Gaps = 18/125 (14%)
 Frame = +2

Query  125  NFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGV  304
            N + +GLGY IAIA G LVL ST++LASY+C                    +S       
Sbjct  4    NLSKVGLGYGIAIAVGILVLVSTIMLASYVC--------------VRVHQTSSGSQSGNS  49

Query  305  YLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSIC  484
              P       DD   + ++  + + GLDQ  + SYPK+VY+  S  P     N   CSIC
Sbjct  50   AGPAAYHSGGDDAHGNPLTEWSTS-GLDQVTVESYPKVVYTA-SQPPLNLQDNS--CSIC  105

Query  485  LCEYK  499
            L +YK
Sbjct  106  LGDYK  110



>ref|XP_001760297.1| predicted protein [Physcomitrella patens]
 gb|EDQ75053.1| predicted protein [Physcomitrella patens]
Length=183

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 55/125 (44%), Gaps = 18/125 (14%)
 Frame = +2

Query  125  NFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGV  304
            + + +GLGY IAIA G LVL STV+LASY+C        +            + PD  G 
Sbjct  12   SLSKVGLGYGIAIAVGILVLVSTVMLASYVC----VRVHQTSSGSLSGSSTGAAPDHAGG  67

Query  305  YLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSIC  484
                     E               GLDQ  + SYPK+VYS     P      DT CSIC
Sbjct  68   DDGGGGAFTEWSTS-----------GLDQITVESYPKVVYSASQALPH---LQDTSCSIC  113

Query  485  LCEYK  499
            L +YK
Sbjct  114  LGDYK  118



>ref|XP_002871246.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47505.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=159

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 57/128 (45%), Gaps = 43/128 (34%)
 Frame = +2

Query  137  IGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGVYLPR  316
            +GLGY IAIA   LVL S ++LASYIC                                R
Sbjct  11   VGLGYGIAIAVSILVLISFIMLASYICI-------------------------------R  39

Query  317  IIFVAEDDEENDGV-----SGQNVALGLDQAVINSYPKLVY--SKRSGNPGGTTGNDTLC  475
                  D+  +DGV         V LGLD+ VI SYP++V   S+R   P     N+  C
Sbjct  40   SKSTGRDEATSDGVLDSPSPAAEVKLGLDRPVIESYPRIVLGDSRRLPRP-----NNGPC  94

Query  476  SICLCEYK  499
            SICLC+Y+
Sbjct  95   SICLCDYE  102



>ref|XP_003552426.1| PREDICTED: RING-H2 finger protein ATL67-like [Glycine max]
Length=179

 Score = 61.6 bits (148),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 77/125 (62%), Gaps = 13/125 (10%)
 Frame = +2

Query  125  NFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGV  304
            +F  +GLGY+IAIA  FL L ST+LL+SY+CCR    R  +    A A        D G+
Sbjct  5    HFPHLGLGYSIAIALAFLFLLSTLLLSSYLCCRHNRRRHTQTTASAAA-------SDGGI  57

Query  305  YLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSIC  484
             LPR+IFVAEDD+E+       + +GLDQ+VINSYP+  ++K S         +T CSIC
Sbjct  58   VLPRVIFVAEDDDEDADAC---MVVGLDQSVINSYPRFQFNKDS---DARNIINTTCSIC  111

Query  485  LCEYK  499
            LCEYK
Sbjct  112  LCEYK  116



>gb|KJB67866.1| hypothetical protein B456_010G215700 [Gossypium raimondii]
Length=178

 Score = 61.2 bits (147),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 49/138 (36%), Positives = 67/138 (49%), Gaps = 23/138 (17%)
 Frame = +2

Query  92   LTTVKPNSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeag  271
            ++T  P   P + T +GLGY IAIA   LVL ST++LASY  C  + A     R    + 
Sbjct  1    MSTADP---PISTTGVGLGYGIAIAVSILVLISTIMLASYA-CVRVKASGSGNRSRRNSN  56

Query  272  yrNSHPDDNGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVY--SKRSGNP  445
              NS+    G+             E+D +    V +GLD  VI SYPK++   S+R   P
Sbjct  57   GGNSNGTSRGI------------TEDDSMDVATVVVGLDGPVIESYPKIIVGESRRLPKP  104

Query  446  GGTTGNDTLCSICLCEYK  499
                 N+  C ICL EY+
Sbjct  105  -----NNGPCCICLTEYQ  117



>gb|EAY75741.1| hypothetical protein OsI_03653 [Oryza sativa Indica Group]
Length=197

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 68/126 (54%), Gaps = 13/126 (10%)
 Frame = +2

Query  131  TTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGVYL  310
             T+GLGY+IAIA GFLVL +++LLASY C R          +   +   +       + +
Sbjct  13   ATLGLGYSIAIALGFLVLLASLLLASYFCFRRGGGGGHFSGVLTPSSSSS----HLSITV  68

Query  311  PRIIFVAEDDEEND----GVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCS  478
            PR++FVAE  E  D    GV+  +  +GLD A I SYPK+ +       G  +  D +CS
Sbjct  69   PRVLFVAEGSESPDAYSSGVAAASSPVGLDPAAIASYPKVPFYS-----GAGSDADAMCS  123

Query  479  ICLCEY  496
            ICL EY
Sbjct  124  ICLSEY  129



>ref|XP_004133841.1| PREDICTED: RING-H2 finger protein ATL67-like [Cucumis sativus]
 ref|XP_004155843.1| PREDICTED: RING-H2 finger protein ATL67-like [Cucumis sativus]
 gb|KGN56477.1| hypothetical protein Csa_3G121045 [Cucumis sativus]
Length=184

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 73/122 (60%), Gaps = 11/122 (9%)
 Frame = +2

Query  134  TIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGVYLP  313
             IGLGY+IAIA  FLVL S +LLA Y+CCR+  +R  RR     +        D G+ LP
Sbjct  12   RIGLGYSIAIALAFLVLLSALLLAFYVCCRASRSRHLRRPPPPSSRS------DAGIILP  65

Query  314  RIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCE  493
            +IIFVAEDD   D      V +GLDQ VINSYPK  +S+         G + +CSICLCE
Sbjct  66   QIIFVAEDDAAPDRDDDNGV-VGLDQTVINSYPKFPFSRDK----SMAGANCVCSICLCE  120

Query  494  YK  499
            YK
Sbjct  121  YK  122



>ref|NP_001044176.2| Os01g0736600 [Oryza sativa Japonica Group]
 dbj|BAD87014.1| RING zinc finger protein-like [Oryza sativa Japonica Group]
 gb|EAZ13459.1| hypothetical protein OsJ_03375 [Oryza sativa Japonica Group]
 dbj|BAG94186.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97131.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF06090.2| Os01g0736600 [Oryza sativa Japonica Group]
Length=197

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 50/126 (40%), Positives = 66/126 (52%), Gaps = 13/126 (10%)
 Frame = +2

Query  131  TTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGVYL  310
             T+GLGY+IAIA GFLVL +++LLASY  C                   +SH     + +
Sbjct  13   ATLGLGYSIAIALGFLVLLASLLLASYF-CFRRGGGGGHFSGVLTPSSSSSH---LSITV  68

Query  311  PRIIFVAEDDEEND----GVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCS  478
            PR++FVAE  E  D    GV+  +  +GLD A I SYPK+ +       G     D +CS
Sbjct  69   PRVLFVAEGSESPDAYSSGVAAASSPVGLDPAAIASYPKVPFYS-----GAGADADAMCS  123

Query  479  ICLCEY  496
            ICL EY
Sbjct  124  ICLSEY  129



>ref|XP_006654677.1| PREDICTED: RING-H2 finger protein ATL67-like [Oryza brachyantha]
Length=200

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 69/131 (53%), Gaps = 10/131 (8%)
 Frame = +2

Query  125  NFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGV  304
            + +++G+GYA+A+A GFLVL +++LL SY C R              A    S      +
Sbjct  7    SLSSVGVGYAVAVALGFLVLLASLLLTSYFCFRRGVPGGGGVHSARHAVSSASSSGHISI  66

Query  305  YLPRIIFVAEDDEENDGVSG------QNVALGLDQAVINSYPKLVYSKRSGNPGGTTGND  466
             +PR+IFVA+D +     S        +  +GLD AVI SYPK+ +S+ +         +
Sbjct  67   TVPRVIFVADDTDSPGSSSRGAGGGVASSPVGLDPAVIASYPKVPFSRAA----AGADAE  122

Query  467  TLCSICLCEYK  499
              CSICLCEYK
Sbjct  123  AACSICLCEYK  133



>ref|XP_002525544.1| ring finger protein, putative [Ricinus communis]
 gb|EEF36803.1| ring finger protein, putative [Ricinus communis]
Length=188

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 71/140 (51%), Gaps = 17/140 (12%)
 Frame = +2

Query  92   LTTVKPNSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsi--aarrrrrrldae  265
            ++T  P   P +   +GLGY IAIA   LVL ST++LASY C R         RR   + 
Sbjct  1    MSTADP---PISAAGVGLGYGIAIAVSILVLISTIMLASYACIRVKGGGGNHTRRSNASS  57

Query  266  agyrNSHPDDNGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVY--SKRSG  439
            +   +S    + +Y     F A  D      +G  + +GLD+ VI SYPK+V   S+R  
Sbjct  58   SSSSSSDGGSSNIYRLSHSFAATGDS-----TGPMIMVGLDEPVIKSYPKIVLGESQRLP  112

Query  440  NPGGTTGNDTLCSICLCEYK  499
             P     N+  CSICLC+Y+
Sbjct  113  KP-----NNGPCSICLCDYQ  127



>ref|XP_002982100.1| hypothetical protein SELMODRAFT_59303, partial [Selaginella moellendorffii]
 gb|EFJ16768.1| hypothetical protein SELMODRAFT_59303, partial [Selaginella moellendorffii]
Length=147

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 55/125 (44%), Gaps = 37/125 (30%)
 Frame = +2

Query  125  NFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGV  304
            + + +GLGY IAIA G LVL ST++LASY+C                             
Sbjct  3    SMSRVGLGYGIAIAVGILVLVSTIMLASYVC-----------------------------  33

Query  305  YLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSIC  484
                 +  +      D   G+    GLDQ  + SYP++V+S +   P      DT C+IC
Sbjct  34   -----VRQSSSSSARDRSDGEWTISGLDQVTLESYPRIVFSAQQPLPH---PQDTACAIC  85

Query  485  LCEYK  499
            L +Y+
Sbjct  86   LADYR  90



>ref|XP_008437981.1| PREDICTED: RING-H2 finger protein ATL67 [Cucumis melo]
Length=184

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 74/121 (61%), Gaps = 11/121 (9%)
 Frame = +2

Query  137  IGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGVYLPR  316
            IGLGY+IAIA  FLVL S +LLA Y+CCR+  +R  RR     +        + G+ LP+
Sbjct  13   IGLGYSIAIALAFLVLLSALLLAFYVCCRASRSRHLRRPPPPPSRS------ETGIILPQ  66

Query  317  IIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEY  496
            IIFVAEDD   D      V +GLDQ+VINSYPK  +S+         G + +CSICLCEY
Sbjct  67   IIFVAEDDAAPDRDDDNGV-VGLDQSVINSYPKFPFSRDK----SMAGANCVCSICLCEY  121

Query  497  K  499
            K
Sbjct  122  K  122



>ref|XP_004308667.1| PREDICTED: putative RING-H2 finger protein ATL69 [Fragaria vesca 
subsp. vesca]
Length=174

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 57/129 (44%), Gaps = 20/129 (16%)
 Frame = +2

Query  119  PTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDN  298
            P + T +G+GY IAIA   LVL S ++LASY C                  +   + DD 
Sbjct  7    PISATGVGVGYGIAIAVSILVLISAIMLASYAC-------------VRVKSHGGYYSDDY  53

Query  299  GVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVY--SKRSGNPGGTTGNDTL  472
                      +     N       V LGLD   I+SYPK+V   SKR   P     ND +
Sbjct  54   DEQYSNSHRRSPTTTSNYSAEPATVVLGLDGPTIDSYPKIVLGESKRLPKP-----NDGV  108

Query  473  CSICLCEYK  499
            CSICL EY+
Sbjct  109  CSICLSEYQ  117



>ref|XP_010534324.1| PREDICTED: putative RING-H2 finger protein ATL69 [Tarenaya hassleriana]
Length=178

 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 61/129 (47%), Gaps = 16/129 (12%)
 Frame = +2

Query  119  PTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDN  298
            P     +GLGY IAIA   LVL ST++LASY+C     +    R  + E    +++  D 
Sbjct  7    PVTAAGVGLGYGIAIAVSILVLISTIMLASYLC-IRAKSAGNHREGEEEDDEDSAYSSDG  65

Query  299  GVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVY--SKRSGNPGGTTGNDTL  472
            G          E          + + LGLD   I SYP++V   S+R   P     N+  
Sbjct  66   GAR--------ELHAPPGSTVEEEMKLGLDGPAIESYPRIVLGESRRLPRP-----NNGP  112

Query  473  CSICLCEYK  499
            CSICLC+Y+
Sbjct  113  CSICLCDYE  121



>ref|XP_006399182.1| hypothetical protein EUTSA_v10014903mg [Eutrema salsugineum]
 gb|ESQ40635.1| hypothetical protein EUTSA_v10014903mg [Eutrema salsugineum]
Length=157

 Score = 58.2 bits (139),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 61/134 (46%), Gaps = 43/134 (32%)
 Frame = +2

Query  119  PTN--FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPD  292
            PTN   T +GLGY IAIA   LVL ST++LASYIC                         
Sbjct  3    PTNPPATGVGLGYGIAIAVSILVLISTIMLASYICI------------------------  38

Query  293  DNGVYLPRIIFVAEDDEENDGVSGQ---NVALGLDQAVINSYPKLVY--SKRSGNPGGTT  457
                   R  +    +  ++GV G     V +GLD+ VI SYP++V   S R   P    
Sbjct  39   -------RSKYAGRYEATSEGVVGSPAAEVKIGLDRPVIESYPRIVLGDSLRLPRP----  87

Query  458  GNDTLCSICLCEYK  499
             N+  CSICL +Y+
Sbjct  88   -NNGPCSICLSDYE  100



>ref|XP_010247223.1| PREDICTED: putative RING-H2 finger protein ATL69 [Nelumbo nucifera]
Length=184

 Score = 58.2 bits (139),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 46/140 (33%), Positives = 68/140 (49%), Gaps = 21/140 (15%)
 Frame = +2

Query  92   LTTVKPNSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeag  271
            +++V P   P + + +G+GY IAIA G LVL ST++LASY+C          R       
Sbjct  1    MSSVGP---PESVSGVGVGYGIAIAVGILVLISTIMLASYVC---------VRVKAGNLS  48

Query  272  yrNSHPDDNGVYLPRIIFVAEDDEENDGVSGQNVAL--GLDQAVINSYPKLVY--SKRSG  439
                  + N          A +   +   +G +  L  GLD+ +I+SYPKL+   S+R  
Sbjct  49   GDGGSGNRNSDSSGAGGGGATNHHHHHMATGHSPVLVVGLDKPIIDSYPKLILGESRRLP  108

Query  440  NPGGTTGNDTLCSICLCEYK  499
             P     ND  C+ICL EY+
Sbjct  109  KP-----NDGSCAICLSEYR  123



>ref|XP_010036586.1| PREDICTED: RING-H2 finger protein ATL70 [Eucalyptus grandis]
 gb|KCW48196.1| hypothetical protein EUGRSUZ_K01918 [Eucalyptus grandis]
Length=183

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 58/121 (48%), Gaps = 14/121 (12%)
 Frame = +2

Query  140  GLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGVYLPRI  319
            GLGY I ++ G L+L +T+ LASY C R++          +    R   P          
Sbjct  19   GLGYGIGVSVGVLLLITTITLASYFCARNLQGASASSAFSSRRVRRLHRPPP--------  70

Query  320  IFVAEDDEENDGVSGQNVA-LGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEY  496
               A D E    V  Q +A  GLD+A I  YPKL+YS+      G+T   + CS+CL +Y
Sbjct  71   ---ATDQERVVVVVEQGLAEQGLDEATITGYPKLLYSEAKLEKKGSTA--SCCSVCLADY  125

Query  497  K  499
            K
Sbjct  126  K  126



>ref|XP_009403522.1| PREDICTED: RING-H2 finger protein ATL67-like [Musa acuminata 
subsp. malaccensis]
Length=197

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 77/134 (57%), Gaps = 18/134 (13%)
 Frame = +2

Query  107  PNSAPTN--FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrN  280
            P++ P++  FT++ L +A+A+A G LVL S  LLASY+CC        R +  + A   +
Sbjct  12   PSTTPSSSIFTSLALPFAVAVALGLLVLLSAFLLASYVCC--------RGQPQSTALDPS  63

Query  281  SHPDDNGVYLPRIIFVAEDDEENDGVSGQNV-ALGLDQAVINSYPKLVYSKRSGNPGGTT  457
            + P D  V  PRIIFV EDD+ +    G    A GLDQ  I+SYPK  +S          
Sbjct  64   AVPADGIVAPPRIIFVPEDDDGDGSEGGGGGQASGLDQTAISSYPKFPFS-------AAK  116

Query  458  GNDTLCSICLCEYK  499
            G DT+CSICLCEY+
Sbjct  117  GGDTVCSICLCEYR  130



>ref|XP_010545157.1| PREDICTED: RING-H2 finger protein ATL67 [Tarenaya hassleriana]
Length=204

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 47/70 (67%), Gaps = 6/70 (9%)
 Frame = +2

Query  290  DDNGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDT  469
            +++ +  PR+IFVAEDD+++  +  ++V    DQ+VINSYPK  +SK    P G  G  T
Sbjct  74   EESDIISPRVIFVAEDDDDDHDLE-ESVVPRFDQSVINSYPKFQFSK---EPEG--GGCT  127

Query  470  LCSICLCEYK  499
             CSICLCEYK
Sbjct  128  TCSICLCEYK  137



>ref|XP_008384425.1| PREDICTED: LOW QUALITY PROTEIN: RING-H2 finger protein ATL68-like 
[Malus domestica]
Length=156

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 39/65 (60%), Gaps = 6/65 (9%)
 Frame = +2

Query  308  LPRIIFVAE-DDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSIC  484
            LPRIIF+AE ++E        N  + L  +VINSYPK  +SK   +P  +T     CSIC
Sbjct  18   LPRIIFIAEYNNEXEXXDDDXNAVVXLRPSVINSYPKFSFSKEVSSPDSST-----CSIC  72

Query  485  LCEYK  499
            LC+YK
Sbjct  73   LCDYK  77



>ref|XP_010232275.1| PREDICTED: RING-H2 finger protein ATL67-like [Brachypodium distachyon]
Length=200

 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 65/126 (52%), Gaps = 8/126 (6%)
 Frame = +2

Query  134  TIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGVYLP  313
            T+GLGY+IAIA GFLVL +++LLASY  C               A    S      + +P
Sbjct  12   TLGLGYSIAIALGFLVLLASLLLASYF-CFRHGGAAGGGGHFTGAFTPTSGSSHLSITVP  70

Query  314  RIIFVAEDDEENDGVSGQNVA----LGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSI  481
            R++FVAE  E  D  S    A    +GLD A I SYPK  +S+           D +CSI
Sbjct  71   RVLFVAEGSESPDAYSSAAAAASSPVGLDPAAIASYPKAPFSRSRAA---AADADAMCSI  127

Query  482  CLCEYK  499
            CLCEY+
Sbjct  128  CLCEYR  133



>ref|XP_011020460.1| PREDICTED: putative RING-H2 finger protein ATL69 [Populus euphratica]
Length=180

 Score = 55.5 bits (132),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 60/124 (48%), Gaps = 25/124 (20%)
 Frame = +2

Query  140  GLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGV---YL  310
            GLGY IAIA   LVL ST++LASY C           ++      RNS   D GV   Y 
Sbjct  15   GLGYGIAIAVSILVLISTIMLASYAC----------IKVKGNGFGRNSR-SDRGVSDGYG  63

Query  311  PRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVY--SKRSGNPGGTTGNDTLCSIC  484
            P   F   D  +   V    V +GLD+ +I SYPK+V   S+R   P     N+  C IC
Sbjct  64   PHRHFTTRDSIDLMPV----VVVGLDEPIIESYPKMVLGDSRRLPKP-----NEGPCPIC  114

Query  485  LCEY  496
            L +Y
Sbjct  115  LSDY  118



>ref|XP_008810939.1| PREDICTED: RING-H2 finger protein ATL67-like [Phoenix dactylifera]
Length=222

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 71/134 (53%), Gaps = 21/134 (16%)
 Frame = +2

Query  125  NFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGV  304
            N + +GLGYAIAIA G LVL STVLLASY+CCR+ A           AG  ++     GV
Sbjct  35   NLSNLGLGYAIAIALGVLVLLSTVLLASYVCCRARARSTNPNPNGGGAGGNSN-----GV  89

Query  305  YLPRIIFVA---------EDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTT  457
             LPRIIFVA          + EE       +   GLD A I+SYP+  +S          
Sbjct  90   VLPRIIFVAEEEEEDDEDNNGEEGGRGGRGSAPTGLDPAAISSYPRFPFS-------AAK  142

Query  458  GNDTLCSICLCEYK  499
            G + +CSICL EY+
Sbjct  143  GGEAVCSICLGEYR  156



>ref|XP_006646300.1| PREDICTED: RING-H2 finger protein ATL67-like [Oryza brachyantha]
Length=226

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 64/126 (51%), Gaps = 15/126 (12%)
 Frame = +2

Query  131  TTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGVYL  310
             T+GLGY+IAIA GFLVL +++LLASY C                    +SH     + +
Sbjct  44   ATLGLGYSIAIALGFLVLLASLLLASYFC--FRRGGGGHFSGVLTPTSSSSH---LSITV  98

Query  311  PRIIFVAEDDEENDGVSGQNVA----LGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCS  478
            PR++FVAE  E  D  S    A    +GLD A I SYPK+ +     +       D +CS
Sbjct  99   PRVLFVAEGSESPDAYSSGAAAAASPVGLDAAAIASYPKVPFYSTGAD------ADAMCS  152

Query  479  ICLCEY  496
            ICL EY
Sbjct  153  ICLSEY  158



>ref|XP_006432382.1| hypothetical protein CICLE_v10003203mg [Citrus clementina]
 gb|ESR45622.1| hypothetical protein CICLE_v10003203mg [Citrus clementina]
Length=176

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 61/120 (51%), Gaps = 18/120 (15%)
 Frame = +2

Query  143  LGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGVYLPRII  322
            LGY IAIA   LVL ST++LASY  C  + A   R          NS+P  N        
Sbjct  22   LGYGIAIAVSILVLISTIMLASYA-CIRVKANANRGGGSGGGSSSNSNPTPNF-------  73

Query  323  FVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGND-TLCSICLCEYK  499
                 D  + G++G  V LGLD  VIN++PK++  +    PG    ND   CSICLC+YK
Sbjct  74   -----DAVDSGLAGVLV-LGLDGTVINTFPKIILGESMRMPG---PNDYGPCSICLCDYK  124



>ref|XP_004961430.1| PREDICTED: RING-H2 finger protein ATL67-like isoform X2 [Setaria 
italica]
Length=204

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 71/135 (53%), Gaps = 15/135 (11%)
 Frame = +2

Query  128  FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGVY  307
              ++GLGYAIAIA GFLVL ++VLLASY C R  A            G    H   +   
Sbjct  7    LASLGLGYAIAIALGFLVLLASVLLASYFCLRRGAGDGFGAGGVGGVGGSARHAASSASS  66

Query  308  -------LPRIIFVAEDDEE----NDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGT  454
                   +PR++FVAED +     + G +     +GLD AVI +YP++ +S+ +  P   
Sbjct  67   SGHISITVPRVVFVAEDYDSPGSSSRGAAAAASPVGLDPAVIATYPRVPFSRAALGPDA-  125

Query  455  TGNDTLCSICLCEYK  499
               +  CSICLCEY+
Sbjct  126  ---EVACSICLCEYR  137



>ref|XP_006494565.1| PREDICTED: putative RING-H2 finger protein ATL69-like [Citrus 
sinensis]
Length=184

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 58/120 (48%), Gaps = 21/120 (18%)
 Frame = +2

Query  143  LGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGVYLPRII  322
            LGY IAIA   LVL ST++LASY C          R     +   N  PD + V      
Sbjct  22   LGYGIAIAVSILVLISTIMLASYAC--IRVKANANRGGGGSSSNSNPTPDFDAV------  73

Query  323  FVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGND-TLCSICLCEYK  499
                    + G++G  V LGLD  VIN+YPK++  +    P     ND   CSICLC+YK
Sbjct  74   --------DSGLAGVLV-LGLDGTVINTYPKIILGESMRMP---RPNDYGPCSICLCDYK  121



>ref|XP_004961429.1| PREDICTED: RING-H2 finger protein ATL67-like isoform X1 [Setaria 
italica]
Length=206

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 71/135 (53%), Gaps = 15/135 (11%)
 Frame = +2

Query  128  FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGVY  307
              ++GLGYAIAIA GFLVL ++VLLASY C R  A            G    H   +   
Sbjct  7    LASLGLGYAIAIALGFLVLLASVLLASYFCLRRGAGDGFGAGGVGGVGGSARHAASSASS  66

Query  308  -------LPRIIFVAEDDEE----NDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGT  454
                   +PR++FVAED +     + G +     +GLD AVI +YP++ +S+ +  P   
Sbjct  67   SGHISITVPRVVFVAEDYDSPGSSSRGAAAAASPVGLDPAVIATYPRVPFSRAALGPDA-  125

Query  455  TGNDTLCSICLCEYK  499
               +  CSICLCEY+
Sbjct  126  ---EVACSICLCEYR  137



>ref|XP_002458455.1| hypothetical protein SORBIDRAFT_03g033910 [Sorghum bicolor]
 gb|EES03575.1| hypothetical protein SORBIDRAFT_03g033910 [Sorghum bicolor]
Length=197

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 61/124 (49%), Gaps = 14/124 (11%)
 Frame = +2

Query  149  YAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGVYLPRIIFV  328
            Y+IAIA GFLVL +++LLA Y C                    +S      + +PR++FV
Sbjct  14   YSIAIALGFLVLLASLLLAFYFCFGRGGGGGGDYWAGEAVTTASSS-GHLSITVPRVLFV  72

Query  329  AEDDEENDGVSGQNVA-------LGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICL  487
            AE  E  D  +  + +       +GLD A I SYPK+ +S R+         D +CSICL
Sbjct  73   AEGSESPDDAAYSSASAAAACSPVGLDAAAIASYPKVAFSSRAAE------ADAMCSICL  126

Query  488  CEYK  499
             EY+
Sbjct  127  SEYR  130



>gb|KDP40569.1| hypothetical protein JCGZ_24568 [Jatropha curcas]
Length=175

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 59/129 (46%), Gaps = 23/129 (18%)
 Frame = +2

Query  119  PTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDN  298
            P + T +GLGY IAIA   LVL ST++LASY C R   + R R          + +  + 
Sbjct  7    PVSATGVGLGYGIAIAVSILVLISTIMLASYACVRVKGSLRDRSNNGDNDDDTDPYRHN-  65

Query  299  GVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVY--SKRSGNPGGTTGNDTL  472
                 R     E            + +GLD   I SYPK+V   S+R   P     N+  
Sbjct  66   -----RQFMTGE----------PMLVIGLDGPQIESYPKMVLGESRRLPKP-----NNGP  105

Query  473  CSICLCEYK  499
            CSICL +YK
Sbjct  106  CSICLSDYK  114



>ref|XP_002440115.1| hypothetical protein SORBIDRAFT_09g026220 [Sorghum bicolor]
 gb|EES18545.1| hypothetical protein SORBIDRAFT_09g026220 [Sorghum bicolor]
Length=206

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 50/136 (37%), Positives = 69/136 (51%), Gaps = 13/136 (10%)
 Frame = +2

Query  125  NFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrs-------iaarrrrrrldaeagyrNS  283
            +  ++GLGYAIAIA GFLVL ++VLLASY C R                     A    S
Sbjct  6    SLASLGLGYAIAIALGFLVLLASVLLASYFCLRRGGAGDLFGPGVGVGVGSARHAASSAS  65

Query  284  HPDDNGVYLPRIIFVAEDDEE----NDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGG  451
                  + +PR++FVAED +     + G +     +GLD +VI SYP++ +SK       
Sbjct  66   SSGHISITVPRVVFVAEDYDSPGSSSRGAAAAASPVGLDPSVIASYPRVPFSKAGAG--A  123

Query  452  TTGNDTLCSICLCEYK  499
                +  CSICLCEY+
Sbjct  124  GADAEVACSICLCEYR  139



>ref|XP_002316476.1| hypothetical protein POPTR_0010s24960g [Populus trichocarpa]
 gb|EEF02647.1| hypothetical protein POPTR_0010s24960g [Populus trichocarpa]
Length=165

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 52/120 (43%), Gaps = 26/120 (22%)
 Frame = +2

Query  140  GLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGVYLPRI  319
            G  YAI ++ G LVL  ++ LA+Y C                           GV  P  
Sbjct  15   GYAYAIGMSSGVLVLIISITLAAYFC-------------------------TYGVDSPTH  49

Query  320  IFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYK  499
                + D   D  S   + LGLD+A + SYPKL+YSK    P G     + CSICL +YK
Sbjct  50   TGTNQGDSITDHDS-IVMELGLDEATLASYPKLLYSKARLEPRGNDLLPSCCSICLGDYK  108



>ref|XP_009395264.1| PREDICTED: putative RING-H2 finger protein ATL69 [Musa acuminata 
subsp. malaccensis]
Length=180

 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 54/129 (42%), Gaps = 23/129 (18%)
 Frame = +2

Query  116  APTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDD  295
            AP +   +GLGY IAIA G LVL ST++LASY+C                     +H   
Sbjct  13   APPSAAAVGLGYGIAIAVGILVLVSTIMLASYVC---------------VRVKGGAHRPF  57

Query  296  NGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINS-YPKLVYSKRSGNPGGTTGNDTL  472
                LP     +   +    V      LGLD   I + YPK V  +     GG +     
Sbjct  58   PAPSLPVRPAASAPGDAAAVVVVTT--LGLDGPAIEAFYPKFVCGQ-----GGASAPAGP  110

Query  473  CSICLCEYK  499
            C ICL EY+
Sbjct  111  CPICLAEYE  119



>ref|XP_009348829.1| PREDICTED: RING-H2 finger protein ATL70-like [Pyrus x bretschneideri]
Length=169

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 51/119 (43%), Gaps = 25/119 (21%)
 Frame = +2

Query  143  LGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGVYLPRII  322
             GY I ++ G L+L +T+ LASY C R+                            P   
Sbjct  19   FGYGIGVSVGVLLLITTITLASYFCARTQQPPA-----------------------PPTR  55

Query  323  FVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYK  499
              A D  +  GV    V +GLD   I SYPKL+YS+       +T   + CSICL +YK
Sbjct  56   RNAGDAMDPPGVENFVVDIGLDDNTIQSYPKLLYSEAKLQMKDSTA--SCCSICLADYK  112



>ref|XP_010491212.1| PREDICTED: putative RING-H2 finger protein ATL71 [Camelina sativa]
Length=199

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 61/123 (50%), Gaps = 8/123 (7%)
 Frame = +2

Query  140  GLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGVYLPRI  319
            GL Y I ++ G L+L +T+ LASY C RS                R +   +  +   + 
Sbjct  22   GLAYGIGVSIGILMLITTITLASYYCTRSHINASPTTTPRTRRRQRET---NETLQAGQE  78

Query  320  IFVAE-DDEENDGVSGQNVALGLDQAVINSYPKLVYSKR--SGNPGGTTGNDTLCSICLC  490
             F  E DD++ND V  +   LGL+  VI S+PKL Y +   S +    + + T CSICL 
Sbjct  79   GFNFEGDDDQNDTVVVE--VLGLNDEVIKSFPKLAYEEACVSYSLQRESSSTTCCSICLA  136

Query  491  EYK  499
            EYK
Sbjct  137  EYK  139



>ref|NP_196267.1| putative RING-H2 finger protein ATL71 [Arabidopsis thaliana]
 sp|Q9FG21.1|ATL71_ARATH RecName: Full=Putative RING-H2 finger protein ATL71 [Arabidopsis 
thaliana]
 dbj|BAB11398.1| C3HC4-type RING zinc finger protein-like [Arabidopsis thaliana]
 gb|AED91023.1| putative RING-H2 finger protein ATL71 [Arabidopsis thaliana]
Length=197

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 58/122 (48%), Gaps = 8/122 (7%)
 Frame = +2

Query  140  GLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGVYLPRI  319
            GL Y I ++ G L+L +T+ L SY C RS  +             R S    NG   P  
Sbjct  22   GLAYGIGVSIGILMLITTITLTSYYCTRSHISASPTTTPRTRRRQRES----NGTLPPGQ  77

Query  320  IFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVY--SKRSGNPGGTTGNDTLCSICLCE  493
                 +D+E+D V  +   LGL + VI  +PKL Y  ++ S +    +   + CSICL +
Sbjct  78   ERFDFEDDESDTVVVE--VLGLTEEVIKGFPKLPYEEARVSYSLQKESSTTSCCSICLAD  135

Query  494  YK  499
            YK
Sbjct  136  YK  137



>ref|XP_002873260.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49519.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=197

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 59/122 (48%), Gaps = 8/122 (7%)
 Frame = +2

Query  140  GLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGVYLPRI  319
            GL Y I ++ G L+L +T+ L SY C RS  +             R +    NG   P  
Sbjct  22   GLAYGIGVSIGILMLITTITLTSYYCTRSHISASPTTTPRTRRRRRET----NGTLQPGQ  77

Query  320  IFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVY--SKRSGNPGGTTGNDTLCSICLCE  493
                 + +END V  +   +GL++ VI S+PKL Y  ++ S +    +   + CSICL +
Sbjct  78   DQFDFEGDENDTVVVE--VMGLNEEVIKSFPKLPYEEARVSYSLQKESSTTSCCSICLAD  135

Query  494  YK  499
            YK
Sbjct  136  YK  137



>ref|XP_003522850.1| PREDICTED: putative RING-H2 finger protein ATL69-like [Glycine 
max]
Length=188

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 48/138 (35%), Positives = 59/138 (43%), Gaps = 18/138 (13%)
 Frame = +2

Query  95   TTVKPNSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagy  274
            T   P SAPT     GLGY IAIA   LVL ST++LASY C                   
Sbjct  3    TAALPPSAPTATAGGGLGYGIAIAVSILVLISTIMLASYAC--VRIKANGSIITRRHNHN  60

Query  275  rNSHPDDNGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSY--PKLVY--SKRSGN  442
             N+H  +N            D  +  GV    V LGL++  I +   PK+V   SKR   
Sbjct  61   INTHQRNNNNNNSSF----RDASDGPGV----VVLGLEKPAIEACYGPKIVIGESKRLPR  112

Query  443  PGGTTGNDTLCSICLCEY  496
            P     +   C+ICL EY
Sbjct  113  P----NDQGPCAICLSEY  126



>ref|XP_011034693.1| PREDICTED: putative RING-H2 finger protein ATL69 [Populus euphratica]
Length=186

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 59/124 (48%), Gaps = 19/124 (15%)
 Frame = +2

Query  140  GLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGVYLPRI  319
            GLGY IAIA G LVL ST++L SY C R           + +    NS+  ++G      
Sbjct  17   GLGYGIAIAIGILVLISTIMLTSYACSRIKGNGNSNGSNNNDNSNDNSNNYEHG------  70

Query  320  IFVAEDDEENDG--VSGQNVALGLDQAVINSYPKLVY--SKRSGNPGGTTGNDTLCSICL  487
                 D     G  +    V +GL + +I+SY K+V   S+R   P     N+  CSICL
Sbjct  71   ----HDRHFTAGNPIEPMTVMVGLAEPIIDSYTKMVLGESRRLPKP-----NEGPCSICL  121

Query  488  CEYK  499
             +Y+
Sbjct  122  SDYQ  125



>ref|XP_009397427.1| PREDICTED: RING-H2 finger protein ATL70-like [Musa acuminata 
subsp. malaccensis]
Length=190

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 49/120 (41%), Gaps = 16/120 (13%)
 Frame = +2

Query  140  GLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGVYLPRI  319
            G GY + ++ G L+L +T+ LASY C                     S          R 
Sbjct  28   GFGYGLGVSIGMLLLITTITLASYFC---------------TRATTASPTAGPPPPPHRA  72

Query  320  IFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYK  499
                  ++E    +G +V  G+D+  + SYPK+ YS          G  + CSICL +YK
Sbjct  73   AARRPAEQETTAAAGGDVEAGIDEDTLKSYPKVRYSHAKLR-RDVAGAASCCSICLSDYK  131



>gb|EAY98765.1| hypothetical protein OsI_20699 [Oryza sativa Indica Group]
Length=206

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 73/137 (53%), Gaps = 16/137 (12%)
 Frame = +2

Query  125  NFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNS-----HP  289
            +F+++G+GYA+AIA GFLVL +++LLA Y C R   A   RR        R++       
Sbjct  7    SFSSLGVGYAVAIALGFLVLLASLLLAFYFCSRRGGAGVVRRGGQGVHSARHAVSSASSS  66

Query  290  DDNGVYLPRIIFVAEDDEENDGVSGQNVA-------LGLDQAVINSYPKLVYSKRSGNPG  448
                + +PR+IFVA+D +     S            +GLD AVI SYPK+ +S+ +    
Sbjct  67   GHISITVPRVIFVADDSDSPGSSSRGGAGGGAASSPVGLDPAVIASYPKVPFSRAA----  122

Query  449  GTTGNDTLCSICLCEYK  499
                 +  CSICLCEYK
Sbjct  123  AGADAEAACSICLCEYK  139



>ref|XP_008780209.1| PREDICTED: RING-H2 finger protein ATL68-like, partial [Phoenix 
dactylifera]
Length=125

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 61/111 (55%), Gaps = 12/111 (11%)
 Frame = +2

Query  125  NFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGV  304
            N +++GLGYAI +    LVL STVLLASY+CCR+              G      + NGV
Sbjct  1    NLSSLGLGYAITLGV--LVLLSTVLLASYVCCRARPRSANPNPNGGNTGAGE---NSNGV  55

Query  305  YLPRIIFVA--EDDEENDGVSGQ-----NVALGLDQAVINSYPKLVYSKRS  436
             LP IIFVA  ED+E+N+G  G      +  +GLD   I+SY +  +S  S
Sbjct  56   VLPCIIFVAEEEDNEDNNGKEGSRGGRGSAPIGLDPVAISSYSRFPFSAAS  106



>ref|XP_010557977.1| PREDICTED: putative RING-H2 finger protein ATL71 [Tarenaya hassleriana]
Length=190

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 53/121 (44%), Gaps = 6/121 (5%)
 Frame = +2

Query  140  GLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGVYLPRI  319
            G  Y I ++ G L+L +T+ LASY C R+  +        +    + +     GV    I
Sbjct  20   GFAYGIGVSIGILLLITTISLASYYCTRNHLSASPMTTPRSRRRRQTNQMSPRGV----I  75

Query  320  IFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTL--CSICLCE  493
            I V +  ++        V  GLD+  I S P++ Y +   + G      T   CSICL +
Sbjct  76   IAVEQPSDDQQPPDVLTVVSGLDEETIKSLPRIPYEEARESYGRKREASTTSCCSICLAD  135

Query  494  Y  496
            Y
Sbjct  136  Y  136



>gb|KJB46372.1| hypothetical protein B456_007G363500 [Gossypium raimondii]
Length=170

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 52/119 (44%), Gaps = 28/119 (24%)
 Frame = +2

Query  143  LGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGVYLPRII  322
             GYAI ++   L++     LASY+C                     + P ++ +  P   
Sbjct  20   FGYAIGVSAIILLIIVVTALASYVC-------------SKAFQSPQAPPSNSDMIDPESF  66

Query  323  FVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYK  499
            FV      +DG        GLD+  I SYPKL YS+      G+T  DT CSICL +YK
Sbjct  67   FV------DDGG-------GLDEETIKSYPKLTYSEAKLLKKGST--DTCCSICLNDYK  110



>ref|XP_004969874.1| PREDICTED: RING-H2 finger protein ATL67-like [Setaria italica]
Length=193

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 65/123 (53%), Gaps = 16/123 (13%)
 Frame = +2

Query  149  YAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGVYLPRIIFV  328
            Y+IAIA GFLVL +++LLASY+C      R        EA    S      + +PR++FV
Sbjct  15   YSIAIALGFLVLLASLLLASYLC----FRRGGGDYWAGEAFTTASSSGHLSITVPRVLFV  70

Query  329  AEDDEENDGVSGQNVA------LGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLC  490
            AE  E  D  +  + A      +GLD A I SYPK+ +S R+         D +CSICL 
Sbjct  71   AEGSESPDDAAYSSAAAASCCPVGLDPAAIASYPKVPFSSRAAE------ADAMCSICLS  124

Query  491  EYK  499
            EY+
Sbjct  125  EYR  127



>ref|NP_001056103.1| Os05g0526600 [Oryza sativa Japonica Group]
 gb|AAU44063.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAF18017.1| Os05g0526600 [Oryza sativa Japonica Group]
Length=207

 Score = 47.8 bits (112),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 74/143 (52%), Gaps = 27/143 (19%)
 Frame = +2

Query  125  NFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyrNSHPDDNGV  304
            +F+++G+GYA+AIA GFLVL +++LLA Y C     +RR    +    G +  H   + V
Sbjct  7    SFSSLGVGYAVAIALGFLVLLASLLLAFYFC-----SRRGGAGVVRRGGGQGVHSARHAV  61

Query  305  Y-----------LPRIIFVAEDDEENDGVSGQNVA-------LGLDQAVINSYPKLVYSK  430
                        +PR+IFVA+D +     S            +GLD AVI SYPK+ +S+
Sbjct  62   SSASSSGHISITVPRVIFVADDSDSPGSSSRGGAGGGAASSPVGLDPAVIASYPKVPFSR  121

Query  431  RSGNPGGTTGNDTLCSICLCEYK  499
             +         +  CSICLCEYK
Sbjct  122  AA----TGADAEAACSICLCEYK  140



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 567283606695