BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001F11

Length=463
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KCW59529.1|  hypothetical protein EUGRSUZ_H02281                     152   1e-43   Eucalyptus grandis [rose gum]
ref|XP_004152272.1|  PREDICTED: uncharacterized protein At2g23090...    150   2e-43   Cucumis sativus [cucumbers]
ref|XP_008657318.1|  PREDICTED: uncharacterized protein At2g23090...    147   1e-42   
ref|XP_009419063.1|  PREDICTED: uncharacterized protein At2g23090...    147   2e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010070636.1|  PREDICTED: uncharacterized protein At2g23090...    147   2e-42   Eucalyptus grandis [rose gum]
ref|XP_009407418.1|  PREDICTED: uncharacterized protein At2g23090...    147   3e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006650234.1|  PREDICTED: uncharacterized protein At2g23090...    147   3e-42   Oryza brachyantha
ref|XP_002467663.1|  hypothetical protein SORBIDRAFT_01g031840          146   4e-42   Sorghum bicolor [broomcorn]
ref|XP_009416809.1|  PREDICTED: uncharacterized protein At2g23090...    146   5e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004983946.1|  PREDICTED: uncharacterized protein At2g23090...    146   5e-42   Setaria italica
ref|XP_006339821.1|  PREDICTED: uncharacterized protein At2g23090...    146   5e-42   Solanum tuberosum [potatoes]
ref|XP_004233452.1|  PREDICTED: uncharacterized protein At2g23090...    145   9e-42   Solanum lycopersicum
gb|ACF74320.1|  unknown                                                 145   1e-41   Arachis hypogaea [goober]
ref|XP_011074376.1|  PREDICTED: uncharacterized protein At2g23090       145   1e-41   Sesamum indicum [beniseed]
ref|XP_011099329.1|  PREDICTED: uncharacterized protein At2g23090...    144   2e-41   Sesamum indicum [beniseed]
gb|AFK38003.1|  unknown                                                 144   2e-41   Lotus japonicus
ref|NP_001058751.1|  Os07g0114300                                       144   2e-41   
emb|CDP02577.1|  unnamed protein product                                144   3e-41   Coffea canephora [robusta coffee]
ref|XP_010523219.1|  PREDICTED: uncharacterized protein At2g23090...    144   3e-41   Tarenaya hassleriana [spider flower]
ref|XP_010679589.1|  PREDICTED: uncharacterized protein At2g23090...    144   4e-41   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010679588.1|  PREDICTED: uncharacterized protein At2g23090       143   6e-41   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010059852.1|  PREDICTED: uncharacterized protein At2g23090...    143   8e-41   Eucalyptus grandis [rose gum]
ref|XP_009780160.1|  PREDICTED: uncharacterized protein At2g23090...    143   8e-41   Nicotiana sylvestris
ref|XP_006657405.1|  PREDICTED: uncharacterized protein At2g23090...    143   8e-41   Oryza brachyantha
ref|XP_007143099.1|  hypothetical protein PHAVU_007G043400g             142   1e-40   Phaseolus vulgaris [French bean]
gb|KDP41641.1|  hypothetical protein JCGZ_16048                         142   1e-40   Jatropha curcas
gb|EAZ02551.1|  hypothetical protein OsI_24662                          142   1e-40   Oryza sativa Indica Group [Indian rice]
gb|KHG01657.1|  hypothetical protein F383_23639                         142   1e-40   Gossypium arboreum [tree cotton]
ref|XP_003517333.1|  PREDICTED: uncharacterized protein At2g23090       142   1e-40   Glycine max [soybeans]
ref|XP_009590579.1|  PREDICTED: uncharacterized protein At2g23090...    142   2e-40   Nicotiana tomentosiformis
ref|XP_008780912.1|  PREDICTED: uncharacterized protein At2g23090...    142   2e-40   Phoenix dactylifera
ref|XP_007201472.1|  hypothetical protein PRUPE_ppa014259mg             142   2e-40   Prunus persica
ref|XP_006362064.1|  PREDICTED: uncharacterized protein At2g23090...    142   2e-40   Solanum tuberosum [potatoes]
ref|XP_006841988.1|  hypothetical protein AMTR_s00144p00063280          142   2e-40   Amborella trichopoda
ref|XP_010906272.1|  PREDICTED: uncharacterized protein At2g23090...    142   2e-40   Elaeis guineensis
ref|XP_004238102.1|  PREDICTED: uncharacterized protein At2g23090       141   3e-40   Solanum lycopersicum
ref|XP_003539296.1|  PREDICTED: uncharacterized protein At2g23090       141   3e-40   Glycine max [soybeans]
ref|XP_007156735.1|  hypothetical protein PHAVU_002G012800g             141   4e-40   Phaseolus vulgaris [French bean]
ref|XP_009628091.1|  PREDICTED: uncharacterized protein At2g23090...    141   4e-40   Nicotiana tomentosiformis
ref|XP_006486945.1|  PREDICTED: uncharacterized protein At2g23090...    140   5e-40   
gb|KJB58614.1|  hypothetical protein B456_009G218200                    140   5e-40   Gossypium raimondii
ref|XP_008236427.1|  PREDICTED: uncharacterized protein At2g23090...    140   5e-40   Prunus mume [ume]
ref|XP_007155853.1|  hypothetical protein PHAVU_003G237200g             140   5e-40   Phaseolus vulgaris [French bean]
ref|XP_010905274.1|  PREDICTED: uncharacterized protein At2g23090...    140   6e-40   Elaeis guineensis
ref|XP_003555981.1|  PREDICTED: uncharacterized protein At2g23090       140   6e-40   
gb|KHG16029.1|  hypothetical protein F383_22011                         140   7e-40   Gossypium arboreum [tree cotton]
ref|XP_002320700.1|  hypothetical protein POPTR_0014s01840g             140   8e-40   Populus trichocarpa [western balsam poplar]
ref|XP_004141283.1|  PREDICTED: uncharacterized protein At2g23090...    140   9e-40   Cucumis sativus [cucumbers]
ref|XP_010105485.1|  hypothetical protein L484_010269                   140   1e-39   Morus notabilis
ref|XP_008452628.1|  PREDICTED: uncharacterized protein At2g23090...    140   1e-39   Cucumis melo [Oriental melon]
ref|XP_010674198.1|  PREDICTED: uncharacterized protein At2g23090...    140   1e-39   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB79433.1|  hypothetical protein B456_013G049400                    140   1e-39   Gossypium raimondii
gb|KJB32277.1|  hypothetical protein B456_005G232900                    140   1e-39   Gossypium raimondii
ref|XP_011028890.1|  PREDICTED: uncharacterized protein At2g23090...    140   1e-39   Populus euphratica
emb|CAN62217.1|  hypothetical protein VITISV_021844                     139   1e-39   Vitis vinifera
gb|ACU13253.1|  unknown                                                 139   2e-39   Glycine max [soybeans]
emb|CDP01219.1|  unnamed protein product                                139   2e-39   Coffea canephora [robusta coffee]
gb|AFY12046.1|  drought responsive protein 2                            139   2e-39   Saccharum hybrid cultivar SP80-3280
ref|XP_002284176.1|  PREDICTED: uncharacterized protein At2g23090       139   2e-39   Vitis vinifera
ref|XP_010099082.1|  hypothetical protein L484_011517                   139   3e-39   Morus notabilis
ref|XP_011069786.1|  PREDICTED: uncharacterized protein At2g23090...    139   3e-39   Sesamum indicum [beniseed]
gb|ACU16633.1|  unknown                                                 139   3e-39   Glycine max [soybeans]
ref|XP_010087302.1|  hypothetical protein L484_009435                   139   3e-39   Morus notabilis
ref|XP_002302417.1|  hypothetical protein POPTR_0002s12100g             139   4e-39   Populus trichocarpa [western balsam poplar]
ref|XP_006426050.1|  hypothetical protein CICLE_v10026876mg             139   4e-39   Citrus clementina [clementine]
ref|XP_004141881.1|  PREDICTED: uncharacterized protein At2g23090...    138   5e-39   
ref|XP_008792663.1|  PREDICTED: uncharacterized protein At2g23090...    138   6e-39   
gb|KJB48665.1|  hypothetical protein B456_008G080400                    138   6e-39   Gossypium raimondii
ref|XP_003524686.1|  PREDICTED: uncharacterized protein At2g23090       138   7e-39   Glycine max [soybeans]
ref|XP_010939767.1|  PREDICTED: uncharacterized protein At2g23090...    138   7e-39   Elaeis guineensis
ref|XP_002459234.1|  hypothetical protein SORBIDRAFT_02g001100          138   7e-39   Sorghum bicolor [broomcorn]
ref|XP_009603270.1|  PREDICTED: uncharacterized protein At2g23090...    138   7e-39   Nicotiana tomentosiformis
ref|XP_002533162.1|  conserved hypothetical protein                     138   8e-39   Ricinus communis
ref|XP_004290956.1|  PREDICTED: uncharacterized protein At2g23090...    137   9e-39   Fragaria vesca subsp. vesca
gb|ABK21925.1|  unknown                                                 137   1e-38   Picea sitchensis
ref|XP_008440357.1|  PREDICTED: uncharacterized protein At2g23090       137   1e-38   Cucumis melo [Oriental melon]
dbj|BAH97744.1|  hypothetical protein                                   137   1e-38   Hypochaeris radicata [flatweed]
gb|KHG08477.1|  hypothetical protein F383_15108                         137   1e-38   Gossypium arboreum [tree cotton]
ref|XP_010277101.1|  PREDICTED: uncharacterized protein At2g23090...    137   1e-38   Nelumbo nucifera [Indian lotus]
gb|ACG30543.1|  hypothetical protein                                    137   1e-38   Zea mays [maize]
ref|XP_002298765.1|  hypothetical protein POPTR_0001s30380g             137   1e-38   Populus trichocarpa [western balsam poplar]
ref|XP_008220309.1|  PREDICTED: uncharacterized protein At2g23090...    137   2e-38   Prunus mume [ume]
gb|KHN42328.1|  Hypothetical protein glysoja_020040                     137   2e-38   Glycine soja [wild soybean]
gb|KJB18003.1|  hypothetical protein B456_003G028800                    137   2e-38   Gossypium raimondii
ref|XP_008393751.1|  PREDICTED: uncharacterized protein At2g23090...    137   2e-38   Malus domestica [apple tree]
dbj|BAJ93722.1|  predicted protein                                      137   2e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EYU44471.1|  hypothetical protein MIMGU_mgv1a017387mg                137   2e-38   Erythranthe guttata [common monkey flower]
ref|XP_003550020.1|  PREDICTED: uncharacterized protein At2g23090       137   2e-38   Glycine max [soybeans]
ref|XP_004141882.1|  PREDICTED: uncharacterized protein At2g23090...    136   2e-38   
ref|XP_010272075.1|  PREDICTED: uncharacterized protein At2g23090...    136   3e-38   Nelumbo nucifera [Indian lotus]
ref|XP_004509083.1|  PREDICTED: uncharacterized protein At2g23090...    136   3e-38   Cicer arietinum [garbanzo]
ref|XP_007042599.1|  Leucine-rich repeat family protein                 143   4e-38   
ref|XP_002510116.1|  conserved hypothetical protein                     136   4e-38   Ricinus communis
gb|KDP32048.1|  hypothetical protein JCGZ_12509                         136   4e-38   Jatropha curcas
ref|XP_006433614.1|  hypothetical protein CICLE_v10003025mg             135   6e-38   Citrus clementina [clementine]
ref|XP_003557668.1|  PREDICTED: uncharacterized protein At2g23090       135   6e-38   Brachypodium distachyon [annual false brome]
gb|ABK20935.1|  unknown                                                 135   7e-38   Picea sitchensis
ref|XP_008651947.1|  PREDICTED: uncharacterized protein At2g23090       135   8e-38   
gb|AFK39948.1|  unknown                                                 135   1e-37   Lotus japonicus
ref|XP_007047475.1|  Uncharacterized protein TCM_000756                 135   1e-37   
ref|XP_002984923.1|  hypothetical protein SELMODRAFT_181308             135   1e-37   Selaginella moellendorffii
ref|XP_009342787.1|  PREDICTED: uncharacterized protein At2g23090...    136   1e-37   Pyrus x bretschneideri [bai li]
ref|XP_007207398.1|  hypothetical protein PRUPE_ppa014253mg             134   1e-37   Prunus persica
ref|XP_010531293.1|  PREDICTED: uncharacterized protein At2g23090       134   1e-37   Tarenaya hassleriana [spider flower]
ref|XP_011030366.1|  PREDICTED: somatic embryogenesis receptor ki...    141   2e-37   Populus euphratica
ref|XP_007226104.1|  hypothetical protein PRUPE_ppa014256mg             134   2e-37   Prunus persica
ref|XP_009623383.1|  PREDICTED: uncharacterized protein At2g23090...    134   2e-37   Nicotiana tomentosiformis
ref|XP_004955338.1|  PREDICTED: uncharacterized protein At2g23090...    134   3e-37   Setaria italica
ref|XP_010472307.1|  PREDICTED: uncharacterized protein At2g23090       134   3e-37   Camelina sativa [gold-of-pleasure]
ref|XP_006404774.1|  hypothetical protein EUTSA_v10000409mg             134   3e-37   Eutrema salsugineum [saltwater cress]
ref|XP_003608464.1|  hypothetical protein MTR_4g095390                  134   3e-37   Medicago truncatula
ref|XP_008340878.1|  PREDICTED: uncharacterized protein At2g23090...    134   4e-37   Malus domestica [apple tree]
ref|XP_004234685.1|  PREDICTED: uncharacterized protein At2g23090...    133   6e-37   Solanum lycopersicum
ref|XP_004955339.1|  PREDICTED: uncharacterized protein At2g23090...    132   9e-37   
ref|XP_002880480.1|  hypothetical protein ARALYDRAFT_481181             132   9e-37   
ref|XP_010417064.1|  PREDICTED: uncharacterized protein At2g23090...    134   9e-37   Camelina sativa [gold-of-pleasure]
ref|XP_004288466.1|  PREDICTED: uncharacterized protein At2g23090       134   1e-36   Fragaria vesca subsp. vesca
ref|XP_009133992.1|  PREDICTED: uncharacterized protein At2g23090...    132   1e-36   Brassica rapa
ref|NP_565547.1|  uncharacterized protein                               132   1e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010429253.1|  PREDICTED: uncharacterized protein At2g23090       132   2e-36   Camelina sativa [gold-of-pleasure]
gb|KFK32764.1|  hypothetical protein AALP_AA6G285700                    131   4e-36   Arabis alpina [alpine rockcress]
ref|XP_001762059.1|  predicted protein                                  130   5e-36   
gb|EYU25501.1|  hypothetical protein MIMGU_mgv1a017360mg                130   6e-36   Erythranthe guttata [common monkey flower]
pdb|1WVK|A  Chain A, Nmr Solution Structure Of The Partially Diso...    130   1e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010548449.1|  PREDICTED: uncharacterized protein At2g23090...    129   1e-35   Tarenaya hassleriana [spider flower]
ref|XP_009354112.1|  PREDICTED: uncharacterized protein At2g23090...    128   5e-35   Pyrus x bretschneideri [bai li]
gb|KJB63926.1|  hypothetical protein B456_010G024800                    127   9e-35   Gossypium raimondii
gb|KHG21316.1|  hypothetical protein F383_02340                         122   2e-32   Gossypium arboreum [tree cotton]
ref|XP_002313166.1|  hypothetical protein POPTR_0009s09400g             120   3e-32   
dbj|BAJ98198.1|  predicted protein                                      120   3e-32   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDO57851.1|  hypothetical protein CISIN_1g046078mg                   106   1e-26   Citrus sinensis [apfelsine]
ref|XP_002508158.1|  predicted protein                                  100   5e-24   Micromonas commoda
tpg|DAA59402.1|  TPA: hypothetical protein ZEAMMB73_829423            97.1    1e-21   
ref|XP_003061975.1|  predicted protein                                91.7    8e-21   Micromonas pusilla CCMP1545
ref|XP_001689924.1|  predicted protein                                90.1    3e-20   Chlamydomonas reinhardtii
gb|KDD74926.1|  hypothetical protein H632_c983p0                      86.3    1e-18   Helicosporidium sp. ATCC 50920
gb|ABR25435.1|  unknown                                               80.5    6e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_008779058.1|  PREDICTED: uncharacterized protein At2g23090     80.1    9e-17   
ref|XP_001418532.1|  predicted protein                                79.3    4e-16   Ostreococcus lucimarinus CCE9901
ref|XP_005846361.1|  hypothetical protein CHLNCDRAFT_135809           78.6    7e-16   Chlorella variabilis
ref|XP_004338589.1|  small conserved protein                          78.6    7e-16   Acanthamoeba castellanii str. Neff
gb|ERS99711.1|  hypothetical protein HMPREF1624_03075                 77.0    3e-15   Sporothrix schenckii ATCC 58251
emb|CEF98457.1|  Zinc finger protein 706                              75.5    1e-14   Ostreococcus tauri
ref|XP_003321593.2|  hypothetical protein PGTG_03130                  74.3    3e-14   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gb|EPB91030.1|  hypothetical protein HMPREF1544_02099                 73.2    6e-14   Mucor circinelloides f. circinelloides 1006PhL
dbj|GAN03917.1|  conserved hypothetical protein                       73.2    7e-14   Mucor ambiguus
ref|XP_007409997.1|  hypothetical protein MELLADRAFT_56097            72.8    9e-14   Melampsora larici-populina 98AG31
gb|KFH45514.1|  hypothetical protein ACRE_037100                      72.4    1e-13   Acremonium chrysogenum ATCC 11550
ref|XP_008657313.1|  PREDICTED: uncharacterized protein At2g23090...  71.6    3e-13   
ref|XP_005835675.1|  hypothetical protein GUITHDRAFT_151660           72.8    4e-13   Guillardia theta CCMP2712
gb|ACG25824.1|  hypothetical protein                                  70.5    4e-13   Zea mays [maize]
gb|EGU13616.1|  hypothetical protein RTG_00053                        72.4    5e-13   Rhodotorula toruloides ATCC 204091
gb|AAR89012.1|  expressed protein, having alternate splicing prod...  70.1    6e-13   Oryza sativa Japonica Group [Japonica rice]
gb|KHN96784.1|  putative protein family SERF                          70.5    7e-13   Metarhizium album ARSEF 1941
ref|NP_001050455.1|  Os03g0439800                                     70.5    9e-13   
gb|AAO23088.1|  unknown protein                                       69.3    1e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_643685.1|  hypothetical protein DDB_G0275367                   70.1    1e-12   Dictyostelium discoideum AX4
gb|KFG77965.1|  hypothetical protein MANI_004634                      69.3    2e-12   Metarhizium anisopliae
gb|EMS19420.1|  SERF family protein                                   69.3    2e-12   Rhodotorula toruloides NP11
gb|EPS28578.1|  hypothetical protein PDE_03524                        68.9    3e-12   Penicillium oxalicum 114-2
ref|XP_004355913.1|  hypothetical protein DFA_08424                   68.6    4e-12   Cavenderia fasciculata
ref|XP_568935.1|  hypothetical protein CNB04380                       68.2    5e-12   Cryptococcus neoformans var. neoformans JEC21
dbj|GAM28548.1|  hypothetical protein SAMD00019534_117240             68.2    5e-12   Acytostelium subglobosum LB1
emb|CDM27839.1|  Uncharacterised protein family SERF                  67.8    7e-12   Penicillium roqueforti FM164
gb|AFR93451.2|  hypothetical protein CNAG_03951                       67.8    7e-12   Cryptococcus neoformans var. grubii H99
gb|KGO68528.1|  hypothetical protein PITC_071530                      67.4    9e-12   Penicillium italicum
ref|XP_003191195.1|  hypothetical protein CGB_A1600W                  67.4    1e-11   Cryptococcus gattii WM276
gb|KIR46616.1|  hypothetical protein I312_04103                       67.4    1e-11   Cryptococcus gattii CA1280
gb|KGB79679.1|  hypothetical protein CNBG_5517                        67.4    1e-11   Cryptococcus gattii VGII R265
emb|CCE35128.1|  uncharacterized protein CPUR_02058                   67.4    1e-11   Claviceps purpurea 20.1
ref|XP_002565772.1|  Pc22g18670                                       67.0    1e-11   Penicillium rubens Wisconsin 54-1255
ref|XP_007513028.1|  predicted protein                                67.0    1e-11   Bathycoccus prasinos
emb|CBJ31557.1|  conserved unknown protein                            67.0    2e-11   Ectocarpus siliculosus
emb|CEI98098.1|  Putative DUF1909-domain-containing protein           66.6    2e-11   Rhizopus microsporus
gb|EKV19680.1|  hypothetical protein PDIG_01270                       66.6    2e-11   Penicillium digitatum PHI26
ref|XP_003714121.1|  hypothetical protein MGG_01222                   66.2    2e-11   Magnaporthe oryzae 70-15
emb|CEG72122.1|  Putative DUF1909-domain-containing protein           66.2    3e-11   Rhizopus microsporus
gb|EJT50685.1|  hypothetical protein A1Q1_08237                       65.9    3e-11   Trichosporon asahii var. asahii CBS 2479
gb|EPS99141.1|  hypothetical protein FOMPIDRAFT_84763                 65.9    3e-11   Fomitopsis pinicola FP-58527 SS1
gb|KDB18063.1|  DUF1909-domain-containing protein                     65.9    4e-11   Ustilaginoidea virens
gb|EFA77673.1|  transmembrane protein                                 70.9    4e-11   Heterostelium album PN500
gb|KGO40152.1|  Uncharacterized protein family SERF                   65.5    4e-11   Penicillium expansum
emb|CEG83423.1|  Putative DUF1909-domain-containing protein           65.9    5e-11   Rhizopus microsporus
gb|ELQ37422.1|  hypothetical protein OOU_Y34scaffold00594g6           66.6    5e-11   Magnaporthe oryzae Y34
ref|XP_003288883.1|  hypothetical protein DICPUDRAFT_92186            65.1    7e-11   Dictyostelium purpureum
ref|XP_002527488.1|  hypothetical protein RCOM_0174730                66.2    7e-11   
gb|ABR25440.1|  conserved hypothetical protein                        64.3    7e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_009226219.1|  hypothetical protein GGTG_10092                  64.7    8e-11   Gaeumannomyces tritici R3-111a-1
ref|XP_007360055.1|  hypothetical protein DICSQDRAFT_164341           64.3    1e-10   Dichomitus squalens LYAD-421 SS1
gb|EMD41713.1|  hypothetical protein CERSUDRAFT_128755                64.3    1e-10   Gelatoporia subvermispora B
ref|XP_003346224.1|  hypothetical protein SMAC_05761                  63.9    2e-10   Sordaria macrospora k-hell
emb|CCA24130.1|  conserved hypothetical protein                       64.3    2e-10   Albugo laibachii Nc14
gb|EHK40374.1|  hypothetical protein TRIATDRAFT_260071                63.5    2e-10   Trichoderma atroviride IMI 206040
gb|EWG36770.1|  hypothetical protein FVEG_00661                       63.5    2e-10   Fusarium verticillioides 7600
ref|XP_003656580.1|  hypothetical protein THITE_2121407               63.5    2e-10   Thielavia terrestris NRRL 8126
gb|EGU79639.1|  hypothetical protein FOXB_09922                       63.5    3e-10   Fusarium oxysporum Fo5176
emb|CDH50296.1|  conserved hypothetical protein                       63.5    3e-10   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_965005.1|  hypothetical protein NCU02602                       63.5    3e-10   Neurospora crassa OR74A
dbj|GAA99781.1|  hypothetical protein E5Q_06484                       63.2    3e-10   Mixia osmundae IAM 14324
ref|XP_007832966.1|  hypothetical protein PFICI_06194                 63.2    3e-10   Pestalotiopsis fici W106-1
ref|XP_006680569.1|  hypothetical protein BATDEDRAFT_90170            63.2    4e-10   Batrachochytrium dendrobatidis JAM81
ref|XP_008780578.1|  PREDICTED: uncharacterized protein At2g23090...  62.4    4e-10   
ref|XP_002320702.1|  hypothetical protein POPTR_0014s01870g           62.4    4e-10   
gb|KHG23789.1|  Prolyl 4-hydroxylase subunit alpha-1                  66.6    4e-10   Gossypium arboreum [tree cotton]
emb|CDO72440.1|  hypothetical protein BN946_scf184977.g141            62.4    6e-10   Trametes cinnabarina
gb|KFH66696.1|  hypothetical protein MVEG_07221                       62.4    7e-10   Mortierella verticillata NRRL 6337
gb|ABK26523.1|  unknown                                               62.0    7e-10   Picea sitchensis
emb|CCA77885.1|  hypothetical protein PIIN_00530                      62.0    8e-10   Serendipita indica DSM 11827
ref|XP_008033154.1|  DUF1909-domain-containing protein                62.0    8e-10   Trametes versicolor FP-101664 SS1
gb|EHK25265.1|  hypothetical protein TRIVIDRAFT_215398                62.0    1e-09   Trichoderma virens Gv29-8
ref|XP_003658614.1|  hypothetical protein MYCTH_2294582               61.6    2e-09   Thermothelomyces thermophila ATCC 42464
ref|XP_006966546.1|  predicted protein                                61.2    2e-09   Trichoderma reesei QM6a
emb|CDP22572.1|  Putative protein of unknown function                 61.2    2e-09   Podospora anserina S mat+
emb|CCI48451.1|  unnamed protein product                              60.8    3e-09   Albugo candida
ref|XP_001349951.1|  conserved protein, unknown function              60.5    4e-09   Plasmodium falciparum 3D7
emb|CDS13635.1|  hypothetical protein LRAMOSA05811                    60.5    4e-09   Lichtheimia ramosa
ref|XP_001273653.1|  conserved hypothetical protein                   60.1    4e-09   Aspergillus clavatus NRRL 1
ref|XP_009263068.1|  hypothetical protein FPSE_11676                  60.1    4e-09   Fusarium pseudograminearum CS3096
emb|CDJ64233.1|  Small conserved protein, related                     60.1    5e-09   Eimeria necatrix
gb|KIW67281.1|  hypothetical protein PV04_06546                       59.7    6e-09   Phialophora americana
ref|XP_002364670.1|  hypothetical protein, conserved                  59.7    6e-09   
ref|XP_011134451.1|  zinc-binding protein                             63.5    6e-09   Gregarina niphandrodes
ref|XP_007299063.1|  DUF1909-domain-containing protein                59.7    7e-09   Stereum hirsutum FP-91666 SS1
gb|ENH77376.1|  transmembrane protein                                 59.7    7e-09   
gb|KIW04468.1|  hypothetical protein PV09_04728                       59.3    7e-09   Verruconis gallopava
gb|AFK34204.1|  unknown                                               51.6    7e-09   Medicago truncatula
gb|KDN64182.1|  hypothetical protein CSUB01_03335                     59.3    7e-09   Colletotrichum sublineola
ref|XP_007599963.1|  hypothetical protein CFIO01_07639                59.3    7e-09   
emb|CCF45008.1|  hypothetical protein CH063_03482                     59.3    8e-09   Colletotrichum higginsianum
ref|XP_008883461.1|  hypothetical protein HHA_314800                  59.3    8e-09   
gb|KDN44927.1|  DUF1909-domain-containing protein                     59.3    8e-09   Tilletiaria anomala UBC 951
ref|XP_003885374.1|  conserved hypothetical protein                   58.9    1e-08   Neospora caninum Liverpool
emb|CDJ37011.1|  Small conserved protein, related                     58.5    1e-08   Eimeria tenella
gb|EFQ25551.1|  hypothetical protein GLRG_00695                       58.5    2e-08   Colletotrichum graminicola M1.001
gb|KFY53500.1|  hypothetical protein V496_07534                       58.5    2e-08   Pseudogymnoascus sp. VKM F-4515 (FW-2607)
gb|KIL94747.1|  hypothetical protein FAVG1_01678                      58.2    2e-08   Fusarium avenaceum
ref|XP_009155990.1|  hypothetical protein HMPREF1120_03662            58.2    2e-08   Exophiala dermatitidis NIH/UT8656
emb|CEG83425.1|  Putative Transmembrane protein                       57.8    2e-08   Rhizopus microsporus
gb|EWC74801.1|  hypothetical protein C923_04541                       58.2    2e-08   Plasmodium falciparum UGT5.1
ref|XP_007734193.1|  hypothetical protein A1O3_05883                  57.8    3e-08   Capronia epimyces CBS 606.96
ref|XP_009514480.1|  hypothetical protein PHYSODRAFT_353379           58.2    3e-08   Phytophthora sojae
gb|ETW17240.1|  hypothetical protein PFFVO_04064                      57.8    3e-08   Plasmodium falciparum Vietnam Oak-Knoll (FVO)
gb|KII93434.1|  hypothetical protein PLICRDRAFT_171189                57.8    3e-08   Plicaturopsis crispa FD-325 SS-3
ref|XP_007282243.1|  hypothetical protein CGGC5_10725                 57.8    3e-08   
ref|XP_007879706.1|  hypothetical protein PFL1_03992                  57.8    3e-08   Anthracocystis flocculosa PF-1
gb|ETW40990.1|  hypothetical protein PFNF135_04626                    57.4    3e-08   Plasmodium falciparum NF135/5.C10
gb|KIM32736.1|  hypothetical protein M408DRAFT_326478                 57.8    3e-08   Serendipita vermifera MAFF 305830
gb|ETW47626.1|  hypothetical protein PFMALIP_04318                    57.8    3e-08   Plasmodium falciparum MaliPS096_E11
gb|ESA15328.1|  hypothetical protein GLOINDRAFT_24007                 57.8    3e-08   
emb|CEG83424.1|  Putative Transmembrane protein                       57.8    4e-08   Rhizopus microsporus
ref|XP_007758339.1|  hypothetical protein A1O7_06145                  57.4    4e-08   Cladophialophora yegresii CBS 114405
ref|XP_666320.1|  hypothetical protein                                57.4    4e-08   Cryptosporidium hominis TU502
gb|ELR06169.1|  hypothetical protein GMDG_07824                       57.4    4e-08   Pseudogymnoascus destructans 20631-21
ref|XP_007403447.1|  hypothetical protein PHACADRAFT_266604           57.4    4e-08   Phanerochaete carnosa HHB-10118-sp
ref|XP_007861227.1|  DUF1909-domain-containing protein                57.4    4e-08   Gloeophyllum trabeum ATCC 11539
ref|XP_002381251.1|  conserved hypothetical protein                   57.4    5e-08   Aspergillus flavus NRRL3357
gb|KEZ46004.1|  hypothetical protein SAPIO_CDS1407                    57.0    5e-08   Scedosporium apiospermum
ref|XP_004224822.1|  hypothetical protein PCYB_143030                 57.0    5e-08   Plasmodium cynomolgi strain B
ref|XP_001267617.1|  hypothetical protein NFIA_045390                 57.4    5e-08   Aspergillus fischeri NRRL 181
gb|KFX88934.1|  hypothetical protein O988_08830                       57.0    5e-08   Pseudogymnoascus sp. VKM F-3808
gb|KGQ12045.1|  hypothetical protein BBAD15_g2225                     57.0    6e-08   Beauveria bassiana D1-5
gb|KFY14093.1|  hypothetical protein V492_02854                       57.0    6e-08   Pseudogymnoascus sp. VKM F-4246
ref|XP_001617137.1|  hypothetical protein                             57.0    6e-08   Plasmodium vivax
gb|KFY77970.1|  hypothetical protein V499_02783                       57.0    6e-08   Pseudogymnoascus sp. VKM F-103
ref|XP_002262106.1|  hypothetical protein                             56.6    6e-08   Plasmodium knowlesi strain H
ref|XP_680886.1|  hypothetical protein AN7617.2                       56.6    7e-08   Aspergillus nidulans FGSC A4
ref|XP_007403412.1|  hypothetical protein PHACADRAFT_266580           56.6    8e-08   Phanerochaete carnosa HHB-10118-sp
ref|XP_001560082.1|  predicted protein                                56.6    9e-08   Botrytis cinerea B05.10
ref|XP_007313728.1|  hypothetical protein SERLADRAFT_457280           56.2    1e-07   Serpula lacrymans var. lacrymans S7.9
gb|KIY69641.1|  DUF1909-domain-containing protein                     56.2    1e-07   Cylindrobasidium torrendii FP15055 ss-10
ref|XP_002142322.1|  hypothetical protein                             56.2    1e-07   Cryptosporidium muris RN66
ref|XP_006670665.1|  hypothetical protein CCM_05458                   56.2    1e-07   Cordyceps militaris CM01
ref|XP_007336743.1|  DUF1909-domain-containing protein                56.2    1e-07   
ref|XP_672987.1|  hypothetical protein                                56.2    1e-07   Plasmodium berghei ANKA
ref|XP_007725345.1|  hypothetical protein A1O1_06276                  55.8    1e-07   Capronia coronata CBS 617.96
gb|KIA75854.1|  hypothetical protein HK57_00381                       58.5    1e-07   Aspergillus ustus
ref|XP_002909638.1|  conserved hypothetical protein                   56.2    1e-07   Phytophthora infestans T30-4
ref|XP_739812.1|  hypothetical protein                                55.8    1e-07   Plasmodium chabaudi chabaudi
emb|CEJ88883.1|  Putative Transmembrane protein                       55.8    1e-07   Torrubiella hemipterigena
ref|XP_008710638.1|  hypothetical protein HMPREF1541_00108            55.8    1e-07   
ref|XP_007763310.1|  DUF1909-domain-containing protein                55.5    2e-07   
gb|KIO27842.1|  hypothetical protein M407DRAFT_72565                  55.5    2e-07   
ref|XP_001592930.1|  hypothetical protein SS1G_05852                  55.8    2e-07   
tpg|DAA45892.1|  TPA: hypothetical protein ZEAMMB73_510249            55.8    2e-07   
ref|XP_007842377.1|  duf1909-domain-containing protein                55.5    2e-07   
ref|XP_008903146.1|  hypothetical protein PPTG_10243                  55.5    2e-07   
emb|CDJ39205.1|  hypothetical protein, conserved                      55.5    2e-07   
gb|KIK71280.1|  hypothetical protein GYMLUDRAFT_33423                 55.5    2e-07   
emb|CDJ68707.1|  hypothetical protein, conserved                      55.5    2e-07   
gb|KDQ13628.1|  hypothetical protein BOTBODRAFT_33337                 55.1    2e-07   
gb|EKD01847.1|  hypothetical protein A1Q2_03910                       55.5    2e-07   
ref|XP_007265970.1|  DUF1909-domain-containing protein                55.1    3e-07   
gb|EWC87115.1|  hypothetical protein PFNF54_04293                     54.7    3e-07   
gb|KIJ68727.1|  hypothetical protein HYDPIDRAFT_24980                 54.7    3e-07   
gb|KDQ30560.1|  hypothetical protein PLEOSDRAFT_1111376               54.7    3e-07   
emb|CDJ48178.1|  hypothetical protein, conserved                      54.7    3e-07   
gb|KIJ21467.1|  hypothetical protein PAXINDRAFT_159556                54.7    4e-07   
gb|KIO02417.1|  hypothetical protein M404DRAFT_1002438                54.7    4e-07   
gb|KIL71047.1|  hypothetical protein M378DRAFT_155996                 54.7    4e-07   
gb|KEF56165.1|  hypothetical protein A1O9_07746                       54.7    4e-07   
ref|XP_001828468.1|  hypothetical protein CC1G_04439                  54.3    5e-07   
gb|KFH10055.1|  hypothetical protein TGVAND_314800                    56.6    6e-07   
gb|EMF15320.1|  DUF1909-domain-containing protein                     53.9    6e-07   
emb|CBQ73127.1|  conserved hypothetical protein                       53.9    6e-07   
gb|KIM84554.1|  hypothetical protein PILCRDRAFT_818127                53.9    6e-07   
gb|KFG56274.1|  hypothetical protein TGFOU_314800                     56.6    6e-07   
ref|XP_002396081.1|  hypothetical protein MPER_03756                  53.9    7e-07   
ref|XP_001397448.1|  hypothetical protein ANI_1_168144                53.9    7e-07   
gb|EIE88198.1|  hypothetical protein RO3G_12909                       53.5    8e-07   
ref|XP_009541400.1|  hypothetical protein HETIRDRAFT_307252           53.5    9e-07   
ref|XP_003853022.1|  hypothetical protein MYCGRDRAFT_104183           53.1    1e-06   
ref|XP_011389098.1|  hypothetical protein UMAG_02732                  53.1    1e-06   
ref|XP_008027247.1|  hypothetical protein SETTUDRAFT_163539           53.1    1e-06   
dbj|GAC71714.1|  hypothetical protein PANT_5c00037                    53.1    1e-06   
ref|XP_007697615.1|  hypothetical protein COCSADRAFT_35254            53.1    1e-06   
ref|XP_007683868.1|  hypothetical protein COCMIDRAFT_33060            53.1    1e-06   
ref|XP_008903145.1|  hypothetical protein PPTG_10242                  53.1    1e-06   
ref|XP_003881748.1|  conserved hypothetical protein                   53.1    1e-06   
gb|KJA25966.1|  hypothetical protein HYPSUDRAFT_36813                 52.8    1e-06   
gb|EDP47082.1|  hypothetical protein AFUB_100770                      53.1    1e-06   
emb|CDI53601.1|  duf1909-domain-containing protein                    52.8    2e-06   
gb|KIK97659.1|  hypothetical protein PAXRUDRAFT_10058                 52.8    2e-06   
gb|KDQ54724.1|  hypothetical protein JAAARDRAFT_37824                 52.8    2e-06   
gb|ETI50898.1|  hypothetical protein F443_05639                       53.1    2e-06   
ref|XP_001481527.1|  conserved hypothetical protein                   52.8    2e-06   
ref|XP_006454791.1|  hypothetical protein AGABI2DRAFT_190023          52.4    2e-06   
ref|XP_009514481.1|  hypothetical protein PHYSODRAFT_284069           52.4    3e-06   
ref|XP_002369161.1|  hypothetical protein TGME49_084630               52.0    3e-06   
gb|EST05455.1|  hypothetical protein PSEUBRA_SCAF5g02324              52.0    3e-06   
gb|EME43672.1|  hypothetical protein DOTSEDRAFT_72884                 51.6    4e-06   
ref|XP_007291420.1|  hypothetical protein MBM_03531                   52.4    5e-06   
gb|EPQ63232.1|  hypothetical protein BGT96224_2191                    51.2    6e-06   
gb|KIV79460.1|  hypothetical protein PV11_07022                       50.8    8e-06   
ref|XP_002175475.1|  hypothetical protein SJAG_04365                  50.8    8e-06   
ref|XP_003302273.1|  hypothetical protein PTT_14022                   50.8    9e-06   
emb|CCU78017.1|  hypothetical protein BGHDH14_bgh01825                51.2    9e-06   
gb|KID75277.1|  putative protein family SERF                          50.4    9e-06   
gb|KIM66973.1|  hypothetical protein SCLCIDRAFT_1144973               50.4    1e-05   
dbj|GAK64338.1|  DUF1909-domain-containing protein                    50.8    1e-05   
emb|CEP15598.1|  hypothetical protein                                 50.1    1e-05   
gb|KIY51394.1|  DUF1909-domain-containing protein                     50.4    1e-05   
ref|XP_003845874.1|  hypothetical protein LEMA_P011820.1              50.4    1e-05   
gb|KIM48424.1|  hypothetical protein M413DRAFT_440153                 50.1    2e-05   
ref|XP_007378502.1|  DUF1909-domain-containing protein                49.7    2e-05   
gb|KHJ35282.1|  hypothetical protein EV44_g3050                       49.7    2e-05   
ref|XP_001874287.1|  predicted protein                                49.7    2e-05   
ref|XP_009842303.1|  hypothetical protein H257_15796                  50.1    2e-05   
ref|XP_002776767.1|  small conserved protein, putative                49.7    2e-05   
ref|XP_007916673.1|  putative duf1909-domain-containing protein       49.3    2e-05   
gb|KIV88902.1|  hypothetical protein PV10_08532                       49.3    3e-05   
ref|XP_008874756.1|  hypothetical protein H310_10221                  49.3    3e-05   
ref|XP_002784498.1|  small conserved protein, putative                49.3    3e-05   
ref|XP_008874755.1|  hypothetical protein H310_10220                  49.3    3e-05   
gb|KIW85619.1|  hypothetical protein Z517_01011                       48.9    3e-05   
gb|KDR84771.1|  hypothetical protein GALMADRAFT_233108                48.9    3e-05   
gb|KIX95647.1|  hypothetical protein Z520_08767                       48.5    4e-05   
gb|EFA83783.1|  hypothetical protein PPL_02851                        48.5    5e-05   
ref|XP_007324983.1|  hypothetical protein AGABI1DRAFT_32833           48.1    7e-05   
dbj|GAM87553.1|  hypothetical protein ANO11243_055800                 47.8    8e-05   
gb|KIK46273.1|  hypothetical protein CY34DRAFT_76411                  47.8    9e-05   
ref|XP_007927952.1|  hypothetical protein MYCFIDRAFT_38481            47.8    1e-04   
emb|CCF52973.1|  uncharacterized protein UHOR_04358                   47.4    1e-04   
ref|XP_003038468.1|  hypothetical protein SCHCODRAFT_49301            47.4    1e-04   
ref|XP_625681.1|  small conserved protein                             47.4    2e-04   
ref|XP_665481.1|  hypothetical protein                                47.0    2e-04   
gb|KIK26533.1|  hypothetical protein PISMIDRAFT_94965                 46.6    2e-04   
dbj|GAA84761.1|  hypothetical protein AKAW_02875                      46.6    2e-04   
ref|XP_729592.1|  hypothetical protein                                46.6    3e-04   
gb|ESZ98767.1|  hypothetical protein SBOR_0873                        46.6    4e-04   
ref|XP_003079989.1|  lipoic acid synthase (ISS)                       48.9    5e-04   
gb|KFY20001.1|  hypothetical protein V493_07770                       45.8    6e-04   
ref|XP_002262160.1|  hypothetical protein                             45.4    6e-04   
gb|EFX05741.1|  hypothetical protein CMQ_3810                         45.8    6e-04   
gb|KDO18924.1|  hypothetical protein SPRG_15766                       45.4    8e-04   
ref|XP_736084.1|  hypothetical protein                                45.1    9e-04   
emb|CDO63897.1|  conserved Plasmodium protein, unknown function       45.1    0.001   
ref|XP_002140969.1|  small conserved protein                          45.1    0.001   



>gb|KCW59529.1| hypothetical protein EUGRSUZ_H02281, partial [Eucalyptus grandis]
Length=146

 Score =   152 bits (384),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/88 (83%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = +2

Query  23   R*GSPFPISEIMGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCT  202
            R G   PI+  MGGGNGQK+KMARE+NLEK+KG+KGSQL+SNKKAMNIQCK+CMQTFMCT
Sbjct  59   RRGIVSPIASRMGGGNGQKAKMAREKNLEKSKGSKGSQLESNKKAMNIQCKICMQTFMCT  118

Query  203  TSEVKCREHAEAKHPKSDVGTCFPHLKK  286
            TSEVKCREHAEAKHPKSDV  CFPHLKK
Sbjct  119  TSEVKCREHAEAKHPKSDVTACFPHLKK  146



>ref|XP_004152272.1| PREDICTED: uncharacterized protein At2g23090-like [Cucumis sativus]
 ref|XP_004156857.1| PREDICTED: uncharacterized protein At2g23090-like [Cucumis sativus]
 ref|XP_008454381.1| PREDICTED: uncharacterized protein At2g23090-like [Cucumis melo]
 gb|KGN52779.1| hypothetical protein Csa_4G000980 [Cucumis sativus]
Length=77

 Score =   150 bits (378),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/77 (94%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQK+KMARERNLEK KGAKGSQLDSNKKAM IQCKVCMQTFMCTTSEVKCREHAE
Sbjct  1    MGGGNGQKAKMARERNLEKQKGAKGSQLDSNKKAMTIQCKVCMQTFMCTTSEVKCREHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            AKHPKSDV TCFPHL+K
Sbjct  61   AKHPKSDVFTCFPHLQK  77



>ref|XP_008657318.1| PREDICTED: uncharacterized protein At2g23090 isoform X2 [Zea 
mays]
 gb|ACG24589.1| hypothetical protein [Zea mays]
 gb|ACG34213.1| hypothetical protein [Zea mays]
 gb|ACG36453.1| hypothetical protein [Zea mays]
 gb|ACN27120.1| unknown [Zea mays]
 tpg|DAA45891.1| TPA: hypothetical protein ZEAMMB73_510249 [Zea mays]
Length=77

 Score =   147 bits (372),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/77 (91%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQKSKMARERNLEKNKGAKGSQL++NKKAM+IQCKVCMQTFMCTT+EVKCREHAE
Sbjct  1    MGGGNGQKSKMARERNLEKNKGAKGSQLETNKKAMSIQCKVCMQTFMCTTTEVKCREHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            AKHPK+DV  CFPHLKK
Sbjct  61   AKHPKTDVYQCFPHLKK  77



>ref|XP_009419063.1| PREDICTED: uncharacterized protein At2g23090-like [Musa acuminata 
subsp. malaccensis]
Length=77

 Score =   147 bits (371),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/77 (91%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQKSK+ARERN+EKNK AKGSQL+SNKKAM IQCKVCMQTFMCTTSEVKCREHAE
Sbjct  1    MGGGNGQKSKIARERNMEKNKAAKGSQLESNKKAMTIQCKVCMQTFMCTTSEVKCREHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            AKHPKSDV  CFPHLKK
Sbjct  61   AKHPKSDVSQCFPHLKK  77



>ref|XP_010070636.1| PREDICTED: uncharacterized protein At2g23090-like [Eucalyptus 
grandis]
Length=77

 Score =   147 bits (371),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/77 (90%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQK+KMARE+NLEK+KG+KGSQL+SNKKAMNIQCK+CMQTFMCTTSEVKCREHAE
Sbjct  1    MGGGNGQKAKMAREKNLEKSKGSKGSQLESNKKAMNIQCKICMQTFMCTTSEVKCREHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            AKHPKSDV  CFPHLKK
Sbjct  61   AKHPKSDVTACFPHLKK  77



>ref|XP_009407418.1| PREDICTED: uncharacterized protein At2g23090-like [Musa acuminata 
subsp. malaccensis]
Length=77

 Score =   147 bits (370),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 70/77 (91%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQKSKMARERN+EKNK AKGSQL++NKKAM IQCKVCMQTFMCTTSEVKCREHAE
Sbjct  1    MGGGNGQKSKMARERNVEKNKAAKGSQLETNKKAMTIQCKVCMQTFMCTTSEVKCREHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            AKHPKSDV  CFPHLKK
Sbjct  61   AKHPKSDVYQCFPHLKK  77



>ref|XP_006650234.1| PREDICTED: uncharacterized protein At2g23090-like [Oryza brachyantha]
Length=77

 Score =   147 bits (370),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 70/77 (91%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQK+KMARERNLEK KGAKGSQL++NKKAMNIQCKVCMQTFMCTTSEVKCREHAE
Sbjct  1    MGGGNGQKAKMARERNLEKAKGAKGSQLETNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            AKHPK+DV  CFPHLKK
Sbjct  61   AKHPKTDVYQCFPHLKK  77



>ref|XP_002467663.1| hypothetical protein SORBIDRAFT_01g031840 [Sorghum bicolor]
 gb|EER94661.1| hypothetical protein SORBIDRAFT_01g031840 [Sorghum bicolor]
Length=77

 Score =   146 bits (369),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 69/77 (90%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQKSKMARERNLEKNKG+KGSQL++NKKAM+IQCKVCMQTFMCTT+EVKCREHAE
Sbjct  1    MGGGNGQKSKMARERNLEKNKGSKGSQLETNKKAMSIQCKVCMQTFMCTTTEVKCREHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            AKHPK+DV  CFPHLKK
Sbjct  61   AKHPKTDVYQCFPHLKK  77



>ref|XP_009416809.1| PREDICTED: uncharacterized protein At2g23090-like [Musa acuminata 
subsp. malaccensis]
Length=76

 Score =   146 bits (368),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 69/76 (91%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQKSKMARERN+EKNK AKGSQL+SNKKAM IQCKVCMQTF+CTTSEVKCREHAE
Sbjct  1    MGGGNGQKSKMARERNIEKNKAAKGSQLESNKKAMTIQCKVCMQTFICTTSEVKCREHAE  60

Query  236  AKHPKSDVGTCFPHLK  283
            AKHPKSDV  CFPHLK
Sbjct  61   AKHPKSDVSQCFPHLK  76



>ref|XP_004983946.1| PREDICTED: uncharacterized protein At2g23090-like [Setaria italica]
Length=77

 Score =   146 bits (368),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 69/77 (90%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQKS+MARERN EKNK AKGSQLD+NKKAM+IQCKVCMQTFMCTT+EVKCREHAE
Sbjct  1    MGGGNGQKSRMARERNAEKNKAAKGSQLDTNKKAMSIQCKVCMQTFMCTTTEVKCREHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            AKHPKSDV  CFPHLKK
Sbjct  61   AKHPKSDVYQCFPHLKK  77



>ref|XP_006339821.1| PREDICTED: uncharacterized protein At2g23090-like [Solanum tuberosum]
Length=77

 Score =   146 bits (368),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 68/77 (88%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQK+KMARE+N+EK KGAKGSQLD+NKKAMNIQCKVCMQTFMCTTSEVKC+EHAE
Sbjct  1    MGGGNGQKAKMAREKNIEKMKGAKGSQLDANKKAMNIQCKVCMQTFMCTTSEVKCKEHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            AKHPKSD+ TCFPHLK+
Sbjct  61   AKHPKSDLATCFPHLKQ  77



>ref|XP_004233452.1| PREDICTED: uncharacterized protein At2g23090-like [Solanum lycopersicum]
 ref|XP_006364420.1| PREDICTED: uncharacterized protein At2g23090-like [Solanum tuberosum]
Length=77

 Score =   145 bits (366),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 69/76 (91%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQK+KMARERNLEK KGAKGSQLD+NKKAMNIQCKVCMQTFMCTTSEVKC+EHAE
Sbjct  1    MGGGNGQKAKMARERNLEKLKGAKGSQLDTNKKAMNIQCKVCMQTFMCTTSEVKCKEHAE  60

Query  236  AKHPKSDVGTCFPHLK  283
            AKHPKSD+  CFPHLK
Sbjct  61   AKHPKSDLYACFPHLK  76



>gb|ACF74320.1| unknown [Arachis hypogaea]
Length=77

 Score =   145 bits (366),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/76 (91%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQK+KMARE+NLEK K AKGSQLDSNKKAM+IQCKVCMQTFMCTTSEVKCREHAE
Sbjct  1    MGGGNGQKAKMAREKNLEKQKAAKGSQLDSNKKAMSIQCKVCMQTFMCTTSEVKCREHAE  60

Query  236  AKHPKSDVGTCFPHLK  283
            AKHPKSDV  CFPHLK
Sbjct  61   AKHPKSDVYVCFPHLK  76



>ref|XP_011074376.1| PREDICTED: uncharacterized protein At2g23090 [Sesamum indicum]
Length=77

 Score =   145 bits (365),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/77 (90%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQK+KMARERNLEK K AKGSQL+SNKKAM+IQCKVCMQTF+CTTSEVKCREHAE
Sbjct  1    MGGGNGQKAKMARERNLEKMKAAKGSQLESNKKAMSIQCKVCMQTFICTTSEVKCREHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            AKHPK+DV TCFPHLKK
Sbjct  61   AKHPKADVYTCFPHLKK  77



>ref|XP_011099329.1| PREDICTED: uncharacterized protein At2g23090-like [Sesamum indicum]
Length=77

 Score =   144 bits (364),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/77 (90%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQK+KMARE+NLEK+K  KGSQL+SNKKAMNIQCKVCMQTFMCTTSEVKCREHAE
Sbjct  1    MGGGNGQKAKMAREKNLEKSKAPKGSQLESNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            AKHPKSDV  CFPHLKK
Sbjct  61   AKHPKSDVYACFPHLKK  77



>gb|AFK38003.1| unknown [Lotus japonicus]
Length=77

 Score =   144 bits (364),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 68/77 (88%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGN QK+KMARERNLEK KGAKGSQL++NKKAM+IQCKVCMQTF+CTTSEVKCREHAE
Sbjct  1    MGGGNAQKAKMARERNLEKQKGAKGSQLETNKKAMSIQCKVCMQTFICTTSEVKCREHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            AKHPKSDV TCFPHL+K
Sbjct  61   AKHPKSDVVTCFPHLQK  77



>ref|NP_001058751.1| Os07g0114300 [Oryza sativa Japonica Group]
 dbj|BAC16171.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF20665.1| Os07g0114300 [Oryza sativa Japonica Group]
 gb|EAZ38478.1| hypothetical protein OsJ_22866 [Oryza sativa Japonica Group]
 dbj|BAG88204.1| unnamed protein product [Oryza sativa Japonica Group]
Length=77

 Score =   144 bits (364),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 67/77 (87%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQKSKMARERN+EKNKGAKGSQL++NKKAMNIQCK+CMQTF+CTTSE KC+EHAE
Sbjct  1    MGGGNGQKSKMARERNMEKNKGAKGSQLEANKKAMNIQCKICMQTFICTTSETKCKEHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            AKHPKSD+  CFPHLKK
Sbjct  61   AKHPKSDLTACFPHLKK  77



>emb|CDP02577.1| unnamed protein product [Coffea canephora]
Length=77

 Score =   144 bits (363),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 69/77 (90%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQKSKMARE+NLEK KG KGSQL++NKKAMNIQCKVCMQTFMCTTSEVKCREHAE
Sbjct  1    MGGGNGQKSKMAREKNLEKMKGPKGSQLETNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            AKHPK+DV  CFPHLKK
Sbjct  61   AKHPKADVYACFPHLKK  77



>ref|XP_010523219.1| PREDICTED: uncharacterized protein At2g23090-like [Tarenaya hassleriana]
Length=77

 Score =   144 bits (363),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 67/77 (87%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQKS+MARERN+EKNK AKGSQL++NKKAM+IQCKVCMQTF+CTTSEVKCREHAE
Sbjct  1    MGGGNGQKSRMARERNMEKNKAAKGSQLEANKKAMSIQCKVCMQTFICTTSEVKCREHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            AKHPKSD+ TCFPHL K
Sbjct  61   AKHPKSDLYTCFPHLNK  77



>ref|XP_010679589.1| PREDICTED: uncharacterized protein At2g23090-like [Beta vulgaris 
subsp. vulgaris]
Length=77

 Score =   144 bits (362),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 68/77 (88%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGN QKSKMARE+ LEKNK +KGSQLD+NKKAMNIQCKVCMQTFMCTTSEVKCREHAE
Sbjct  1    MGGGNAQKSKMAREKALEKNKASKGSQLDTNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            AKHPK DV  CFPHLKK
Sbjct  61   AKHPKQDVDACFPHLKK  77



>ref|XP_010679588.1| PREDICTED: uncharacterized protein At2g23090 [Beta vulgaris subsp. 
vulgaris]
Length=77

 Score =   143 bits (361),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 69/77 (90%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQKSK ARERNLEKNK AKGSQL++NKKAMNIQCKVCMQTF+CTTSEVKCREHAE
Sbjct  1    MGGGNGQKSKTARERNLEKNKPAKGSQLEANKKAMNIQCKVCMQTFICTTSEVKCREHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            AKHPK DV  CFPHLKK
Sbjct  61   AKHPKHDVYACFPHLKK  77



>ref|XP_010059852.1| PREDICTED: uncharacterized protein At2g23090-like [Eucalyptus 
grandis]
 gb|KCW66292.1| hypothetical protein EUGRSUZ_F00119 [Eucalyptus grandis]
Length=77

 Score =   143 bits (360),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 66/77 (86%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQK+KMARERNLEK KG +GSQL++NKKAMNIQCKVCMQTF+CTT+EVKCREHAE
Sbjct  1    MGGGNGQKAKMARERNLEKQKGVRGSQLEANKKAMNIQCKVCMQTFICTTTEVKCREHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            AKHPKSD+  CFPHLKK
Sbjct  61   AKHPKSDLYACFPHLKK  77



>ref|XP_009780160.1| PREDICTED: uncharacterized protein At2g23090-like [Nicotiana 
sylvestris]
Length=77

 Score =   143 bits (360),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 66/77 (86%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQK+KMARE+NLEK+K +KGSQLD+NKKAM+IQCKVCMQTFMCTTSEVKC+EHAE
Sbjct  1    MGGGNGQKAKMAREKNLEKSKASKGSQLDTNKKAMSIQCKVCMQTFMCTTSEVKCKEHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            AKHPKSD+  CFPHLKK
Sbjct  61   AKHPKSDIYACFPHLKK  77



>ref|XP_006657405.1| PREDICTED: uncharacterized protein At2g23090-like [Oryza brachyantha]
Length=77

 Score =   143 bits (360),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 67/77 (87%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQKSKMARERN+EKNKGAKGSQL++NKKAMNIQCKVCMQTF+CTTSE KC+EHAE
Sbjct  1    MGGGNGQKSKMARERNMEKNKGAKGSQLEANKKAMNIQCKVCMQTFICTTSETKCKEHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            AKHPK+D+  CFPHLKK
Sbjct  61   AKHPKTDLFQCFPHLKK  77



>ref|XP_007143099.1| hypothetical protein PHAVU_007G043400g [Phaseolus vulgaris]
 gb|ESW15093.1| hypothetical protein PHAVU_007G043400g [Phaseolus vulgaris]
Length=77

 Score =   142 bits (359),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 66/77 (86%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQKS+MARERN+EKNK +KGSQL++NKKAMNIQCKVCMQTF+CTTSEVKCREHAE
Sbjct  1    MGGGNGQKSRMARERNMEKNKSSKGSQLEANKKAMNIQCKVCMQTFICTTSEVKCREHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            AKHPK D+  CFPHLKK
Sbjct  61   AKHPKVDLNACFPHLKK  77



>gb|KDP41641.1| hypothetical protein JCGZ_16048 [Jatropha curcas]
Length=77

 Score =   142 bits (359),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 66/77 (86%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQK+KMARERN+EK K A+GSQLDSNKKAM IQCKVCMQTF+CTT+EVKCREHAE
Sbjct  1    MGGGNGQKAKMARERNMEKQKAARGSQLDSNKKAMTIQCKVCMQTFICTTTEVKCREHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            AKHPKSD+  CFPHLKK
Sbjct  61   AKHPKSDLYACFPHLKK  77



>gb|EAZ02551.1| hypothetical protein OsI_24662 [Oryza sativa Indica Group]
Length=77

 Score =   142 bits (358),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 66/77 (86%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGG+GQKSKMARERN+EKNKGAKGSQL++NKKAMNIQCK+CMQTF+CTTSE KC+EHAE
Sbjct  1    MGGGHGQKSKMARERNMEKNKGAKGSQLEANKKAMNIQCKICMQTFICTTSETKCKEHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            AKHPKSD+  CFPHLKK
Sbjct  61   AKHPKSDLTACFPHLKK  77



>gb|KHG01657.1| hypothetical protein F383_23639 [Gossypium arboreum]
Length=78

 Score =   142 bits (358),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/78 (90%), Positives = 74/78 (95%), Gaps = 1/78 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGA-KGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGNGQKSKMARE+NLEK K A KGSQL+SNKKAM+IQCKVCMQTFMCTT+EVKCREHA
Sbjct  1    MGGGNGQKSKMAREKNLEKQKAAAKGSQLESNKKAMSIQCKVCMQTFMCTTTEVKCREHA  60

Query  233  EAKHPKSDVGTCFPHLKK  286
            EAKHPKSDV TCFPHLKK
Sbjct  61   EAKHPKSDVYTCFPHLKK  78



>ref|XP_003517333.1| PREDICTED: uncharacterized protein At2g23090 [Glycine max]
 gb|KHN36281.1| Hypothetical protein glysoja_003404 [Glycine soja]
Length=78

 Score =   142 bits (358),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/78 (90%), Positives = 73/78 (94%), Gaps = 1/78 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGA-KGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGNGQK+KMARE+NLEK K A KGSQLDSNKKAM+IQCKVCMQTFMCTTSEVKCREHA
Sbjct  1    MGGGNGQKAKMAREKNLEKQKAASKGSQLDSNKKAMSIQCKVCMQTFMCTTSEVKCREHA  60

Query  233  EAKHPKSDVGTCFPHLKK  286
            EAKHPKSDV  CFPHLKK
Sbjct  61   EAKHPKSDVYACFPHLKK  78



>ref|XP_009590579.1| PREDICTED: uncharacterized protein At2g23090-like [Nicotiana 
tomentosiformis]
Length=77

 Score =   142 bits (358),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 66/77 (86%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQK+KMARE+NLEK+K +KGSQLD+NKKAM+IQCKVCMQTFMCTTSEVKC+EHAE
Sbjct  1    MGGGNGQKAKMAREKNLEKSKASKGSQLDTNKKAMSIQCKVCMQTFMCTTSEVKCKEHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            AKHPKSD+  CFPHLKK
Sbjct  61   AKHPKSDLYACFPHLKK  77



>ref|XP_008780912.1| PREDICTED: uncharacterized protein At2g23090-like [Phoenix dactylifera]
Length=77

 Score =   142 bits (358),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/77 (88%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQKSKMARERN+EKNK  KGSQL+SNKKAM IQCKVCMQTF+CTTSEVKCREHAE
Sbjct  1    MGGGNGQKSKMARERNVEKNKPPKGSQLESNKKAMTIQCKVCMQTFICTTSEVKCREHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            AKHPKSD+  CFPHLKK
Sbjct  61   AKHPKSDLYQCFPHLKK  77



>ref|XP_007201472.1| hypothetical protein PRUPE_ppa014259mg [Prunus persica]
 gb|EMJ02671.1| hypothetical protein PRUPE_ppa014259mg [Prunus persica]
Length=77

 Score =   142 bits (357),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 66/77 (86%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQK+K ARERN+EK K AKGSQL++NKKAMNIQCKVCMQTF+CTTSEVKCREHAE
Sbjct  1    MGGGNGQKAKTARERNMEKQKAAKGSQLEANKKAMNIQCKVCMQTFICTTSEVKCREHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            AKHPK+DV +CFPHLKK
Sbjct  61   AKHPKADVYSCFPHLKK  77



>ref|XP_006362064.1| PREDICTED: uncharacterized protein At2g23090-like [Solanum tuberosum]
Length=77

 Score =   142 bits (357),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/77 (87%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQK+KMARE+N+EK KG KGSQL++NKKAMNIQCKVCMQTF+CTTSEVKCREHAE
Sbjct  1    MGGGNGQKAKMAREKNMEKMKGQKGSQLEANKKAMNIQCKVCMQTFICTTSEVKCREHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            AKHPKSDV  CFPHLKK
Sbjct  61   AKHPKSDVNACFPHLKK  77



>ref|XP_006841988.1| hypothetical protein AMTR_s00144p00063280 [Amborella trichopoda]
 gb|ERN03663.1| hypothetical protein AMTR_s00144p00063280 [Amborella trichopoda]
Length=77

 Score =   142 bits (357),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/77 (87%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQK+KMARE+NLEK K +KGSQL+SNKKAM+IQCKVCMQTF+CTTSEVKCREHAE
Sbjct  1    MGGGNGQKAKMAREKNLEKQKASKGSQLESNKKAMSIQCKVCMQTFICTTSEVKCREHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            AKHPKSDV  CFPHLKK
Sbjct  61   AKHPKSDVYQCFPHLKK  77



>ref|XP_010906272.1| PREDICTED: uncharacterized protein At2g23090-like [Elaeis guineensis]
Length=77

 Score =   142 bits (357),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/77 (87%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQKSKMARE+N+EKNK  KGSQL+SNKKAM IQCKVCMQTF+CTTSEVKCREHAE
Sbjct  1    MGGGNGQKSKMAREKNMEKNKAPKGSQLESNKKAMTIQCKVCMQTFICTTSEVKCREHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            AKHPKSD+  CFPHLKK
Sbjct  61   AKHPKSDLNQCFPHLKK  77



>ref|XP_004238102.1| PREDICTED: uncharacterized protein At2g23090 [Solanum lycopersicum]
Length=77

 Score =   141 bits (356),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 67/77 (87%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQK+KMARE+N+EK KG KGSQL++NKKAMNIQCKVCMQTF+CTTSEVKCREHAE
Sbjct  1    MGGGNGQKAKMAREKNMEKMKGQKGSQLEANKKAMNIQCKVCMQTFICTTSEVKCREHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            AKHPKSDV  CFPHLKK
Sbjct  61   AKHPKSDVYACFPHLKK  77



>ref|XP_003539296.1| PREDICTED: uncharacterized protein At2g23090 [Glycine max]
 gb|KHN12981.1| Hypothetical protein glysoja_027269 [Glycine soja]
Length=78

 Score =   141 bits (356),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/78 (88%), Positives = 73/78 (94%), Gaps = 1/78 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGA-KGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGNGQK+KMARE+N+EK K A KGSQLDSNKKAM+IQCKVCMQTFMCTTSEVKCREHA
Sbjct  1    MGGGNGQKAKMAREKNIEKQKAASKGSQLDSNKKAMSIQCKVCMQTFMCTTSEVKCREHA  60

Query  233  EAKHPKSDVGTCFPHLKK  286
            EAKHPKSDV  CFPHLKK
Sbjct  61   EAKHPKSDVYACFPHLKK  78



>ref|XP_007156735.1| hypothetical protein PHAVU_002G012800g [Phaseolus vulgaris]
 gb|ESW28729.1| hypothetical protein PHAVU_002G012800g [Phaseolus vulgaris]
Length=78

 Score =   141 bits (355),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 69/78 (88%), Positives = 73/78 (94%), Gaps = 1/78 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGA-KGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGNGQKSKMARE+N+EK + A KGSQLDSNKKAM+IQCKVCMQTFMCTTSEVKCREHA
Sbjct  1    MGGGNGQKSKMAREKNIEKQRAAGKGSQLDSNKKAMSIQCKVCMQTFMCTTSEVKCREHA  60

Query  233  EAKHPKSDVGTCFPHLKK  286
            EAKHPKSDV  CFPHLKK
Sbjct  61   EAKHPKSDVYACFPHLKK  78



>ref|XP_009628091.1| PREDICTED: uncharacterized protein At2g23090-like [Nicotiana 
tomentosiformis]
 ref|XP_009797629.1| PREDICTED: uncharacterized protein At2g23090-like [Nicotiana 
sylvestris]
Length=77

 Score =   141 bits (355),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 67/77 (87%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQK+KMARERNLEK K  KGSQL+ NK+AMNIQCKVCMQTFMCTTSEVKC+EHAE
Sbjct  1    MGGGNGQKAKMARERNLEKMKAQKGSQLEKNKQAMNIQCKVCMQTFMCTTSEVKCKEHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            AKHPKSD+ TCFPHLKK
Sbjct  61   AKHPKSDLYTCFPHLKK  77



>ref|XP_006486945.1| PREDICTED: uncharacterized protein At2g23090-like isoform X1 
[Citrus sinensis]
Length=77

 Score =   140 bits (354),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQK+KMARE+++E+N+ AKGSQL++NKKAMNIQCKVC+QTFMCTTSEVKCREHAE
Sbjct  1    MGGGNGQKAKMAREKHMERNRPAKGSQLETNKKAMNIQCKVCVQTFMCTTSEVKCREHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            AKHPKSD+ TCFPHLKK
Sbjct  61   AKHPKSDLYTCFPHLKK  77



>gb|KJB58614.1| hypothetical protein B456_009G218200 [Gossypium raimondii]
Length=77

 Score =   140 bits (354),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQKS+MARE+++EKNK AKGSQL+SNKKAM IQCKVCMQTF+CTTSEVKCREHAE
Sbjct  1    MGGGNGQKSRMAREKHVEKNKAAKGSQLESNKKAMTIQCKVCMQTFICTTSEVKCREHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            +KHPKSD+  CFPHLKK
Sbjct  61   SKHPKSDIYACFPHLKK  77



>ref|XP_008236427.1| PREDICTED: uncharacterized protein At2g23090-like [Prunus mume]
Length=77

 Score =   140 bits (354),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQK+K ARERN+EK K AKGSQL++NKKAMNIQCKVCMQTF+CTTSEVKCREHAE
Sbjct  1    MGGGNGQKAKTARERNMEKQKAAKGSQLEANKKAMNIQCKVCMQTFICTTSEVKCREHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            AKHPK+DV +CFPH+KK
Sbjct  61   AKHPKADVYSCFPHVKK  77



>ref|XP_007155853.1| hypothetical protein PHAVU_003G237200g [Phaseolus vulgaris]
 gb|ESW27847.1| hypothetical protein PHAVU_003G237200g [Phaseolus vulgaris]
Length=78

 Score =   140 bits (354),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 69/78 (88%), Positives = 72/78 (92%), Gaps = 1/78 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGA-KGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGNGQKSKMARE+N EK + A KGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA
Sbjct  1    MGGGNGQKSKMAREKNTEKQRAAAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  60

Query  233  EAKHPKSDVGTCFPHLKK  286
            EAKHPKSD+  CFPHLKK
Sbjct  61   EAKHPKSDLYACFPHLKK  78



>ref|XP_010905274.1| PREDICTED: uncharacterized protein At2g23090-like [Elaeis guineensis]
 ref|XP_010905275.1| PREDICTED: uncharacterized protein At2g23090-like [Elaeis guineensis]
 ref|XP_010905277.1| PREDICTED: uncharacterized protein At2g23090-like [Elaeis guineensis]
Length=77

 Score =   140 bits (354),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 68/77 (88%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQKSKMARE+N+EKNK  KGSQL+SNKKAM IQCKVCMQTFMCTTSEVKCREHAE
Sbjct  1    MGGGNGQKSKMAREKNMEKNKAPKGSQLESNKKAMTIQCKVCMQTFMCTTSEVKCREHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            AKHPKSDV  CF HLKK
Sbjct  61   AKHPKSDVYQCFTHLKK  77



>ref|XP_003555981.1| PREDICTED: uncharacterized protein At2g23090 [Glycine max]
Length=77

 Score =   140 bits (354),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQK+KMARERN+EKNK AKGSQL++NKKAMNIQCKVCMQTF+CTTSEVKCREHAE
Sbjct  1    MGGGNGQKAKMARERNMEKNKPAKGSQLEANKKAMNIQCKVCMQTFICTTSEVKCREHAE  60

Query  236  AKHPKSDVGTCFPHLK  283
            AKHPK+ + TCFPHLK
Sbjct  61   AKHPKAHLYTCFPHLK  76



>gb|KHG16029.1| hypothetical protein F383_22011 [Gossypium arboreum]
Length=77

 Score =   140 bits (354),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQKS+MARE+++EK K AKGSQL+SNKKAM IQCKVCMQTF+CTTSEVKCREHAE
Sbjct  1    MGGGNGQKSRMAREKHVEKYKAAKGSQLESNKKAMTIQCKVCMQTFICTTSEVKCREHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            +KHPKSD+ TCFPHLKK
Sbjct  61   SKHPKSDIYTCFPHLKK  77



>ref|XP_002320700.1| hypothetical protein POPTR_0014s01840g [Populus trichocarpa]
 gb|EEE99015.1| hypothetical protein POPTR_0014s01840g [Populus trichocarpa]
Length=78

 Score =   140 bits (353),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 68/78 (87%), Positives = 75/78 (96%), Gaps = 1/78 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNK-GAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGNGQK+KMARE+NLEK K G+KGSQL+SNKKAM+IQCKVCMQTF+CTTSEVKCREHA
Sbjct  1    MGGGNGQKAKMAREKNLEKQKAGSKGSQLESNKKAMSIQCKVCMQTFICTTSEVKCREHA  60

Query  233  EAKHPKSDVGTCFPHLKK  286
            EAKHPKSDV TCFPHL+K
Sbjct  61   EAKHPKSDVNTCFPHLQK  78



>ref|XP_004141283.1| PREDICTED: uncharacterized protein At2g23090-like [Cucumis sativus]
 ref|XP_004164026.1| PREDICTED: uncharacterized protein At2g23090-like [Cucumis sativus]
 gb|KGN55255.1| hypothetical protein Csa_4G642360 [Cucumis sativus]
Length=77

 Score =   140 bits (353),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQK+KMARERNLEK K ++GSQL++NKKAM IQCKVCMQTF+CTT+EVKCREHAE
Sbjct  1    MGGGNGQKAKMARERNLEKQKASRGSQLETNKKAMTIQCKVCMQTFICTTTEVKCREHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            A+HPKSDV  CFPHLKK
Sbjct  61   ARHPKSDVYACFPHLKK  77



>ref|XP_010105485.1| hypothetical protein L484_010269 [Morus notabilis]
 gb|EXC04841.1| hypothetical protein L484_010269 [Morus notabilis]
Length=78

 Score =   140 bits (353),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/78 (90%), Positives = 72/78 (92%), Gaps = 1/78 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGA-KGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGNGQKSKMARERN EK K A KGSQL+SNKKAM IQCKVCMQTFMCTT+EVKCREHA
Sbjct  1    MGGGNGQKSKMARERNTEKMKAAAKGSQLESNKKAMTIQCKVCMQTFMCTTTEVKCREHA  60

Query  233  EAKHPKSDVGTCFPHLKK  286
            EAKHPKSDV TCFPHLKK
Sbjct  61   EAKHPKSDVFTCFPHLKK  78



>ref|XP_008452628.1| PREDICTED: uncharacterized protein At2g23090-like [Cucumis melo]
Length=77

 Score =   140 bits (352),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQK+KMARERNLEK K ++GSQL++NKKAM IQCKVCMQTF+CTT+EVKCREHAE
Sbjct  1    MGGGNGQKAKMARERNLEKQKSSRGSQLETNKKAMTIQCKVCMQTFICTTTEVKCREHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            A+HPKSDV  CFPHLKK
Sbjct  61   ARHPKSDVYACFPHLKK  77



>ref|XP_010674198.1| PREDICTED: uncharacterized protein At2g23090-like [Beta vulgaris 
subsp. vulgaris]
Length=77

 Score =   140 bits (352),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGN QKSK ARERNLEKNK +KGSQLD+NKKAM+IQCKVCMQTFMCTT+EVKCREHAE
Sbjct  1    MGGGNAQKSKTARERNLEKNKASKGSQLDTNKKAMSIQCKVCMQTFMCTTTEVKCREHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            AKHPK D+  CFPH++K
Sbjct  61   AKHPKHDITACFPHIQK  77



>gb|KJB79433.1| hypothetical protein B456_013G049400 [Gossypium raimondii]
Length=78

 Score =   140 bits (352),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/78 (87%), Positives = 72/78 (92%), Gaps = 1/78 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGA-KGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGN QKSKMARE+NLEK K A KGSQLDSNKKAM IQCKVCMQTF+CTT+EVKCREHA
Sbjct  1    MGGGNAQKSKMAREKNLEKQKAAAKGSQLDSNKKAMTIQCKVCMQTFICTTTEVKCREHA  60

Query  233  EAKHPKSDVGTCFPHLKK  286
            EAKHPKSD+ TCFPHLKK
Sbjct  61   EAKHPKSDLYTCFPHLKK  78



>gb|KJB32277.1| hypothetical protein B456_005G232900 [Gossypium raimondii]
Length=78

 Score =   140 bits (352),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/78 (88%), Positives = 73/78 (94%), Gaps = 1/78 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGA-KGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGNGQKSKMARE+NLEK K A KGSQL+SNKKAM+IQCKVCMQTFMCTT+EVKCREHA
Sbjct  1    MGGGNGQKSKMAREKNLEKQKAAGKGSQLESNKKAMSIQCKVCMQTFMCTTTEVKCREHA  60

Query  233  EAKHPKSDVGTCFPHLKK  286
            EAKHPKSDV  CFPHLKK
Sbjct  61   EAKHPKSDVYACFPHLKK  78



>ref|XP_011028890.1| PREDICTED: uncharacterized protein At2g23090-like [Populus euphratica]
Length=78

 Score =   140 bits (352),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/78 (87%), Positives = 74/78 (95%), Gaps = 1/78 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGA-KGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGNGQK+KMARE+NLEK K A KGSQL+SNKKAM+IQCKVCMQTF+CTTSEVKCREHA
Sbjct  1    MGGGNGQKAKMAREKNLEKQKAASKGSQLESNKKAMSIQCKVCMQTFICTTSEVKCREHA  60

Query  233  EAKHPKSDVGTCFPHLKK  286
            EAKHPKSDV TCFPHL+K
Sbjct  61   EAKHPKSDVYTCFPHLQK  78



>emb|CAN62217.1| hypothetical protein VITISV_021844 [Vitis vinifera]
 emb|CBI19422.3| unnamed protein product [Vitis vinifera]
Length=78

 Score =   139 bits (351),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/78 (87%), Positives = 74/78 (95%), Gaps = 1/78 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNK-GAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGNGQKSKMARE+N+EK K  A+GSQL+SNKKAM+IQCKVCMQTF+CTTSEVKCREHA
Sbjct  1    MGGGNGQKSKMAREKNMEKQKNAARGSQLESNKKAMSIQCKVCMQTFICTTSEVKCREHA  60

Query  233  EAKHPKSDVGTCFPHLKK  286
            EAKHPKSDV TCFPHLKK
Sbjct  61   EAKHPKSDVYTCFPHLKK  78



>gb|ACU13253.1| unknown [Glycine max]
Length=78

 Score =   139 bits (351),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/78 (87%), Positives = 72/78 (92%), Gaps = 1/78 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGA-KGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGNGQK+KMARE+N+EK K A KGSQLDSNKKAM+IQCKVCMQTFMCTTSEVKCREHA
Sbjct  1    MGGGNGQKAKMAREKNIEKQKAASKGSQLDSNKKAMSIQCKVCMQTFMCTTSEVKCREHA  60

Query  233  EAKHPKSDVGTCFPHLKK  286
            EAKHPK DV  CFPHLKK
Sbjct  61   EAKHPKPDVYACFPHLKK  78



>emb|CDP01219.1| unnamed protein product [Coffea canephora]
Length=78

 Score =   139 bits (351),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/78 (88%), Positives = 73/78 (94%), Gaps = 1/78 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGA-KGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGNGQKSKMARERNLEK K A KGSQL++NKKAMNIQCKVCMQTFMCTTSEVKC+EHA
Sbjct  1    MGGGNGQKSKMARERNLEKMKNAGKGSQLETNKKAMNIQCKVCMQTFMCTTSEVKCKEHA  60

Query  233  EAKHPKSDVGTCFPHLKK  286
            EAKHPKSD+  CFPHLKK
Sbjct  61   EAKHPKSDLNACFPHLKK  78



>gb|AFY12046.1| drought responsive protein 2 [Saccharum hybrid cultivar SP80-3280]
Length=77

 Score =   139 bits (350),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQKSKMARERN EKNK AKGSQL++NKKAMNIQCKVCMQTF+CTTSE KC+EHAE
Sbjct  1    MGGGNGQKSKMARERNAEKNKAAKGSQLETNKKAMNIQCKVCMQTFICTTSEAKCKEHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            A+HPK+D+  CFPHLKK
Sbjct  61   ARHPKNDLYQCFPHLKK  77



>ref|XP_002284176.1| PREDICTED: uncharacterized protein At2g23090 [Vitis vinifera]
 emb|CBI33719.3| unnamed protein product [Vitis vinifera]
Length=77

 Score =   139 bits (350),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQKSK ARERN+EK K AKGSQL+SNKKAM IQCKVCMQTF+CTTSE KC+EHAE
Sbjct  1    MGGGNGQKSKTARERNMEKTKAAKGSQLESNKKAMTIQCKVCMQTFICTTSEAKCKEHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            AKHPKS++ TCFPHLKK
Sbjct  61   AKHPKSELSTCFPHLKK  77



>ref|XP_010099082.1| hypothetical protein L484_011517 [Morus notabilis]
 gb|EXB76671.1| hypothetical protein L484_011517 [Morus notabilis]
Length=77

 Score =   139 bits (350),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQK+KMARE+NLEK K  KGSQL+SNKKAM IQCKVCMQTFMCTT+EVKC EHAE
Sbjct  1    MGGGNGQKAKMAREKNLEKQKAVKGSQLESNKKAMTIQCKVCMQTFMCTTTEVKCWEHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            AKHPK+D+ TCFPHLKK
Sbjct  61   AKHPKADLFTCFPHLKK  77



>ref|XP_011069786.1| PREDICTED: uncharacterized protein At2g23090-like [Sesamum indicum]
Length=77

 Score =   139 bits (350),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQKS+MARERN+EK K  KGSQL+SNKKAMNIQCKVCMQTF+CTTSEVKC+EHAE
Sbjct  1    MGGGNGQKSRMARERNMEKLKAPKGSQLESNKKAMNIQCKVCMQTFICTTSEVKCKEHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            AKHPK+D+  CFPHLKK
Sbjct  61   AKHPKADLYACFPHLKK  77



>gb|ACU16633.1| unknown [Glycine max]
Length=77

 Score =   139 bits (349),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQK+KMARERN+EKNK AKGSQL+++KKAMNIQCKVCMQTF+CTTSEVKCREHAE
Sbjct  1    MGGGNGQKAKMARERNMEKNKPAKGSQLEASKKAMNIQCKVCMQTFICTTSEVKCREHAE  60

Query  236  AKHPKSDVGTCFPHLK  283
            AKHPK+ + TCFPHLK
Sbjct  61   AKHPKAHLYTCFPHLK  76



>ref|XP_010087302.1| hypothetical protein L484_009435 [Morus notabilis]
 gb|EXB28749.1| hypothetical protein L484_009435 [Morus notabilis]
Length=78

 Score =   139 bits (349),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/78 (88%), Positives = 71/78 (91%), Gaps = 1/78 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGA-KGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGN QKSKMARE+NLEK K A KGSQLDSNKKAM IQCKVCMQTFMCTTSEVKC+EHA
Sbjct  1    MGGGNAQKSKMAREKNLEKQKAAGKGSQLDSNKKAMTIQCKVCMQTFMCTTSEVKCKEHA  60

Query  233  EAKHPKSDVGTCFPHLKK  286
            EAKHPKSDV  CFPHLKK
Sbjct  61   EAKHPKSDVCVCFPHLKK  78



>ref|XP_002302417.1| hypothetical protein POPTR_0002s12100g [Populus trichocarpa]
 ref|XP_011017134.1| PREDICTED: uncharacterized protein At2g23090 [Populus euphratica]
 gb|ABK93237.1| unknown [Populus trichocarpa]
 gb|EEE81690.1| hypothetical protein POPTR_0002s12100g [Populus trichocarpa]
Length=78

 Score =   139 bits (349),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 74/78 (95%), Gaps = 1/78 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNK-GAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGNGQK+KMARERNL+K K G+KGSQL++NKKAM+IQCKVCMQTF+CTTSEVKCREHA
Sbjct  1    MGGGNGQKAKMARERNLDKQKAGSKGSQLEANKKAMSIQCKVCMQTFICTTSEVKCREHA  60

Query  233  EAKHPKSDVGTCFPHLKK  286
            EAKHPKSDV  CFPHLKK
Sbjct  61   EAKHPKSDVYACFPHLKK  78



>ref|XP_006426050.1| hypothetical protein CICLE_v10026876mg [Citrus clementina]
 ref|XP_006466490.1| PREDICTED: uncharacterized protein At2g23090-like [Citrus sinensis]
 gb|ESR39290.1| hypothetical protein CICLE_v10026876mg [Citrus clementina]
 gb|KDO78984.1| hypothetical protein CISIN_1g034948mg [Citrus sinensis]
Length=78

 Score =   139 bits (349),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 73/78 (94%), Gaps = 1/78 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGA-KGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGNGQK+KMARE+NLEK K A KGSQL++NKKAM+IQCKVCMQTFMCTTSEVKCREHA
Sbjct  1    MGGGNGQKAKMAREKNLEKQKAANKGSQLETNKKAMSIQCKVCMQTFMCTTSEVKCREHA  60

Query  233  EAKHPKSDVGTCFPHLKK  286
            EAKHPKSD+  CFPHLKK
Sbjct  61   EAKHPKSDIYACFPHLKK  78



>ref|XP_004141881.1| PREDICTED: uncharacterized protein At2g23090-like [Cucumis sativus]
 gb|KGN48591.1| hypothetical protein Csa_6G494960 [Cucumis sativus]
Length=78

 Score =   138 bits (348),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 68/78 (87%), Positives = 74/78 (95%), Gaps = 1/78 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGA-KGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGNGQKSKMARE+N+EK K A KGSQL++NKKAM+IQCKVCMQTF+CTTSEVKCREHA
Sbjct  1    MGGGNGQKSKMAREKNMEKLKAASKGSQLEANKKAMSIQCKVCMQTFICTTSEVKCREHA  60

Query  233  EAKHPKSDVGTCFPHLKK  286
            EAKHPKSDV TCFPHLKK
Sbjct  61   EAKHPKSDVHTCFPHLKK  78



>ref|XP_008792663.1| PREDICTED: uncharacterized protein At2g23090-like [Phoenix dactylifera]
Length=77

 Score =   138 bits (347),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 66/77 (86%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQKSKMAR+++LEKNK  KGSQL+SNKKAM+IQCKVCMQTF+CTTSEVKCREHAE
Sbjct  1    MGGGNGQKSKMARDKHLEKNKLPKGSQLESNKKAMSIQCKVCMQTFICTTSEVKCREHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            AKHPKSD+  CFPHLKK
Sbjct  61   AKHPKSDLYQCFPHLKK  77



>gb|KJB48665.1| hypothetical protein B456_008G080400 [Gossypium raimondii]
 gb|KJB48666.1| hypothetical protein B456_008G080400 [Gossypium raimondii]
Length=78

 Score =   138 bits (347),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 68/78 (87%), Positives = 71/78 (91%), Gaps = 1/78 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNK-GAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGN QKSK ARERNLEK K GAKGSQL+SNKKAM+IQC+VCMQ FMCTTSEVKCREHA
Sbjct  1    MGGGNAQKSKTARERNLEKAKAGAKGSQLESNKKAMSIQCRVCMQAFMCTTSEVKCREHA  60

Query  233  EAKHPKSDVGTCFPHLKK  286
            EAKHPKSDV  CFPHLKK
Sbjct  61   EAKHPKSDVYACFPHLKK  78



>ref|XP_003524686.1| PREDICTED: uncharacterized protein At2g23090 [Glycine max]
 gb|ACU14952.1| unknown [Glycine max]
 gb|KHN06010.1| Hypothetical protein glysoja_031959 [Glycine soja]
Length=78

 Score =   138 bits (347),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 72/78 (92%), Gaps = 1/78 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGA-KGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGN QKSKMARE+NLEK K A KGSQLDSNKKAM+IQCKVCMQTF+CTTSEVKC+EHA
Sbjct  1    MGGGNAQKSKMAREKNLEKQKAAAKGSQLDSNKKAMSIQCKVCMQTFICTTSEVKCKEHA  60

Query  233  EAKHPKSDVGTCFPHLKK  286
            EAKHPKSD+  CFPHLKK
Sbjct  61   EAKHPKSDLYVCFPHLKK  78



>ref|XP_010939767.1| PREDICTED: uncharacterized protein At2g23090-like [Elaeis guineensis]
Length=77

 Score =   138 bits (347),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 66/77 (86%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQKSK ARER++EKNK  KGSQL+SNKKAM IQCKVCMQTF+CTTSEVKCREHAE
Sbjct  1    MGGGNGQKSKTARERHMEKNKPPKGSQLESNKKAMTIQCKVCMQTFICTTSEVKCREHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            AKHPKSD+  CFPHLKK
Sbjct  61   AKHPKSDLYQCFPHLKK  77



>ref|XP_002459234.1| hypothetical protein SORBIDRAFT_02g001100 [Sorghum bicolor]
 gb|ABB03718.1| hypothetical protein [Sorghum bicolor]
 gb|EER95755.1| hypothetical protein SORBIDRAFT_02g001100 [Sorghum bicolor]
Length=77

 Score =   138 bits (347),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQKSKMARERN EKNKG+KGSQL++NKKAMNIQCK+CMQTF+CTTSE KC+EHAE
Sbjct  1    MGGGNGQKSKMARERNAEKNKGSKGSQLETNKKAMNIQCKICMQTFICTTSEAKCKEHAE  60

Query  236  AKHPKSDVGTCFPHLK  283
            A+HPK+D+  CFPHLK
Sbjct  61   ARHPKNDLYQCFPHLK  76



>ref|XP_009603270.1| PREDICTED: uncharacterized protein At2g23090-like [Nicotiana 
tomentosiformis]
 ref|XP_009791057.1| PREDICTED: uncharacterized protein At2g23090-like [Nicotiana 
sylvestris]
Length=77

 Score =   138 bits (347),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQK+KMARE+N EK KG KGSQL++NKKAM+IQCKVCMQTF+CTTSEVKCREHAE
Sbjct  1    MGGGNGQKAKMAREKNAEKMKGQKGSQLEANKKAMSIQCKVCMQTFICTTSEVKCREHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            AKHPK+DV  CFPHLKK
Sbjct  61   AKHPKADVYACFPHLKK  77



>ref|XP_002533162.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29221.1| conserved hypothetical protein [Ricinus communis]
Length=78

 Score =   138 bits (347),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 67/77 (87%), Positives = 72/77 (94%), Gaps = 1/77 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGA-KGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGNGQK+KMARE+NLEK K A KGSQL+SNKKAMNIQCKVCMQTFMCTTSEVKCREHA
Sbjct  1    MGGGNGQKAKMAREKNLEKQKAAAKGSQLESNKKAMNIQCKVCMQTFMCTTSEVKCREHA  60

Query  233  EAKHPKSDVGTCFPHLK  283
            EAKHPKS++  CFPHLK
Sbjct  61   EAKHPKSELYACFPHLK  77



>ref|XP_004290956.1| PREDICTED: uncharacterized protein At2g23090-like [Fragaria vesca 
subsp. vesca]
Length=77

 Score =   137 bits (346),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 66/77 (86%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQKSK AR RNLEK K AKGSQLDSNKKAM IQCKVCMQ F+CTT+EVKCREHAE
Sbjct  1    MGGGNGQKSKTARLRNLEKQKPAKGSQLDSNKKAMTIQCKVCMQAFICTTTEVKCREHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            AKHPKSDV  CFPHL+K
Sbjct  61   AKHPKSDVYACFPHLQK  77



>gb|ABK21925.1| unknown [Picea sitchensis]
Length=77

 Score =   137 bits (346),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQK+KMARE+N EKNK  KGSQL++NKKAM+IQCKVCMQTF+CTTSEVKCREHAE
Sbjct  1    MGGGNGQKAKMAREKNNEKNKAPKGSQLETNKKAMSIQCKVCMQTFICTTSEVKCREHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            AKHPK+DV  CFPHLKK
Sbjct  61   AKHPKADVYQCFPHLKK  77



>ref|XP_008440357.1| PREDICTED: uncharacterized protein At2g23090 [Cucumis melo]
Length=78

 Score =   137 bits (346),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 74/78 (95%), Gaps = 1/78 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGA-KGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGNGQKSKMARE+N+EK K + KGSQL++NKKAM+IQCKVCMQTF+CTTSEVKCREHA
Sbjct  1    MGGGNGQKSKMAREKNMEKLKASSKGSQLEANKKAMSIQCKVCMQTFICTTSEVKCREHA  60

Query  233  EAKHPKSDVGTCFPHLKK  286
            EAKHPKSDV TCFPHLKK
Sbjct  61   EAKHPKSDVYTCFPHLKK  78



>dbj|BAH97744.1| hypothetical protein [Hypochaeris radicata]
Length=78

 Score =   137 bits (346),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 72/78 (92%), Gaps = 1/78 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGA-KGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGN QKSKMARE+NLEK K A KGSQL++NKKAMNIQCKVCMQTF+CTTSEVKCREHA
Sbjct  1    MGGGNAQKSKMAREKNLEKAKAAGKGSQLEANKKAMNIQCKVCMQTFICTTSEVKCREHA  60

Query  233  EAKHPKSDVGTCFPHLKK  286
            EAKHPK+DV  CFPHLKK
Sbjct  61   EAKHPKADVYACFPHLKK  78



>gb|KHG08477.1| hypothetical protein F383_15108 [Gossypium arboreum]
Length=77

 Score =   137 bits (345),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQKS+MARE+++EKNK  KGSQL+SNKKAM IQCKVCMQTF+CTTSEVKC+EHAE
Sbjct  1    MGGGNGQKSRMAREKHMEKNKPTKGSQLESNKKAMTIQCKVCMQTFICTTSEVKCKEHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            AKHPKSD+  CFPHLKK
Sbjct  61   AKHPKSDIFACFPHLKK  77



>ref|XP_010277101.1| PREDICTED: uncharacterized protein At2g23090-like [Nelumbo nucifera]
Length=77

 Score =   137 bits (345),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQKS+MARE++ EK K  KGSQL+SNKKAM IQCKVCMQTF+CTTSEVKCREHAE
Sbjct  1    MGGGNGQKSRMAREKHSEKMKAPKGSQLESNKKAMTIQCKVCMQTFICTTSEVKCREHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            AKHPKSD+ TCFPHLKK
Sbjct  61   AKHPKSDIYTCFPHLKK  77



>gb|ACG30543.1| hypothetical protein [Zea mays]
Length=77

 Score =   137 bits (345),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQKSKMARERN EKNKG KGSQL++NKKAMNIQCK+CMQTF+CTTSE KC+EHAE
Sbjct  1    MGGGNGQKSKMARERNAEKNKGGKGSQLEANKKAMNIQCKICMQTFICTTSEAKCKEHAE  60

Query  236  AKHPKSDVGTCFPHLK  283
            A+HPK+D+  CFPHLK
Sbjct  61   ARHPKNDLYQCFPHLK  76



>ref|XP_002298765.1| hypothetical protein POPTR_0001s30380g [Populus trichocarpa]
 gb|EEE83570.1| hypothetical protein POPTR_0001s30380g [Populus trichocarpa]
Length=84

 Score =   137 bits (345),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQKSKMARERN+EK K AK SQL+SNKKAM IQCKVCMQTF+CTT+EVKCREHAE
Sbjct  1    MGGGNGQKSKMARERNIEKQKAAKRSQLESNKKAMTIQCKVCMQTFICTTTEVKCREHAE  60

Query  236  AKHPKSDVGTCFPHLK  283
            AKH KSDV  CFPHLK
Sbjct  61   AKHAKSDVYACFPHLK  76



>ref|XP_008220309.1| PREDICTED: uncharacterized protein At2g23090-like [Prunus mume]
Length=78

 Score =   137 bits (345),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 72/78 (92%), Gaps = 1/78 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGA-KGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGNGQKSKMAR+RN+EK K A KGSQL+SNKK+M IQCKVCMQ F+CTTSEVKCREHA
Sbjct  1    MGGGNGQKSKMARQRNMEKQKAAAKGSQLESNKKSMTIQCKVCMQVFICTTSEVKCREHA  60

Query  233  EAKHPKSDVGTCFPHLKK  286
            EAKHPKSDV TCFPHL+K
Sbjct  61   EAKHPKSDVYTCFPHLQK  78



>gb|KHN42328.1| Hypothetical protein glysoja_020040 [Glycine soja]
Length=77

 Score =   137 bits (344),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQK+KMARERN+EKNK AKGSQL++NKKAMNIQCK CMQTF+CTTSEVKCREHAE
Sbjct  1    MGGGNGQKAKMARERNMEKNKPAKGSQLEANKKAMNIQCKGCMQTFICTTSEVKCREHAE  60

Query  236  AKHPKSDVGTCFPHLK  283
            AKHPK+ + TCFPHLK
Sbjct  61   AKHPKAHLYTCFPHLK  76



>gb|KJB18003.1| hypothetical protein B456_003G028800 [Gossypium raimondii]
Length=78

 Score =   137 bits (344),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 71/78 (91%), Gaps = 1/78 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNK-GAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGN QKSKMARE+NLEK K  AKGSQL++NKKAM IQCKVCMQTF+CTTSEVKCREHA
Sbjct  1    MGGGNAQKSKMAREKNLEKAKNAAKGSQLETNKKAMTIQCKVCMQTFICTTSEVKCREHA  60

Query  233  EAKHPKSDVGTCFPHLKK  286
            EAKHPKSDV  CFPHLKK
Sbjct  61   EAKHPKSDVYACFPHLKK  78



>ref|XP_008393751.1| PREDICTED: uncharacterized protein At2g23090-like [Malus domestica]
 ref|XP_008365103.1| PREDICTED: uncharacterized protein At2g23090-like [Malus domestica]
Length=78

 Score =   137 bits (344),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 72/78 (92%), Gaps = 1/78 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNK-GAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGNGQKSKMAR+RN+EK K  AKGSQL+SNKK+M IQCKVCMQ F+CTTSEVKCREHA
Sbjct  1    MGGGNGQKSKMARQRNMEKQKNAAKGSQLESNKKSMTIQCKVCMQVFICTTSEVKCREHA  60

Query  233  EAKHPKSDVGTCFPHLKK  286
            EAKHPKSDV TCFPHL+K
Sbjct  61   EAKHPKSDVYTCFPHLQK  78



>dbj|BAJ93722.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS50701.1| hypothetical protein TRIUR3_26862 [Triticum urartu]
 gb|EMT10092.1| hypothetical protein F775_30559 [Aegilops tauschii]
Length=77

 Score =   137 bits (344),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGN QKSKMARERNLEK KG KGSQL++NKKAMNIQCK+CMQTF+CTTSE KC+EHAE
Sbjct  1    MGGGNAQKSKMARERNLEKLKGGKGSQLEANKKAMNIQCKICMQTFICTTSEAKCKEHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            AKHPKSD+  CFPHLK+
Sbjct  61   AKHPKSDLVQCFPHLKQ  77



>gb|EYU44471.1| hypothetical protein MIMGU_mgv1a017387mg [Erythranthe guttata]
Length=78

 Score =   137 bits (344),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 72/78 (92%), Gaps = 1/78 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGA-KGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGN QK+KMARE+NLEK+K A KGSQLD+NKKAM IQCKVCMQTFMCTTSEVKCREHA
Sbjct  1    MGGGNAQKAKMAREKNLEKSKAAGKGSQLDTNKKAMTIQCKVCMQTFMCTTSEVKCREHA  60

Query  233  EAKHPKSDVGTCFPHLKK  286
            EAKHPK+DV  CFPHL+K
Sbjct  61   EAKHPKADVFACFPHLQK  78



>ref|XP_003550020.1| PREDICTED: uncharacterized protein At2g23090 [Glycine max]
 gb|ACU13731.1| unknown [Glycine max]
 gb|KHN28327.1| Hypothetical protein glysoja_043492 [Glycine soja]
Length=78

 Score =   137 bits (344),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 72/78 (92%), Gaps = 1/78 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGA-KGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGN QKSKMARE+NLEK + A KGSQLDSNKKAM+IQCKVCMQTF+CTTSEVKC+EHA
Sbjct  1    MGGGNAQKSKMAREKNLEKQRAAAKGSQLDSNKKAMSIQCKVCMQTFICTTSEVKCKEHA  60

Query  233  EAKHPKSDVGTCFPHLKK  286
            EAKHPKSD+  CFPHLKK
Sbjct  61   EAKHPKSDLHVCFPHLKK  78



>ref|XP_004141882.1| PREDICTED: uncharacterized protein At2g23090-like [Cucumis sativus]
 ref|XP_004163834.1| PREDICTED: uncharacterized protein At2g23090-like [Cucumis sativus]
Length=78

 Score =   136 bits (343),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 73/78 (94%), Gaps = 1/78 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGA-KGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGNGQKSKMARE+N+EK K A KG QL++NKKAM+IQCKVCMQTF+CTTSEVKCREHA
Sbjct  1    MGGGNGQKSKMAREKNMEKLKAASKGDQLEANKKAMSIQCKVCMQTFICTTSEVKCREHA  60

Query  233  EAKHPKSDVGTCFPHLKK  286
            EAKHPKSDV TCFPHLKK
Sbjct  61   EAKHPKSDVHTCFPHLKK  78



>ref|XP_010272075.1| PREDICTED: uncharacterized protein At2g23090-like [Nelumbo nucifera]
Length=77

 Score =   136 bits (343),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQKS+MARE++L+K K  KGSQL+SNKKAM IQCKVCMQTF+CTTSEVKC+EHAE
Sbjct  1    MGGGNGQKSRMAREKHLDKMKAPKGSQLESNKKAMTIQCKVCMQTFICTTSEVKCKEHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            AKHPKSD+ TCFPHLKK
Sbjct  61   AKHPKSDLYTCFPHLKK  77



>ref|XP_004509083.1| PREDICTED: uncharacterized protein At2g23090-like [Cicer arietinum]
 emb|CAA10129.1| hypothetical protein [Cicer arietinum]
Length=78

 Score =   136 bits (343),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 72/78 (92%), Gaps = 1/78 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGA-KGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGNGQK+KMARERNLEK K A KGSQL++NKKAM+IQCKVCMQTF+CTTSEVKCREHA
Sbjct  1    MGGGNGQKAKMARERNLEKQKNAGKGSQLETNKKAMSIQCKVCMQTFICTTSEVKCREHA  60

Query  233  EAKHPKSDVGTCFPHLKK  286
            EAKHPKSDV  CFPHL K
Sbjct  61   EAKHPKSDVLVCFPHLNK  78



>ref|XP_007042599.1| Leucine-rich repeat family protein [Theobroma cacao]
 gb|EOX98430.1| Leucine-rich repeat family protein [Theobroma cacao]
Length=326

 Score =   143 bits (360),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 70/78 (90%), Positives = 73/78 (94%), Gaps = 1/78 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNK-GAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGNGQKSKMARE+N+EK K GAKGSQL+SNKKAM IQCKVCMQTFMCTTSEVKCREHA
Sbjct  1    MGGGNGQKSKMAREKNMEKQKAGAKGSQLESNKKAMTIQCKVCMQTFMCTTSEVKCREHA  60

Query  233  EAKHPKSDVGTCFPHLKK  286
            EAKHPKSDV  CFPHLKK
Sbjct  61   EAKHPKSDVYMCFPHLKK  78



>ref|XP_002510116.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52303.1| conserved hypothetical protein [Ricinus communis]
Length=78

 Score =   136 bits (342),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 72/78 (92%), Gaps = 1/78 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGA-KGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGNGQK+K ARERN+EK K A KGSQL+SNKKAM+IQCKVCMQTF+CTTSEVKCREHA
Sbjct  1    MGGGNGQKAKTARERNMEKQKAAAKGSQLESNKKAMSIQCKVCMQTFICTTSEVKCREHA  60

Query  233  EAKHPKSDVGTCFPHLKK  286
            EAKHPKSD+  CFPHLKK
Sbjct  61   EAKHPKSDLFVCFPHLKK  78



>gb|KDP32048.1| hypothetical protein JCGZ_12509 [Jatropha curcas]
Length=78

 Score =   136 bits (342),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 72/78 (92%), Gaps = 1/78 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGA-KGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGNGQK+KMARE++LEK K A KGSQL++NKKAMNIQCKVCMQTFMCTTSEVKCREHA
Sbjct  1    MGGGNGQKAKMAREKHLEKQKAANKGSQLETNKKAMNIQCKVCMQTFMCTTSEVKCREHA  60

Query  233  EAKHPKSDVGTCFPHLKK  286
            EAKHPKSD   CFPHLKK
Sbjct  61   EAKHPKSDPYACFPHLKK  78



>ref|XP_006433614.1| hypothetical protein CICLE_v10003025mg [Citrus clementina]
 ref|XP_006472280.1| PREDICTED: uncharacterized protein At2g23090-like [Citrus sinensis]
 gb|ESR46854.1| hypothetical protein CICLE_v10003025mg [Citrus clementina]
 gb|KDO81555.1| hypothetical protein CISIN_1g034932mg [Citrus sinensis]
Length=78

 Score =   135 bits (341),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 74/78 (95%), Gaps = 1/78 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGA-KGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGNGQKSKMARE+N+EK + A KGSQL+SNKKAM+IQCKVCMQTF+CTTSEVKC+EHA
Sbjct  1    MGGGNGQKSKMAREKNMEKQRAAGKGSQLESNKKAMSIQCKVCMQTFICTTSEVKCKEHA  60

Query  233  EAKHPKSDVGTCFPHLKK  286
            EA+HPKSD+ TCFPHLKK
Sbjct  61   EARHPKSDLFTCFPHLKK  78



>ref|XP_003557668.1| PREDICTED: uncharacterized protein At2g23090 [Brachypodium distachyon]
Length=77

 Score =   135 bits (341),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGN QKSKMARERNLEK KG KGSQL++NKKAMNIQCK+CMQTF+CTTSE KC+EHAE
Sbjct  1    MGGGNAQKSKMARERNLEKLKGGKGSQLEANKKAMNIQCKICMQTFICTTSEAKCKEHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            AKHPKS++  CFPHLK+
Sbjct  61   AKHPKSELTQCFPHLKQ  77



>gb|ABK20935.1| unknown [Picea sitchensis]
 gb|ABK24978.1| unknown [Picea sitchensis]
Length=77

 Score =   135 bits (340),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQK+K ARERNLEK K A+GSQL++NKKAM IQCKVCMQTF+CTT+EVKCREHAE
Sbjct  1    MGGGNGQKAKTARERNLEKMKCARGSQLETNKKAMTIQCKVCMQTFICTTTEVKCREHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            AKHPK+D+  CFPHLKK
Sbjct  61   AKHPKADIYQCFPHLKK  77



>ref|XP_008651947.1| PREDICTED: uncharacterized protein At2g23090 [Zea mays]
 gb|ACG28009.1| hypothetical protein [Zea mays]
 gb|ACG31193.1| hypothetical protein [Zea mays]
Length=77

 Score =   135 bits (340),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGN QKSKMARERN EKNKG KGSQL++NKKAMNIQCK+CMQTF+CTTSE KC+EHAE
Sbjct  1    MGGGNAQKSKMARERNAEKNKGGKGSQLEANKKAMNIQCKICMQTFICTTSEAKCKEHAE  60

Query  236  AKHPKSDVGTCFPHLK  283
            A+HPK+D+  CFPHLK
Sbjct  61   ARHPKNDLYQCFPHLK  76



>gb|AFK39948.1| unknown [Lotus japonicus]
Length=77

 Score =   135 bits (339),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQK++MARE+++EK K AKGSQL++NKKAM IQCKVCMQTF+CTTSEVKCREHAE
Sbjct  1    MGGGNGQKARMAREKHMEKLKSAKGSQLETNKKAMTIQCKVCMQTFICTTSEVKCREHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            AKHPK+D+  CFPHLKK
Sbjct  61   AKHPKADLYACFPHLKK  77



>ref|XP_007047475.1| Uncharacterized protein TCM_000756 [Theobroma cacao]
 gb|EOX91632.1| Uncharacterized protein TCM_000756 [Theobroma cacao]
Length=78

 Score =   135 bits (339),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 73/78 (94%), Gaps = 1/78 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGA-KGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGNGQKSKMARE++LEK K A KGSQL++NKKAM+IQCKVCMQTFMCTTSEVKC+EHA
Sbjct  1    MGGGNGQKSKMAREKHLEKAKAAGKGSQLETNKKAMSIQCKVCMQTFMCTTSEVKCKEHA  60

Query  233  EAKHPKSDVGTCFPHLKK  286
            EAKHPKSD+  CFPHLKK
Sbjct  61   EAKHPKSDLYACFPHLKK  78



>ref|XP_002984923.1| hypothetical protein SELMODRAFT_181308 [Selaginella moellendorffii]
 ref|XP_002985976.1| hypothetical protein SELMODRAFT_157702 [Selaginella moellendorffii]
 gb|EFJ13153.1| hypothetical protein SELMODRAFT_157702 [Selaginella moellendorffii]
 gb|EFJ14173.1| hypothetical protein SELMODRAFT_181308 [Selaginella moellendorffii]
Length=78

 Score =   135 bits (339),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 70/77 (91%), Gaps = 1/77 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGA-KGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGN QKSKMAR+RNLEK K + KGSQLDSNKKAMNIQCK+CMQTFMCTTSEVKC+EHA
Sbjct  1    MGGGNAQKSKMARDRNLEKAKASGKGSQLDSNKKAMNIQCKICMQTFMCTTSEVKCKEHA  60

Query  233  EAKHPKSDVGTCFPHLK  283
            EAKHPK D+  CFPHLK
Sbjct  61   EAKHPKVDLHACFPHLK  77



>ref|XP_009342787.1| PREDICTED: uncharacterized protein At2g23090-like, partial [Pyrus 
x bretschneideri]
Length=125

 Score =   136 bits (342),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 73/82 (89%), Gaps = 1/82 (1%)
 Frame = +2

Query  44   ISEIMGGGNGQKSKMARERNLEKNKGA-KGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKC  220
            + + MGGGNGQK+KMARE+NLEK K A KGSQL +N+KAM+IQCKVCMQ FMCTTSEVKC
Sbjct  44   LPDAMGGGNGQKAKMAREKNLEKQKAAGKGSQLKTNEKAMSIQCKVCMQAFMCTTSEVKC  103

Query  221  REHAEAKHPKSDVGTCFPHLKK  286
            REHAEAKHPKSDV  CFPHLKK
Sbjct  104  REHAEAKHPKSDVYACFPHLKK  125



>ref|XP_007207398.1| hypothetical protein PRUPE_ppa014253mg [Prunus persica]
 ref|XP_008238318.1| PREDICTED: uncharacterized protein At2g23090 [Prunus mume]
 ref|XP_008338413.1| PREDICTED: uncharacterized protein At2g23090 [Malus domestica]
 ref|XP_009336057.1| PREDICTED: uncharacterized protein At2g23090 [Pyrus x bretschneideri]
 ref|XP_009349834.1| PREDICTED: uncharacterized protein At2g23090 [Pyrus x bretschneideri]
 gb|EMJ08597.1| hypothetical protein PRUPE_ppa014253mg [Prunus persica]
Length=78

 Score =   134 bits (338),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 71/78 (91%), Gaps = 1/78 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGA-KGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGNGQK+KMARE+NLEK K A KGSQL +N+KAM+IQCKVCMQ FMCTTSEVKCREHA
Sbjct  1    MGGGNGQKAKMAREKNLEKQKAAGKGSQLKTNEKAMSIQCKVCMQAFMCTTSEVKCREHA  60

Query  233  EAKHPKSDVGTCFPHLKK  286
            EAKHPKSDV  CFPHLKK
Sbjct  61   EAKHPKSDVYACFPHLKK  78



>ref|XP_010531293.1| PREDICTED: uncharacterized protein At2g23090 [Tarenaya hassleriana]
Length=78

 Score =   134 bits (338),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 71/78 (91%), Gaps = 1/78 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGA-KGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGN QKSKMARE+NLEK K A KGSQL+ NKKAM+IQCKVCMQTFMCTT+EVKCREHA
Sbjct  1    MGGGNAQKSKMAREKNLEKQKAAGKGSQLEMNKKAMSIQCKVCMQTFMCTTTEVKCREHA  60

Query  233  EAKHPKSDVGTCFPHLKK  286
            EAKHPKSD+  CFPHLKK
Sbjct  61   EAKHPKSDLFACFPHLKK  78



>ref|XP_011030366.1| PREDICTED: somatic embryogenesis receptor kinase 1-like [Populus 
euphratica]
Length=327

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQKSKMARERN+EK K AKGSQL+SNKKAM IQCKVCMQTF+CTT+EVKCREHAE
Sbjct  1    MGGGNGQKSKMARERNIEKQKAAKGSQLESNKKAMTIQCKVCMQTFICTTTEVKCREHAE  60

Query  236  AKHPKSDVGTCFPHLK  283
            AKH KSDV  CFPHLK
Sbjct  61   AKHAKSDVYACFPHLK  76



>ref|XP_007226104.1| hypothetical protein PRUPE_ppa014256mg [Prunus persica]
 gb|EMJ27303.1| hypothetical protein PRUPE_ppa014256mg [Prunus persica]
Length=78

 Score =   134 bits (337),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 71/78 (91%), Gaps = 1/78 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGA-KGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGNGQKSKMAR+RN+EK K A KGSQL+SNKK+M IQCKVCMQ F+CTTSEVKCREHA
Sbjct  1    MGGGNGQKSKMARQRNMEKQKAAAKGSQLESNKKSMTIQCKVCMQVFICTTSEVKCREHA  60

Query  233  EAKHPKSDVGTCFPHLKK  286
            EAKHPKSDV TCFP L+K
Sbjct  61   EAKHPKSDVYTCFPRLQK  78



>ref|XP_009623383.1| PREDICTED: uncharacterized protein At2g23090-like [Nicotiana 
tomentosiformis]
Length=77

 Score =   134 bits (337),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGN QK+KMARE+NLEK+K +KGSQ D+NKKAM+IQCKV MQTFMCTTSEVKC+EHAE
Sbjct  1    MGGGNSQKAKMAREKNLEKSKASKGSQHDTNKKAMSIQCKVSMQTFMCTTSEVKCKEHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            AKHPKSD+  CFPHLKK
Sbjct  61   AKHPKSDLYACFPHLKK  77



>ref|XP_004955338.1| PREDICTED: uncharacterized protein At2g23090-like isoform X1 
[Setaria italica]
Length=77

 Score =   134 bits (336),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQK+KMARERN EKNKG KGSQL++NKKAMN+QCK+CMQTF+CTTSE KC+EHAE
Sbjct  1    MGGGNGQKAKMARERNAEKNKGPKGSQLEANKKAMNMQCKICMQTFICTTSEAKCKEHAE  60

Query  236  AKHPKSDVGTCFPHLK  283
            A+HPK+D+  CFPHLK
Sbjct  61   ARHPKNDLFQCFPHLK  76



>ref|XP_010472307.1| PREDICTED: uncharacterized protein At2g23090 [Camelina sativa]
Length=78

 Score =   134 bits (336),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 71/78 (91%), Gaps = 1/78 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGA-KGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGN QKS MAR +NLEK K A KGSQL++NKKAM+IQCKVCMQTF+CTTSEVKCREHA
Sbjct  1    MGGGNAQKSAMARAKNLEKAKAAGKGSQLEANKKAMSIQCKVCMQTFICTTSEVKCREHA  60

Query  233  EAKHPKSDVGTCFPHLKK  286
            EAKHPK+DV TCFPHLKK
Sbjct  61   EAKHPKADVVTCFPHLKK  78



>ref|XP_006404774.1| hypothetical protein EUTSA_v10000409mg [Eutrema salsugineum]
 ref|XP_009117313.1| PREDICTED: uncharacterized protein At2g23090 [Brassica rapa]
 gb|ESQ46227.1| hypothetical protein EUTSA_v10000409mg [Eutrema salsugineum]
 emb|CDY49446.1| BnaA09g42210D [Brassica napus]
 emb|CDX76879.1| BnaC08g34650D [Brassica napus]
Length=78

 Score =   134 bits (336),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 72/78 (92%), Gaps = 1/78 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGA-KGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGN QKSKMARE+NLEK + A KGSQL++NKKAM+IQCKVCMQTF+CTTSEVKCREHA
Sbjct  1    MGGGNAQKSKMAREKNLEKARQAGKGSQLEANKKAMSIQCKVCMQTFICTTSEVKCREHA  60

Query  233  EAKHPKSDVGTCFPHLKK  286
            EAKHPK+DV  CFPHLKK
Sbjct  61   EAKHPKADVVACFPHLKK  78



>ref|XP_003608464.1| hypothetical protein MTR_4g095390 [Medicago truncatula]
 gb|AES90661.1| zinc-binding protein [Medicago truncatula]
 gb|AFK33725.1| unknown [Medicago truncatula]
Length=80

 Score =   134 bits (336),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 72/77 (94%), Gaps = 1/77 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGA-KGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGNGQK+KMARERNLEK K A KGSQL+ NKKAM+IQCKVCMQTF+CTTSEVKC+EHA
Sbjct  1    MGGGNGQKAKMARERNLEKQKQAGKGSQLEKNKKAMSIQCKVCMQTFICTTSEVKCKEHA  60

Query  233  EAKHPKSDVGTCFPHLK  283
            EA+HPKSD+ TCFPHLK
Sbjct  61   EARHPKSDLFTCFPHLK  77



>ref|XP_008340878.1| PREDICTED: uncharacterized protein At2g23090-like [Malus domestica]
Length=117

 Score =   134 bits (338),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 73/82 (89%), Gaps = 1/82 (1%)
 Frame = +2

Query  44   ISEIMGGGNGQKSKMARERNLEKNKGA-KGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKC  220
            + + MGGGNGQK+KMARE+NLEK K A KGSQL +N+KAM+IQCKVCMQ FMCTTSEVKC
Sbjct  36   LPDGMGGGNGQKAKMAREKNLEKQKAAGKGSQLKTNEKAMSIQCKVCMQAFMCTTSEVKC  95

Query  221  REHAEAKHPKSDVGTCFPHLKK  286
            REHAEAKHPKSDV  CFPHLKK
Sbjct  96   REHAEAKHPKSDVYACFPHLKK  117



>ref|XP_004234685.1| PREDICTED: uncharacterized protein At2g23090-like [Solanum lycopersicum]
Length=77

 Score =   133 bits (334),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGN QK+KM RE+ ++K KGAKGSQLD+NKKAM IQCKVCMQT +CTTSEVKC+EHAE
Sbjct  1    MGGGNSQKAKMTREKKIDKMKGAKGSQLDANKKAMYIQCKVCMQTIICTTSEVKCKEHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            +KHPKSD+ TCFPHLKK
Sbjct  61   SKHPKSDLATCFPHLKK  77



>ref|XP_004955339.1| PREDICTED: uncharacterized protein At2g23090-like isoform X2 
[Setaria italica]
Length=77

 Score =   132 bits (333),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQK+KMARERN EKNKG KGSQL++NKKAM++QCK+CMQTF+CTTSE KC+EHAE
Sbjct  1    MGGGNGQKAKMARERNAEKNKGPKGSQLEANKKAMSLQCKICMQTFICTTSEAKCKEHAE  60

Query  236  AKHPKSDVGTCFPHLK  283
            A+HPK+D+  CFPHLK
Sbjct  61   ARHPKNDLFQCFPHLK  76



>ref|XP_002880480.1| hypothetical protein ARALYDRAFT_481181 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56739.1| hypothetical protein ARALYDRAFT_481181 [Arabidopsis lyrata subsp. 
lyrata]
Length=78

 Score =   132 bits (333),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 70/78 (90%), Gaps = 1/78 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGA-KGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGN QKS MAR +NLEK K A KGSQL++NKKAM+IQCKVCMQTF+CTTSEVKCREHA
Sbjct  1    MGGGNAQKSAMARAKNLEKAKAAGKGSQLEANKKAMSIQCKVCMQTFICTTSEVKCREHA  60

Query  233  EAKHPKSDVGTCFPHLKK  286
            EAKHPK+DV  CFPHLKK
Sbjct  61   EAKHPKADVDACFPHLKK  78



>ref|XP_010417064.1| PREDICTED: uncharacterized protein At2g23090-like [Camelina sativa]
Length=128

 Score =   134 bits (337),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 70/78 (90%), Gaps = 1/78 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGA-KGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGN QKS MAR +NLEK K A KGSQL++NKKAM+IQCKVCMQTF+CTTSEVKCREHA
Sbjct  1    MGGGNAQKSAMARAKNLEKAKAAGKGSQLEANKKAMSIQCKVCMQTFICTTSEVKCREHA  60

Query  233  EAKHPKSDVGTCFPHLKK  286
            EAKHPK+DV  CFPHLKK
Sbjct  61   EAKHPKADVVACFPHLKK  78



>ref|XP_004288466.1| PREDICTED: uncharacterized protein At2g23090 [Fragaria vesca 
subsp. vesca]
Length=131

 Score =   134 bits (337),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 72/81 (89%), Gaps = 1/81 (1%)
 Frame = +2

Query  44   ISEIMGGGNGQKSKMARERNLEKNKGA-KGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKC  220
            I+  MGGGNGQK+KMARE+  EK K A KGSQL++NKKAM+IQCKVCMQTFMCTTSEVKC
Sbjct  50   IARAMGGGNGQKAKMAREKAQEKAKNAGKGSQLETNKKAMSIQCKVCMQTFMCTTSEVKC  109

Query  221  REHAEAKHPKSDVGTCFPHLK  283
            REHAEAKHPKSDV  CFPHLK
Sbjct  110  REHAEAKHPKSDVYACFPHLK  130



>ref|XP_009133992.1| PREDICTED: uncharacterized protein At2g23090-like [Brassica rapa]
 emb|CDY21477.1| BnaC03g27200D [Brassica napus]
 emb|CDX83201.1| BnaA03g23050D [Brassica napus]
Length=78

 Score =   132 bits (332),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 71/78 (91%), Gaps = 1/78 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGA-KGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGN QKSKMARE+NLEK + A KGSQL++NKKAM+IQCKVCMQTF+CTTSEVKCREHA
Sbjct  1    MGGGNAQKSKMAREKNLEKARQAGKGSQLEANKKAMSIQCKVCMQTFICTTSEVKCREHA  60

Query  233  EAKHPKSDVGTCFPHLKK  286
            EAKHPK+DV  CFPHL K
Sbjct  61   EAKHPKADVVACFPHLSK  78



>ref|NP_565547.1| uncharacterized protein [Arabidopsis thaliana]
 ref|XP_006295352.1| hypothetical protein CARUB_v10024443mg [Capsella rubella]
 sp|O64818.1|Y2309_ARATH RecName: Full=Uncharacterized protein At2g23090 [Arabidopsis 
thaliana]
 gb|AAC17825.1| Expressed protein [Arabidopsis thaliana]
 gb|AAK96535.1| At2g23090/F21P24.15 [Arabidopsis thaliana]
 gb|AAL08233.1| At2g23090/F21P24.15 [Arabidopsis thaliana]
 gb|AAM62542.1| unknown [Arabidopsis thaliana]
 gb|AAN28739.1| At2g23090/F21P24.15 [Arabidopsis thaliana]
 gb|AEC07407.1| uncharacterized protein AT2G23090 [Arabidopsis thaliana]
 gb|EOA28250.1| hypothetical protein CARUB_v10024443mg [Capsella rubella]
Length=78

 Score =   132 bits (332),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 70/78 (90%), Gaps = 1/78 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGA-KGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGN QKS MAR +NLEK K A KGSQL++NKKAM+IQCKVCMQTF+CTTSEVKCREHA
Sbjct  1    MGGGNAQKSAMARAKNLEKAKAAGKGSQLEANKKAMSIQCKVCMQTFICTTSEVKCREHA  60

Query  233  EAKHPKSDVGTCFPHLKK  286
            EAKHPK+DV  CFPHLKK
Sbjct  61   EAKHPKADVVACFPHLKK  78



>ref|XP_010429253.1| PREDICTED: uncharacterized protein At2g23090 [Camelina sativa]
Length=78

 Score =   132 bits (331),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 70/78 (90%), Gaps = 1/78 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGA-KGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGN QKS MAR +NLEK K A KGSQL++NKKAM+IQCKVCMQTF+CTTSEVKCREHA
Sbjct  1    MGGGNAQKSAMARAKNLEKAKSAGKGSQLEANKKAMSIQCKVCMQTFICTTSEVKCREHA  60

Query  233  EAKHPKSDVGTCFPHLKK  286
            EAKHPK+DV  CFPHLKK
Sbjct  61   EAKHPKADVVACFPHLKK  78



>gb|KFK32764.1| hypothetical protein AALP_AA6G285700 [Arabis alpina]
Length=79

 Score =   131 bits (329),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 70/76 (92%), Gaps = 1/76 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGA-KGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGN QKSKMARE+NLEK + A KGSQL++NKKAM+IQCKVCMQTF+CTTSEVKCREHA
Sbjct  1    MGGGNAQKSKMAREKNLEKARQAGKGSQLEANKKAMSIQCKVCMQTFICTTSEVKCREHA  60

Query  233  EAKHPKSDVGTCFPHL  280
            EAKHPK+DV  CFPHL
Sbjct  61   EAKHPKADVVACFPHL  76



>ref|XP_001762059.1| predicted protein [Physcomitrella patens]
 gb|EDQ73163.1| predicted protein [Physcomitrella patens]
Length=81

 Score =   130 bits (328),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGA-KGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGNGQK+KMARERN EK KGA KGSQL+SNKKAMN+QCKVCMQTFMCT++E KCREHA
Sbjct  1    MGGGNGQKAKMARERNAEKLKGAGKGSQLESNKKAMNLQCKVCMQTFMCTSNEAKCREHA  60

Query  233  EAKHPKSDVGTCFPHL  280
            EAKHPK DV  CFPHL
Sbjct  61   EAKHPKVDVTKCFPHL  76



>gb|EYU25501.1| hypothetical protein MIMGU_mgv1a017360mg [Erythranthe guttata]
Length=79

 Score =   130 bits (327),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 72/78 (92%), Gaps = 1/78 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNK-GAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGN QK+KMARE+NLEK K G KGSQLD+NKKAM+IQCK+CMQTF+CTTSE KC+EHA
Sbjct  1    MGGGNAQKAKMAREKNLEKLKAGGKGSQLDANKKAMSIQCKICMQTFICTTSEAKCKEHA  60

Query  233  EAKHPKSDVGTCFPHLKK  286
            EAKHPK+++ TCFPHLKK
Sbjct  61   EAKHPKAELLTCFPHLKK  78



>pdb|1WVK|A Chain A, Nmr Solution Structure Of The Partially Disordered Protein 
At2g23090 From Arabidopsis Thaliana
Length=86

 Score =   130 bits (326),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 70/79 (89%), Gaps = 1/79 (1%)
 Frame = +2

Query  53   IMGGGNGQKSKMARERNLEKNKGA-KGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREH  229
            + GGGN QKS MAR +NLEK K A KGSQL++NKKAM+IQCKVCMQTF+CTTSEVKCREH
Sbjct  8    LEGGGNAQKSAMARAKNLEKAKAAGKGSQLEANKKAMSIQCKVCMQTFICTTSEVKCREH  67

Query  230  AEAKHPKSDVGTCFPHLKK  286
            AEAKHPK+DV  CFPHLKK
Sbjct  68   AEAKHPKADVVACFPHLKK  86



>ref|XP_010548449.1| PREDICTED: uncharacterized protein At2g23090-like [Tarenaya hassleriana]
Length=79

 Score =   129 bits (325),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 68/76 (89%), Gaps = 1/76 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGA-KGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGN QKSKMARERNLEK K A KGSQL+ NKKAM IQCKVCMQTF+CTT+EVKC+EHA
Sbjct  1    MGGGNAQKSKMARERNLEKQKAAGKGSQLEKNKKAMTIQCKVCMQTFICTTTEVKCKEHA  60

Query  233  EAKHPKSDVGTCFPHL  280
            EA+HPKSD+  CFPHL
Sbjct  61   EARHPKSDLFACFPHL  76



>ref|XP_009354112.1| PREDICTED: uncharacterized protein At2g23090-like [Pyrus x bretschneideri]
Length=78

 Score =   128 bits (321),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 68/78 (87%), Gaps = 1/78 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNK-GAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGN QKSKMAR+RN+EK K  AKGSQL+SNK +M I CKVCMQ F+C TSEVKCREHA
Sbjct  1    MGGGNSQKSKMARQRNMEKQKNAAKGSQLESNKISMTIHCKVCMQVFICKTSEVKCREHA  60

Query  233  EAKHPKSDVGTCFPHLKK  286
            EAKHPKSDV TCFPHL+K
Sbjct  61   EAKHPKSDVYTCFPHLQK  78



>gb|KJB63926.1| hypothetical protein B456_010G024800 [Gossypium raimondii]
Length=77

 Score =   127 bits (319),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNGQKS+MARE+++EKNK  KG  L+SNK+AM IQCKVCMQ F+CTTSEVKC+EHAE
Sbjct  1    MGGGNGQKSRMAREKHMEKNKPTKGKHLESNKEAMTIQCKVCMQAFICTTSEVKCKEHAE  60

Query  236  AKHPKSDVGTCFPHLKK  286
            AKHPKSD+   FPHLKK
Sbjct  61   AKHPKSDIFASFPHLKK  77



>gb|KHG21316.1| hypothetical protein F383_02340 [Gossypium arboreum]
Length=123

 Score =   122 bits (307),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 64/69 (93%), Gaps = 1/69 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNK-GAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGN QKSK ARERNLEK K GAKGSQL+SNKKAM+IQCKVCMQ FMCTTSEVKCREHA
Sbjct  1    MGGGNAQKSKTARERNLEKAKAGAKGSQLESNKKAMSIQCKVCMQEFMCTTSEVKCREHA  60

Query  233  EAKHPKSDV  259
            EAKHPKSDV
Sbjct  61   EAKHPKSDV  69



>ref|XP_002313166.1| hypothetical protein POPTR_0009s09400g [Populus trichocarpa]
 gb|EEE87121.1| hypothetical protein POPTR_0009s09400g [Populus trichocarpa]
Length=67

 Score =   120 bits (302),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +2

Query  86   MARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKHPKSDVGT  265
            MARERN+EK + AKGSQL+SNKKAM+IQCKVCM TF+CTT+EVKCREHAEAKHPKSDV  
Sbjct  1    MARERNMEKQRAAKGSQLESNKKAMSIQCKVCMLTFICTTTEVKCREHAEAKHPKSDVYA  60

Query  266  CFPHLKK  286
            CFPHLKK
Sbjct  61   CFPHLKK  67



>dbj|BAJ98198.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=68

 Score =   120 bits (302),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +2

Query  83   KMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKHPKSDVG  262
            KMARERNLEK KG KGSQL++NKKAMNIQCK+CMQTF+CTTSE KC+EHAEAKHPKSD+ 
Sbjct  1    KMARERNLEKLKGGKGSQLEANKKAMNIQCKICMQTFICTTSEAKCKEHAEAKHPKSDLV  60

Query  263  TCFPHLKK  286
             CFPHLK+
Sbjct  61   QCFPHLKQ  68



>gb|KDO57851.1| hypothetical protein CISIN_1g046078mg [Citrus sinensis]
Length=68

 Score =   106 bits (265),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  128  GSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKHPKSDVGTCFPHLKK  286
            GSQL++NKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKHPKSD+ TCFPHLKK
Sbjct  16   GSQLETNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKHPKSDLYTCFPHLKK  68



>ref|XP_002508158.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO69416.1| predicted protein [Micromonas sp. RCC299]
Length=78

 Score =   100 bits (248),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 58/77 (75%), Gaps = 1/77 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKN-KGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGN QKS MAR++  EK  K  KGSQL  N  A +IQCKVCM TF+CTT+EVK +EHA
Sbjct  1    MGGGNAQKSAMARKKAQEKAAKEGKGSQLKQNAAAQSIQCKVCMATFICTTAEVKLKEHA  60

Query  233  EAKHPKSDVGTCFPHLK  283
            + KHPK+D   CFPHLK
Sbjct  61   DNKHPKNDFHQCFPHLK  77



>tpg|DAA59402.1| TPA: hypothetical protein ZEAMMB73_829423 [Zea mays]
Length=217

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  125  KGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKHPKSDVGTCFPHLK  283
            +GSQL++NKKAMNIQCK+CMQTF+CTTSE KC+EHAEA+HPK+D+  CFPHLK
Sbjct  164  EGSQLEANKKAMNIQCKICMQTFICTTSEAKCKEHAEARHPKNDLYQCFPHLK  216



>ref|XP_003061975.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH53687.1| predicted protein [Micromonas pusilla CCMP1545]
Length=78

 Score = 91.7 bits (226),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 55/75 (73%), Gaps = 1/75 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGA-KGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGN QKS  AR+   EK K A KGSQL  N KAMNIQCKVC+QTF+ TT+ VK +EHA
Sbjct  1    MGGGNAQKSAKARQMKQEKMKTASKGSQLADNAKAMNIQCKVCLQTFVSTTASVKLKEHA  60

Query  233  EAKHPKSDVGTCFPH  277
            + KHPK+    CFP+
Sbjct  61   DNKHPKNPYEQCFPN  75



>ref|XP_001689924.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP09662.1| predicted protein [Chlamydomonas reinhardtii]
Length=79

 Score = 90.1 bits (222),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 54/77 (70%), Gaps = 1/77 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGA-KGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGNGQKS M R + LE+ + A KGSQL  N+ +MNI+C++C+  F+CTTSE   REH 
Sbjct  1    MGGGNGQKSAMRRAKKLEEAQAANKGSQLKQNQASMNIKCQICLTAFVCTTSEKLLREHW  60

Query  233  EAKHPKSDVGTCFPHLK  283
            E KHPK  +   FP LK
Sbjct  61   ENKHPKQPIEAAFPQLK  77



>gb|KDD74926.1| hypothetical protein H632_c983p0 [Helicosporidium sp. ATCC 50920]
Length=78

 Score = 86.3 bits (212),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 53/74 (72%), Gaps = 1/74 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKN-KGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGN QK+ MAR + LEK  KG+ GSQL SN  A NI C++C  TF+CT++ VK +EHA
Sbjct  1    MGGGNAQKTAMARAKKLEKAAKGSAGSQLKSNAAANNIVCQICRSTFICTSTVVKLKEHA  60

Query  233  EAKHPKSDVGTCFP  274
            + KHPK+    CFP
Sbjct  61   DNKHPKNKFEECFP  74



>gb|ABR25435.1| unknown [Oryza sativa Indica Group]
Length=42

 Score = 80.5 bits (197),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  161  NIQCKVCMQTFMCTTSEVKCREHAEAKHPKSDVGTCFPHLKK  286
            NIQCK+CMQTF+CTTSE KC+EHAEAKHPKSD+  CFPHLKK
Sbjct  1    NIQCKICMQTFICTTSETKCKEHAEAKHPKSDLTACFPHLKK  42



>ref|XP_008779058.1| PREDICTED: uncharacterized protein At2g23090 [Phoenix dactylifera]
Length=41

 Score = 80.1 bits (196),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +2

Query  164  IQCKVCMQTFMCTTSEVKCREHAEAKHPKSDVGTCFPHLKK  286
            +QCKVCMQTF+CTTSEVKCREHAEAKHPKSD+  CFPHLKK
Sbjct  1    MQCKVCMQTFICTTSEVKCREHAEAKHPKSDLYQCFPHLKK  41



>ref|XP_001418532.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO96825.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=78

 Score = 79.3 bits (194),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 50/74 (68%), Gaps = 1/74 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEK-NKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGN QKS  AR++ +EK  K   GSQL +N KAM+  C+VC  +FMCT + +K +EH+
Sbjct  1    MGGGNAQKSATARKKAMEKAQKAGAGSQLAANAKAMSTVCQVCRASFMCTLAPIKLKEHS  60

Query  233  EAKHPKSDVGTCFP  274
            + KHPK     CFP
Sbjct  61   DNKHPKQTFEHCFP  74



>ref|XP_005846361.1| hypothetical protein CHLNCDRAFT_135809 [Chlorella variabilis]
 gb|EFN54259.1| hypothetical protein CHLNCDRAFT_135809 [Chlorella variabilis]
Length=79

 Score = 78.6 bits (192),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 50/75 (67%), Gaps = 2/75 (3%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKG--SQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREH  229
            MGGGN QKS  AR+R  EK+K   G  SQL  N KA++I C++C Q+FMC  +  K +EH
Sbjct  1    MGGGNAQKSATARQRKAEKDKKLAGGKSQLADNAKALSIVCQICRQSFMCNMTPAKLKEH  60

Query  230  AEAKHPKSDVGTCFP  274
            ++++HPK     CFP
Sbjct  61   SDSRHPKQKFEECFP  75



>ref|XP_004338589.1| small conserved protein [Acanthamoeba castellanii str. Neff]
 gb|ELR16576.1| small conserved protein [Acanthamoeba castellanii str. Neff]
Length=79

 Score = 78.6 bits (192),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGS-QLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MG GN Q++   RERN +KN  +  S QL SN+KA++I C VC QTF+CT++    +EHA
Sbjct  1    MGKGNAQQAAQKRERNAKKNATSTASSQLKSNEKALSIICNVCKQTFLCTSNPKTLKEHA  60

Query  233  EAKHPKSDVGTCFPHL  280
            + KHPK+    CFP L
Sbjct  61   DNKHPKNTFAQCFPTL  76



>gb|ERS99711.1| hypothetical protein HMPREF1624_03075 [Sporothrix schenckii ATCC 
58251]
 gb|KIH91891.1| hypothetical protein SPBR_02098 [Sporothrix brasiliensis 5110]
Length=79

 Score = 77.0 bits (188),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNG K+   RERN +   GA  SQL +N+KA+NIQC VC  TF+ TT E    +HA 
Sbjct  1    MGGGNGAKAAQKRERNAKDKAGAAKSQLKTNEKALNIQCFVCKATFLSTTRENALNDHAT  60

Query  236  AKHPKSDVGTCFPHLK  283
             KH K+ +  CFP  K
Sbjct  61   NKHSKT-LADCFPDFK  75



>emb|CEF98457.1| Zinc finger protein 706 [Ostreococcus tauri]
Length=78

 Score = 75.5 bits (184),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 51/77 (66%), Gaps = 3/77 (4%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEK--NKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREH  229
            MGGGN QKS MAR++  EK   KGA GSQL +N KAM   C VC  +F+CT +  K +EH
Sbjct  1    MGGGNAQKSAMARKKAQEKLAAKGA-GSQLATNAKAMTQMCMVCRTSFLCTLAPAKLKEH  59

Query  230  AEAKHPKSDVGTCFPHL  280
            ++ KHPK     CFP++
Sbjct  60   SDNKHPKQTFEQCFPNV  76



>ref|XP_003321593.2| hypothetical protein PGTG_03130 [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
 gb|EFP77174.2| hypothetical protein PGTG_03130 [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
Length=76

 Score = 74.3 bits (181),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNG K+   RERN + +     SQL  N+ A NIQCKVC QTF+ T+ E   +EHAE
Sbjct  1    MGGGNGAKAAQKRERNAKASGATAKSQLKVNEAAKNIQCKVCFQTFLITSREPALKEHAE  60

Query  236  AKHPKSDVGTCFPHLK  283
             +H K+ +  CFP  K
Sbjct  61   NRHSKALL-DCFPMWK  75



>gb|EPB91030.1| hypothetical protein HMPREF1544_02099 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=76

 Score = 73.2 bits (178),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKH  244
            GNGQK++M RERN +  KG   SQL +N  A NI CK C QTF+CT+ E    EH+E KH
Sbjct  2    GNGQKAQMKRERNAKNAKGQGASQLKTNDAAKNIICKTCFQTFLCTSREKALSEHSENKH  61

Query  245  PKSDVGTCFP  274
             KS +  CFP
Sbjct  62   NKS-LKECFP  70



>dbj|GAN03917.1| conserved hypothetical protein [Mucor ambiguus]
Length=76

 Score = 73.2 bits (178),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKH  244
            GNGQK++M RERN +  KG   SQL +N  A NI CK C QTF+CT+ E    EH+E KH
Sbjct  2    GNGQKAQMKRERNAKNAKGNGASQLKTNDAAKNIICKTCFQTFLCTSREKALSEHSENKH  61

Query  245  PKSDVGTCFP  274
             KS +  CFP
Sbjct  62   NKS-LKECFP  70



>ref|XP_007409997.1| hypothetical protein MELLADRAFT_56097 [Melampsora larici-populina 
98AG31]
 gb|EGG06557.1| hypothetical protein MELLADRAFT_56097 [Melampsora larici-populina 
98AG31]
Length=76

 Score = 72.8 bits (177),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNG K+   RERN +       SQL  N+ A NIQCK+C QTF+ T+ E   +EHAE
Sbjct  1    MGGGNGAKAAQKRERNAKTAGTTAKSQLKVNEAAKNIQCKICFQTFLQTSREPALKEHAE  60

Query  236  AKHPKSDVGTCFPHLK  283
             KH K+ +  CFP  K
Sbjct  61   NKHSKT-LADCFPMYK  75



>gb|KFH45514.1| hypothetical protein ACRE_037100 [Acremonium chrysogenum ATCC 
11550]
Length=74

 Score = 72.4 bits (176),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 47/71 (66%), Gaps = 1/71 (1%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKH  244
            GNG K++  RERN +  K AK SQL  N+KAMNIQC++C  TF+ TT   + +EHAE KH
Sbjct  2    GNGAKAQQKRERNAKDTKTAK-SQLKVNEKAMNIQCQICKSTFLQTTKLPQLKEHAENKH  60

Query  245  PKSDVGTCFPH  277
               D   CFP+
Sbjct  61   ANKDFADCFPN  71



>ref|XP_008657313.1| PREDICTED: uncharacterized protein At2g23090 isoform X1 [Zea 
mays]
Length=82

 Score = 71.6 bits (174),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/43 (84%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCM  184
            MGGGNGQKSKMARERNLEKNKGAKGSQL++NKKAM+IQ   C+
Sbjct  1    MGGGNGQKSKMARERNLEKNKGAKGSQLETNKKAMSIQIFCCI  43



>ref|XP_005835675.1| hypothetical protein GUITHDRAFT_151660 [Guillardia theta CCMP2712]
 gb|EKX48695.1| hypothetical protein GUITHDRAFT_151660 [Guillardia theta CCMP2712]
Length=143

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 48/77 (62%), Gaps = 2/77 (3%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKG--SQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREH  229
            MGGGN QK+ ++RERN  K + A+G  SQL +N KAM+I+CK+C Q FMCT +E     H
Sbjct  1    MGGGNAQKTAISRERNQAKLRAAQGGASQLGNNAKAMSIKCKICKQAFMCTQNEQDLMNH  60

Query  230  AEAKHPKSDVGTCFPHL  280
             E KH       CF  +
Sbjct  61   VEGKHKGKTYEDCFDPI  77



>gb|ACG25824.1| hypothetical protein [Zea mays]
Length=44

 Score = 70.5 bits (171),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQC  172
            MGGGNGQKSKMARERNLEKNKGAKGSQL++NKKAM+IQ 
Sbjct  1    MGGGNGQKSKMARERNLEKNKGAKGSQLETNKKAMSIQI  39



>gb|EGU13616.1| hypothetical protein RTG_00053 [Rhodotorula glutinis ATCC 204091]
Length=147

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 48/73 (66%), Gaps = 1/73 (1%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKH  244
            GNG K++  RERN +  K    SQL +NK AMN++CK+CMQ FM T+   + +EHAE KH
Sbjct  75   GNGAKAQQKRERNAKDAKKGPTSQLANNKAAMNLKCKICMQLFMNTSRAPQLKEHAENKH  134

Query  245  PKSDVGTCFPHLK  283
             K D+  CFP  +
Sbjct  135  SK-DIKDCFPDFQ  146



>gb|AAR89012.1| expressed protein, having alternate splicing products [Oryza 
sativa Japonica Group]
Length=48

 Score = 70.1 bits (170),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVC  181
            MGGGNGQKS+MARERN+EK KGAKGSQL++NKKAMNIQ  V 
Sbjct  1    MGGGNGQKSRMARERNMEKAKGAKGSQLETNKKAMNIQVLVF  42



>gb|KHN96784.1| putative protein family SERF [Metarhizium album ARSEF 1941]
Length=73

 Score = 70.5 bits (171),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 48/70 (69%), Gaps = 2/70 (3%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKH  244
            GNG K++  RERN + +K AK SQL  N++AMNIQC+VC  TF+ TT     +EHA  KH
Sbjct  2    GNGAKAQQKRERNAKDSKVAK-SQLKVNQQAMNIQCQVCKATFLSTTKGPALQEHATNKH  60

Query  245  PKSDVGTCFP  274
             K D+G CFP
Sbjct  61   SK-DIGACFP  69



>ref|NP_001050455.1| Os03g0439800 [Oryza sativa Japonica Group]
 dbj|BAF12369.1| Os03g0439800 [Oryza sativa Japonica Group]
Length=90

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 43/58 (74%), Gaps = 1/58 (2%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREH  229
            MGGGNGQKS+MARERN+EK KGAKGSQL++NKKAMNIQ  +   TF      +  +E 
Sbjct  1    MGGGNGQKSRMARERNMEKAKGAKGSQLETNKKAMNIQV-IFRGTFWARQWSLLLKEE  57



>gb|AAO23088.1| unknown protein [Oryza sativa Japonica Group]
 gb|AAR89013.1| expressed protein, having alternate splicing products [Oryza 
sativa Japonica Group]
 gb|ABF96838.1| expressed protein [Oryza sativa Japonica Group]
Length=42

 Score = 69.3 bits (168),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVC  181
            MGGGNGQKS+MARERN+EK KGAKGSQL++NKKAMNIQ   C
Sbjct  1    MGGGNGQKSRMARERNMEKAKGAKGSQLETNKKAMNIQVGSC  42



>ref|XP_643685.1| hypothetical protein DDB_G0275367 [Dictyostelium discoideum AX4]
 gb|EAL69749.1| hypothetical protein DDB_G0275367 [Dictyostelium discoideum AX4]
Length=80

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 48/77 (62%), Gaps = 2/77 (3%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKG--SQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREH  229
            M  GNG K++  RERNL++N+GA    SQL +N+ A    C +C  +F+CT  E + R H
Sbjct  1    MPSGNGAKAQQKRERNLKRNEGASSAKSQLKTNEAAKTTICNICRASFLCTAKETELRIH  60

Query  230  AEAKHPKSDVGTCFPHL  280
            ++ KHPK+    CFP +
Sbjct  61   SDNKHPKNKFEECFPAM  77



>gb|KFG77965.1| hypothetical protein MANI_004634 [Metarhizium anisopliae]
Length=73

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 47/70 (67%), Gaps = 2/70 (3%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKH  244
            GNG K++  RERN +  K AK SQL  N++AMNIQC++C  TF+ TT     +EHA  KH
Sbjct  2    GNGAKAQQKRERNAKDGKVAK-SQLKVNQQAMNIQCQICKATFLSTTKGPALQEHATNKH  60

Query  245  PKSDVGTCFP  274
             K D+G CFP
Sbjct  61   SK-DIGDCFP  69



>gb|EMS19420.1| SERF family protein [Rhodosporidium toruloides NP11]
 emb|CDR42157.1| RHTO0S06e10440g1_1 [Rhodosporidium toruloides]
Length=74

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 47/73 (64%), Gaps = 1/73 (1%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKH  244
            GNG K++  RERN +  K    SQL +NK AMN++CK+CMQ FM T+   + +EHA  KH
Sbjct  2    GNGAKAQQKRERNAKDAKKGPTSQLANNKAAMNLKCKICMQLFMNTSRAPQLQEHATNKH  61

Query  245  PKSDVGTCFPHLK  283
             K D+  CFP  +
Sbjct  62   SK-DIKDCFPDFQ  73



>gb|EPS28578.1| hypothetical protein PDE_03524 [Penicillium oxalicum 114-2]
Length=74

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 48/71 (68%), Gaps = 3/71 (4%)
 Frame = +2

Query  65   GNGQKSKMARERNL-EKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAK  241
            GNG K+ M RERN  +K K AK SQ+ +N+KAMNIQCKVC+QTF+ TT      EHA  K
Sbjct  2    GNGAKANMKRERNAADKGKVAK-SQIKTNEKAMNIQCKVCLQTFLQTTKAPALLEHASNK  60

Query  242  HPKSDVGTCFP  274
            H K  +  CFP
Sbjct  61   H-KKGLAECFP  70



>ref|XP_004355913.1| hypothetical protein DFA_08424 [Dictyostelium fasciculatum]
 gb|EGG17429.1| hypothetical protein DFA_08424 [Dictyostelium fasciculatum]
Length=87

 Score = 68.6 bits (166),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 44/75 (59%), Gaps = 2/75 (3%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGA--KGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREH  229
            M  GNG K++  RERNL+K  G     SQL SN+ A NI C VC Q+FMCT  E + R H
Sbjct  10   MPSGNGAKAQQKRERNLKKAAGETKAHSQLKSNEAAKNIMCNVCRQSFMCTAKEPELRLH  69

Query  230  AEAKHPKSDVGTCFP  274
            AE KH       CFP
Sbjct  70   AENKHVGRAFTDCFP  84



>ref|XP_568935.1| hypothetical protein CNB04380 [Cryptococcus neoformans var. neoformans 
JEC21]
 ref|XP_777335.1| hypothetical protein CNBB1370 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|EAL22688.1| hypothetical protein CNBB1370 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|AAW41628.1| hypothetical protein CNB04380 [Cryptococcus neoformans var. neoformans 
JEC21]
Length=77

 Score = 68.2 bits (165),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 46/74 (62%), Gaps = 7/74 (9%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKG----SQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            GNG K++  R+RN    KGA G    SQL SN  AM IQC  C   F  T+ ++  ++H 
Sbjct  2    GNGAKAQAKRDRN---TKGAAGKGDQSQLKSNAAAMTIQCITCKAVFQGTSKQLVLQQHV  58

Query  233  EAKHPKSDVGTCFP  274
            ++KHPKSD+ TCFP
Sbjct  59   DSKHPKSDIKTCFP  72



>dbj|GAM28548.1| hypothetical protein SAMD00019534_117240 [Acytostelium subglobosum 
LB1]
Length=77

 Score = 68.2 bits (165),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 47/75 (63%), Gaps = 2/75 (3%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKG-AKG-SQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREH  229
            M  GNG +++  RERN++K  G AK  SQL SN+ A +I C VC  +FMCTT E + R+H
Sbjct  1    MPSGNGARAQQKRERNIKKAAGEAKAHSQLKSNEAAKSIVCNVCRTSFMCTTKEPELRQH  60

Query  230  AEAKHPKSDVGTCFP  274
            AE KH       CFP
Sbjct  61   AENKHAGKSFADCFP  75



>emb|CDM27839.1| Uncharacterised protein family SERF [Penicillium roqueforti FM164]
Length=73

 Score = 67.8 bits (164),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 46/72 (64%), Gaps = 2/72 (3%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKH  244
            GNG K+ M RERN +  K AK SQ  SN+KAMNIQC+VC QTF+ TT      EHA  KH
Sbjct  2    GNGAKASMKRERNAKDQKTAK-SQTKSNEKAMNIQCQVCRQTFLQTTKAPALLEHASNKH  60

Query  245  PKSDVGTCFPHL  280
             K  +  CFP +
Sbjct  61   SKG-LPDCFPGI  71



>gb|AFR93451.2| hypothetical protein CNAG_03951 [Cryptococcus neoformans var. 
grubii H99]
Length=77

 Score = 67.8 bits (164),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 45/74 (61%), Gaps = 7/74 (9%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKG----SQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            GNG K++  RERN    KGA G    SQL SN  AM IQC  C   F  T+ ++  ++H 
Sbjct  2    GNGAKAQAKRERN---TKGASGKGDQSQLKSNAAAMTIQCMTCKAVFQGTSKQLVLQQHV  58

Query  233  EAKHPKSDVGTCFP  274
            ++KHPKSD+  CFP
Sbjct  59   DSKHPKSDIKACFP  72



>gb|KGO68528.1| hypothetical protein PITC_071530 [Penicillium italicum]
Length=73

 Score = 67.4 bits (163),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 45/70 (64%), Gaps = 2/70 (3%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKH  244
            GNG K+ M RERN +  K AK SQ  SN+KAMNIQC+VC QTF+ TT      EHA  KH
Sbjct  2    GNGAKANMKRERNAKDTKTAK-SQTKSNEKAMNIQCQVCRQTFLQTTKPPALLEHASNKH  60

Query  245  PKSDVGTCFP  274
             K  +  CFP
Sbjct  61   SKG-LPECFP  69



>ref|XP_003191195.1| hypothetical protein CGB_A1600W [Cryptococcus gattii WM276]
 gb|ADV19408.1| Hypothetical protein CGB_A1600W [Cryptococcus gattii WM276]
 gb|KIR54205.1| hypothetical protein I315_03264 [Cryptococcus gattii Ru294]
 gb|KIR80002.1| hypothetical protein I306_02966 [Cryptococcus gattii EJB2]
 gb|KIR85488.1| hypothetical protein I308_04184 [Cryptococcus gattii IND107]
 gb|KIY34356.1| hypothetical protein I305_03136 [Cryptococcus gattii E566]
 gb|KJE05285.1| hypothetical protein I311_00964 [Cryptococcus gattii NT-10]
Length=77

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 46/72 (64%), Gaps = 3/72 (4%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKG--SQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEA  238
            GNG K++  R+RN +   G KG  SQL SN  AM IQC  C   F  T+ ++  ++H ++
Sbjct  2    GNGAKAQAKRDRNTKAAAG-KGDQSQLKSNAAAMTIQCVTCKAVFQGTSKQLVLQQHVDS  60

Query  239  KHPKSDVGTCFP  274
            KHPKSD+ TCFP
Sbjct  61   KHPKSDIKTCFP  72



>gb|KIR46616.1| hypothetical protein I312_04103 [Cryptococcus gattii CA1280]
 gb|KIR59845.1| hypothetical protein I314_04280 [Cryptococcus gattii CA1873]
Length=77

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 46/72 (64%), Gaps = 3/72 (4%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKG--SQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEA  238
            GNG K++  R+RN +   G KG  SQL SN  AM IQC  C   F  T+ ++  ++H ++
Sbjct  2    GNGAKAQAKRDRNTKAAAG-KGDQSQLKSNAAAMTIQCVTCKAVFQGTSKQLVLQQHVDS  60

Query  239  KHPKSDVGTCFP  274
            KHPKSD+ TCFP
Sbjct  61   KHPKSDIKTCFP  72



>gb|KGB79679.1| hypothetical protein CNBG_5517 [Cryptococcus gattii R265]
 gb|KIR28810.1| hypothetical protein I309_02305 [Cryptococcus gattii LA55]
 gb|KIR32838.1| hypothetical protein I352_04773 [Cryptococcus gattii MMRL2647]
 gb|KIR39233.1| hypothetical protein I313_04834 [Cryptococcus gattii Ram5]
 gb|KIR71165.1| hypothetical protein I310_05056 [Cryptococcus gattii CA1014]
 gb|KIR94655.1| hypothetical protein I304_00974 [Cryptococcus gattii CBS 10090]
 gb|KIS00820.1| hypothetical protein L804_02241 [Cryptococcus gattii 2001/935-1]
 gb|KIY57529.1| hypothetical protein I307_03021 [Cryptococcus gattii 99/473]
Length=77

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 46/72 (64%), Gaps = 3/72 (4%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKG--SQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEA  238
            GNG K++  R+RN +   G KG  SQL SN  AM IQC  C   F  T+ ++  ++H ++
Sbjct  2    GNGAKAQAKRDRNTKAATG-KGDQSQLKSNAAAMTIQCVTCKAVFQGTSKQLVLQQHVDS  60

Query  239  KHPKSDVGTCFP  274
            KHPKSD+ TCFP
Sbjct  61   KHPKSDIKTCFP  72



>emb|CCE35128.1| uncharacterized protein CPUR_02058 [Claviceps purpurea 20.1]
Length=73

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 46/70 (66%), Gaps = 2/70 (3%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKH  244
            GNG K++  RERN +  K AK SQL  N++AMNIQC+VC  TF+ TT      EHA+ KH
Sbjct  2    GNGAKAQQKRERNAKDGKVAK-SQLKVNQQAMNIQCQVCKATFLSTTKAPALLEHAQNKH  60

Query  245  PKSDVGTCFP  274
             KS +  CFP
Sbjct  61   SKS-IADCFP  69



>ref|XP_002565772.1| Pc22g18670 [Penicillium rubens Wisconsin 54-1255]
 emb|CAP99155.1| Pc22g18670 [Penicillium rubens Wisconsin 54-1255]
Length=73

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 46/72 (64%), Gaps = 2/72 (3%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKH  244
            GNG K+ M RERN +  K AK SQ  SN+KAMNIQC+VC QTF+ TT      EHA  KH
Sbjct  2    GNGAKANMKRERNAKDTKTAK-SQTKSNEKAMNIQCQVCRQTFLQTTKAPALLEHASNKH  60

Query  245  PKSDVGTCFPHL  280
             K  +  CFP +
Sbjct  61   NKG-LPECFPGI  71



>ref|XP_007513028.1| predicted protein [Bathycoccus prasinos]
 emb|CCO16586.1| predicted protein [Bathycoccus prasinos]
Length=77

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKG-SQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGNGQKS  ARE+   K       S L +N+ A +IQCKVCMQ F+ T S  + ++HA
Sbjct  1    MGGGNGQKSAKAREKAQAKAAKGGAGSMLKANEAAKSIQCKVCMQAFVSTLSHSELKKHA  60

Query  233  EAKHPKSDVGTCFPHLK  283
            E KHPK D   CFP L+
Sbjct  61   ENKHPKLDAKQCFPFLE  77



>emb|CBJ31557.1| conserved unknown protein [Ectocarpus siliculosus]
Length=79

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 45/75 (60%), Gaps = 2/75 (3%)
 Frame = +2

Query  56   MGGGNGQKSKMARERN-LEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGN QKS  AR RN  +K K  KGSQL  NK A +I C+VC Q+FM  +++    +H 
Sbjct  1    MGGGNAQKSATARARNEAKKAKAGKGSQLAVNKAAQSIVCQVCRQSFMSVSNDAMLADHV  60

Query  233  EAKHPKSDV-GTCFP  274
             AKH K      CFP
Sbjct  61   TAKHNKKKTPAECFP  75



>emb|CEI98098.1| Putative DUF1909-domain-containing protein [Rhizopus microsporus]
Length=77

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 48/71 (68%), Gaps = 2/71 (3%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKG-SQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAK  241
            GNG K++M RERN ++N+  +G SQL +N  A NI CK C QTF+CT+ E    EHA+ K
Sbjct  2    GNGAKAQMKRERNAKQNQKKEGASQLKANAAAKNIICKTCFQTFLCTSREKALTEHAQNK  61

Query  242  HPKSDVGTCFP  274
            H K+ +  CFP
Sbjct  62   HNKT-MKECFP  71



>gb|EKV19680.1| hypothetical protein PDIG_01270 [Penicillium digitatum PHI26]
 gb|EKV20792.1| hypothetical protein PDIP_12590 [Penicillium digitatum Pd1]
Length=73

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 45/70 (64%), Gaps = 2/70 (3%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKH  244
            GNG K+ M RERN +  K AK SQ+ SN+KAM IQC+VC QTF+ TT      EHA  KH
Sbjct  2    GNGAKANMKRERNAKDTKTAK-SQIKSNEKAMTIQCQVCRQTFLQTTKAPALLEHASNKH  60

Query  245  PKSDVGTCFP  274
             K  +  CFP
Sbjct  61   SKG-LPECFP  69



>ref|XP_003714121.1| hypothetical protein MGG_01222 [Magnaporthe oryzae 70-15]
 gb|EHA54314.1| hypothetical protein MGG_01222 [Magnaporthe oryzae 70-15]
Length=74

 Score = 66.2 bits (160),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKH  244
            GNG +++  RERN +  K A  SQL  N+ A NIQC++C  TF+ TT E +  +HAE KH
Sbjct  2    GNGNRAQQKRERNAKDAKSAPKSQLKVNENAKNIQCEICKSTFLMTTREPQLLQHAENKH  61

Query  245  PKSDVGTCFP  274
             K+ +  CFP
Sbjct  62   SKT-IADCFP  70



>emb|CEG72122.1| Putative DUF1909-domain-containing protein [Rhizopus microsporus]
 emb|CEJ04551.1| Putative DUF1909-domain-containing protein [Rhizopus microsporus]
Length=77

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 47/71 (66%), Gaps = 2/71 (3%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKG-SQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAK  241
            GNG K++M RERN ++N+   G SQL +N  A NI CK C QTF+CT+ E    EHA+ K
Sbjct  2    GNGAKAQMKRERNAKQNQKKDGASQLKANAAAKNIICKTCFQTFLCTSREKALTEHAQNK  61

Query  242  HPKSDVGTCFP  274
            H K+ +  CFP
Sbjct  62   HNKT-MKECFP  71



>gb|EJT50685.1| hypothetical protein A1Q1_08237 [Trichosporon asahii var. asahii 
CBS 2479]
Length=74

 Score = 65.9 bits (159),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 39/75 (52%), Gaps = 3/75 (4%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNG KS  AR RN  K      SQL SN    +I C +C QTF  T      ++H +
Sbjct  1    MGGGNGAKSAQARARNAAKADKGPTSQLKSNA---SIMCSICRQTFQGTAKAPMLQQHVD  57

Query  236  AKHPKSDVGTCFPHL  280
             KHPKS    CFP  
Sbjct  58   GKHPKSTFAVCFPSF  72



>gb|EPS99141.1| hypothetical protein FOMPIDRAFT_84763 [Fomitopsis pinicola FP-58527 
SS1]
Length=74

 Score = 65.9 bits (159),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 43/70 (61%), Gaps = 1/70 (1%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKH  244
            GNG K++  RERN  K  G   SQ+ +N+ AMNI C+ C Q FM TT      EHA++KH
Sbjct  2    GNGAKAQQKRERNAAKAGGTAKSQIKTNQAAMNIVCQTCKQAFMLTTRAPALEEHAQSKH  61

Query  245  PKSDVGTCFP  274
             K+ +  CFP
Sbjct  62   SKA-LADCFP  70



>gb|KDB18063.1| DUF1909-domain-containing protein [Ustilaginoidea virens]
Length=73

 Score = 65.9 bits (159),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 46/70 (66%), Gaps = 2/70 (3%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKH  244
            GNG K++  RERN +  K AK SQL  N++AMNIQC+VC  TF+ TT     +EHA+ KH
Sbjct  2    GNGAKAQQKRERNAKDGKVAK-SQLKVNQQAMNIQCQVCKATFLSTTKGPALQEHAQNKH  60

Query  245  PKSDVGTCFP  274
             K  +  CFP
Sbjct  61   SKG-IADCFP  69



>gb|EFA77673.1| transmembrane protein [Polysphondylium pallidum PN500]
Length=1257

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 36/75 (48%), Positives = 48/75 (64%), Gaps = 2/75 (3%)
 Frame = +2

Query  53    IMGGGNGQKSKMARERNLEKNKG-AKG-SQLDSNKKAMNIQCKVCMQTFMCTTSEVKCRE  226
             IM  GNG +++  RERNL+K  G +KG SQL +N+ A +I C VC  +F+CTT E + R+
Sbjct  1179  IMPSGNGARAQQKRERNLKKAAGESKGKSQLKTNEAAKSIMCNVCRASFLCTTKEPELRQ  1238

Query  227   HAEAKHPKSDVGTCF  271
             HAE KH       CF
Sbjct  1239  HAENKHAGRAFADCF  1253



>gb|KGO40152.1| Uncharacterized protein family SERF [Penicillium expansum]
 gb|KGO40901.1| Uncharacterized protein family SERF [Penicillium expansum]
 gb|KGO53084.1| Uncharacterized protein family SERF [Penicillium expansum]
Length=73

 Score = 65.5 bits (158),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 45/70 (64%), Gaps = 2/70 (3%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKH  244
            GNG K+ M RERN +  K AK SQ  SN+KAM+IQC+VC QTF+ TT      EHA  KH
Sbjct  2    GNGAKANMKRERNAKDTKTAK-SQTKSNEKAMSIQCQVCRQTFLQTTKAPALLEHASNKH  60

Query  245  PKSDVGTCFP  274
             K  +  CFP
Sbjct  61   SKG-LPECFP  69



>emb|CEG83423.1| Putative DUF1909-domain-containing protein [Rhizopus microsporus]
Length=94

 Score = 65.9 bits (159),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 47/71 (66%), Gaps = 2/71 (3%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKG-SQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAK  241
            GNG K++M RERN ++N+   G SQL +N  A NI CK C QTF+CT+ E    EHA+ K
Sbjct  2    GNGAKAQMKRERNAKQNQKKDGASQLKANAAAKNIICKTCFQTFLCTSREKALTEHAQNK  61

Query  242  HPKSDVGTCFP  274
            H K+ +  CFP
Sbjct  62   HNKT-MKECFP  71



>gb|ELQ37422.1| hypothetical protein OOU_Y34scaffold00594g6 [Magnaporthe oryzae 
Y34]
 gb|ELQ65421.1| hypothetical protein OOW_P131scaffold00497g6 [Magnaporthe oryzae 
P131]
Length=130

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 45/74 (61%), Gaps = 1/74 (1%)
 Frame = +2

Query  53   IMGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            I   G G +++  RERN +  K A  SQL  N+ A NIQC++C  TF+ TT E +  +HA
Sbjct  54   IFVAGRGNRAQQKRERNAKDAKSAPKSQLKVNENAKNIQCEICKSTFLMTTREPQLLQHA  113

Query  233  EAKHPKSDVGTCFP  274
            E KH K+ +  CFP
Sbjct  114  ENKHSKT-IADCFP  126



>ref|XP_003288883.1| hypothetical protein DICPUDRAFT_92186 [Dictyostelium purpureum]
 gb|EGC34606.1| hypothetical protein DICPUDRAFT_92186 [Dictyostelium purpureum]
Length=81

 Score = 65.1 bits (157),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 47/75 (63%), Gaps = 2/75 (3%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKG--SQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREH  229
            M  GNG +++  RERN+++ +GA G  SQL +N+ A    C +C  +F+CT  E + + H
Sbjct  1    MPSGNGARAQQKRERNIKRQEGAGGGKSQLKANEAAKTTICNICRTSFLCTAKESELKIH  60

Query  230  AEAKHPKSDVGTCFP  274
            +E KHPK+    CFP
Sbjct  61   SENKHPKNKFEECFP  75



>ref|XP_002527488.1| hypothetical protein RCOM_0174730 [Ricinus communis]
 gb|EEF34886.1| hypothetical protein RCOM_0174730 [Ricinus communis]
Length=137

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 39/50 (78%), Gaps = 2/50 (4%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNK--GAKGSQLDSNKKAMNIQCKVCMQTFMC  199
            MGGGNGQK+KMARE+NLEK +   AKGSQL+SNKKAM+IQ  +C    M 
Sbjct  1    MGGGNGQKAKMAREKNLEKQRAAAAKGSQLESNKKAMSIQLVICFPHTML  50



>gb|ABR25440.1| conserved hypothetical protein [Oryza sativa Indica Group]
Length=34

 Score = 64.3 bits (155),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  185  QTFMCTTSEVKCREHAEAKHPKSDVGTCFPHLKK  286
            QTF+CTTSE KC+EHAEAKHPKSD+  CFPHLKK
Sbjct  1    QTFICTTSETKCKEHAEAKHPKSDLTACFPHLKK  34



>ref|XP_009226219.1| hypothetical protein GGTG_10092 [Gaeumannomyces graminis var. 
tritici R3-111a-1]
 gb|EJT73245.1| hypothetical protein GGTG_10092 [Gaeumannomyces graminis var. 
tritici R3-111a-1]
Length=74

 Score = 64.7 bits (156),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKH  244
            GNG +++  R+RN +  KG + SQL  N++A NIQC+VC  TF+ TT E +   H++ KH
Sbjct  2    GNGNRAQQKRDRNAKDQKGVQKSQLKVNEQAKNIQCEVCKATFLTTTREPQLLLHSDNKH  61

Query  245  PKSDVGTCFP  274
             K+ V  CFP
Sbjct  62   SKT-VAECFP  70



>ref|XP_007360055.1| hypothetical protein DICSQDRAFT_164341 [Dichomitus squalens LYAD-421 
SS1]
 gb|EJF66502.1| hypothetical protein DICSQDRAFT_164341 [Dichomitus squalens LYAD-421 
SS1]
Length=74

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 42/70 (60%), Gaps = 1/70 (1%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKH  244
            GNG K++  RERN  K      SQ+ +N+ A+NI C VC QTF+ TT      EHA+ KH
Sbjct  2    GNGAKAQQKRERNAVKTANNAKSQIKTNQAALNIVCSVCRQTFLLTTRAPALEEHAQNKH  61

Query  245  PKSDVGTCFP  274
             KS +  CFP
Sbjct  62   SKS-LAECFP  70



>gb|EMD41713.1| hypothetical protein CERSUDRAFT_128755 [Ceriporiopsis subvermispora 
B]
Length=74

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 44/70 (63%), Gaps = 1/70 (1%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKH  244
            GNG K++  RERN  K++ A  SQ+  N++AMNI C+ C Q F+ TT      EHA+ KH
Sbjct  2    GNGAKAQQKRERNATKSQSAAKSQIKVNQQAMNIVCQTCRQAFLLTTRAPALEEHAQNKH  61

Query  245  PKSDVGTCFP  274
             K+ +  CFP
Sbjct  62   SKT-MAECFP  70



>ref|XP_003346224.1| hypothetical protein SMAC_05761 [Sordaria macrospora k-hell]
 emb|CCC08516.1| unnamed protein product [Sordaria macrospora k-hell]
Length=80

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 42/73 (58%), Gaps = 1/73 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNG K+   RERN +       SQL +N  AMNI C+ C  TF+ T+      EHA+
Sbjct  1    MGGGNGAKAAQKRERNAKNAAAGPKSQLKTNAAAMNIICQTCRATFLSTSRAKALDEHAQ  60

Query  236  AKHPKSDVGTCFP  274
             KH K+ +  CFP
Sbjct  61   NKHSKT-LADCFP  72



>emb|CCA24130.1| conserved hypothetical protein [Albugo laibachii Nc14]
Length=86

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 50/85 (59%), Gaps = 12/85 (14%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLE--------KNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSE  211
            MGGGNGQKSK  R+RN E        K   AK  ++ ++K+A  I+CK+CM TFM T S 
Sbjct  1    MGGGNGQKSKTKRDRNNEKKMKDQKQKTHVAKKGKMAADKEA--IKCKICMTTFMVTASN  58

Query  212  VKCREHAEAKHP--KSDVGTCFPHL  280
                +H E+KH    + +  CFPHL
Sbjct  59   KALTDHFESKHSSKSATITECFPHL  83



>gb|EHK40374.1| hypothetical protein TRIATDRAFT_260071 [Trichoderma atroviride 
IMI 206040]
Length=74

 Score = 63.5 bits (153),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 45/70 (64%), Gaps = 2/70 (3%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKH  244
            GNG K++  RERN  K+KG   SQL  N++AM+IQC++C  TF+ TT      EHA+ KH
Sbjct  2    GNGAKAQQKRERN-AKDKGVAKSQLKVNQQAMDIQCQICKSTFLKTTKAPALLEHAQNKH  60

Query  245  PKSDVGTCFP  274
             K  +  CFP
Sbjct  61   TKG-LADCFP  69



>gb|EWG36770.1| hypothetical protein FVEG_00661 [Fusarium verticillioides 7600]
Length=74

 Score = 63.5 bits (153),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 48/73 (66%), Gaps = 2/73 (3%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKH  244
            GNG K++  RERN  K+K    SQL  N+KA +IQC++C  TF+ TT     +EHAE KH
Sbjct  2    GNGAKAQQKRERNA-KDKSTAKSQLKVNEKACDIQCQICKSTFLKTTKAPALKEHAENKH  60

Query  245  PKSDVGTCFPHLK  283
             K+ +  CFP+++
Sbjct  61   SKT-IADCFPNVQ  72



>ref|XP_003656580.1| hypothetical protein THITE_2121407 [Thielavia terrestris NRRL 
8126]
 gb|AEO70244.1| hypothetical protein THITE_2121407 [Thielavia terrestris NRRL 
8126]
Length=79

 Score = 63.5 bits (153),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 43/76 (57%), Gaps = 1/76 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNG K+   R RN +K     GSQL SN  AMNI C  C Q+F+ T+ E +   HA 
Sbjct  1    MGGGNGAKAAQKRARNNQKIATKPGSQLKSNAAAMNIICAQCKQSFLSTSREPQLTLHAV  60

Query  236  AKHPKSDVGTCFPHLK  283
             KH  + +  CFP  K
Sbjct  61   NKH-NATLPQCFPDFK  75



>gb|EGU79639.1| hypothetical protein FOXB_09922 [Fusarium oxysporum Fo5176]
 gb|EMT61542.1| hypothetical protein FOC4_g10014605 [Fusarium oxysporum f. sp. 
cubense race 4]
 gb|ENH61354.1| hypothetical protein FOC1_g10016168 [Fusarium oxysporum f. sp. 
cubense race 1]
 emb|CCT63446.1| uncharacterized protein FFUJ_00714 [Fusarium fujikuroi IMI 58289]
 gb|EWY93113.1| hypothetical protein FOYG_06446 [Fusarium oxysporum FOSC 3-a]
 gb|EWZ51573.1| hypothetical protein FOZG_01612 [Fusarium oxysporum Fo47]
 gb|EWZ90951.1| hypothetical protein FOWG_06721 [Fusarium oxysporum f. sp. lycopersici 
MN25]
 gb|EXA52165.1| hypothetical protein FOVG_00570 [Fusarium oxysporum f. sp. pisi 
HDV247]
 gb|EXK48874.1| hypothetical protein FOMG_01622 [Fusarium oxysporum f. sp. melonis 
26406]
 gb|EXK95942.1| hypothetical protein FOQG_03159 [Fusarium oxysporum f. sp. raphani 
54005]
 gb|EXL43611.1| hypothetical protein FOCG_13999 [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
 gb|EXL89622.1| hypothetical protein FOPG_00253 [Fusarium oxysporum f. sp. conglutinans 
race 2 54008]
 gb|EXM11947.1| hypothetical protein FOIG_01409 [Fusarium oxysporum f. sp. cubense 
tropical race 4 54006]
 gb|EXM11948.1| hypothetical protein FOIG_01409 [Fusarium oxysporum f. sp. cubense 
tropical race 4 54006]
 gb|EXM11949.1| hypothetical protein FOIG_01409 [Fusarium oxysporum f. sp. cubense 
tropical race 4 54006]
 gb|EXM30154.1| hypothetical protein FOTG_04240 [Fusarium oxysporum f. sp. vasinfectum 
25433]
Length=74

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 48/73 (66%), Gaps = 2/73 (3%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKH  244
            GNG K++  RERN  K+K    SQL  N+KA +IQC++C  TF+ TT     +EHAE KH
Sbjct  2    GNGAKAQQKRERNA-KDKNTAKSQLKVNEKACDIQCQICKSTFLKTTKAPALKEHAENKH  60

Query  245  PKSDVGTCFPHLK  283
             K+ +  CFP+++
Sbjct  61   SKT-IADCFPNVQ  72



>emb|CDH50296.1| conserved hypothetical protein [Lichtheimia corymbifera JMRC:FSU:9682]
Length=78

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 43/70 (61%), Gaps = 1/70 (1%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKH  244
            GNGQK++M RERN +    A  SQL  N  A NI C  C QTF+CT  E +  EHAE KH
Sbjct  2    GNGQKAQMRRERNAKAAGKAANSQLKVNAAAKNIICVQCRQTFLCTAREKQLSEHAENKH  61

Query  245  PKSDVGTCFP  274
             K+ V  CFP
Sbjct  62   SKT-VKDCFP  70



>ref|XP_965005.1| hypothetical protein NCU02602 [Neurospora crassa OR74A]
 gb|EAA35769.1| hypothetical protein NCU02602 [Neurospora crassa OR74A]
 gb|EGZ77901.1| DUF1909-domain-containing protein [Neurospora tetrasperma FGSC 
2509]
 gb|KHE90040.1| DUF1909-domain-containing protein [Neurospora crassa]
Length=80

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 42/73 (58%), Gaps = 1/73 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNG K+   RERN +       SQL +N  AMNI C+ C  TF+ T+      EHA+
Sbjct  1    MGGGNGAKAAQKRERNAKNAAAGPKSQLKTNAAAMNIICQTCRATFLSTSRAKALDEHAQ  60

Query  236  AKHPKSDVGTCFP  274
             KH K+ +  CFP
Sbjct  61   NKHNKT-LADCFP  72



>dbj|GAA99781.1| hypothetical protein E5Q_06484 [Mixia osmundae IAM 14324]
 gb|KEI37840.1| hypothetical protein L969DRAFT_52118 [Mixia osmundae IAM 14324]
Length=79

 Score = 63.2 bits (152),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 44/75 (59%), Gaps = 3/75 (4%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKG--SQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREH  229
            MGGGNG KS  AR+R   K K   G  SQL SN  ++ IQCK C+QTF  TT      EH
Sbjct  1    MGGGNGAKSAEARKRAEAKAKSNAGGKSQLKSNAASLTIQCKTCLQTFQQTTKAPMLEEH  60

Query  230  AEAKHPKSDVGTCFP  274
            A+ +H K  +  CFP
Sbjct  61   AQNRHSKG-LKDCFP  74



>ref|XP_007832966.1| hypothetical protein PFICI_06194 [Pestalotiopsis fici W106-1]
 gb|ETS81192.1| hypothetical protein PFICI_06194 [Pestalotiopsis fici W106-1]
Length=74

 Score = 63.2 bits (152),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 47/70 (67%), Gaps = 2/70 (3%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKH  244
            GNG K++  RERN + +K AK SQL  N+ AM+IQC++C  TF+ TT   +  +HA+ KH
Sbjct  2    GNGAKAQQKRERNAKDSKVAK-SQLKVNQAAMDIQCQICKSTFLKTTRAPQLEQHAQNKH  60

Query  245  PKSDVGTCFP  274
             K+ +  CFP
Sbjct  61   SKA-IADCFP  69



>ref|XP_006680569.1| hypothetical protein BATDEDRAFT_90170 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF79084.1| hypothetical protein BATDEDRAFT_90170 [Batrachochytrium dendrobatidis 
JAM81]
Length=74

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 41/72 (57%), Gaps = 1/72 (1%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKH  244
            GNG K+ M R+R+ +  KG K SQL +N+ AMNI C +C QTF+ T       EH   KH
Sbjct  2    GNGAKAAMRRDRSEKDAKGGK-SQLKTNQAAMNIICSICRQTFLQTIKRKALEEHVAGKH  60

Query  245  PKSDVGTCFPHL  280
               D   CFP+ 
Sbjct  61   AGKDFKLCFPNF  72



>ref|XP_008780578.1| PREDICTED: uncharacterized protein At2g23090-like, partial [Phoenix 
dactylifera]
Length=38

 Score = 62.4 bits (150),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQ  169
            MGGGN QKSKMARE+N++KNK +KGSQL+SNKKAM IQ
Sbjct  1    MGGGNAQKSKMAREKNMDKNKASKGSQLESNKKAMTIQ  38



>ref|XP_002320702.1| hypothetical protein POPTR_0014s01870g [Populus trichocarpa]
 gb|EEE99017.1| hypothetical protein POPTR_0014s01870g [Populus trichocarpa]
Length=49

 Score = 62.4 bits (150),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 38/44 (86%), Gaps = 1/44 (2%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNK-GAKGSQLDSNKKAMNIQCKVCM  184
            MGGGNGQK+KMARE+NLEK K G+KGSQL+SNKKAM+IQ    +
Sbjct  1    MGGGNGQKAKMAREKNLEKQKAGSKGSQLESNKKAMSIQVFTAL  44



>gb|KHG23789.1| Prolyl 4-hydroxylase subunit alpha-1 [Gossypium arboreum]
Length=340

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +2

Query  44   ISEIMGGGNGQKSKMARERNLEKNK-GAKGSQLDSNKKAMNIQC  172
            +S  MGGGN QKSKMARE+NLEK K  AKGSQLDSNKKAM IQ 
Sbjct  278  LSSTMGGGNAQKSKMAREKNLEKQKAAAKGSQLDSNKKAMTIQI  321



>emb|CDO72440.1| hypothetical protein BN946_scf184977.g141 [Trametes cinnabarina]
Length=74

 Score = 62.4 bits (150),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKH  244
            GNG K+   RERN  K      SQL  N++AMNI C+ C QTF+ TT      EHA+ KH
Sbjct  2    GNGAKAAQKRERNAAKAASGPKSQLKVNQQAMNIICQTCRQTFLLTTRPPALEEHAQNKH  61

Query  245  PKSDVGTCFPHLKK  286
             K+ +  CFP+  K
Sbjct  62   GKT-MAECFPNAGK  74



>gb|KFH66696.1| hypothetical protein MVEG_07221 [Mortierella verticillata NRRL 
6337]
Length=78

 Score = 62.4 bits (150),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 41/70 (59%), Gaps = 1/70 (1%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKH  244
            GNGQK++M RERN +   G   SQL  N+ A NI C+ C QTF+CT       EHA  KH
Sbjct  2    GNGQKAQMKRERNAKNAGGDAKSQLKVNEAAKNIVCQTCRQTFLCTIRAKALEEHATNKH  61

Query  245  PKSDVGTCFP  274
             K  +  CFP
Sbjct  62   SKPLL-ECFP  70



>gb|ABK26523.1| unknown [Picea sitchensis]
Length=66

 Score = 62.0 bits (149),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQ  169
            MGGGNGQK+KMARE+N EKNK  KGSQL++NKKAM+IQ
Sbjct  1    MGGGNGQKAKMAREKNNEKNKAPKGSQLETNKKAMSIQ  38



>emb|CCA77885.1| hypothetical protein PIIN_00530 [Piriformospora indica DSM 11827]
Length=76

 Score = 62.0 bits (149),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 40/76 (53%), Gaps = 1/76 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNG K+   RERN  K      S L SN+   NI C+ C Q F  TT      EH++
Sbjct  1    MGGGNGAKAAQKRERNAAKAGKTANSTLKSNEAQKNIICQTCRQAFFVTTRAPALEEHSQ  60

Query  236  AKHPKSDVGTCFPHLK  283
             KH K+ +  CFP  K
Sbjct  61   NKHSKT-IAECFPDFK  75



>ref|XP_008033154.1| DUF1909-domain-containing protein [Trametes versicolor FP-101664 
SS1]
 gb|EIW64890.1| DUF1909-domain-containing protein [Trametes versicolor FP-101664 
SS1]
Length=74

 Score = 62.0 bits (149),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 41/70 (59%), Gaps = 1/70 (1%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKH  244
            GNG K++  RERN  K  G   SQ  +N+ A+NI C VC QTF+ TT      EHA+ +H
Sbjct  2    GNGAKAQQKRERNAAKAGGTAKSQTKTNQAALNIICSVCKQTFLLTTRLPALEEHAQNRH  61

Query  245  PKSDVGTCFP  274
             K+    CFP
Sbjct  62   SKT-AAECFP  70



>gb|EHK25265.1| hypothetical protein TRIVIDRAFT_215398 [Trichoderma virens Gv29-8]
Length=75

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 43/70 (61%), Gaps = 1/70 (1%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKH  244
            GNG K++  RERN EK   A  SQL  N +AM+IQC++C  TF+ TT      EHA+ KH
Sbjct  2    GNGAKAQQKRERNNEKGGKAAKSQLKVNAQAMDIQCQICKSTFLKTTKAPALLEHAQNKH  61

Query  245  PKSDVGTCFP  274
             K  +  CFP
Sbjct  62   SKG-MPECFP  70



>ref|XP_003658614.1| hypothetical protein MYCTH_2294582 [Myceliophthora thermophila 
ATCC 42464]
 gb|AEO53369.1| hypothetical protein MYCTH_2294582 [Myceliophthora thermophila 
ATCC 42464]
Length=81

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 43/77 (56%), Gaps = 2/77 (3%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLE-KNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MGGGNG K+   R RN + KN     SQL SN  AMNI C +C Q F+ T+ E +   HA
Sbjct  1    MGGGNGAKAAQKRARNEKHKNVPKAASQLKSNAAAMNIICAICKQAFLSTSREPQLTLHA  60

Query  233  EAKHPKSDVGTCFPHLK  283
              KH  + +  CFP  K
Sbjct  61   VNKH-NATLPQCFPDFK  76



>ref|XP_006966546.1| predicted protein [Trichoderma reesei QM6a]
 gb|EGR47417.1| predicted protein [Trichoderma reesei QM6a]
 gb|ETS00922.1| DUF1909-domain-containing protein [Trichoderma reesei RUT C-30]
Length=76

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 42/70 (60%), Gaps = 1/70 (1%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKH  244
            GNG K++  RERN EK      SQL  N +AM+IQC++C  TF+ TT      EHA+ KH
Sbjct  2    GNGAKAQQKRERNNEKGGKTAKSQLKVNAQAMDIQCQICKSTFLKTTKAPALTEHAQNKH  61

Query  245  PKSDVGTCFP  274
             K  +  CFP
Sbjct  62   NKG-LADCFP  70



>emb|CDP22572.1| Putative protein of unknown function [Podospora anserina S mat+]
Length=79

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 46/79 (58%), Gaps = 2/79 (3%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNG K+   R RN +       SQL SN+KAMNI C +C QTF+ T+ + +  +H+ 
Sbjct  1    MGGGNGAKAAQKRARNAKDAAPKAASQLKSNEKAMNIICNICKQTFLSTSRKPQLEQHSS  60

Query  236  A-KHP-KSDVGTCFPHLKK  286
            + KH  K     CFP  K+
Sbjct  61   SGKHAGKHTFEQCFPEYKE  79



>emb|CCI48451.1| unnamed protein product [Albugo candida]
Length=86

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 50/86 (58%), Gaps = 12/86 (14%)
 Frame = +2

Query  56   MGGGNGQKSKMARERN--------LEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSE  211
            MGGGNGQKSK  R+RN         +K  G    ++ ++K+A  I+CK+C+ TFM T S 
Sbjct  1    MGGGNGQKSKTKRDRNNEKKMKEQKQKLHGETRGKMTADKEA--IRCKICLTTFMVTASP  58

Query  212  VKCREHAEAKHPK--SDVGTCFPHLK  283
            V   +H E+KH      +  CFPHL+
Sbjct  59   VALTDHFESKHVSKGYTIAQCFPHLE  84



>ref|XP_001349951.1| conserved protein, unknown function [Plasmodium falciparum 3D7]
 emb|CAD52359.1| conserved protein, unknown function [Plasmodium falciparum 3D7]
 gb|ETW59616.1| hypothetical protein PFMC_04427 [Plasmodium falciparum CAMP/Malaysia]
 gb|EUR66209.1| hypothetical protein PFBG_04499 [Plasmodium falciparum 7G8]
 gb|EUT81248.1| hypothetical protein PFAG_04464 [Plasmodium falciparum Santa 
Lucia]
 emb|CDO66006.1| conserved protein, unknown function [Plasmodium reichenowi]
Length=78

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 45/75 (60%), Gaps = 3/75 (4%)
 Frame = +2

Query  56   MG-GGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHA  232
            MG G N  K   ARER   + KG K SQL +NK+A+N+ CKVC   FM T S  +  EHA
Sbjct  1    MGKGSNACKRNQARERKNVEVKGGK-SQLKANKEALNVTCKVCYTVFMQTQSISQLAEHA  59

Query  233  EAKHPKSDVGTCFPH  277
            E KH K DV  CFP 
Sbjct  60   ENKHNK-DVKECFPQ  73



>emb|CDS13635.1| hypothetical protein LRAMOSA05811 [Absidia idahoensis var. thermophila]
Length=80

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 42/73 (58%), Gaps = 1/73 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            M    GQK++M RERN +    A  SQL  N  A NI C  C QTF+CT  E +  EHAE
Sbjct  1    MDNLQGQKAQMRRERNAKAAGKAANSQLKVNAAAKNIICVQCRQTFLCTAREKQLSEHAE  60

Query  236  AKHPKSDVGTCFP  274
             KH K+ V  CFP
Sbjct  61   NKHSKT-VKDCFP  72



>ref|XP_001273653.1| conserved hypothetical protein [Aspergillus clavatus NRRL 1]
 gb|EAW12227.1| conserved hypothetical protein [Aspergillus clavatus NRRL 1]
Length=78

 Score = 60.1 bits (144),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 42/72 (58%), Gaps = 1/72 (1%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKH  244
            GNG K+   RERN +  KG+  SQL  N+ A +I C VC QTF+ TT      EHA  KH
Sbjct  2    GNGAKAASKRERNAKDAKGSAKSQLKVNEAAKDIMCNVCRQTFLRTTRAPALTEHASNKH  61

Query  245  PKSDVGTCFPHL  280
             K+ +  CFP+ 
Sbjct  62   SKT-LQDCFPNF  72



>ref|XP_009263068.1| hypothetical protein FPSE_11676 [Fusarium pseudograminearum CS3096]
 ref|XP_011316628.1| hypothetical protein FGSG_00894 [Fusarium graminearum PH-1]
 gb|EKJ68209.1| hypothetical protein FPSE_11676 [Fusarium pseudograminearum CS3096]
 gb|ESU06143.1| hypothetical protein FGSG_00894 [Fusarium graminearum PH-1]
 gb|EYB26296.1| hypothetical protein FG05_00894 [Fusarium graminearum]
 emb|CEF72928.1| unnamed protein product [Fusarium graminearum]
Length=73

 Score = 60.1 bits (144),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 44/70 (63%), Gaps = 2/70 (3%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKH  244
            GNG K++  RER   K+K    SQL  N+KA +IQC++C  TF+ TT     +EHAE KH
Sbjct  2    GNGAKAQQKRER-AAKDKNTAKSQLKVNEKACDIQCQICKSTFLKTTKAPALKEHAENKH  60

Query  245  PKSDVGTCFP  274
             K+ +  CFP
Sbjct  61   SKT-IADCFP  69



>emb|CDJ64233.1| Small conserved protein, related [Eimeria necatrix]
Length=76

 Score = 60.1 bits (144),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 41/72 (57%), Gaps = 1/72 (1%)
 Frame = +2

Query  71   GQKSKMARERNLEKN-KGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKHP  247
            G +  + RER   +N +G + S L S  K +N+ C+VC QTFMCT       +H E+KHP
Sbjct  4    GNQRDVDRERAQRRNQRGMQNSTLKSKDKNLNVVCEVCRQTFMCTIKRPTLEQHMESKHP  63

Query  248  KSDVGTCFPHLK  283
            K     CFP+ +
Sbjct  64   KHQFRDCFPNFE  75



>gb|KIW67281.1| hypothetical protein PV04_06546 [Capronia semiimmersa]
Length=72

 Score = 59.7 bits (143),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNG K+   RERN +  K    SQL SN KA  I+CK+C  TF  T++     +HA 
Sbjct  1    MGGGNGAKAAQKRERNAKDAKKDPQSQLKSNAKAQTIKCKICFGTFQSTSARKSLEDHAS  60

Query  236  AKHPK  250
             KH K
Sbjct  61   NKHSK  65



>ref|XP_002364670.1| hypothetical protein, conserved [Toxoplasma gondii ME49]
 gb|KFG49731.1| hypothetical protein TGP89_314800 [Toxoplasma gondii p89]
 gb|KFG66271.1| hypothetical protein TGRUB_464968 [Toxoplasma gondii RUB]
Length=77

 Score = 59.7 bits (143),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = +2

Query  62   GGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAK  241
            G N  K   AR R  E       SQL SN+ AM+I+CKVCMQ FM T S  +  EHA  K
Sbjct  4    GSNACKKNTARARADEAKSKEPKSQLKSNQAAMSIKCKVCMQPFMKTQSVAQLNEHAANK  63

Query  242  HPKSDVGTCFPHL  280
            H K+ V  CFP +
Sbjct  64   HNKT-VAECFPEM  75



>ref|XP_011134451.1| zinc-binding protein [Gregarina niphandrodes]
 gb|EZG69273.1| zinc-binding protein [Gregarina niphandrodes]
Length=453

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 46/85 (54%), Gaps = 2/85 (2%)
 Frame = +2

Query  35   PFPISEIMGGGNGQKSKMARERNLEKNKGAK--GSQLDSNKKAMNIQCKVCMQTFMCTTS  208
            P P   +     G + ++AR +NL+K   A    S L    KAM I CKVC Q FMCT++
Sbjct  369  PLPKFNVSSMARGNQRELARAKNLKKQAEASKAHSTLKEKDKAMTILCKVCRQAFMCTST  428

Query  209  EVKCREHAEAKHPKSDVGTCFPHLK  283
            +    +H +AKHPK+    CF  LK
Sbjct  429  KQILTQHVDAKHPKNQYSDCFDELK  453



>ref|XP_007299063.1| DUF1909-domain-containing protein [Stereum hirsutum FP-91666 
SS1]
 gb|EIM92762.1| DUF1909-domain-containing protein [Stereum hirsutum FP-91666 
SS1]
Length=74

 Score = 59.7 bits (143),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 45/72 (63%), Gaps = 4/72 (6%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKGS--QLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEA  238
            GNG K++  RERN +KN GAKGS  Q   N+ A NI C+VC Q F+ TT      EH++ 
Sbjct  2    GNGAKAQQKRERNADKN-GAKGSKSQAKVNEAAKNIVCQVCRQPFLVTTRAPALEEHSQN  60

Query  239  KHPKSDVGTCFP  274
            KH K+ +  CFP
Sbjct  61   KHSKT-MAECFP  71



>gb|ENH77376.1| transmembrane protein [Colletotrichum orbiculare MAFF 240422]
Length=74

 Score = 59.7 bits (143),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKH  244
            GNG K++  RERN +K+   KGSQL  N  A +IQC++C  TF+ TT      EHAE KH
Sbjct  2    GNGAKAQQKRERN-QKDAKNKGSQLKVNAAAKDIQCQICKATFLKTTKAPALTEHAENKH  60

Query  245  PKSDVGTCFPHL  280
             K  +  CFP  
Sbjct  61   SKG-LPECFPSF  71



>gb|KIW04468.1| hypothetical protein PV09_04728 [Verruconis gallopava]
Length=70

 Score = 59.3 bits (142),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 35/69 (51%), Gaps = 0/69 (0%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKH  244
            GNG K+   RER     K   GSQL SN  A  I+CKVC QTF  T+     +EH   KH
Sbjct  2    GNGAKAAQRRERKAADEKKGGGSQLKSNAAAQTIKCKVCFQTFQSTSKPAALQEHVNNKH  61

Query  245  PKSDVGTCF  271
             K     CF
Sbjct  62   EKKTYADCF  70



>gb|AFK34204.1| unknown [Medicago truncatula]
Length=60

 Score = 51.6 bits (122),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 1/36 (3%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGA-KGSQLDSNKKAM  160
            MGGGNGQK+KMARERNLEK K A KGSQL+ NKK+ 
Sbjct  1    MGGGNGQKAKMARERNLEKQKQAGKGSQLEKNKKSY  36


 Score = 34.7 bits (78),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +1

Query  148  QKGHEYPVQGMHANIYVHNIRGEVQRA  228
            +K +   VQG+HANIY+H+IR EVQ A
Sbjct  33   KKSYVNSVQGVHANIYLHHIRSEVQGA  59



>gb|KDN64182.1| hypothetical protein CSUB01_03335 [Colletotrichum sublineola]
Length=74

 Score = 59.3 bits (142),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 43/70 (61%), Gaps = 2/70 (3%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKH  244
            GNG K++  R+RN  K+   KGSQL +N  A +IQC++C  TF+ TT      EHAE KH
Sbjct  2    GNGAKAQQKRDRN-AKDAKPKGSQLKANAAAKDIQCQICKATFLKTTKAPALTEHAENKH  60

Query  245  PKSDVGTCFP  274
             K  +  CFP
Sbjct  61   SKG-LPDCFP  69



>ref|XP_007599963.1| hypothetical protein CFIO01_07639 [Colletotrichum fioriniae PJ7]
 gb|EXF76382.1| hypothetical protein CFIO01_07639 [Colletotrichum fioriniae PJ7]
Length=74

 Score = 59.3 bits (142),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 42/70 (60%), Gaps = 2/70 (3%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKH  244
            GNG K++  R+RN  K+   KGSQL  N  A +IQC++C  TF+ TT      EHAE KH
Sbjct  2    GNGAKAQQKRDRN-AKDAKPKGSQLKVNAAAKDIQCQICKSTFLKTTKAPALTEHAENKH  60

Query  245  PKSDVGTCFP  274
             K  +  CFP
Sbjct  61   SKG-LADCFP  69



>emb|CCF45008.1| hypothetical protein CH063_03482 [Colletotrichum higginsianum]
Length=74

 Score = 59.3 bits (142),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 42/72 (58%), Gaps = 2/72 (3%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKH  244
            GNG K++  R+RN  K+   KGSQL  N  A +IQC++C  TF+ TT      EHAE KH
Sbjct  2    GNGAKAQQKRDRN-AKDAKLKGSQLKVNAAAKDIQCQICKATFLKTTKAPALTEHAENKH  60

Query  245  PKSDVGTCFPHL  280
             K  +  CFP  
Sbjct  61   SKG-LADCFPSF  71



>ref|XP_008883461.1| hypothetical protein HHA_314800 [Hammondia hammondi]
 gb|KEP65915.1| hypothetical protein HHA_314800 [Hammondia hammondi]
Length=77

 Score = 59.3 bits (142),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = +2

Query  62   GGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAK  241
            G N  K   AR R  E       SQL SN+ AM+I+CKVCMQ FM T S  +  EHA  K
Sbjct  4    GSNACKKNTARARADEAKSKEPKSQLKSNQAAMSIKCKVCMQPFMKTQSVAQLNEHAANK  63

Query  242  HPKSDVGTCFPHL  280
            H K+ V  CFP +
Sbjct  64   HNKT-VAECFPEM  75



>gb|KDN44927.1| DUF1909-domain-containing protein [Tilletiaria anomala UBC 951]
Length=74

 Score = 59.3 bits (142),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 42/70 (60%), Gaps = 1/70 (1%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKH  244
            GNG K++  RERN + +K    SQL  N+ A NIQC  C QTF+ TT      +HA+ +H
Sbjct  2    GNGAKAQQKRERNAKDSKKGPTSQLKVNEAAKNIQCMTCRQTFLATTRSPALIQHAQDRH  61

Query  245  PKSDVGTCFP  274
             K+ +  CFP
Sbjct  62   SKT-LKECFP  70



>ref|XP_003885374.1| conserved hypothetical protein [Neospora caninum Liverpool]
 emb|CBZ55346.1| conserved hypothetical protein [Neospora caninum Liverpool]
Length=77

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = +2

Query  62   GGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAK  241
            G N  K   AR R  E       SQL SN+ AM+I+CK+CMQ FM T S  +  EHA  K
Sbjct  4    GSNACKKNTARARADEAKTKEPKSQLKSNQAAMSIKCKICMQPFMKTQSVAQLNEHATNK  63

Query  242  HPKSDVGTCFPHL  280
            H K+ V  CFP +
Sbjct  64   HNKT-VAECFPDM  75



>emb|CDJ37011.1| Small conserved protein, related [Eimeria tenella]
Length=76

 Score = 58.5 bits (140),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 40/72 (56%), Gaps = 1/72 (1%)
 Frame = +2

Query  71   GQKSKMARERNLEKN-KGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKHP  247
            G +  + RER   +N +G + S L S  K +N+ C+VC Q FMCT       +H E+KHP
Sbjct  4    GNQRDVDRERAQRRNQRGVQNSTLKSKDKNLNVVCEVCRQAFMCTIKRPTLEQHMESKHP  63

Query  248  KSDVGTCFPHLK  283
            K     CFP+ +
Sbjct  64   KHQFRDCFPNFE  75



>gb|EFQ25551.1| hypothetical protein GLRG_00695 [Colletotrichum graminicola M1.001]
Length=74

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 42/72 (58%), Gaps = 2/72 (3%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKH  244
            GNG K++  R+RN  K+   KGSQL  N  A +IQC++C  TF+ TT      EHAE KH
Sbjct  2    GNGAKAQQKRDRN-AKDAKPKGSQLKVNAAAKDIQCQICKATFLKTTKAPALTEHAENKH  60

Query  245  PKSDVGTCFPHL  280
             K  +  CFP  
Sbjct  61   SKG-LPDCFPSF  71



>gb|KFY53500.1| hypothetical protein V496_07534 [Pseudogymnoascus pannorum VKM 
F-4515 (FW-2607)]
 gb|KFY87317.1| hypothetical protein V500_07037 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
 gb|KFY98670.1| hypothetical protein V498_01324 [Pseudogymnoascus pannorum VKM 
F-4517 (FW-2822)]
 gb|KFZ04252.1| hypothetical protein V502_10291 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=77

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 43/75 (57%), Gaps = 1/75 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNG K+   RER  +  K    SQ   N++AM++QC +C  TF+ T+      EHA 
Sbjct  1    MGGGNGAKAASKRERAAKDAKPTAKSQKKVNEQAMDVQCNICKATFLKTSRAPALTEHAT  60

Query  236  AKHPKSDVGTCFPHL  280
             KH K+ +  CFP+ 
Sbjct  61   NKHSKT-LPECFPNF  74



>gb|KIL94747.1| hypothetical protein FAVG1_01678 [Fusarium avenaceum]
Length=73

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 44/70 (63%), Gaps = 2/70 (3%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKH  244
            GNG K++  RER   K+K    SQL  N+KA +IQC+VC  TF+ TT     +EHAE KH
Sbjct  2    GNGAKAQQKRER-AAKDKSTAKSQLKVNEKACDIQCQVCKSTFLKTTKGPALKEHAENKH  60

Query  245  PKSDVGTCFP  274
             K+ +  CFP
Sbjct  61   SKT-IEECFP  69



>ref|XP_009155990.1| hypothetical protein HMPREF1120_03662 [Exophiala dermatitidis 
NIH/UT8656]
 gb|EHY55529.1| hypothetical protein HMPREF1120_03662 [Exophiala dermatitidis 
NIH/UT8656]
Length=70

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 40/69 (58%), Gaps = 1/69 (1%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKH  244
            GNG K+ M RERN + +K    SQL SN KA +I+CK+C  TF  T +     EHA  KH
Sbjct  2    GNGAKAAMKRERNAKDSKKEPSSQLKSNAKAQSIKCKICFSTFQSTMARKGLEEHASNKH  61

Query  245  PKSDVGTCF  271
             K +   CF
Sbjct  62   SK-NYEDCF  69



>emb|CEG83425.1| Putative Transmembrane protein [Rhizopus microsporus]
Length=69

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 41/64 (64%), Gaps = 2/64 (3%)
 Frame = +2

Query  86   MARERNLEKNKGAKG-SQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKHPKSDVG  262
            M RERN ++N+   G SQL +N  A NI CK C QTF+CT+ E    EHA+ KH K+ + 
Sbjct  1    MKRERNAKQNQKKDGASQLKANAAAKNIICKTCFQTFLCTSREKALTEHAQNKHNKT-MK  59

Query  263  TCFP  274
             CFP
Sbjct  60   ECFP  63



>gb|EWC74801.1| hypothetical protein C923_04541 [Plasmodium falciparum UGT5.1]
Length=74

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 41/67 (61%), Gaps = 2/67 (3%)
 Frame = +2

Query  77   KSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKHPKSD  256
            K   ARER   + KG K SQL +NK+A+N+ CKVC   FM T S  +  EHAE KH K D
Sbjct  5    KRNQARERKNVEVKGGK-SQLKANKEALNVTCKVCYTVFMQTQSISQLAEHAENKHNK-D  62

Query  257  VGTCFPH  277
            V  CFP 
Sbjct  63   VKECFPQ  69



>ref|XP_007734193.1| hypothetical protein A1O3_05883 [Capronia epimyces CBS 606.96]
 gb|EXJ85208.1| hypothetical protein A1O3_05883 [Capronia epimyces CBS 606.96]
Length=70

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 39/69 (57%), Gaps = 1/69 (1%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKH  244
            GNG K+   RERN +  K    SQL SN KA +I+CK+C  TF  TT+     EHA  KH
Sbjct  2    GNGAKAAQKRERNAKDGKKEPNSQLKSNAKAQSIKCKICFATFQSTTARKGLDEHASNKH  61

Query  245  PKSDVGTCF  271
             KS    CF
Sbjct  62   SKS-YEDCF  69



>ref|XP_009514480.1| hypothetical protein PHYSODRAFT_353379 [Phytophthora sojae]
 gb|EGZ27205.1| hypothetical protein PHYSODRAFT_353379 [Phytophthora sojae]
Length=84

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 46/81 (57%), Gaps = 8/81 (10%)
 Frame = +2

Query  56   MGGGNGQKSKMARERN-LEKNKGAKGSQLDSNKKAMN-----IQCKVCMQTFMCTTSEVK  217
            MGGGNGQKS   RERN L+K K AK      +K  M      I+CK+CM TF+ T S+ +
Sbjct  1    MGGGNGQKSATKRERNNLKKMKDAKQKNHAESKAKMEADKNGIKCKICMTTFLITASKSQ  60

Query  218  CREHAEAKHPKS--DVGTCFP  274
              +H E+KH      +  CFP
Sbjct  61   LNDHYESKHSAKGFTIEQCFP  81



>gb|ETW17240.1| hypothetical protein PFFVO_04064 [Plasmodium falciparum Vietnam 
Oak-Knoll (FVO)]
Length=77

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 41/67 (61%), Gaps = 2/67 (3%)
 Frame = +2

Query  77   KSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKHPKSD  256
            K   ARER   + KG K SQL +NK+A+N+ CKVC   FM T S  +  EHAE KH K D
Sbjct  8    KRNQARERKNVEVKGGK-SQLKANKEALNVTCKVCYTVFMQTQSISQLAEHAENKHNK-D  65

Query  257  VGTCFPH  277
            V  CFP 
Sbjct  66   VKECFPQ  72



>gb|KII93434.1| hypothetical protein PLICRDRAFT_171189 [Plicaturopsis crispa 
FD-325 SS-3]
Length=74

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 43/76 (57%), Gaps = 5/76 (7%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKG--SQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEA  238
            GNG K++  RERN +K  GAKG  SQ   N+ A NI C  C Q F+ TT      EHA+ 
Sbjct  2    GNGAKAQQKRERNADK--GAKGGKSQAKVNEAAKNIVCATCKQPFLTTTRAPALEEHAQN  59

Query  239  KHPKSDVGTCFPHLKK  286
            KH K+ +  CFP   K
Sbjct  60   KHSKT-IADCFPTFAK  74



>ref|XP_007282243.1| hypothetical protein CGGC5_10725 [Colletotrichum gloeosporioides 
Nara gc5]
 gb|ELA28685.1| hypothetical protein CGGC5_10725 [Colletotrichum gloeosporioides 
Nara gc5]
 gb|EQB49502.1| hypothetical protein CGLO_11161 [Colletotrichum gloeosporioides 
Cg-14]
Length=74

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 42/72 (58%), Gaps = 2/72 (3%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKH  244
            GNG K++  R+R  +K+   KGSQL  N  A +IQC++C  TF+ TT      EHAE KH
Sbjct  2    GNGAKAQQKRDR-AQKDAKPKGSQLKVNAAAKDIQCQICKATFLKTTKAPALTEHAENKH  60

Query  245  PKSDVGTCFPHL  280
             K  +  CFP  
Sbjct  61   SKG-LADCFPSF  71



>ref|XP_007879706.1| hypothetical protein PFL1_03992 [Pseudozyma flocculosa PF-1]
 gb|EPQ28689.1| hypothetical protein PFL1_03992 [Pseudozyma flocculosa PF-1]
Length=74

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 40/70 (57%), Gaps = 1/70 (1%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKH  244
            GNG K++  RERN +   G   SQ   N+ A N+ C  C QTF+ T  E   ++HAE KH
Sbjct  2    GNGAKAQQKRERNAKAAGGVAKSQTKVNEAAKNVMCMTCRQTFLLTVREPALKQHAEDKH  61

Query  245  PKSDVGTCFP  274
             K+ +  CFP
Sbjct  62   NKT-LAECFP  70



>gb|ETW40990.1| hypothetical protein PFNF135_04626 [Plasmodium falciparum NF135/5.C10]
Length=72

 Score = 57.4 bits (137),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 40/62 (65%), Gaps = 2/62 (3%)
 Frame = +2

Query  89   ARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKHPKSDVGTC  268
            ARER   + KG K SQL +NK+A+N+ CKVC   FM T S  +  EHAE KH K DV  C
Sbjct  7    ARERKNVEVKGGK-SQLKANKEALNVTCKVCYTVFMQTQSISQLAEHAENKHNK-DVKEC  64

Query  269  FP  274
            FP
Sbjct  65   FP  66



>gb|KIM32736.1| hypothetical protein M408DRAFT_326478 [Serendipita vermifera 
MAFF 305830]
Length=80

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 41/75 (55%), Gaps = 1/75 (1%)
 Frame = +2

Query  56   MGGGNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAE  235
            MGGGNG K+   R RN ++   +  S L SN+ A +I C VC Q+F  TT      EHA 
Sbjct  1    MGGGNGAKAAQKRARNAKEAGTSAKSSLKSNEAAKSIICGVCKQSFFITTRAPALEEHAT  60

Query  236  AKHPKSDVGTCFPHL  280
             +H K+ +  CFP  
Sbjct  61   NRHSKT-LAECFPSF  74



>gb|ETW47626.1| hypothetical protein PFMALIP_04318 [Plasmodium falciparum MaliPS096_E11]
Length=86

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 42/67 (63%), Gaps = 2/67 (3%)
 Frame = +2

Query  74   QKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKHPKS  253
            +K   ARER   + KG K SQL +NK+A+N+ CKVC   FM T S  +  EHAE KH K 
Sbjct  16   KKRNQARERKNVEVKGGK-SQLKANKEALNVTCKVCYTVFMQTQSISQLAEHAENKHNK-  73

Query  254  DVGTCFP  274
            DV  CFP
Sbjct  74   DVKECFP  80



>gb|ESA15328.1| hypothetical protein GLOINDRAFT_24007 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX51967.1| hypothetical protein RirG_257240 [Rhizophagus irregularis DAOM 
197198w]
Length=79

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 41/70 (59%), Gaps = 1/70 (1%)
 Frame = +2

Query  65   GNGQKSKMARERNLEKNKGAKGSQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKH  244
            GNGQK++  RER     K    SQL +N+ A NI C+VC  TF+CT  +    EHA+ KH
Sbjct  2    GNGQKAQHKRERAKNDAKKGPTSQLKTNEAAKNIVCQVCRNTFLCTVRKKALEEHADNKH  61

Query  245  PKSDVGTCFP  274
             K  +  CFP
Sbjct  62   GKK-LEECFP  70



>emb|CEG83424.1| Putative Transmembrane protein [Rhizopus microsporus]
Length=86

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 41/64 (64%), Gaps = 2/64 (3%)
 Frame = +2

Query  86   MARERNLEKNKGAKG-SQLDSNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKHPKSDVG  262
            M RERN ++N+   G SQL +N  A NI CK C QTF+CT+ E    EHA+ KH K+ + 
Sbjct  1    MKRERNAKQNQKKDGASQLKANAAAKNIICKTCFQTFLCTSREKALTEHAQNKHNKT-MK  59

Query  263  TCFP  274
             CFP
Sbjct  60   ECFP  63



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 561614547535