BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001F10

Length=604
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009617253.1|  PREDICTED: cytochrome P450 CYP72A219-like          213   3e-62   Nicotiana tomentosiformis
ref|XP_006348303.1|  PREDICTED: secologanin synthase-like               211   1e-61   Solanum tuberosum [potatoes]
ref|XP_006360179.1|  PREDICTED: secologanin synthase-like               211   1e-61   Solanum tuberosum [potatoes]
ref|XP_009781171.1|  PREDICTED: cytochrome P450 CYP72A219-like          208   3e-61   Nicotiana sylvestris
ref|XP_009617254.1|  PREDICTED: cytochrome P450 CYP72A219-like          209   7e-61   Nicotiana tomentosiformis
ref|XP_004244272.1|  PREDICTED: cytochrome P450 CYP72A219-like          208   1e-60   Solanum lycopersicum
ref|XP_006348304.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    208   2e-60   Solanum tuberosum [potatoes]
ref|XP_009797873.1|  PREDICTED: cytochrome P450 CYP72A219-like          208   2e-60   Nicotiana sylvestris
gb|ABC69422.1|  CYP72A58                                                207   2e-60   Nicotiana tabacum [American tobacco]
ref|XP_006363763.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      207   5e-60   Solanum tuberosum [potatoes]
ref|XP_009789309.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    206   1e-59   Nicotiana sylvestris
ref|XP_009789316.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    206   1e-59   Nicotiana sylvestris
ref|XP_009620491.1|  PREDICTED: cytochrome P450 CYP72A219-like          205   2e-59   Nicotiana tomentosiformis
ref|XP_009618785.1|  PREDICTED: cytochrome P450 CYP72A219-like          205   4e-59   Nicotiana tomentosiformis
ref|XP_006348911.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      204   4e-59   Solanum tuberosum [potatoes]
gb|ABC69393.1|  CYP72A55v2                                              204   5e-59   Nicotiana tabacum [American tobacco]
emb|CBI22134.3|  unnamed protein product                                203   1e-58   Vitis vinifera
ref|XP_002270326.1|  PREDICTED: cytochrome P450 CYP72A219               203   2e-58   Vitis vinifera
ref|XP_004244273.1|  PREDICTED: cytochrome P450 CYP72A219-like          203   2e-58   
ref|XP_006348302.1|  PREDICTED: secologanin synthase-like               202   3e-58   Solanum tuberosum [potatoes]
ref|XP_009790250.1|  PREDICTED: cytochrome P450 CYP72A219-like          202   4e-58   Nicotiana sylvestris
ref|XP_011082968.1|  PREDICTED: cytochrome P450 CYP72A219-like          202   4e-58   Sesamum indicum [beniseed]
ref|XP_004243845.1|  PREDICTED: cytochrome P450 CYP72A219-like          202   4e-58   Solanum lycopersicum
emb|CBI39895.3|  unnamed protein product                                194   5e-58   Vitis vinifera
gb|ABC69392.1|  CYP72A55v1                                              201   7e-58   Nicotiana tabacum [American tobacco]
emb|CDP19599.1|  unnamed protein product                                201   7e-58   Coffea canephora [robusta coffee]
gb|EYU31631.1|  hypothetical protein MIMGU_mgv1a004628mg                197   1e-57   Erythranthe guttata [common monkey flower]
ref|XP_004243253.1|  PREDICTED: cytochrome P450 CYP72A219               200   2e-57   Solanum lycopersicum
emb|CDP19600.1|  unnamed protein product                                199   3e-57   Coffea canephora [robusta coffee]
ref|XP_002271303.2|  PREDICTED: cytochrome P450 CYP72A219-like          199   5e-57   Vitis vinifera
gb|KDO52098.1|  hypothetical protein CISIN_1g038814mg                   190   5e-57   Citrus sinensis [apfelsine]
emb|CDP15975.1|  unnamed protein product                                198   1e-56   Coffea canephora [robusta coffee]
emb|CDP15981.1|  unnamed protein product                                198   1e-56   Coffea canephora [robusta coffee]
gb|EYU31630.1|  hypothetical protein MIMGU_mgv1a004628mg                197   2e-56   Erythranthe guttata [common monkey flower]
emb|CAN63404.1|  hypothetical protein VITISV_001871                     196   2e-56   Vitis vinifera
emb|CBI22139.3|  unnamed protein product                                194   3e-56   Vitis vinifera
ref|XP_006364092.1|  PREDICTED: secologanin synthase-like               197   4e-56   Solanum tuberosum [potatoes]
ref|XP_004244274.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    196   6e-56   Solanum lycopersicum
gb|EYU43426.1|  hypothetical protein MIMGU_mgv1a018638mg                192   6e-56   Erythranthe guttata [common monkey flower]
ref|XP_006363756.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      196   7e-56   Solanum tuberosum [potatoes]
emb|CBI22133.3|  unnamed protein product                                198   7e-56   Vitis vinifera
emb|CAN72247.1|  hypothetical protein VITISV_024665                     189   2e-55   Vitis vinifera
emb|CDP19609.1|  unnamed protein product                                194   3e-55   Coffea canephora [robusta coffee]
ref|XP_004488669.1|  PREDICTED: secologanin synthase-like               194   4e-55   Cicer arietinum [garbanzo]
ref|XP_010645072.1|  PREDICTED: cytochrome P450 CYP72A219-like          191   4e-55   Vitis vinifera
ref|XP_002270501.2|  PREDICTED: cytochrome P450 CYP72A219-like          194   5e-55   Vitis vinifera
gb|KEH38478.1|  cytochrome P450 family 72 protein                       194   5e-55   Medicago truncatula
ref|XP_004248200.1|  PREDICTED: cytochrome P450 CYP72A219-like          194   6e-55   Solanum lycopersicum
ref|XP_011082820.1|  PREDICTED: cytochrome P450 CYP72A219-like          193   6e-55   Sesamum indicum [beniseed]
ref|XP_006348906.1|  PREDICTED: secologanin synthase-like               193   1e-54   Solanum tuberosum [potatoes]
ref|XP_006594768.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      193   1e-54   Glycine max [soybeans]
ref|XP_010644729.1|  PREDICTED: cytochrome P450 CYP72A219-like          192   1e-54   Vitis vinifera
ref|XP_009797437.1|  PREDICTED: cytochrome P450 CYP72A219-like          192   1e-54   Nicotiana sylvestris
ref|XP_007213922.1|  hypothetical protein PRUPE_ppa004271mg             192   2e-54   
emb|CDP15982.1|  unnamed protein product                                192   2e-54   Coffea canephora [robusta coffee]
gb|AHK60841.1|  CYP72A225                                               192   2e-54   Catharanthus roseus [chatas]
emb|CDP15988.1|  unnamed protein product                                192   2e-54   Coffea canephora [robusta coffee]
emb|CAN72443.1|  hypothetical protein VITISV_032856                     184   3e-54   Vitis vinifera
ref|XP_002268319.1|  PREDICTED: cytochrome P450 CYP72A219               191   3e-54   
ref|XP_002265455.1|  PREDICTED: cytochrome P450 CYP72A219               191   3e-54   Vitis vinifera
emb|CBI39916.3|  unnamed protein product                                191   3e-54   Vitis vinifera
emb|CDP19608.1|  unnamed protein product                                190   4e-54   Coffea canephora [robusta coffee]
ref|NP_001291324.1|  cytochrome P450 CYP72A219-like                     191   6e-54   Sesamum indicum [beniseed]
gb|EYU31636.1|  hypothetical protein MIMGU_mgv1a004595mg                191   6e-54   Erythranthe guttata [common monkey flower]
ref|XP_007022099.1|  Cytochrome P450, family 72, subfamily A, pol...    191   7e-54   
ref|XP_009339350.1|  PREDICTED: cytochrome P450 CYP72A219-like          191   7e-54   
ref|XP_008226210.1|  PREDICTED: cytochrome P450 CYP72A219-like          191   7e-54   Prunus mume [ume]
emb|CDP15983.1|  unnamed protein product                                191   8e-54   Coffea canephora [robusta coffee]
ref|XP_006495013.1|  PREDICTED: secologanin synthase-like               191   8e-54   Citrus sinensis [apfelsine]
ref|XP_008226211.1|  PREDICTED: cytochrome P450 CYP72A219-like          190   1e-53   Prunus mume [ume]
ref|XP_009602242.1|  PREDICTED: cytochrome P450 CYP72A219-like          190   1e-53   Nicotiana tomentosiformis
emb|CDP15986.1|  unnamed protein product                                189   2e-53   Coffea canephora [robusta coffee]
ref|XP_009615907.1|  PREDICTED: cytochrome P450 CYP72A219-like          189   2e-53   Nicotiana tomentosiformis
gb|ABC69419.1|  CYP72A56                                                189   2e-53   Nicotiana tabacum [American tobacco]
emb|CDP19607.1|  unnamed protein product                                189   3e-53   Coffea canephora [robusta coffee]
ref|XP_011082966.1|  PREDICTED: cytochrome P450 CYP72A219-like          189   3e-53   Sesamum indicum [beniseed]
ref|XP_004243254.1|  PREDICTED: cytochrome P450 CYP72A219-like          189   3e-53   Solanum lycopersicum
ref|XP_006598137.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    189   4e-53   Glycine max [soybeans]
gb|KHN44056.1|  Secologanin synthase                                    189   4e-53   Glycine soja [wild soybean]
gb|AJD25167.1|  cytochrome P450 CYP72A326                               188   5e-53   Salvia miltiorrhiza [Chinese salvia]
emb|CDP19601.1|  unnamed protein product                                188   7e-53   Coffea canephora [robusta coffee]
emb|CBI39884.3|  unnamed protein product                                187   8e-53   Vitis vinifera
gb|KGN66156.1|  hypothetical protein Csa_1G574240                       178   8e-53   Cucumis sativus [cucumbers]
ref|XP_006477947.1|  PREDICTED: secologanin synthase-like               181   1e-52   
ref|XP_010644780.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    187   1e-52   Vitis vinifera
ref|XP_004151605.1|  PREDICTED: secologanin synthase-like               183   1e-52   
ref|XP_002263609.1|  PREDICTED: cytochrome P450 CYP72A219               187   1e-52   Vitis vinifera
ref|XP_002263652.1|  PREDICTED: cytochrome P450 CYP72A219-like          187   1e-52   Vitis vinifera
ref|XP_007212438.1|  hypothetical protein PRUPE_ppa016770mg             187   1e-52   
ref|XP_002265784.2|  PREDICTED: cytochrome P450 CYP72A219-like          187   1e-52   Vitis vinifera
gb|KEH28455.1|  cytochrome P450 family 72 protein                       185   2e-52   Medicago truncatula
ref|XP_006598136.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    184   2e-52   
gb|KEH38475.1|  cytochrome P450 family 72 protein                       187   2e-52   Medicago truncatula
ref|XP_003634773.1|  PREDICTED: cytochrome P450 CYP72A219               187   2e-52   Vitis vinifera
emb|CBI22131.3|  unnamed protein product                                186   2e-52   Vitis vinifera
ref|XP_009356840.1|  PREDICTED: cytochrome P450 CYP72A219-like          187   2e-52   Pyrus x bretschneideri [bai li]
ref|XP_009343587.1|  PREDICTED: cytochrome P450 CYP72A219-like          186   2e-52   Pyrus x bretschneideri [bai li]
emb|CBI39886.3|  unnamed protein product                                187   2e-52   Vitis vinifera
gb|KJB12898.1|  hypothetical protein B456_002G043200                    186   3e-52   Gossypium raimondii
gb|EYU30744.1|  hypothetical protein MIMGU_mgv1a004594mg                186   3e-52   Erythranthe guttata [common monkey flower]
ref|XP_004243261.1|  PREDICTED: cytochrome P450 CYP72A219-like          186   3e-52   
ref|XP_010644781.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    186   3e-52   Vitis vinifera
ref|XP_008386388.1|  PREDICTED: cytochrome P450 CYP72A219-like          186   4e-52   Malus domestica [apple tree]
ref|XP_004166890.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    186   5e-52   
ref|XP_010465361.1|  PREDICTED: cytochrome P450 72A13-like              186   5e-52   Camelina sativa [gold-of-pleasure]
dbj|BAF98466.1|  cytochrome P450                                        186   5e-52   Coptis japonica var. dissecta
ref|XP_009615908.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    186   5e-52   Nicotiana tomentosiformis
ref|XP_009339349.1|  PREDICTED: cytochrome P450 CYP72A219-like          186   5e-52   Pyrus x bretschneideri [bai li]
ref|XP_002262693.1|  PREDICTED: cytochrome P450 CYP72A219               186   5e-52   Vitis vinifera
ref|XP_011082818.1|  PREDICTED: cytochrome P450 CYP72A219-like          186   5e-52   Sesamum indicum [beniseed]
ref|XP_006442294.1|  hypothetical protein CICLE_v10024650mg             179   6e-52   
ref|XP_008386157.1|  PREDICTED: cytochrome P450 CYP72A219-like          185   7e-52   
ref|XP_004135800.1|  PREDICTED: secologanin synthase-like               185   7e-52   
ref|XP_009790251.1|  PREDICTED: cytochrome P450 CYP72A219-like          185   7e-52   Nicotiana sylvestris
ref|XP_003617766.1|  Cytochrome P450 monooxygenase CYP72A59             185   8e-52   Medicago truncatula
dbj|BAL45206.1|  cytochrome P450 monooxygenase                          185   8e-52   Glycyrrhiza uralensis [Chinese licorice]
gb|KEH38473.1|  cytochrome P450 family 72 protein                       183   1e-51   Medicago truncatula
gb|KHN44057.1|  Secologanin synthase                                    185   1e-51   Glycine soja [wild soybean]
ref|XP_007022096.1|  Cytochrome P450, family 72, subfamily A, pol...    184   1e-51   
ref|XP_003546751.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    185   1e-51   Glycine max [soybeans]
ref|XP_009607556.1|  PREDICTED: cytochrome P450 CYP72A219-like          184   1e-51   Nicotiana tomentosiformis
ref|XP_006348901.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    184   1e-51   Solanum tuberosum [potatoes]
ref|XP_004171842.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    186   2e-51   
gb|ABC69390.1|  CYP72A53v1                                              184   2e-51   Nicotiana tabacum [American tobacco]
ref|XP_010327256.1|  PREDICTED: cytochrome P450 CYP72A219-like          182   2e-51   
ref|XP_004243263.1|  PREDICTED: cytochrome P450 CYP72A219-like          184   2e-51   Solanum lycopersicum
emb|CAN67740.1|  hypothetical protein VITISV_015554                     184   2e-51   Vitis vinifera
ref|XP_009411225.1|  PREDICTED: cytochrome P450 72A15-like              175   2e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008367417.1|  PREDICTED: cytochrome P450 CYP72A219-like          177   3e-51   
ref|XP_007149353.1|  hypothetical protein PHAVU_005G063300g             184   3e-51   Phaseolus vulgaris [French bean]
ref|XP_006377672.1|  hypothetical protein POPTR_0011s101202g            181   3e-51   
emb|CDP15972.1|  unnamed protein product                                181   3e-51   Coffea canephora [robusta coffee]
ref|XP_004244382.2|  PREDICTED: cytochrome P450 CYP72A219-like          183   3e-51   
ref|XP_007149352.1|  hypothetical protein PHAVU_005G063200g             183   4e-51   Phaseolus vulgaris [French bean]
gb|KDO52111.1|  hypothetical protein CISIN_1g046539mg                   182   4e-51   Citrus sinensis [apfelsine]
ref|XP_009758460.1|  PREDICTED: cytochrome P450 CYP72A219-like          183   4e-51   Nicotiana sylvestris
ref|XP_004166892.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    183   4e-51   
ref|XP_009796418.1|  PREDICTED: cytochrome P450 CYP72A219-like          183   5e-51   Nicotiana sylvestris
emb|CBI22129.3|  unnamed protein product                                181   5e-51   Vitis vinifera
ref|XP_009628921.1|  PREDICTED: cytochrome P450 CYP72A219-like          183   5e-51   Nicotiana tomentosiformis
emb|CDX97593.1|  BnaA05g24860D                                          183   5e-51   
ref|XP_006477888.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      183   5e-51   Citrus sinensis [apfelsine]
gb|ABC69389.1|  CYP72A52v1                                              183   5e-51   Nicotiana tabacum [American tobacco]
ref|XP_006442317.1|  hypothetical protein CICLE_v10023602mg             183   5e-51   
emb|CDP15985.1|  unnamed protein product                                182   6e-51   Coffea canephora [robusta coffee]
gb|KHG14489.1|  Secologanin synthase                                    183   6e-51   Gossypium arboreum [tree cotton]
ref|XP_009146333.1|  PREDICTED: cytochrome P450 72A13-like              182   6e-51   Brassica rapa
ref|XP_004243257.1|  PREDICTED: cytochrome P450 CYP72A219-like          182   8e-51   Solanum lycopersicum
gb|EYU38228.1|  hypothetical protein MIMGU_mgv1a004669mg                182   8e-51   Erythranthe guttata [common monkey flower]
ref|XP_006495014.1|  PREDICTED: secologanin synthase-like               182   8e-51   Citrus sinensis [apfelsine]
ref|XP_010327096.1|  PREDICTED: cytochrome P450 CYP72A219-like          176   8e-51   
gb|KJB12905.1|  hypothetical protein B456_002G043600                    179   8e-51   Gossypium raimondii
ref|XP_008226217.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    182   9e-51   Prunus mume [ume]
ref|XP_010092742.1|  Secologanin synthase                               182   1e-50   Morus notabilis
ref|XP_008450754.1|  PREDICTED: cytochrome P450 CYP72A219-like          182   1e-50   Cucumis melo [Oriental melon]
ref|XP_008366858.1|  PREDICTED: cytochrome P450 CYP72A219-like          182   1e-50   
ref|XP_006348982.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      185   1e-50   
ref|XP_004243260.1|  PREDICTED: cytochrome P450 CYP72A219               182   1e-50   Solanum lycopersicum
ref|XP_008226302.1|  PREDICTED: cytochrome P450 CYP72A219-like          182   1e-50   
gb|ABC69417.1|  CYP72A54                                                182   1e-50   Nicotiana tabacum [American tobacco]
ref|XP_011009102.1|  PREDICTED: cytochrome P450 72A15-like isofor...    182   1e-50   Populus euphratica
gb|AJD25170.1|  cytochrome P450 CYP72A329                               181   2e-50   Salvia miltiorrhiza [Chinese salvia]
gb|KJB12900.1|  hypothetical protein B456_002G043400                    179   2e-50   Gossypium raimondii
gb|EYU31635.1|  hypothetical protein MIMGU_mgv1a025572mg                181   2e-50   Erythranthe guttata [common monkey flower]
ref|XP_007022098.1|  Cytochrome P450, family 72, subfamily A, pol...    181   2e-50   
ref|XP_006348910.1|  PREDICTED: secologanin synthase-like               181   2e-50   Solanum tuberosum [potatoes]
ref|XP_007022097.1|  Cytochrome P450, family 72, subfamily A, pol...    181   2e-50   
ref|XP_008226215.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    181   2e-50   Prunus mume [ume]
sp|H2DH21.1|C7A29_PANGI  RecName: Full=Cytochrome P450 CYP72A219;...    181   3e-50   Panax ginseng [Asiatic ginseng]
ref|XP_006477887.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      181   3e-50   Citrus sinensis [apfelsine]
ref|XP_006407055.1|  hypothetical protein EUTSA_v10020534mg             181   3e-50   Eutrema salsugineum [saltwater cress]
emb|CDP15976.1|  unnamed protein product                                181   3e-50   Coffea canephora [robusta coffee]
ref|XP_006364094.1|  PREDICTED: secologanin synthase-like               181   3e-50   Solanum tuberosum [potatoes]
emb|CDY32348.1|  BnaC01g36670D                                          181   4e-50   Brassica napus [oilseed rape]
ref|XP_009394213.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    180   5e-50   
gb|KJB26994.1|  hypothetical protein B456_004G270700                    180   5e-50   Gossypium raimondii
ref|XP_008226216.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    180   5e-50   Prunus mume [ume]
ref|XP_009594691.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    178   5e-50   Nicotiana tomentosiformis
ref|XP_009394212.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    180   5e-50   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFO64616.1|  cytochrome P450 mono-oxygenase                          180   6e-50   Artemisia annua [sweet Annie]
ref|XP_004294188.2|  PREDICTED: cytochrome P450 72A15-like              180   6e-50   Fragaria vesca subsp. vesca
ref|XP_002882888.1|  CYP72A15                                           180   6e-50   
ref|XP_008226213.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    180   7e-50   Prunus mume [ume]
gb|KHN36820.1|  Secologanin synthase                                    179   8e-50   Glycine soja [wild soybean]
ref|XP_009411224.1|  PREDICTED: cytochrome P450 72A15-like              177   9e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009343590.1|  PREDICTED: cytochrome P450 CYP72A219-like          179   9e-50   Pyrus x bretschneideri [bai li]
gb|KGN55013.1|  hypothetical protein Csa_4G622230                       171   1e-49   Cucumis sativus [cucumbers]
ref|XP_011469476.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    176   1e-49   Fragaria vesca subsp. vesca
ref|XP_006348908.1|  PREDICTED: secologanin synthase-like               179   1e-49   Solanum tuberosum [potatoes]
gb|KJB12904.1|  hypothetical protein B456_002G043600                    179   1e-49   Gossypium raimondii
ref|XP_010694547.1|  PREDICTED: cytochrome P450 72A15-like              179   1e-49   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006442316.1|  hypothetical protein CICLE_v10024206mg             179   1e-49   Citrus clementina [clementine]
gb|KEH36886.1|  cytochrome P450 family monooxygenase                    176   1e-49   Medicago truncatula
ref|XP_009394211.1|  PREDICTED: cytochrome P450 CYP72A219-like          171   1e-49   
ref|XP_011469477.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    176   1e-49   Fragaria vesca subsp. vesca
ref|XP_006477946.1|  PREDICTED: secologanin synthase-like               179   1e-49   Citrus sinensis [apfelsine]
ref|XP_004294187.1|  PREDICTED: cytochrome P450 CYP72A219-like          179   1e-49   Fragaria vesca subsp. vesca
ref|XP_004243258.1|  PREDICTED: cytochrome P450 CYP72A219-like          179   2e-49   Solanum lycopersicum
ref|XP_009594690.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    179   2e-49   Nicotiana tomentosiformis
gb|KJB12906.1|  hypothetical protein B456_002G043600                    179   2e-49   Gossypium raimondii
dbj|BAL45203.1|  cytochrome P450 monooxygenase                          179   2e-49   Medicago truncatula
ref|XP_006348907.1|  PREDICTED: secologanin synthase-like               179   2e-49   Solanum tuberosum [potatoes]
ref|XP_006349622.1|  PREDICTED: secologanin synthase-like               179   2e-49   Solanum tuberosum [potatoes]
ref|XP_006364093.1|  PREDICTED: secologanin synthase-like               179   2e-49   
gb|KFK38823.1|  hypothetical protein AALP_AA3G165300                    178   2e-49   Arabis alpina [alpine rockcress]
gb|KHN14193.1|  Secologanin synthase                                    178   3e-49   Glycine soja [wild soybean]
ref|XP_010502020.1|  PREDICTED: cytochrome P450 72A13 isoform X2        178   3e-49   Camelina sativa [gold-of-pleasure]
gb|KJB12901.1|  hypothetical protein B456_002G043400                    178   3e-49   Gossypium raimondii
ref|XP_010502032.1|  PREDICTED: cytochrome P450 72A13-like isofor...    178   3e-49   
ref|XP_004295683.1|  PREDICTED: cytochrome P450 CYP72A219-like          178   3e-49   Fragaria vesca subsp. vesca
ref|XP_008452438.1|  PREDICTED: cytochrome P450 CYP72A219-like          178   3e-49   Cucumis melo [Oriental melon]
gb|KEH37984.1|  cytochrome P450 family 72 protein                       176   3e-49   Medicago truncatula
ref|XP_004243255.1|  PREDICTED: cytochrome P450 CYP72A219 isoform X1    178   3e-49   Solanum lycopersicum
gb|KEH38469.1|  cytochrome P450 family 709 protein                      178   4e-49   Medicago truncatula
ref|XP_008386384.1|  PREDICTED: cytochrome P450 CYP72A219-like          178   4e-49   
ref|XP_006477948.1|  PREDICTED: secologanin synthase-like               178   5e-49   Citrus sinensis [apfelsine]
gb|AJD25172.1|  cytochrome P450 CYP72A331                               177   5e-49   Salvia miltiorrhiza [Chinese salvia]
emb|CDP15977.1|  unnamed protein product                                169   5e-49   Coffea canephora [robusta coffee]
ref|XP_004243259.1|  PREDICTED: cytochrome P450 CYP72A219-like          177   5e-49   Solanum lycopersicum
ref|XP_009356829.1|  PREDICTED: cytochrome P450 CYP72A219-like          177   6e-49   Pyrus x bretschneideri [bai li]
emb|CDP06076.1|  unnamed protein product                                177   6e-49   Coffea canephora [robusta coffee]
ref|XP_011009101.1|  PREDICTED: cytochrome P450 CYP72A219-like          178   6e-49   Populus euphratica
gb|AIA82924.1|  SLS1                                                    177   7e-49   Gentiana rigescens
ref|XP_004242635.1|  PREDICTED: cytochrome P450 CYP72A219-like          177   7e-49   Solanum lycopersicum
ref|XP_011098146.1|  PREDICTED: cytochrome P450 CYP72A219-like          177   8e-49   Sesamum indicum [beniseed]
ref|XP_010465357.1|  PREDICTED: cytochrome P450 72A13-like              177   8e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010275244.1|  PREDICTED: cytochrome P450 CYP72A219-like          177   1e-48   Nelumbo nucifera [Indian lotus]
ref|XP_010487266.1|  PREDICTED: cytochrome P450 72A13-like              177   1e-48   Camelina sativa [gold-of-pleasure]
ref|XP_006343585.1|  PREDICTED: secologanin synthase-like               176   1e-48   Solanum tuberosum [potatoes]
ref|XP_006348909.1|  PREDICTED: secologanin synthase-like               176   1e-48   
ref|XP_009394210.1|  PREDICTED: cytochrome P450 CYP72A219-like          177   1e-48   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX98486.1|  BnaC05g38890D                                          176   1e-48   
ref|XP_007227257.1|  hypothetical protein PRUPE_ppa017915mg             176   1e-48   Prunus persica
ref|XP_009343589.1|  PREDICTED: cytochrome P450 CYP72A219-like          176   2e-48   
ref|XP_004146005.1|  PREDICTED: secologanin synthase-like               176   2e-48   
ref|XP_004169020.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    176   2e-48   
ref|XP_009339373.1|  PREDICTED: cytochrome P450 CYP72A219-like          176   2e-48   Pyrus x bretschneideri [bai li]
ref|XP_008219216.1|  PREDICTED: cytochrome P450 CYP72A219-like          176   2e-48   Prunus mume [ume]
ref|XP_009116688.1|  PREDICTED: cytochrome P450 72A15-like              176   2e-48   Brassica rapa
emb|CDY20078.1|  BnaA01g29240D                                          176   2e-48   Brassica napus [oilseed rape]
gb|ABC59075.1|  cytochrome P450 monooxygenase CYP72A67                  176   2e-48   Medicago truncatula
ref|NP_188087.1|  cytochrome P450, family 72, subfamily A, polype...    176   2e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004248734.1|  PREDICTED: cytochrome P450 CYP72A219               176   2e-48   Solanum lycopersicum
gb|AJD25168.1|  cytochrome P450 CYP72A327                               176   2e-48   Salvia miltiorrhiza [Chinese salvia]
gb|KCW67646.1|  hypothetical protein EUGRSUZ_F01394                     176   3e-48   Eucalyptus grandis [rose gum]
ref|XP_010060783.1|  PREDICTED: cytochrome P450 72A15-like              176   3e-48   Eucalyptus grandis [rose gum]
ref|XP_008452436.1|  PREDICTED: cytochrome P450 CYP72A219-like          176   3e-48   Cucumis melo [Oriental melon]
ref|XP_006377693.1|  hypothetical protein POPTR_0011s10300g             175   4e-48   
ref|XP_006299550.1|  hypothetical protein CARUB_v10015724mg             175   4e-48   Capsella rubella
ref|XP_004307203.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    176   4e-48   Fragaria vesca subsp. vesca
gb|KHG18227.1|  Secologanin synthase                                    175   4e-48   Gossypium arboreum [tree cotton]
gb|EYU30753.1|  hypothetical protein MIMGU_mgv1a004802mg                175   5e-48   Erythranthe guttata [common monkey flower]
emb|CDP15973.1|  unnamed protein product                                175   6e-48   Coffea canephora [robusta coffee]
gb|KEH37983.1|  cytochrome P450 family 72 protein                       175   7e-48   Medicago truncatula
ref|XP_004488668.1|  PREDICTED: secologanin synthase-like               174   7e-48   Cicer arietinum [garbanzo]
gb|AGX93046.1|  secologanin synthase-like protein                       174   7e-48   Amsonia hubrichtii
ref|XP_007224159.1|  hypothetical protein PRUPE_ppa016446mg             174   7e-48   Prunus persica
ref|XP_010465353.1|  PREDICTED: cytochrome P450 72A13-like              174   7e-48   Camelina sativa [gold-of-pleasure]
ref|XP_004243262.1|  PREDICTED: cytochrome P450 CYP72A219-like          174   8e-48   Solanum lycopersicum
ref|XP_006477949.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    174   9e-48   Citrus sinensis [apfelsine]
gb|AGX93060.1|  7-deoxyloganic acid 7-hydroxylase-like protein          174   1e-47   Tabernaemontana elegans
ref|XP_009146335.1|  PREDICTED: cytochrome P450 72A15-like              174   1e-47   Brassica rapa
ref|XP_011082969.1|  PREDICTED: cytochrome P450 CYP72A219-like          174   1e-47   Sesamum indicum [beniseed]
dbj|BAL45204.1|  cytochrome P450 monooxygenase                          174   1e-47   Medicago truncatula
ref|XP_010060775.1|  PREDICTED: cytochrome P450 72A15-like              174   1e-47   Eucalyptus grandis [rose gum]
ref|XP_009116708.1|  PREDICTED: cytochrome P450 72A15-like isofor...    174   1e-47   Brassica rapa
gb|EPS71634.1|  hypothetical protein M569_03124                         166   1e-47   Genlisea aurea
ref|XP_006364091.1|  PREDICTED: secologanin synthase-like               174   1e-47   Solanum tuberosum [potatoes]
ref|XP_003605472.1|  Cytochrome P450 monooxygenase CYP72A61             171   1e-47   
ref|XP_009339348.1|  PREDICTED: cytochrome P450 CYP72A219-like          174   1e-47   Pyrus x bretschneideri [bai li]
emb|CDP15978.1|  unnamed protein product                                174   1e-47   Coffea canephora [robusta coffee]
ref|XP_010060782.1|  PREDICTED: cytochrome P450 72A15-like              174   1e-47   Eucalyptus grandis [rose gum]
ref|XP_010060778.1|  PREDICTED: cytochrome P450 72A15-like isofor...    174   2e-47   Eucalyptus grandis [rose gum]
gb|KFK38821.1|  hypothetical protein AALP_AA3G164800                    173   2e-47   Arabis alpina [alpine rockcress]
ref|XP_009394217.1|  PREDICTED: cytochrome P450 CYP72A219-like          174   2e-47   
gb|KGN55010.1|  hypothetical protein Csa_4G621220                       165   2e-47   Cucumis sativus [cucumbers]
ref|XP_009339365.1|  PREDICTED: cytochrome P450 CYP72A219-like          173   2e-47   Pyrus x bretschneideri [bai li]
emb|CDP15979.1|  unnamed protein product                                173   2e-47   Coffea canephora [robusta coffee]
ref|XP_004146006.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    173   2e-47   
emb|CAN72865.1|  hypothetical protein VITISV_029731                     173   2e-47   
ref|XP_004168302.1|  PREDICTED: secologanin synthase-like               173   2e-47   
ref|XP_010927467.1|  PREDICTED: cytochrome P450 72A15-like              173   2e-47   
gb|AGX93044.1|  secologanin synthase-like protein                       173   3e-47   
ref|XP_010060779.1|  PREDICTED: cytochrome P450 72A15-like isofor...    173   3e-47   
gb|ABC59077.1|  cytochrome P450 monooxygenase CYP72A68                  173   3e-47   
ref|XP_010926817.1|  PREDICTED: cytochrome P450 72A15-like isofor...    173   3e-47   
ref|XP_004243256.1|  PREDICTED: cytochrome P450 CYP72A219-like          173   3e-47   
gb|AGX93059.1|  7-deoxyloganic acid 7-hydroxylase-like protein          172   3e-47   
emb|CDX98485.1|  BnaC05g38900D                                          172   4e-47   
ref|XP_008798317.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    172   4e-47   
ref|XP_006495010.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      172   4e-47   
sp|Q05047.1|C72A1_CATRO  RecName: Full=Secologanin synthase; Shor...    172   4e-47   
ref|XP_010926808.1|  PREDICTED: cytochrome P450 72A15-like isofor...    172   4e-47   
ref|XP_008219294.1|  PREDICTED: cytochrome P450 CYP72A219-like          172   4e-47   
ref|XP_004248201.1|  PREDICTED: cytochrome P450 CYP72A219-like          172   4e-47   
gb|AJD25171.1|  cytochrome P450 CYP72A330                               172   5e-47   
emb|CDY32349.1|  BnaC01g36680D                                          172   5e-47   
gb|KHG20902.1|  Secologanin synthase                                    172   5e-47   
ref|XP_008226214.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    172   5e-47   
ref|XP_010060780.1|  PREDICTED: cytochrome P450 72A15-like              172   6e-47   
ref|XP_009394216.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    172   6e-47   
ref|XP_010502013.1|  PREDICTED: cytochrome P450 72A13 isoform X1        172   6e-47   
ref|XP_010926829.1|  PREDICTED: cytochrome P450 72A11-like              172   8e-47   
gb|EPS70870.1|  hypothetical protein M569_03891                         172   8e-47   
ref|XP_006407058.1|  hypothetical protein EUTSA_v10021993mg             171   8e-47   
ref|XP_011098149.1|  PREDICTED: cytochrome P450 CYP72A219-like          171   9e-47   
ref|XP_004488695.1|  PREDICTED: secologanin synthase-like               171   9e-47   
ref|XP_006442293.1|  hypothetical protein CICLE_v10024650mg             163   9e-47   
gb|KHN47456.1|  Secologanin synthase                                    172   9e-47   
ref|XP_003605471.1|  Cytochrome P450 monooxygenase CYP72A61             171   1e-46   
ref|XP_003543171.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      172   1e-46   
ref|XP_009135394.1|  PREDICTED: cytochrome P450 72A15-like              171   1e-46   
gb|AJD25169.1|  cytochrome P450 CYP72A328                               171   1e-46   
emb|CDX98484.1|  BnaC05g38910D                                          171   1e-46   
gb|ABC59078.1|  cytochrome P450 monooxygenase CYP72A59                  171   1e-46   
ref|XP_009790240.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    171   1e-46   
ref|XP_010465366.1|  PREDICTED: cytochrome P450 72A13-like              171   1e-46   
gb|ADO16184.1|  cytochrome P450 mono-oxygenase                          171   1e-46   
ref|XP_010676733.1|  PREDICTED: cytochrome P450 CYP72A219-like          171   1e-46   
ref|XP_003605470.1|  Cytochrome P450 monooxygenase CYP72A61             171   1e-46   
dbj|BAL45199.1|  cytochrome P450 monooxygenase                          171   2e-46   
ref|XP_010465355.1|  PREDICTED: cytochrome P450 72A15-like              171   2e-46   
ref|XP_010041835.1|  PREDICTED: cytochrome P450 72A15-like              168   3e-46   
gb|AGX93064.1|  secologanin synthase                                    170   3e-46   
ref|XP_010926800.1|  PREDICTED: cytochrome P450 72A15-like isofor...    170   3e-46   
ref|XP_010535012.1|  PREDICTED: cytochrome P450 72A13-like              170   3e-46   
gb|AGX93049.1|  secologanin synthase-like protein                       170   3e-46   
gb|AGX93058.1|  7-deoxyloganic acid 7-hydroxylase-like protein          170   4e-46   
gb|KFK38824.1|  hypothetical protein AALP_AA3G165400                    173   4e-46   
gb|ADU19849.1|  putative secologanin synthase                           169   5e-46   
ref|XP_010502007.1|  PREDICTED: cytochrome P450 72A15-like              169   6e-46   
gb|AFK42047.1|  unknown                                                 169   6e-46   
gb|KFK38825.1|  hypothetical protein AALP_AA3G165400                    172   7e-46   
gb|AGX93056.1|  7-deoxyloganic acid 7-hydroxylase-like protein          169   7e-46   
ref|XP_007149362.1|  hypothetical protein PHAVU_005G063900g             169   8e-46   
ref|XP_006495015.1|  PREDICTED: secologanin synthase-like               166   9e-46   
ref|XP_010465358.1|  PREDICTED: cytochrome P450 72A13-like isofor...    169   9e-46   
gb|AAA17732.1|  cytochrome P450                                         169   9e-46   
ref|XP_010685026.1|  PREDICTED: cytochrome P450 CYP72A219-like          169   9e-46   
ref|XP_010060776.1|  PREDICTED: cytochrome P450 72A15-like              169   1e-45   
emb|CDX82468.1|  BnaA03g33530D                                          169   1e-45   
dbj|BAL45198.1|  cytochrome P450 monooxygenase                          169   1e-45   
emb|CDY65330.1|  BnaC03g73760D                                          165   1e-45   
ref|XP_010487267.1|  PREDICTED: cytochrome P450 72A15-like              169   1e-45   
ref|XP_006300449.1|  hypothetical protein CARUB_v10020157mg             168   1e-45   
ref|XP_006495016.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    168   1e-45   
ref|XP_011460847.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    168   2e-45   
ref|XP_006495017.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    168   2e-45   
ref|XP_011098148.1|  PREDICTED: cytochrome P450 CYP72A219-like          168   2e-45   
emb|CDY51038.1|  BnaA06g03010D                                          168   2e-45   
ref|XP_010275181.1|  PREDICTED: cytochrome P450 CYP72A219-like          167   2e-45   
emb|CDX97592.1|  BnaA05g24870D                                          167   3e-45   
ref|XP_011083293.1|  PREDICTED: cytochrome P450 CYP72A219-like          167   4e-45   
ref|XP_010678727.1|  PREDICTED: cytochrome P450 CYP72A219-like          167   4e-45   
ref|XP_009146334.1|  PREDICTED: cytochrome P450 72A15                   167   5e-45   
ref|XP_010535013.1|  PREDICTED: cytochrome P450 72A13-like              167   5e-45   
ref|XP_006307236.1|  hypothetical protein CARUB_v10008841mg             167   5e-45   
ref|XP_003531823.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase iso...    167   6e-45   
gb|AGX93047.1|  secologanin synthase-like protein                       167   6e-45   
ref|XP_006477952.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      167   6e-45   
ref|XP_010926866.1|  PREDICTED: cytochrome P450 72A15-like              167   6e-45   
ref|NP_188083.1|  cytochrome P450, family 72, subfamily A, polype...    166   8e-45   
ref|XP_006297414.1|  hypothetical protein CARUB_v10013438mg             166   8e-45   
ref|XP_010910666.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    160   8e-45   
ref|XP_010465360.1|  PREDICTED: cytochrome P450 72A15                   166   8e-45   
ref|XP_010694548.1|  PREDICTED: cytochrome P450 CYP72A219-like          166   9e-45   
emb|CDY28093.1|  BnaC06g02740D                                          166   1e-44   
ref|XP_010275158.1|  PREDICTED: cytochrome P450 CYP72A219-like          166   1e-44   
gb|AEI59770.1|  cytochrome P450                                         166   1e-44   
ref|XP_006442299.1|  hypothetical protein CICLE_v100199322mg            159   1e-44   
ref|XP_003543172.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      166   1e-44   
gb|AAA17746.1|  cytochrome P450                                         166   1e-44   
ref|XP_004146075.1|  PREDICTED: secologanin synthase-like               166   2e-44   
ref|XP_004166891.1|  PREDICTED: secologanin synthase-like               166   2e-44   
gb|AEI59771.1|  cytochrome P450                                         165   2e-44   
ref|XP_010911572.1|  PREDICTED: cytochrome P450 CYP72A219-like          165   2e-44   
emb|CDX82471.1|  BnaA03g33500D                                          165   2e-44   
gb|AFO67233.1|  putative cytochrome P450 monooxygenase                  156   2e-44   
ref|XP_010540131.1|  PREDICTED: cytochrome P450 72C1-like isoform X1    165   2e-44   
ref|XP_010060773.1|  PREDICTED: cytochrome P450 72A15-like              165   2e-44   
gb|KGN55015.1|  hypothetical protein Csa_4G622740                       162   2e-44   
ref|XP_009394812.1|  PREDICTED: cytochrome P450 72A15-like              165   3e-44   
ref|XP_007131275.1|  hypothetical protein PHAVU_011G000200g             165   3e-44   
dbj|BAL45208.1|  cytochrome P450 monooxygenase                          165   3e-44   
ref|XP_008452437.1|  PREDICTED: cytochrome P450 CYP72A219-like          165   3e-44   
ref|XP_010068176.1|  PREDICTED: cytochrome P450 CYP72A219-like          156   4e-44   
gb|AGX93061.1|  7-deoxyloganic acid 7-hydroxylase-like protein          164   4e-44   
ref|XP_002458199.1|  hypothetical protein SORBIDRAFT_03g028600          164   5e-44   
ref|XP_004295684.1|  PREDICTED: cytochrome P450 CYP72A219-like          164   5e-44   
ref|XP_010241316.1|  PREDICTED: cytochrome P450 CYP72A219-like          164   5e-44   
gb|KCW67648.1|  hypothetical protein EUGRSUZ_F01396                     164   5e-44   
ref|XP_010927457.1|  PREDICTED: cytochrome P450 72A15-like              164   6e-44   
gb|EPS69403.1|  hypothetical protein M569_05363                         164   6e-44   
ref|XP_010676732.1|  PREDICTED: cytochrome P450 CYP72A219-like          164   7e-44   
ref|XP_010060784.1|  PREDICTED: cytochrome P450 72A15-like              164   7e-44   
ref|XP_009147881.1|  PREDICTED: cytochrome P450 72A15-like              163   8e-44   
ref|XP_007149364.1|  hypothetical protein PHAVU_005G064100g             164   8e-44   
gb|EPS61578.1|  hypothetical protein M569_13218                         163   8e-44   
ref|XP_008804072.1|  PREDICTED: cytochrome P450 72A15-like              164   9e-44   
ref|NP_188084.1|  cytochrome P450, family 72, subfamily A, polype...    163   1e-43   
emb|CDP15980.1|  unnamed protein product                                163   1e-43   
ref|XP_010927481.1|  PREDICTED: cytochrome P450 CYP72A219-like          163   1e-43   
emb|CDX97591.1|  BnaA05g24880D                                          162   1e-43   
emb|CDP11335.1|  unnamed protein product                                163   1e-43   
ref|XP_010676734.1|  PREDICTED: cytochrome P450 CYP72A219-like          163   2e-43   
ref|XP_010501993.1|  PREDICTED: cytochrome P450 72A13-like              162   2e-43   
dbj|BAP90521.1|  secologanin synthase                                   162   2e-43   
dbj|BAB02396.1|  cytochrome P450                                        162   2e-43   
ref|XP_007149376.1|  hypothetical protein PHAVU_005G065000g             162   2e-43   
ref|NP_188082.1|  cytochrome P450, family 72, subfamily A, polype...    162   2e-43   
ref|XP_010241317.1|  PREDICTED: cytochrome P450 CYP72A219-like          162   3e-43   
emb|CDY51036.1|  BnaA06g02990D                                          162   3e-43   
ref|XP_010242111.1|  PREDICTED: cytochrome P450 CYP72A219-like          161   4e-43   
ref|NP_188079.1|  cytochrome P450, family 72, subfamily A, polype...    161   4e-43   
ref|XP_010678917.1|  PREDICTED: cytochrome P450 72A15-like              162   4e-43   
ref|XP_010275170.1|  PREDICTED: cytochrome P450 CYP72A219-like          161   5e-43   
ref|XP_007149361.1|  hypothetical protein PHAVU_005G063800g             161   6e-43   
ref|XP_008785718.1|  PREDICTED: cytochrome P450 CYP72A219-like          161   6e-43   
gb|AGX93062.1|  CYP72A224 7-deoxyloganic acid 7-hydroxylase             161   6e-43   
ref|NP_001140686.1|  putative cytochrome P450 superfamily protein       161   7e-43   
ref|XP_008784422.1|  PREDICTED: cytochrome P450 CYP72A219-like          160   9e-43   
ref|XP_010465352.1|  PREDICTED: cytochrome P450 72A13-like              160   1e-42   
ref|XP_010487262.1|  PREDICTED: cytochrome P450 72A13-like              160   1e-42   
emb|CDY20075.1|  BnaA01g29270D                                          160   1e-42   
ref|XP_006830578.1|  hypothetical protein AMTR_s00117p00135230          154   2e-42   
ref|XP_007133274.1|  hypothetical protein PHAVU_011G165900g             152   2e-42   
gb|AGX93057.1|  7-deoxyloganic acid 7-hydroxylase-like protein          159   3e-42   
ref|XP_006416747.1|  hypothetical protein EUTSA_v10007523mg             159   3e-42   
gb|AFO67228.1|  putative cytochrome P450 72A                            150   3e-42   
ref|XP_011091092.1|  PREDICTED: cytochrome P450 CYP72A219-like          159   4e-42   
ref|XP_008784485.1|  PREDICTED: cytochrome P450 CYP72A219-like          159   4e-42   
ref|XP_010498047.1|  PREDICTED: cytochrome P450 72C1-like               159   4e-42   
gb|AGX93045.1|  secologanin synthase-like protein                       159   5e-42   
ref|XP_010459266.1|  PREDICTED: cytochrome P450 72C1 isoform X1         159   5e-42   
ref|XP_010476840.1|  PREDICTED: cytochrome P450 72C1-like               159   5e-42   
ref|XP_010064522.1|  PREDICTED: cytochrome P450 72A15-like              158   5e-42   
ref|XP_010542332.1|  PREDICTED: cytochrome P450 72A13-like              158   5e-42   
ref|XP_009116734.1|  PREDICTED: cytochrome P450 72A13-like isofor...    158   6e-42   
ref|XP_010926871.1|  PREDICTED: cytochrome P450 72A15-like isofor...    158   6e-42   
ref|XP_006442298.1|  hypothetical protein CICLE_v10019876mg             157   8e-42   
ref|XP_010487268.1|  PREDICTED: cytochrome P450 72A13-like              158   9e-42   
ref|XP_004300362.1|  PREDICTED: cytochrome P450 CYP72A219-like          158   1e-41   
gb|EYU26272.1|  hypothetical protein MIMGU_mgv1a018891mg                158   1e-41   
gb|KCW62995.1|  hypothetical protein EUGRSUZ_G00595                     158   1e-41   
emb|CDY64008.1|  BnaCnng42960D                                          157   1e-41   
ref|XP_010678723.1|  PREDICTED: cytochrome P450 CYP72A219-like          157   2e-41   
ref|XP_011091091.1|  PREDICTED: cytochrome P450 CYP72A219-like          157   2e-41   
emb|CDY67933.1|  BnaAnng25600D                                          157   2e-41   
ref|XP_009149145.1|  PREDICTED: cytochrome P450 72C1                    157   2e-41   
ref|XP_010683653.1|  PREDICTED: cytochrome P450 CYP72A219-like          156   2e-41   
ref|XP_010470433.1|  PREDICTED: cytochrome P450 72A13-like              157   3e-41   
ref|XP_010683652.1|  PREDICTED: cytochrome P450 CYP72A219-like          156   3e-41   
ref|XP_009116727.1|  PREDICTED: cytochrome P450 72A13-like isofor...    156   3e-41   
gb|KEH38471.1|  cytochrome P450 family monooxygenase                    156   3e-41   
ref|XP_004488667.1|  PREDICTED: secologanin synthase-like               156   4e-41   
ref|XP_010537688.1|  PREDICTED: cytochrome P450 72C1-like               156   5e-41   
ref|XP_003546748.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase iso...    155   5e-41   
gb|KFK43897.1|  hypothetical protein AALP_AA1G188200                    155   5e-41   
ref|XP_009394606.1|  PREDICTED: cytochrome P450 CYP72A219-like          149   6e-41   
gb|KFK38818.1|  hypothetical protein AALP_AA3G164500                    155   6e-41   
gb|EYU26273.1|  hypothetical protein MIMGU_mgv1a004412mg                155   6e-41   
ref|XP_002892932.1|  CYP72C1                                            155   7e-41   
ref|NP_173149.1|  cytochrome p450 72c1                                  155   7e-41   
gb|EYU26264.1|  hypothetical protein MIMGU_mgv1a004586mg                155   8e-41   
ref|XP_002870785.1|  CYP72C1                                            155   9e-41   
gb|EYU26274.1|  hypothetical protein MIMGU_mgv1a004552mg                155   1e-40   
emb|CDY21768.1|  BnaA09g45190D                                          155   1e-40   
ref|XP_009394814.1|  PREDICTED: cytochrome P450 72A13-like isofor...    155   1e-40   
gb|EPS61577.1|  hypothetical protein M569_13217                         155   1e-40   
ref|XP_009117728.1|  PREDICTED: cytochrome P450 72C1-like               155   1e-40   
sp|Q9SHG5.2|C72C1_ARATH  RecName: Full=Cytochrome P450 72C1; AltN...    155   1e-40   
ref|XP_010540137.1|  PREDICTED: cytochrome P450 72C1-like               154   1e-40   
gb|KDO52097.1|  hypothetical protein CISIN_1g039833mg                   145   2e-40   
gb|EPS65653.1|  hypothetical protein M569_09124                         154   2e-40   
ref|XP_010552154.1|  PREDICTED: cytochrome P450 72A15-like              154   2e-40   
ref|XP_010926840.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    154   3e-40   
ref|XP_008443404.1|  PREDICTED: cytochrome P450 CYP72A219-like          154   3e-40   
gb|EYU26263.1|  hypothetical protein MIMGU_mgv1a019274mg                154   3e-40   
ref|XP_006495011.1|  PREDICTED: cytochrome P450 72C1-like isoform X1    146   3e-40   
ref|NP_188086.1|  cytochrome P450, family 72, subfamily A, polype...    154   3e-40   
ref|XP_009394815.1|  PREDICTED: cytochrome P450 72A15-like              154   3e-40   
ref|XP_002882887.1|  CYP72A7                                            154   3e-40   
ref|XP_003525967.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      154   4e-40   
emb|CDY32351.1|  BnaC01g36700D                                          153   4e-40   
ref|XP_006830577.1|  hypothetical protein AMTR_s00117p00134960          153   4e-40   
ref|XP_004294189.1|  PREDICTED: cytochrome P450 72A15-like              153   4e-40   
gb|EPS71635.1|  hypothetical protein M569_03125                         146   6e-40   
gb|KHN44046.1|  Secologanin synthase                                    152   8e-40   
ref|XP_006598147.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      152   8e-40   
ref|XP_008386423.1|  PREDICTED: cytochrome P450 CYP72A219-like          152   1e-39   
ref|XP_008776863.1|  PREDICTED: cytochrome P450 72A15-like isofor...    152   1e-39   
gb|EPS68529.1|  hypothetical protein M569_06239                         149   1e-39   
gb|EYU26266.1|  hypothetical protein MIMGU_mgv1a0182362mg               150   1e-39   
emb|CDP06075.1|  unnamed protein product                                152   1e-39   
ref|XP_011091090.1|  PREDICTED: cytochrome P450 CYP72A219-like          151   2e-39   
ref|XP_010065484.1|  PREDICTED: cytochrome P450 CYP72A219-like          151   2e-39   
ref|XP_009395215.1|  PREDICTED: cytochrome P450 CYP72A219-like          151   2e-39   
ref|XP_009394813.1|  PREDICTED: cytochrome P450 72A13-like isofor...    151   2e-39   
gb|EPS61172.1|  hypothetical protein M569_13627                         151   3e-39   
ref|XP_009361686.1|  PREDICTED: cytochrome P450 72A15-like              151   3e-39   



>ref|XP_009617253.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
 gb|ABC69414.1| CYP72A57 [Nicotiana tabacum]
Length=518

 Score =   213 bits (541),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 131/175 (75%), Gaps = 0/175 (0%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVK  258
            +++I T     + + L+   WRVL WVWF+PK LEK L++ GLKGN Y+IL GDMKEL  
Sbjct  4    VQIIITASCAAIIITLVVCIWRVLNWVWFRPKKLEKLLRKQGLKGNSYKILYGDMKELSG  63

Query  259  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  438
            M  +A SKPM LSD++APR++P++     KYGK  +VW+GP P+V I DPEL+KE+ +KY
Sbjct  64   MIKEANSKPMNLSDDIAPRLVPFFLDTIKKYGKKSFVWLGPKPLVLIMDPELIKEIFSKY  123

Query  439  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             L+QKP  NP+ + LV+GLVS E+++WAKHR+++NPAF+ EKLK M PAF LSC+
Sbjct  124  YLYQKPHGNPVTKLLVQGLVSLEEDKWAKHRKIINPAFHLEKLKHMLPAFCLSCT  178



>ref|XP_006348303.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=519

 Score =   211 bits (538),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 132/179 (74%), Gaps = 4/179 (2%)
 Frame = +1

Query  79   MEVIYTLLGVC---VSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKE  249
            M+ I  L+ +C   ++V L    W+VL WVWF+PK LEK L++ GLKGN YRIL GDMK+
Sbjct  1    MDKIQILVTICCCVIAVALFVCLWKVLNWVWFRPKKLEKLLRKQGLKGNSYRILYGDMKD  60

Query  250  LVKMASDAISKPMTLS-DNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEV  426
               M  +A SKPM +S D+++PR++P++  +  KYGK C+ WMGP P + I DPEL+KEV
Sbjct  61   FSGMIKEANSKPMNISNDDLSPRLVPFFLEIIKKYGKKCFTWMGPRPQILIMDPELIKEV  120

Query  427  LNKYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            L+K  ++QKP  NPLG   V+GLV+YEK++WAKHR+++NPAF+ EKLK M PAF LSCS
Sbjct  121  LSKTYVYQKPHANPLGTLFVQGLVTYEKDKWAKHRKIINPAFHLEKLKHMLPAFYLSCS  179



>ref|XP_006360179.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=514

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 129/176 (73%), Gaps = 1/176 (1%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVK  258
            ME I  ++ +C     +   W+VL WVWF PK LE  L++ GLKGN YR+L GDMK++ +
Sbjct  1    METIQMIVTICCCAIAITLLWKVLNWVWFNPKKLENLLRKQGLKGNSYRLLYGDMKDVTR  60

Query  259  MASDAISKPMTLSD-NVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNK  435
            M  +A SKPM +SD ++APR++P++    +KYGK C+ WMGP P V I DPEL+KEVL+K
Sbjct  61   MIKEANSKPMNMSDHDLAPRMMPFFLETINKYGKKCFTWMGPKPQVLIMDPELIKEVLSK  120

Query  436  YELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
              L+QKP  NPLG   V+GLVSYEK++WAK+R+++NPAF+ EKLK M PAF LSCS
Sbjct  121  TYLYQKPGGNPLGSLFVQGLVSYEKDKWAKNRKIINPAFHLEKLKHMLPAFYLSCS  176



>ref|XP_009781171.1| PREDICTED: cytochrome P450 CYP72A219-like, partial [Nicotiana 
sylvestris]
Length=449

 Score =   208 bits (530),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 136/177 (77%), Gaps = 2/177 (1%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVGLLA-FAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELV  255
            ME+ Y L+    +V LL  +AW++L W WF+P+ LE+CL+Q GL GN Y+++ GD+KEL 
Sbjct  1    MEMAYYLVLSLFAVTLLVIYAWKLLKWAWFRPRKLEQCLRQQGLIGNSYKLIFGDLKELS  60

Query  256  KMASDAISKPMTLSDN-VAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLN  432
            K   +  SKP+ +SD+ + PR++PY+     KYGKNC+VW+GP P+VF+R+PE++K+VL 
Sbjct  61   KSIEEVKSKPLNVSDDDIPPRILPYFIEAIKKYGKNCFVWLGPNPLVFVREPEVIKDVLT  120

Query  433  KYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            ++ L+QKP++ PL R L +G+VSYE+++WAKHR++LNPAF+ EK+K M PAF LSCS
Sbjct  121  RHALYQKPKSTPLTRLLAQGIVSYEEDKWAKHRKILNPAFHMEKIKHMLPAFHLSCS  177



>ref|XP_009617254.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=518

 Score =   209 bits (532),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 129/175 (74%), Gaps = 0/175 (0%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVK  258
            +++  T     + + L+   WRVL WVWF+PK LEK L++ GLKGN YRIL GDMKEL  
Sbjct  4    VQITVTASCAAIIITLVVCIWRVLNWVWFRPKKLEKLLRKQGLKGNSYRILYGDMKELSG  63

Query  259  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  438
            M  +A SKPM LSD++APR++P++     KYGK  +VW+GP P+VF+ DPEL+KEV +K 
Sbjct  64   MIKEANSKPMNLSDDIAPRLVPFFLDTIKKYGKKSFVWLGPKPLVFVMDPELIKEVFSKN  123

Query  439  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             L+QKP +NPL + L +GLVS E+++WAKHR+++ PAF+ EKLK M PAF LSC+
Sbjct  124  YLYQKPHSNPLTKLLAQGLVSQEEDKWAKHRKIVTPAFHLEKLKHMLPAFCLSCT  178



>ref|XP_004244272.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=514

 Score =   208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 126/174 (72%), Gaps = 1/174 (1%)
 Frame = +1

Query  85   VIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMA  264
            +I T+    +++ L    W+VL WVWF+PK LEK L++ GL GN YR L GDMK+  KM 
Sbjct  1    MIVTIFCCAIAITLFVCLWKVLNWVWFQPKKLEKLLRKQGLNGNSYRFLYGDMKDFSKMI  60

Query  265  SDAISKPMTLSD-NVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYE  441
             +A SKPM + D ++APR++P++     KYGK C+ WMGP P + I DPEL+KEVL+K  
Sbjct  61   KEANSKPMNMDDHDLAPRMVPFFLETIKKYGKKCFTWMGPRPQILIMDPELIKEVLSKTY  120

Query  442  LFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            ++QKP  NPLG   V+GLVSYEK++WAKHR+++NPAF+ EKLK M PAF LSCS
Sbjct  121  VYQKPHGNPLGTLFVQGLVSYEKDKWAKHRKIINPAFHLEKLKHMLPAFYLSCS  174



>ref|XP_006348304.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Solanum 
tuberosum]
Length=519

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 128/176 (73%), Gaps = 1/176 (1%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVK  258
            +E+I T+     ++ L    W+VL WVWF PK LEK L++ GL GN YR+L GDMK+L  
Sbjct  4    IEMIVTICCCATAITLFVCLWKVLNWVWFNPKKLEKLLRKQGLNGNSYRLLYGDMKDLSG  63

Query  259  MASDAISKPMTLSD-NVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNK  435
            M  +A SKPM +SD N+APR++P++     KYGK  ++WMGP P + I DPEL+KEVL+K
Sbjct  64   MIKEANSKPMNMSDHNLAPRMVPFFLETIKKYGKKSFIWMGPRPQILIMDPELIKEVLSK  123

Query  436  YELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
              ++QKP  NPLG   V+GLVSYEK++WAKHR+++NPAF+ EKLK M PAF LSCS
Sbjct  124  NYVYQKPHGNPLGTLFVQGLVSYEKDKWAKHRKIINPAFHLEKLKHMLPAFYLSCS  179



>ref|XP_009797873.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
Length=519

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 128/175 (73%), Gaps = 0/175 (0%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVK  258
            +++  T     + + LL   WRVL W+WF+PK LE  L++ GL+GN Y++L GDMKE   
Sbjct  5    LQMTVTASCAAIVITLLVCIWRVLNWIWFRPKKLELLLRKQGLEGNSYKVLYGDMKEFSG  64

Query  259  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  438
            M  +A SKPM+LSD+VAPR++P++     KYGK  ++W GP P+V I DPEL+KEVL+K 
Sbjct  65   MIKEAYSKPMSLSDDVAPRLMPFFLETIKKYGKRSFIWFGPRPLVLIMDPELIKEVLSKI  124

Query  439  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             L+QKP  NPL   LV+G+ +YE+++WAKHR+++NPAF+ EKLKLM PAF LSCS
Sbjct  125  HLYQKPGGNPLATLLVQGIATYEEDKWAKHRKIINPAFHLEKLKLMLPAFRLSCS  179



>gb|ABC69422.1| CYP72A58 [Nicotiana tabacum]
Length=513

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 127/172 (74%), Gaps = 2/172 (1%)
 Frame = +1

Query  94   TLLGVC--VSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMAS  267
            T+   C  + + LL   WRVL W+WF+PK LE  L++ GL+GN Y++L GDMKE   M  
Sbjct  2    TVTASCAAIVITLLVCIWRVLNWIWFRPKKLELLLRKQGLEGNSYKVLYGDMKEFSGMIK  61

Query  268  DAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELF  447
            +A SKPM+LSD+VAPR++P++     KYGK  ++W GP P+V I DPEL+KEVL+K  L+
Sbjct  62   EAYSKPMSLSDDVAPRLMPFFLETIKKYGKRSFIWFGPRPLVLIMDPELIKEVLSKIHLY  121

Query  448  QKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            QKP  NPL   LV+G+ +YE+++WAKHR+++NPAF+ EKLKLM PAF LSCS
Sbjct  122  QKPGGNPLATLLVQGIATYEEDKWAKHRKIINPAFHLEKLKLMLPAFRLSCS  173



>ref|XP_006363763.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Solanum tuberosum]
Length=518

 Score =   207 bits (526),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 88/172 (51%), Positives = 131/172 (76%), Gaps = 1/172 (1%)
 Frame = +1

Query  91   YTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASD  270
            Y L+   +++  + +AWR+L W WF P+ LEKCL+Q GLKGN Y+++ GD+KEL K   D
Sbjct  6    YFLVLFLLAITFVIYAWRLLDWAWFMPRKLEKCLRQQGLKGNSYKLIYGDIKELSKSIED  65

Query  271  AISKPMTLSDN-VAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELF  447
            A SKP+ +SD+ + PR++PY+     KYGKNC++W+GP P+V + DPE++++V NK+ L+
Sbjct  66   AESKPLNVSDDDLTPRILPYFVQTIKKYGKNCFIWIGPKPLVIVGDPEVIRDVFNKHALY  125

Query  448  QKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            QKP++ PL + L +G+VSYE+++WAKHR++LNPAF+ EK+K M  A LLSCS
Sbjct  126  QKPKSTPLTKLLAQGIVSYEEDKWAKHRKILNPAFHMEKIKDMLQAVLLSCS  177



>ref|XP_009789309.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Nicotiana 
sylvestris]
Length=516

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 127/175 (73%), Gaps = 0/175 (0%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVK  258
            +++  T     + + L+   WRVL WVWF+PK LEK  ++ GLKGN YRIL GDMKEL  
Sbjct  4    VQITATASCAAIIITLMVCIWRVLNWVWFRPKKLEKLQRKQGLKGNSYRILYGDMKELSG  63

Query  259  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  438
            M  +A SKPM LSD++APR++P++     KYGK  +VW+GP P+VFI DPEL+KEV +K 
Sbjct  64   MIEEANSKPMNLSDDIAPRLVPFFLDTIKKYGKKSFVWLGPKPLVFIMDPELIKEVFSKN  123

Query  439  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             L++KP +NPL + L +GLVS E ++WAKHR+++ PAF+ EKLK M PAF LSC+
Sbjct  124  YLYEKPHSNPLTKLLAQGLVSQEGDKWAKHRKIITPAFHLEKLKHMLPAFCLSCT  178



>ref|XP_009789316.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Nicotiana 
sylvestris]
Length=516

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 127/175 (73%), Gaps = 0/175 (0%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVK  258
            +++  T     + + L+   WRVL WVWF+PK LEK  ++ GLKGN YRIL GDMKEL  
Sbjct  4    VQITATASCAAIIITLMVCIWRVLNWVWFRPKKLEKLQRKQGLKGNSYRILYGDMKELSG  63

Query  259  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  438
            M  +A SKPM LSD++APR++P++     KYGK  +VW+GP P+VFI DPEL+KEV +K 
Sbjct  64   MIEEANSKPMNLSDDIAPRLVPFFLDTIKKYGKKSFVWLGPKPLVFIMDPELIKEVFSKN  123

Query  439  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             L++KP +NPL + L +GLVS E ++WAKHR+++ PAF+ EKLK M PAF LSC+
Sbjct  124  YLYEKPHSNPLTKLLAQGLVSQEGDKWAKHRKIITPAFHLEKLKHMLPAFCLSCT  178



>ref|XP_009620491.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=516

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 134/176 (76%), Gaps = 1/176 (1%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVK  258
            ME+ Y ++    +V  + + W++L W WF+P+ L++CL+Q GLKGN Y+++ GD+KEL K
Sbjct  1    MEMAYYIVLSLFAVTSVIYVWKLLNWAWFRPRKLDQCLRQQGLKGNSYKLIFGDLKELSK  60

Query  259  MASDAISKPMTLSDN-VAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNK  435
               +A SKP+ +SD+ + PR++PY+     KYGKN ++W+GP P+VF+RDP+++K+VL K
Sbjct  61   SIEEAKSKPLNVSDDDIPPRILPYFIEAIKKYGKNSFIWLGPNPLVFVRDPDVLKDVLTK  120

Query  436  YELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            + L+QKP++ PL R L +G+VSYE+++WAKHR++LNPAF+ EK+K M PA  LSCS
Sbjct  121  HSLYQKPKSTPLTRLLAQGIVSYEEDKWAKHRKILNPAFHMEKIKHMLPAIQLSCS  176



>ref|XP_009618785.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=531

 Score =   205 bits (521),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 96/171 (56%), Positives = 124/171 (73%), Gaps = 2/171 (1%)
 Frame = +1

Query  97   LLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAI  276
            +  +C+ + L+  AW +L W+W KPK LE CL++ GLKGN YR+  GDMKEL K   +  
Sbjct  19   IAAICLIIFLVYKAWELLKWIWIKPKKLESCLRKQGLKGNSYRLFYGDMKELSKSLKEIN  78

Query  277  SKPM-TLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQK  453
            SKP+  LS+ VAPR+IPYY  +  KYGK C+VW GP P + I +PEL+KE+  K  +FQK
Sbjct  79   SKPIINLSNEVAPRIIPYYLEIIQKYGKRCFVWQGPTPAILITEPELIKEIFGKNYVFQK  138

Query  454  PRN-NPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            P N NPL + L RG+VSYE+E+WAKHR++LNPAF+ EKLK M PAF LSCS
Sbjct  139  PNNPNPLTKLLARGVVSYEEEKWAKHRKILNPAFHMEKLKHMLPAFYLSCS  189



>ref|XP_006348911.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Solanum tuberosum]
Length=518

 Score =   204 bits (520),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 135/177 (76%), Gaps = 2/177 (1%)
 Frame = +1

Query  79   MEVI-YTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELV  255
            ME++ Y L+   +++ ++ +AW++L W WF+P+ LEKCL++ GLKGN Y+++ GD+KEL 
Sbjct  1    MEIVAYYLVSFLLTITIVIYAWKLLDWAWFRPRKLEKCLRKQGLKGNSYKLIFGDLKELA  60

Query  256  KMASDAISKPMTLSDN-VAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLN  432
            K   DA SKP+ +SD+ + PR++PY+     K+GKNC++W+GP PMV +R+PE++++V N
Sbjct  61   KSFEDANSKPLKVSDDDICPRIVPYFVDTIKKHGKNCFIWIGPKPMVLVREPEVIRDVFN  120

Query  433  KYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            KY L+QKP++ P+ + L +G+ SYE+++W  HR++LNPAF+ EK+K M PA  LSC+
Sbjct  121  KYVLYQKPKSTPITKLLAQGVSSYEEDKWEMHRKILNPAFHMEKIKSMVPAVHLSCT  177



>gb|ABC69393.1| CYP72A55v2 [Nicotiana tabacum]
Length=521

 Score =   204 bits (520),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 96/171 (56%), Positives = 124/171 (73%), Gaps = 2/171 (1%)
 Frame = +1

Query  97   LLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAI  276
            +  +C+ + L+  AW +L W+W KPK LE CL++ GLKGN YR+  GDMKEL K   +  
Sbjct  9    IAAICLIIFLVYKAWELLKWIWIKPKKLESCLRKQGLKGNSYRLFYGDMKELSKSLKEIN  68

Query  277  SKPM-TLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQK  453
            SKP+  LS+ VAPR+IPYY  +  KYGK C+VW GP P + I +PEL+KE+  K  +FQK
Sbjct  69   SKPIINLSNEVAPRIIPYYLEIIQKYGKRCFVWQGPTPAILITEPELIKEIFGKNYVFQK  128

Query  454  PRN-NPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            P N NPL + L RG+VSYE+E+WAKHR++LNPAF+ EKLK M PAF LSCS
Sbjct  129  PNNPNPLTKLLARGVVSYEEEKWAKHRKILNPAFHMEKLKHMLPAFYLSCS  179



>emb|CBI22134.3| unnamed protein product [Vitis vinifera]
Length=529

 Score =   203 bits (517),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 127/171 (74%), Gaps = 3/171 (2%)
 Frame = +1

Query  97   LLGVCVS---VGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMAS  267
            L+ V +S   + LL +AWR+L WVW +PK LE+CL+Q G+ GN YR+L GD++E+++M S
Sbjct  16   LISVAISFAFITLLIYAWRLLNWVWLRPKKLERCLRQQGITGNSYRLLHGDVREMLRMIS  75

Query  268  DAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELF  447
            +A S+P++LSD +  RV+P++ H   KYGKN ++WMGP P+V I DPEL+++V  +Y  F
Sbjct  76   EANSRPISLSDEIVQRVLPFHYHSLKKYGKNYFIWMGPKPVVNIMDPELIRDVFLRYNAF  135

Query  448  QKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSC  600
             KP  +PLG+ L  GLV+ E EQW KHR+++NPAF+ EKLK M PAF LSC
Sbjct  136  HKPAPHPLGKLLATGLVTLEGEQWTKHRKIINPAFHLEKLKHMVPAFQLSC  186



>ref|XP_002270326.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=516

 Score =   203 bits (516),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 127/172 (74%), Gaps = 3/172 (2%)
 Frame = +1

Query  97   LLGVCVS---VGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMAS  267
            L+ V +S   + LL +AWR+L WVW +PK LE+CL+Q G+ GN YR+L GD++E+++M S
Sbjct  3    LISVAISFAFITLLIYAWRLLNWVWLRPKKLERCLRQQGITGNSYRLLHGDVREMLRMIS  62

Query  268  DAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELF  447
            +A S+P++LSD +  RV+P++ H   KYGKN ++WMGP P+V I DPEL+++V  +Y  F
Sbjct  63   EANSRPISLSDEIVQRVLPFHYHSLKKYGKNYFIWMGPKPVVNIMDPELIRDVFLRYNAF  122

Query  448  QKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             KP  +PLG+ L  GLV+ E EQW KHR+++NPAF+ EKLK M PAF LSC 
Sbjct  123  HKPAPHPLGKLLATGLVTLEGEQWTKHRKIINPAFHLEKLKHMVPAFQLSCG  174



>ref|XP_004244273.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=519

 Score =   203 bits (516),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/178 (51%), Positives = 126/178 (71%), Gaps = 3/178 (2%)
 Frame = +1

Query  79   MEVIYTLLGVC---VSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKE  249
            M+ I  L+ VC   +++ L    W+VL WVW  PK LE  L++ GL GN Y+IL GD+ +
Sbjct  1    MDEIQILVRVCCSAIAIALFVCLWKVLNWVWLNPKKLENLLRKQGLNGNSYKILYGDLND  60

Query  250  LVKMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVL  429
             + M  +A SKPM LSD++APR++P++     KYGK C++W+GP P V I DPEL+KEVL
Sbjct  61   FIGMIREASSKPMNLSDDIAPRLVPFFLETTKKYGKKCFIWLGPKPQVIIMDPELIKEVL  120

Query  430  NKYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            +K  L+QKP  NP    LV+GL +YE+++WAKHR+++NPAF+ EKLK M PAF LSC+
Sbjct  121  SKTYLYQKPGGNPFAALLVQGLATYEEDKWAKHRKIINPAFHLEKLKHMLPAFHLSCT  178



>ref|XP_006348302.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=518

 Score =   202 bits (514),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 126/178 (71%), Gaps = 3/178 (2%)
 Frame = +1

Query  79   MEVIYTLLGVC---VSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKE  249
            M+ I  L+ VC   +++ L    W+VL WVWF PK LE  L++ GL GN Y+IL GD+ +
Sbjct  1    MDKIQILVTVCCFAIAIALFVCLWKVLNWVWFNPKKLENLLRKQGLNGNSYKILYGDLND  60

Query  250  LVKMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVL  429
             + M  +A SKPM LSD++APR++P++     KYGK C++W+GP P V I DP+L+KEVL
Sbjct  61   FIGMIREATSKPMNLSDDIAPRLVPFFLETIKKYGKKCFIWLGPKPQVIIMDPKLIKEVL  120

Query  430  NKYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            +K  L+QKP  NP    LV+GL +YE+++WAKHR+++NPAF+ EKLK M PAF L C+
Sbjct  121  SKTYLYQKPGGNPFAALLVQGLATYEEDKWAKHRKIINPAFHLEKLKHMLPAFHLCCT  178



>ref|XP_009790250.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
Length=517

 Score =   202 bits (513),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/179 (52%), Positives = 123/179 (69%), Gaps = 4/179 (2%)
 Frame = +1

Query  79   MEVIYTLLGVCVS----VGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMK  246
            ME+ Y  L + +S    + +L +AW++L WVWFKPK LEKCL+Q G KGN YR L GD+ 
Sbjct  1    MEISYYSLKIAISSFVVIFILKWAWKILNWVWFKPKELEKCLRQQGFKGNSYRFLFGDVN  60

Query  247  ELVKMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEV  426
            E++KM  +A+SKP+  S N+ PRV+P++      YGKNC  W GP P + I DPEL++EV
Sbjct  61   EMMKMGKEALSKPIDFSHNIWPRVMPFFHKTITTYGKNCLAWYGPRPAIVIVDPELIREV  120

Query  427  LNKYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            L K  +FQKP   PL +    GL  YE ++WAKHRRL+NPAF+ +KLK M PAFLL+ S
Sbjct  121  LTKNYIFQKPPGTPLTKLAANGLAGYEADKWAKHRRLINPAFHLDKLKHMLPAFLLTAS  179



>ref|XP_011082968.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=516

 Score =   202 bits (513),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 128/176 (73%), Gaps = 1/176 (1%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVK  258
            MEV++ +L    +  +L ++WRV+ W + +PK LEK L++ GL GN YR++ GD+KE++K
Sbjct  1    MEVVWQILAASSAFVVLMYSWRVVNWAYIRPKRLEKFLRKQGLSGNSYRLVYGDLKEMLK  60

Query  259  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  438
            M  D  SKP+ L D++ PRV+ +      KYG   ++W+GP P V I DPELVKEV+NKY
Sbjct  61   MMEDGRSKPINLDDDIKPRVLHFVFKTVQKYGTESFLWLGPRPTVTISDPELVKEVMNKY  120

Query  439  ELFQKPRN-NPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            +++QKP N NPL + L +G+VSYE ++WAKHR+L+NPAF+ EKLKLM PAF LSC 
Sbjct  121  DIYQKPNNPNPLTKLLAQGVVSYEMDKWAKHRKLINPAFHMEKLKLMIPAFYLSCD  176



>ref|XP_004243845.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=518

 Score =   202 bits (513),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 133/177 (75%), Gaps = 2/177 (1%)
 Frame = +1

Query  79   MEVI-YTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELV  255
            ME++ Y L+   +++  + +AWR+L W WF+P+ L+KCL+Q GLKGN Y+++ GD+KEL 
Sbjct  1    MEIVAYFLVLFLLAITFVIYAWRLLDWAWFRPRKLDKCLRQQGLKGNSYKLIFGDIKELS  60

Query  256  KMASDAISKPMTLSDN-VAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLN  432
            K   DA SKP+ +SD+ + PR++PY+     KYGKNC++W+G  P+V + DPE++++V N
Sbjct  61   KSIEDAESKPLDVSDDDLTPRILPYFVQTIKKYGKNCFIWIGTKPLVIVGDPEVIRDVFN  120

Query  433  KYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            K+ L+QKP++ PL + L +G+VSYE+ +WAKHR++LNPAF+ EK+K M  A  LSCS
Sbjct  121  KHALYQKPKSTPLTKLLAQGIVSYEEVKWAKHRKILNPAFHMEKIKDMLQAVHLSCS  177



>emb|CBI39895.3| unnamed protein product [Vitis vinifera]
Length=235

 Score =   194 bits (492),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 123/171 (72%), Gaps = 4/171 (2%)
 Frame = +1

Query  103  GVCVSVG----LLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASD  270
             V +S G    L++  WR+L WVW +PK LE+CL++ GL GN YR+L GD KE+  M  +
Sbjct  5    SVAISFGFLTVLISCLWRLLNWVWLRPKRLERCLREQGLAGNSYRLLHGDFKEMSMMLKE  64

Query  271  AISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQ  450
            A S+P++LSD+  PRV+P++ H   KYGKN + W GP PMV I +PEL+++VL K  +FQ
Sbjct  65   AYSRPISLSDDTTPRVLPFHFHFIKKYGKNSFAWFGPNPMVNIMEPELIRDVLLKSNVFQ  124

Query  451  KPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            KP  +PLG+ LV GLV+ E E+WAK R+++NPAF+ EKLK M PAF LSCS
Sbjct  125  KPPPHPLGKLLVSGLVTLEGERWAKRRKIINPAFHLEKLKNMLPAFHLSCS  175



>gb|ABC69392.1| CYP72A55v1 [Nicotiana tabacum]
Length=521

 Score =   201 bits (512),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 123/171 (72%), Gaps = 2/171 (1%)
 Frame = +1

Query  97   LLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAI  276
            +  +C+ + L+  AW +L W+W KPK LE CL++ GLKGN Y +  GDMKEL K   +  
Sbjct  9    IAAICLIIFLVYKAWELLKWIWIKPKKLESCLRKQGLKGNSYGLFYGDMKELSKSLKEIN  68

Query  277  SKPM-TLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQK  453
            SKP+  LS+ VAPR+IPYY  +  KYGK C+VW GP P + I +PEL+KE+  K  +FQK
Sbjct  69   SKPIINLSNEVAPRIIPYYLEIIQKYGKRCFVWQGPTPAILITEPELIKEIFGKNYVFQK  128

Query  454  PRN-NPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            P N NPL + L RG+VSYE+E+WAKHR++LNPAF+ EKLK M PAF LSCS
Sbjct  129  PNNPNPLTKLLARGVVSYEEEKWAKHRKILNPAFHMEKLKHMLPAFYLSCS  179



>emb|CDP19599.1| unnamed protein product [Coffea canephora]
Length=515

 Score =   201 bits (511),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 123/174 (71%), Gaps = 0/174 (0%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVK  258
            MEV+Y+L+ V  +  L+  +WR+L W WFKPK  EKCL+Q GL+GN Y ++ GDMKE V+
Sbjct  1    MEVLYSLVAVLSASFLVILSWRILNWAWFKPKKREKCLRQQGLRGNSYNLVLGDMKETVR  60

Query  259  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  438
            M  +A SKP+  ++++  RV+P+       YG+N Y W GPMP V + DPE +KEV+NK 
Sbjct  61   MTQEAKSKPINFTNDIVSRVMPFIDKTIKTYGENSYAWAGPMPAVLLMDPEHIKEVMNKS  120

Query  439  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSC  600
              + KP  NPL + L  GLVSYE ++W+KHR+L+NPAF+ EK+KLM PAF LSC
Sbjct  121  FNYLKPPGNPLSKLLATGLVSYETDKWSKHRKLINPAFHLEKVKLMLPAFRLSC  174



>gb|EYU31631.1| hypothetical protein MIMGU_mgv1a004628mg [Erythranthe guttata]
Length=380

 Score =   197 bits (501),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 126/175 (72%), Gaps = 1/175 (1%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVK  258
            ME+I++ L +C +V ++ +AW+++ +VWF+PK +EK L+Q G  G PYR L GD+ E+  
Sbjct  1    MELIHSFLSLCCTVVVVIYAWKIMNFVWFRPKKMEKILRQQGFVGKPYRFLVGDLNEMKN  60

Query  259  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  438
            M ++A+SKP+  SD+  PR+IP+       +G+NC++W+GP P V I DP++V+EVL+K 
Sbjct  61   MGNEALSKPIDFSDDFVPRIIPFIHKTVTNHGENCFIWLGPYPAVLIFDPDIVREVLSKT  120

Query  439  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             +FQKP  NPL   L RGL SYE ++WAKHRRL+NPAF+ +K+K M P+F   C+
Sbjct  121  YVFQKPY-NPLANVLARGLASYETDKWAKHRRLINPAFHLDKVKHMIPSFHKCCA  174



>ref|XP_004243253.1| PREDICTED: cytochrome P450 CYP72A219 [Solanum lycopersicum]
Length=518

 Score =   200 bits (509),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 130/177 (73%), Gaps = 2/177 (1%)
 Frame = +1

Query  79   MEVI-YTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELV  255
            ME++ Y L+   +++  + +AW++L W WF+P+ LEKCL++ GLKGN Y+++ GD+KEL 
Sbjct  1    MEIVAYYLVSFLLTITSVIYAWKLLDWAWFRPRKLEKCLRKQGLKGNSYKLIFGDLKELA  60

Query  256  KMASDAISKPMTL-SDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLN  432
            K   D  SKP+ +  D++ PR++PY+     K+GKNC++W+GP PMV + D E++++V N
Sbjct  61   KSFEDVKSKPLNVFDDDITPRIVPYFVDTIKKHGKNCFIWIGPKPMVLVNDAEVIRDVFN  120

Query  433  KYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            KY L+QKP+  PL + L +GL SYE+++WA HR++LNPAF+ EK+K M PA  LSC+
Sbjct  121  KYVLYQKPKPTPLTKLLAQGLASYEEDKWAMHRKILNPAFHMEKIKNMVPAIHLSCT  177



>emb|CDP19600.1| unnamed protein product [Coffea canephora]
Length=516

 Score =   199 bits (507),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 124/175 (71%), Gaps = 0/175 (0%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVK  258
            M++ Y+++GV  SV L  +AW +L WVWFKPK LEK L+Q GL G+ YR+L GDMKE  +
Sbjct  1    MDMFYSIIGVLCSVFLTIWAWIILNWVWFKPKKLEKYLRQQGLGGSHYRLLFGDMKETAQ  60

Query  259  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  438
            M   A SKP+  ++++ PR++P+   L    G N   WMGP P + + DPELVKEVL K 
Sbjct  61   MVKQAYSKPINFTNDIVPRILPFVDKLIRSSGTNTLTWMGPSPALLLIDPELVKEVLTKN  120

Query  439  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             ++QKPRNNPLG+ L  G  +Y+ ++WAK+RR+++PAF+ EKLK M PAF LSCS
Sbjct  121  YVYQKPRNNPLGKLLAEGFATYDTDKWAKNRRIISPAFHLEKLKHMVPAFCLSCS  175



>ref|XP_002271303.2| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=515

 Score =   199 bits (506),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 122/162 (75%), Gaps = 0/162 (0%)
 Frame = +1

Query  118  VGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLS  297
            + LL +AWR+L WVW +PK LE+CL+Q GL GN YR+L GD +E+++M S+A S+ ++LS
Sbjct  13   ITLLIYAWRLLNWVWLRPKKLERCLRQQGLTGNSYRLLHGDFREMLRMISEANSRSISLS  72

Query  298  DNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGR  477
            D++  RV+P++ H   KYGKN ++WMGP P+V I DPEL+++V  KY  F+KP  +PLG+
Sbjct  73   DDIVQRVLPFHCHSIKKYGKNYFIWMGPKPVVNIMDPELIRDVFLKYNAFRKPPPHPLGK  132

Query  478  KLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             L  GLV+ E EQW K R+++NPAF+ EKLK M PAF LSCS
Sbjct  133  LLATGLVTLEGEQWTKRRKIINPAFHLEKLKHMVPAFQLSCS  174



>gb|KDO52098.1| hypothetical protein CISIN_1g038814mg, partial [Citrus sinensis]
Length=189

 Score =   190 bits (482),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 116/159 (73%), Gaps = 0/159 (0%)
 Frame = +1

Query  127  LAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNV  306
            + +AW++L W W KPK +EK L++ G KGN YR L GD++E   +++ A SKP++  D++
Sbjct  1    VTWAWKILNWAWLKPKRVEKQLRKQGFKGNSYRFLFGDVREHAVLSNQAKSKPISFEDDI  60

Query  307  APRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLV  486
            APRV+P Y  L   YGK CY W+GP+PM+ I DP+ +KEV  K   FQKP++NPLG+ L 
Sbjct  61   APRVVPLYDQLVKLYGKICYWWVGPIPMINIMDPDQLKEVFTKINDFQKPKSNPLGKILT  120

Query  487  RGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             GL S+E E+WAKHR+++NPAF+ EKLKLM PAF  SCS
Sbjct  121  TGLASHEGEKWAKHRKIINPAFHQEKLKLMLPAFNQSCS  159



>emb|CDP15975.1| unnamed protein product [Coffea canephora]
Length=516

 Score =   198 bits (503),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 124/176 (70%), Gaps = 1/176 (1%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVG-LLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELV  255
            ME+ Y  +    S   +L  AWRVL W W +PK LEK LK+ GLKGNPYR+L GD KE+ 
Sbjct  1    MEIGYIRIAAISSCAVILVLAWRVLNWAWLRPKKLEKQLKEQGLKGNPYRLLYGDFKEIS  60

Query  256  KMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNK  435
             +  +A SKP+ LSD++ PR++P +     KYGK+ YVW+GP PMV+I +PEL++EV+ K
Sbjct  61   TLIREAQSKPINLSDDILPRILPAFPDALKKYGKSTYVWLGPTPMVYILEPELIREVMQK  120

Query  436  YELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
              LFQKPR NPL   L+ GLV+Y+ ++WAK R+L+NPAF+ EKLK M P+F  S S
Sbjct  121  IYLFQKPRLNPLSLLLIEGLVNYDGDKWAKQRKLINPAFHVEKLKHMLPSFYTSAS  176



>emb|CDP15981.1| unnamed protein product [Coffea canephora]
Length=513

 Score =   198 bits (503),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 125/177 (71%), Gaps = 2/177 (1%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVGLL--AFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKEL  252
            M+  ++ + V VS  L+    AW+VL WVWFKP+ LEK LKQ G KGNPY++  GD KE+
Sbjct  1    MKTTHSFMIVLVSSCLVLSVLAWKVLSWVWFKPRKLEKHLKQQGFKGNPYKLFYGDFKEI  60

Query  253  VKMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLN  432
              +  +A SKP++LSD++ PRVIP++    +KYGKN Y+W GP P + I DPEL ++V  
Sbjct  61   GTLFQEAYSKPISLSDDIVPRVIPHFLGTVNKYGKNAYLWFGPKPTMLIMDPELTRKVTQ  120

Query  433  KYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            K E+FQKP+ +PL + L +G + YE ++WAKHR+LLN AF+ EKLKLM PAF  S S
Sbjct  121  KMEIFQKPQFHPLSKLLAQGTLVYEGDKWAKHRKLLNQAFHMEKLKLMVPAFYTSAS  177



>gb|EYU31630.1| hypothetical protein MIMGU_mgv1a004628mg [Erythranthe guttata]
Length=517

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 126/175 (72%), Gaps = 1/175 (1%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVK  258
            ME+I++ L +C +V ++ +AW+++ +VWF+PK +EK L+Q G  G PYR L GD+ E+  
Sbjct  1    MELIHSFLSLCCTVVVVIYAWKIMNFVWFRPKKMEKILRQQGFVGKPYRFLVGDLNEMKN  60

Query  259  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  438
            M ++A+SKP+  SD+  PR+IP+       +G+NC++W+GP P V I DP++V+EVL+K 
Sbjct  61   MGNEALSKPIDFSDDFVPRIIPFIHKTVTNHGENCFIWLGPYPAVLIFDPDIVREVLSKT  120

Query  439  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             +FQKP  NPL   L RGL SYE ++WAKHRRL+NPAF+ +K+K M P+F   C+
Sbjct  121  YVFQKPY-NPLANVLARGLASYETDKWAKHRRLINPAFHLDKVKHMIPSFHKCCA  174



>emb|CAN63404.1| hypothetical protein VITISV_001871 [Vitis vinifera]
Length=471

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 124/171 (73%), Gaps = 4/171 (2%)
 Frame = +1

Query  103  GVCVSVG----LLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASD  270
             V +S G    L++  WR+L WVW +PK LE+CL++ GL GN YR+L GD KE+  M  +
Sbjct  5    SVAISFGFLTVLISCLWRLLNWVWLRPKRLERCLREQGLAGNSYRLLHGDFKEMSMMLKE  64

Query  271  AISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQ  450
            A S+P++LSD++APRV+P++ H   KYGKN + W GP PMV I +P L+++VL K  +FQ
Sbjct  65   AYSRPISLSDDIAPRVLPFHCHFIKKYGKNSFAWFGPNPMVNIMEPGLIRDVLLKSNVFQ  124

Query  451  KPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            KP  +PLG+ LV GLV+ E E+WAK R+++NPAF+ EKLK M PAF LSCS
Sbjct  125  KPPPHPLGKLLVSGLVTLEGERWAKRRKIINPAFHLEKLKNMLPAFQLSCS  175



>emb|CBI22139.3| unnamed protein product [Vitis vinifera]
Length=417

 Score =   194 bits (494),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 124/171 (73%), Gaps = 4/171 (2%)
 Frame = +1

Query  103  GVCVSVG----LLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASD  270
             V +S G    L++  WR+L WVW +PK LE+CL++ GL GN YR+L GD KE+  M  +
Sbjct  5    SVAISFGFLTVLISCLWRLLNWVWLRPKRLERCLREQGLAGNSYRLLHGDFKEMSMMLKE  64

Query  271  AISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQ  450
            A S+P++LSD++APRV+P++ H   KYGKN + W GP PMV I +PEL++++L K  +FQ
Sbjct  65   AYSRPISLSDDIAPRVLPFHCHFIKKYGKNFFAWFGPNPMVNIMEPELIRDILLKSNVFQ  124

Query  451  KPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            KP  +PLG+ LV GLV+ E E+WAK R+ +NPAF+ EKLK M PAF LSCS
Sbjct  125  KPPPHPLGKLLVSGLVTLEGERWAKRRKNINPAFHLEKLKNMLPAFHLSCS  175



>ref|XP_006364092.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=521

 Score =   197 bits (500),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 121/170 (71%), Gaps = 1/170 (1%)
 Frame = +1

Query  97   LLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAI  276
            +L  C  + +L +AWR+L WVWFKPK LEKCL+Q G KGN Y+ L GD+KE++KM  +A+
Sbjct  13   VLFSCAIILVLRWAWRILNWVWFKPKKLEKCLRQQGFKGNSYKFLFGDVKEMMKMGKEAL  72

Query  277  SKPMTLS-DNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQK  453
            SKP+  S D + PRV+P++    + YGKNC+ W GP P V I DPEL++EVL K  ++QK
Sbjct  73   SKPIDFSHDMIWPRVMPFFHKTINNYGKNCFAWYGPRPAVVIVDPELIREVLTKNYIYQK  132

Query  454  PRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            P  NPL R    GL  YE ++WAKHRR++NPAF+ +KLK M PAF L+ S
Sbjct  133  PPGNPLTRLAANGLAGYEADKWAKHRRIVNPAFHLDKLKHMLPAFQLTSS  182



>ref|XP_004244274.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Solanum 
lycopersicum]
Length=513

 Score =   196 bits (498),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 123/175 (70%), Gaps = 1/175 (1%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVK  258
            ME++ T     +++ L    W+VL WVWF+PK LEK L++ GL GN YR+L GDMK+  K
Sbjct  1    MELV-TACCCAITITLFVCLWKVLNWVWFRPKKLEKLLRKQGLNGNSYRLLYGDMKDFSK  59

Query  259  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  438
            M  +A SKPM LS+++ PR++P++     KYGK  ++W+ P P V I DPEL+KEV +K 
Sbjct  60   MIKEANSKPMNLSNDITPRLVPFFLETIKKYGKKSFIWLCPKPQVLIMDPELIKEVFSKN  119

Query  439  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
              +QKP  NP    LV+GL +YE+++WAKHR+++NPAF+ EKLK M PAF LSCS
Sbjct  120  YFYQKPHGNPFAALLVQGLAAYEEDKWAKHRKIINPAFHLEKLKHMLPAFHLSCS  174



>gb|EYU43426.1| hypothetical protein MIMGU_mgv1a018638mg, partial [Erythranthe 
guttata]
Length=361

 Score =   192 bits (488),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 121/176 (69%), Gaps = 1/176 (1%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVK  258
            MEV+Y +        +L + WR+L W + +PK LEK L   GL GN Y+ L GD+KE+ K
Sbjct  1    MEVVYKIFAASFGFVVLFYTWRILNWAYIQPKRLEKSLGNQGLTGNTYKFLYGDLKEMSK  60

Query  259  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  438
            M + A S P+ L D++ PRV+ +     +KYG+  ++W+GP P V I +PELVKEV+ K+
Sbjct  61   MFNHAKSTPINLHDDIKPRVLAFLHKTFEKYGQESFIWLGPRPTVMITEPELVKEVMTKF  120

Query  439  ELFQKPRN-NPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             L+QKP+N NPL + L +GL SYE ++W+KHR+++NPAF+ EKLKLM PAF LSC 
Sbjct  121  NLYQKPKNSNPLTKLLAQGLFSYEGDKWSKHRKIINPAFHFEKLKLMIPAFYLSCE  176



>ref|XP_006363756.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Solanum tuberosum]
Length=519

 Score =   196 bits (498),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 130/178 (73%), Gaps = 3/178 (2%)
 Frame = +1

Query  79   MEVI-YTLLGV-CVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKEL  252
            ME++ Y  L +  +++  + +AWR+L W WF+P+ LEKCL++ GLKGN Y+++ GD+KEL
Sbjct  1    MEIVTYHFLALFLLAITFVIYAWRLLDWAWFRPRKLEKCLRKQGLKGNSYKLIYGDIKEL  60

Query  253  VKMASDAISKPMTLSDN-VAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVL  429
             K   DA SKP+  SD+ + PR++PY+     KYGKNC++W+GP P+V + DPE++++V 
Sbjct  61   SKSIEDAKSKPLNASDDDLTPRILPYFVQTIKKYGKNCFIWVGPKPLVIVGDPEVIRDVF  120

Query  430  NKYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            NK+ L+QKP+  P  + L +G++SYE ++WAKHRR+LNPAF+ EK+K M     LSCS
Sbjct  121  NKHALYQKPKYPPQTKLLAKGILSYEDDKWAKHRRILNPAFHMEKIKDMLHTVHLSCS  178



>emb|CBI22133.3| unnamed protein product [Vitis vinifera]
Length=629

 Score =   198 bits (503),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 122/162 (75%), Gaps = 0/162 (0%)
 Frame = +1

Query  118  VGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLS  297
            + LL +AWR+L WVW +PK LE+CL+Q GL GN YR+L GD +E+++M S+A S+ ++LS
Sbjct  83   ITLLIYAWRLLNWVWLRPKKLERCLRQQGLTGNSYRLLHGDFREMLRMISEANSRSISLS  142

Query  298  DNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGR  477
            D++  RV+P++ H   KYGKN ++WMGP P+V I DPEL+++V  KY  F+KP  +PLG+
Sbjct  143  DDIVQRVLPFHCHSIKKYGKNYFIWMGPKPVVNIMDPELIRDVFLKYNAFRKPPPHPLGK  202

Query  478  KLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             L  GLV+ E EQW K R+++NPAF+ EKLK M PAF LSCS
Sbjct  203  LLATGLVTLEGEQWTKRRKIINPAFHLEKLKHMVPAFQLSCS  244



>emb|CAN72247.1| hypothetical protein VITISV_024665 [Vitis vinifera]
Length=288

 Score =   189 bits (480),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 121/171 (71%), Gaps = 4/171 (2%)
 Frame = +1

Query  103  GVCVSVG----LLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASD  270
             V +S G    L++  WR+L WVW +PK LE+CL + GL GN YR+L GD KE+  M  +
Sbjct  46   SVAISFGFLTVLISCLWRLLNWVWLRPKRLERCLXEQGLAGNSYRLLHGDFKEMSMMLKE  105

Query  271  AISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQ  450
            A S+P++LSD++APRV+P++ H   KYGKN + W GP PMV I +PEL+++ L K  +FQ
Sbjct  106  AYSRPISLSDDIAPRVLPFHCHFIKKYGKNFFAWFGPNPMVNIMEPELIRDXLLKSNVFQ  165

Query  451  KPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             P  +PLG+ LV GLV+ E E+WAK R+ +NPAF+ EKLK M PAF LSCS
Sbjct  166  XPPPHPLGKLLVSGLVTLEGERWAKRRKNINPAFHLEKLKNMLPAFHLSCS  216



>emb|CDP19609.1| unnamed protein product [Coffea canephora]
Length=524

 Score =   194 bits (494),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 94/173 (54%), Positives = 123/173 (71%), Gaps = 1/173 (1%)
 Frame = +1

Query  88   IYTLLGVCVSVGLL-AFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMA  264
            ++T+   C+ + L+ A +W+ L WVWF+PK LEK LK+   +GNPY++L GD KE+  + 
Sbjct  9    MFTVYSSCLLLLLVVAVSWKALNWVWFRPKKLEKRLKEQRFRGNPYKLLHGDFKEMSTLY  68

Query  265  SDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYEL  444
            ++A SK + LSD++ PRVIP Y     KYGKN Y+W GP P + I DP L+K V  K ++
Sbjct  69   TEAQSKNLNLSDDIVPRVIPQYLGAVKKYGKNTYLWFGPRPALVIMDPNLIKAVTQKVDV  128

Query  445  FQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            FQKPR NPLGR L +GLVSYE E+WAK R+LLNPAF+ EKLKLM PAF  S S
Sbjct  129  FQKPRVNPLGRLLAQGLVSYEGEKWAKQRKLLNPAFHVEKLKLMLPAFYKSAS  181



>ref|XP_004488669.1| PREDICTED: secologanin synthase-like [Cicer arietinum]
Length=518

 Score =   194 bits (493),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 119/175 (68%), Gaps = 0/175 (0%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVK  258
            ME    + G  + + +L +AW++L W+W +PK LEK L++ GLKGNPYR+L GDMKE  K
Sbjct  1    MEATSAIFGCIILLIMLVWAWKMLHWLWLRPKKLEKLLREQGLKGNPYRLLVGDMKEFFK  60

Query  259  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  438
                A SKPM LSD++  RV PY      K+GKN ++W GP P V + DPELVK+V NK 
Sbjct  61   SEMKARSKPMNLSDDIVSRVFPYGQQTVTKHGKNSFIWFGPTPRVILTDPELVKDVFNKM  120

Query  439  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
              FQKP +NPL R L  GL+++E+E+W  HR+++NPAF+ EKLK+M P    SC+
Sbjct  121  YDFQKPNSNPLIRLLATGLITHEEEKWRMHRKIINPAFHLEKLKMMLPVIFESCN  175



>ref|XP_010645072.1| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=390

 Score =   191 bits (485),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 120/164 (73%), Gaps = 0/164 (0%)
 Frame = +1

Query  112  VSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMT  291
            V + LL +AWR+L WVW +PK LE+CL+Q GL GN YR+L GD +E+ +M ++A S+P++
Sbjct  22   VFITLLIYAWRLLNWVWLRPKKLERCLRQQGLTGNSYRLLHGDFREMSRMINEANSRPIS  81

Query  292  LSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPL  471
             SD++  RV+P++ H   KYGKN ++W+GP P+V I  PEL+++VL K+  FQKP  +PL
Sbjct  82   FSDDIVQRVLPFHDHSIQKYGKNNFIWLGPKPVVNIMQPELIRDVLLKHNAFQKPPPHPL  141

Query  472  GRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            G+ L  G+ S + EQW K R+++NPAF+ EKLK M  AF LSCS
Sbjct  142  GKLLASGISSLDGEQWTKRRKIINPAFHLEKLKHMVSAFQLSCS  185



>ref|XP_002270501.2| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=515

 Score =   194 bits (492),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 120/164 (73%), Gaps = 0/164 (0%)
 Frame = +1

Query  112  VSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMT  291
            V + LL +AWR+L WVW +PK LE+CL+Q GL GN YR+L GD +E+ +M ++A S+P++
Sbjct  11   VFITLLIYAWRLLNWVWLRPKKLERCLRQQGLTGNSYRLLHGDFREMSRMINEANSRPIS  70

Query  292  LSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPL  471
             SD++  RV+P++ H   KYGKN ++W+GP P+V I  PEL+++VL K+  FQKP  +PL
Sbjct  71   FSDDIVQRVLPFHDHSIQKYGKNNFIWLGPKPVVNIMQPELIRDVLLKHNAFQKPPRHPL  130

Query  472  GRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            G+ L  G+ S E EQW K R+++NPAF+ EKLK M  AF LSCS
Sbjct  131  GKLLASGVASLEGEQWTKRRKIINPAFHLEKLKHMVSAFQLSCS  174



>gb|KEH38478.1| cytochrome P450 family 72 protein [Medicago truncatula]
Length=518

 Score =   194 bits (492),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 115/159 (72%), Gaps = 0/159 (0%)
 Frame = +1

Query  127  LAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNV  306
            L +AW++L W+W KPK LEK L++ GLKGN YR+L GD+++L+KM  +  SKPM LSD++
Sbjct  17   LIWAWKILNWLWLKPKKLEKFLREQGLKGNSYRLLVGDIRDLLKMRKETTSKPMNLSDDI  76

Query  307  APRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLV  486
            APRV  Y+ H   KYGKN ++W GP P V I DPEL+K VLNK   FQKP  +PL R L 
Sbjct  77   APRVFSYFHHSVAKYGKNSFMWFGPTPRVNISDPELIKYVLNKIYDFQKPNASPLVRLLA  136

Query  487  RGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             GLV+ E E+W+KHR+L+NPAF  EKLK+M P F  SC 
Sbjct  137  NGLVNLEGEKWSKHRKLINPAFNIEKLKIMLPIFFKSCD  175



>ref|XP_004248200.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=523

 Score =   194 bits (492),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 119/166 (72%), Gaps = 1/166 (1%)
 Frame = +1

Query  109  CVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPM  288
            C  + +L +AWR+L WVWFKPK LEKCL+Q G KGN Y+ L GD+KE++KM  +A+SKP+
Sbjct  19   CAIILVLIWAWRILNWVWFKPKMLEKCLRQQGFKGNSYKFLFGDVKEMMKMGKEALSKPI  78

Query  289  TLSDNVA-PRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNN  465
              S ++  PRV+P++    + YGKNC+ W GP P V I DPEL++EVL+K  ++QKP  N
Sbjct  79   DFSHDMTWPRVMPFFHKTINNYGKNCFGWYGPRPAVVIVDPELIREVLSKNYIYQKPPGN  138

Query  466  PLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            PL R    GL  YE ++WAKHRR++NP F+ +KLK M PAF L+ S
Sbjct  139  PLTRLAANGLAGYEADKWAKHRRIINPGFHLDKLKHMLPAFQLTSS  184



>ref|XP_011082820.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=519

 Score =   193 bits (491),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 121/171 (71%), Gaps = 4/171 (2%)
 Frame = +1

Query  88   IYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMAS  267
            ++T L   +++    +AWR++ WVW +PKN+EK L+  G  GNPYRIL GD  ++ KM  
Sbjct  5    LFTFLFFAIAI----WAWRIVNWVWIRPKNIEKRLRAQGFGGNPYRILYGDTNDMAKMIK  60

Query  268  DAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELF  447
            +A SKP+ LSD+V PRVIP + H+  KYGK C+VW+GP+  V I +PEL+KEVLN   +F
Sbjct  61   EANSKPIKLSDDVLPRVIPLHHHIVRKYGKACFVWIGPVARVVIMEPELIKEVLNNNHIF  120

Query  448  QKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSC  600
            +KP  NPL R LV G+  YE ++W+KHR+++NPAFY EKL+ M PA   SC
Sbjct  121  KKPTPNPLARFLVCGINGYEDDKWSKHRKIINPAFYVEKLRHMVPAMHRSC  171



>ref|XP_006348906.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=518

 Score =   193 bits (490),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 124/177 (70%), Gaps = 3/177 (2%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVG-LLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELV  255
            ME +  ++   +SV  LL + W+VL W WF+PK LEK L+Q GL GN YR+L GD+KE  
Sbjct  1    METLSNIIIATISVAILLVYTWKVLNWAWFRPKKLEKFLRQQGLCGNSYRLLHGDLKEFS  60

Query  256  KMASDAISKPM-TLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLN  432
            K   +A SKP+  LS+++APR+IPY+     KYGK C+VW GP PM+ I + E ++E+  
Sbjct  61   KSIKEAQSKPIDNLSNDIAPRIIPYFIQTISKYGKKCFVWFGPKPMILIMESEQIREIFA  120

Query  433  KYELFQKPRN-NPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSC  600
            K  ++QKP + NP+   L RG+ +YE+++WAKHR++L PAF+ EKLKLM PAF LSC
Sbjct  121  KNYVYQKPHHSNPVANLLARGIANYEEDKWAKHRKILKPAFHMEKLKLMLPAFYLSC  177



>ref|XP_006594768.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Glycine max]
Length=523

 Score =   193 bits (490),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/170 (52%), Positives = 122/170 (72%), Gaps = 0/170 (0%)
 Frame = +1

Query  94   TLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDA  273
            +++ V V + L ++AWR+L W+W +PK LE+ L++ GL+GNPYRIL GD+KE+VK+  +A
Sbjct  11   SIVFVIVILALTSWAWRMLNWLWIRPKRLERLLREQGLQGNPYRILVGDLKEIVKLQMEA  70

Query  274  ISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQK  453
             SKPM LS ++ PRV  +      K+GKN ++W GP P V + DPEL+K+VLNK   F+K
Sbjct  71   RSKPMNLSHDIVPRVFAHLHQSVLKHGKNSFIWFGPKPRVTLTDPELIKDVLNKISDFRK  130

Query  454  PRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            P  NPL + L  GLV+Y+ E+W KHRRL+NPAF  EKLK+M P F  SC+
Sbjct  131  PEANPLAKLLATGLVNYDGEKWNKHRRLINPAFSLEKLKIMLPIFFKSCN  180



>ref|XP_010644729.1| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=514

 Score =   192 bits (489),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/172 (51%), Positives = 124/172 (72%), Gaps = 3/172 (2%)
 Frame = +1

Query  97   LLGVCVS---VGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMAS  267
            L  V VS   + LL FAWR+L WVW +PK LE+CL++ GL GN YR+L GD +E+ +M +
Sbjct  3    LSSVAVSFAFITLLIFAWRLLNWVWLRPKKLERCLRKQGLTGNSYRLLHGDFREMSRMNN  62

Query  268  DAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELF  447
            +A S P++ SD++  RV+P++ H   KYGKN + W+GP P+V I +PEL+++VL K+ +F
Sbjct  63   EANSGPISFSDDIVKRVLPFFNHSIQKYGKNSFTWLGPKPVVNIMEPELIRDVLLKHNVF  122

Query  448  QKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            QKP  +PLG+ L  G+V+ E EQW K R+++NPAF+ EKLK M  AF LSCS
Sbjct  123  QKPPPHPLGKLLATGVVALEGEQWTKRRKIINPAFHLEKLKHMVSAFQLSCS  174



>ref|XP_009797437.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
Length=515

 Score =   192 bits (489),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 78/175 (45%), Positives = 122/175 (70%), Gaps = 0/175 (0%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVK  258
            M+++  L    V   L+ + W+++ WVW +P+ LEKC ++ G+ G+PYR L GD KE+ +
Sbjct  1    MKIVAILFSAIVINALVIWGWKMVNWVWLRPRKLEKCFRKQGMNGHPYRTLYGDTKEMAE  60

Query  259  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  438
            +  +A+ KP+ L+D++ PR+ P+Y H  +KYG +CY W+GP P +F+ +PEL+KE++   
Sbjct  61   LTKEAMLKPIKLTDDILPRIFPFYHHTLNKYGNHCYAWIGPEPRIFVMEPELIKEIVTNN  120

Query  439  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             +F+KP+  PL + LV G+ SYE E+WAKHR+++N AFY+EKLK M PA   SC 
Sbjct  121  TIFKKPKPAPLVQLLVSGISSYEDEKWAKHRKIINTAFYAEKLKCMLPAMHTSCE  175



>ref|XP_007213922.1| hypothetical protein PRUPE_ppa004271mg [Prunus persica]
 gb|EMJ15121.1| hypothetical protein PRUPE_ppa004271mg [Prunus persica]
Length=519

 Score =   192 bits (489),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 115/160 (72%), Gaps = 0/160 (0%)
 Frame = +1

Query  124  LLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDN  303
            ++ +AWRVL WVW +PK LE+CL+Q GL GN YR+L GD KE   M  +A SKPM L  +
Sbjct  19   IITWAWRVLNWVWLRPKKLERCLRQQGLAGNSYRLLIGDTKESSMMLKEAKSKPMDLFHD  78

Query  304  VAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKL  483
            +APRV+P+     + YGKN ++W+GP P V I +PE +K++  KYE FQKP  NPL + L
Sbjct  79   LAPRVLPFVHQSMNTYGKNSFIWIGPTPRVNISNPEDMKDIFAKYEDFQKPVKNPLVKLL  138

Query  484  VRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
              GL +YE E+WAKHR+++NPAF+SEKLK M PAF  SCS
Sbjct  139  ATGLANYEGEKWAKHRKIINPAFHSEKLKRMLPAFHQSCS  178



>emb|CDP15982.1| unnamed protein product [Coffea canephora]
Length=515

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 124/178 (70%), Gaps = 3/178 (2%)
 Frame = +1

Query  79   MEVIYTLLGVCVS---VGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKE  249
            ME  ++ +   VS   V L   AWR L W WF+PK L+K LKQ G KGNPY+++ GD K+
Sbjct  1    MEAAHSFMIALVSSCCVVLSVLAWRALNWAWFQPKKLQKHLKQQGFKGNPYKLIYGDFKQ  60

Query  250  LVKMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVL  429
            +  +  +A SKP++LSD++ PR++P++    +KYGKN Y+W GP PM+ I DPEL+++V 
Sbjct  61   ISSLFQEANSKPISLSDDIVPRIVPHFLEAVNKYGKNTYLWFGPRPMMLIMDPELIRKVT  120

Query  430  NKYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            +K ++FQK R  P  R L+ G++ YE E+WAK R+LLN AF++EKLKLM PAF  S S
Sbjct  121  HKMDIFQKVRFRPQARLLIGGILVYEGEKWAKQRKLLNQAFHTEKLKLMVPAFYKSAS  178



>gb|AHK60841.1| CYP72A225 [Catharanthus roseus]
Length=538

 Score =   192 bits (489),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 123/175 (70%), Gaps = 0/175 (0%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVK  258
            M+V Y  + V  +   L  AW++L W W KPK LEK L+QLGLKGN YR+L GD+ E  +
Sbjct  18   MDVFYRGISVLGTCFFLLLAWKMLNWAWIKPKKLEKRLRQLGLKGNSYRLLIGDLGETSQ  77

Query  259  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  438
            M  +A SKP+  ++++ PR++P+   +   +GKN ++W GP P V I DPEL+KEVL K 
Sbjct  78   MDKEAKSKPINFTNHIIPRIMPFLHKIIQSHGKNPFIWQGPNPAVIITDPELIKEVLTKN  137

Query  439  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
              +QKP ++ LG+ + +G+ +Y+K++WAKHRRLLNPAF+ EKLK M PAF LSCS
Sbjct  138  YTYQKPPSDDLGKLISQGVAAYDKDKWAKHRRLLNPAFHIEKLKHMLPAFHLSCS  192



>emb|CDP15988.1| unnamed protein product [Coffea canephora]
Length=515

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 120/174 (69%), Gaps = 0/174 (0%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVK  258
            ME++Y+L+ V  +  L+  +WR+L W WFKPK LEKCL+Q GL+GN Y ++ GDMKE V+
Sbjct  1    MEILYSLVAVLSASFLVILSWRILNWAWFKPKKLEKCLRQQGLRGNSYNLVFGDMKETVR  60

Query  259  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  438
            M  +A SKPM  ++++  RV+P+       YG+N Y W GPMP V +  PE +KEV+NK 
Sbjct  61   MTQEAKSKPMNFTNDIVSRVMPFIDKTIKTYGENSYTWAGPMPAVLLMYPEHIKEVMNKS  120

Query  439  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSC  600
              + KP  NPL + L  GL +YE ++W+KHR+L++PAF+ EK+K M PAF  SC
Sbjct  121  FNYLKPPGNPLTKLLATGLANYETDKWSKHRKLISPAFHLEKVKFMLPAFRWSC  174



>emb|CAN72443.1| hypothetical protein VITISV_032856 [Vitis vinifera]
Length=245

 Score =   184 bits (468),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 117/164 (71%), Gaps = 0/164 (0%)
 Frame = +1

Query  112  VSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMT  291
            V + LL +AWR+L WVW +PK LE+CL+Q GL GN Y  L GD KE+ +M ++A S+P++
Sbjct  11   VFITLLIYAWRLLNWVWLRPKKLERCLRQQGLTGNSYSCLYGDFKEMSRMINEANSRPIS  70

Query  292  LSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPL  471
             SD++  RV+P++ H   KYGKN + W+GP P+V I +PEL+++V  K+  FQK   +PL
Sbjct  71   FSDDIVQRVLPFHDHSIQKYGKNSFTWLGPKPVVNIMEPELIRDVFLKHNAFQKVPPHPL  130

Query  472  GRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            G+ L  G+V+ E EQW K R+++NPAF+ EKLK M  AF LSCS
Sbjct  131  GKLLATGVVALEGEQWTKRRKIINPAFHLEKLKHMVSAFQLSCS  174



>ref|XP_002268319.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=515

 Score =   191 bits (486),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 83/162 (51%), Positives = 120/162 (74%), Gaps = 0/162 (0%)
 Frame = +1

Query  118  VGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLS  297
            + LL +AWR+L WVW +PK LE+CL+Q GL GN YR+L GD +E+ +M ++A S+P++ S
Sbjct  13   IVLLIYAWRLLNWVWLRPKKLERCLRQQGLTGNSYRLLHGDFREMSEMINEANSRPISFS  72

Query  298  DNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGR  477
            D++  RV+P++ H   KYGKN + W GP P+V+I +PEL+++VL K+ +FQKP  +PL +
Sbjct  73   DDIVQRVLPFHDHSIQKYGKNSFTWFGPKPVVYIMEPELIRDVLLKHNVFQKPPPHPLSK  132

Query  478  KLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             L  G+V+ E EQW K R+++NPAF+ EKLK M  AF LSCS
Sbjct  133  LLATGVVALEGEQWTKRRKIINPAFHLEKLKHMVSAFQLSCS  174



>ref|XP_002265455.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=515

 Score =   191 bits (486),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 121/162 (75%), Gaps = 0/162 (0%)
 Frame = +1

Query  118  VGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLS  297
            + LL +AWR+L  VW KPK +E+ L+Q GL GN YR+L GD +E+ +M  +A S+P++LS
Sbjct  13   ITLLIYAWRLLNSVWLKPKKIERYLRQQGLIGNSYRLLHGDFREMSRMIDEANSRPISLS  72

Query  298  DNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGR  477
            D++  RV+P++ H   KYGKNC++WMGP P+V I +PEL+++VL K+  FQKP  +PLG+
Sbjct  73   DDIVQRVLPFHYHSIKKYGKNCFIWMGPKPVVNIMEPELIRDVLLKHNAFQKPPVHPLGK  132

Query  478  KLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             L  G+++ E EQW K R+++NPAF+ EKLK M PAF LSCS
Sbjct  133  LLATGVIALEGEQWTKRRKIINPAFHLEKLKHMVPAFQLSCS  174



>emb|CBI39916.3| unnamed protein product [Vitis vinifera]
Length=505

 Score =   191 bits (486),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 121/162 (75%), Gaps = 0/162 (0%)
 Frame = +1

Query  118  VGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLS  297
            + LL +AWR+L  VW KPK +E+ L+Q GL GN YR+L GD +E+ +M  +A S+P++LS
Sbjct  13   ITLLIYAWRLLNSVWLKPKKIERYLRQQGLIGNSYRLLHGDFREMSRMIDEANSRPISLS  72

Query  298  DNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGR  477
            D++  RV+P++ H   KYGKNC++WMGP P+V I +PEL+++VL K+  FQKP  +PLG+
Sbjct  73   DDIVQRVLPFHYHSIKKYGKNCFIWMGPKPVVNIMEPELIRDVLLKHNAFQKPPVHPLGK  132

Query  478  KLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             L  G+++ E EQW K R+++NPAF+ EKLK M PAF LSCS
Sbjct  133  LLATGVIALEGEQWTKRRKIINPAFHLEKLKHMVPAFQLSCS  174



>emb|CDP19608.1| unnamed protein product [Coffea canephora]
Length=470

 Score =   190 bits (483),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 118/175 (67%), Gaps = 0/175 (0%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVK  258
            M+  Y+L+GV   + LL  AWR L W W  PK +EK L++ GL+GN YR L GD +++ +
Sbjct  1    MDFFYSLIGVSSVIVLLIGAWRFLNWAWITPKKMEKRLRRQGLQGNSYRFLFGDTRDMGR  60

Query  259  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  438
            M  +A SKP++L+D++ PR++P+        GKN + W+GP P + I DPE VKEV  K 
Sbjct  61   MLEEAKSKPISLTDDIFPRIVPFINETMQHKGKNSFFWLGPRPAMVILDPEQVKEVFTKN  120

Query  439  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
              +QKPR NP+ + L  GL S + E+WAKHRRLLNPAF+ EKLK M PAF LSC+
Sbjct  121  FTYQKPRANPISKLLALGLASLDTEKWAKHRRLLNPAFHVEKLKYMVPAFYLSCN  175



>ref|NP_001291324.1| cytochrome P450 CYP72A219-like [Sesamum indicum]
 gb|AAZ07706.1| cytochrome P450 monooxygenase [Sesamum indicum]
Length=514

 Score =   191 bits (484),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 85/175 (49%), Positives = 114/175 (65%), Gaps = 0/175 (0%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVK  258
            ME + + L +      L +AW++L WVWF+P+ LEK L+Q G KGN Y++  GD  EL  
Sbjct  1    METLLSSLALISCAVALVYAWKILNWVWFRPRKLEKILRQQGFKGNSYKLFFGDFNELKA  60

Query  259  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  438
            M  +A SKPM+ S  + PRV P        YG+  ++W GP P V + DPE+V+E+L+K 
Sbjct  61   MTKEAKSKPMSFSHEIVPRVAPSIIKTVKNYGEQSFLWFGPRPAVIVLDPEMVREILSKS  120

Query  439  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             +FQ P  NP  R L RG+ SYE ++WAKHRRL+NPAF+ EKLK M PAF LSC+
Sbjct  121  YVFQMPGGNPTSRMLARGIASYETDKWAKHRRLINPAFHVEKLKHMVPAFYLSCA  175



>gb|EYU31636.1| hypothetical protein MIMGU_mgv1a004595mg [Erythranthe guttata]
Length=519

 Score =   191 bits (484),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 88/179 (49%), Positives = 126/179 (70%), Gaps = 4/179 (2%)
 Frame = +1

Query  79   MEVI---YTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKE  249
            MEVI   Y ++G C++  +L + WR+L W + +PK LEK L++ GL GN Y  L GD+KE
Sbjct  1    MEVILILYKIIGACLAFVVLFYTWRILNWAYIRPKRLEKSLRKQGLIGNTYNFLYGDLKE  60

Query  250  LVKMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVL  429
            ++ M + A S P+ L D++ PRV+ +      KYGK  ++W+GP P V I +PEL+KEV+
Sbjct  61   MLNMINHAKSHPINLDDDIKPRVLAFIHKTFLKYGKGSFIWLGPRPAVMITEPELIKEVM  120

Query  430  NKYELFQKPRN-NPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             K  L+QKP+N NPL + L +G+V+YE ++WAKHR+++NPAF+ EKLKLM PAF LSC 
Sbjct  121  TKINLYQKPKNSNPLTKLLAQGVVAYEGDKWAKHRKIINPAFHFEKLKLMIPAFYLSCD  179



>ref|XP_007022099.1| Cytochrome P450, family 72, subfamily A, polypeptide 15, putative 
[Theobroma cacao]
 gb|EOY13624.1| Cytochrome P450, family 72, subfamily A, polypeptide 15, putative 
[Theobroma cacao]
Length=518

 Score =   191 bits (484),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 118/172 (69%), Gaps = 1/172 (1%)
 Frame = +1

Query  85   VIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMA  264
            VI TLL   V VG+L   WR+L WVW KPK LE+CL++ GL+GN YR LSGD+KE   M+
Sbjct  6    VIGTLLSFLV-VGILIGGWRILDWVWLKPKRLERCLRKQGLRGNSYRFLSGDIKESSDMS  64

Query  265  SDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYEL  444
              A SKPM LSD++A  V P+       YGKN +VW+GP P V I +PE ++E+  K+  
Sbjct  65   KQARSKPMPLSDDIAQYVSPFLHQTVKNYGKNSFVWIGPRPRVTIMEPEQIREIFTKFND  124

Query  445  FQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSC  600
            FQKPR+ P+G  LV GL + + E+WAKHR ++NPAF+ +KLK M PAF  SC
Sbjct  125  FQKPRSYPVGNLLVCGLANLQGEEWAKHRNIINPAFHQDKLKNMLPAFYQSC  176



>ref|XP_009339350.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=519

 Score =   191 bits (484),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 114/158 (72%), Gaps = 0/158 (0%)
 Frame = +1

Query  130  AFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVA  309
            A AWRVL WVW +PK+LEKCL+Q GL GN YR+ SGD++E   M  +A+SKPM LS + A
Sbjct  21   ACAWRVLNWVWLRPKDLEKCLRQQGLAGNSYRLWSGDLRESSIMLKEAMSKPMNLSHDTA  80

Query  310  PRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVR  489
            PRV+P+       YGKN ++W+GP P V I +PE +K++  K+E F KP  NPL + L  
Sbjct  81   PRVLPFVHQSVSTYGKNSFMWIGPTPRVNITNPEDLKDIFTKHEDFPKPALNPLVKLLAT  140

Query  490  GLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            GL +YE ++WAKHRR++NPAF+SEKLK M P+F  SCS
Sbjct  141  GLANYEGDKWAKHRRIVNPAFHSEKLKRMLPSFYQSCS  178



>ref|XP_008226210.1| PREDICTED: cytochrome P450 CYP72A219-like [Prunus mume]
Length=519

 Score =   191 bits (484),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 113/160 (71%), Gaps = 0/160 (0%)
 Frame = +1

Query  124  LLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDN  303
            ++ +AWRVL WVW +PK LE+CL+Q GL GN YR+L GD KE   M  +  SKPM L  +
Sbjct  19   IITWAWRVLNWVWLRPKKLERCLRQQGLAGNSYRLLIGDTKESSMMVKETKSKPMDLCHD  78

Query  304  VAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKL  483
            +APRV+P+     + YGKN ++W+GP P V I +P+ +K++  KYE FQKP  NPL   L
Sbjct  79   LAPRVLPFVHQSMNTYGKNFFIWIGPTPRVNISNPDDMKDIFAKYEDFQKPATNPLVNLL  138

Query  484  VRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
              GL SYE E+WAKHR+++NPAF+SEKLK M PAF  SCS
Sbjct  139  ATGLSSYEGEKWAKHRKIINPAFHSEKLKRMLPAFHQSCS  178



>emb|CDP15983.1| unnamed protein product [Coffea canephora]
Length=521

 Score =   191 bits (484),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 118/171 (69%), Gaps = 0/171 (0%)
 Frame = +1

Query  91   YTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASD  270
            YT+   C+ + ++  +W+ L WVWF+P+ LEK LK+ G +GNPY++L GD+KE+  +  +
Sbjct  9    YTVYSSCLLLVVVGVSWKALNWVWFRPRKLEKRLKEQGFRGNPYKLLHGDIKEMSTLHKE  68

Query  271  AISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQ  450
            A SK + LSD++ PRVIP Y     KYGK  Y+W+GP P + I DPE VKE+  K  +FQ
Sbjct  69   AQSKNLNLSDDIVPRVIPQYLGAVKKYGKKTYLWLGPKPAMVIMDPEQVKEITQKVYVFQ  128

Query  451  KPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            KP  NPL R L  G+V YE ++W +HR+LLNPAF+ EKLKLM PAF  S S
Sbjct  129  KPHGNPLRRMLTPGIVMYEGDKWTQHRKLLNPAFHIEKLKLMLPAFHKSAS  179



>ref|XP_006495013.1| PREDICTED: secologanin synthase-like [Citrus sinensis]
Length=536

 Score =   191 bits (484),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 113/156 (72%), Gaps = 0/156 (0%)
 Frame = +1

Query  136  AWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAPR  315
            AW++L W W KPK +EK L++ G KGN YR L GD++E   ++  A SKP++  D++APR
Sbjct  40   AWKILNWAWLKPKRVEKQLRKQGFKGNSYRFLFGDVREHAVLSKQAKSKPISFEDDIAPR  99

Query  316  VIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVRGL  495
            V+P Y  L   YGK CY W+GP+PM+ I DP+ +KEV  K   FQKP++NPLG+ L  GL
Sbjct  100  VVPLYDQLVKLYGKICYWWVGPIPMINIMDPDQLKEVFTKINDFQKPKSNPLGKILTTGL  159

Query  496  VSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             S+E E+WAKHR+++NPAF+ EKLKLM PAF  SCS
Sbjct  160  ASHEGEKWAKHRKIINPAFHQEKLKLMLPAFNQSCS  195



>ref|XP_008226211.1| PREDICTED: cytochrome P450 CYP72A219-like [Prunus mume]
Length=519

 Score =   190 bits (483),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 115/173 (66%), Gaps = 0/173 (0%)
 Frame = +1

Query  85   VIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMA  264
            V    L V +   ++  AWRVL WVW +PK LE+CL+Q GL GN YR+L GD KE   M 
Sbjct  6    VASVALRVFLVSTVITLAWRVLNWVWLRPKKLERCLRQQGLAGNSYRLLVGDTKESSMMV  65

Query  265  SDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYEL  444
             +A SKPM LS ++ PRV+P+       YGKN ++W+GP P V I +P  VK+V   YE 
Sbjct  66   KEAKSKPMNLSHDITPRVLPFLHQSVTTYGKNFFIWIGPTPRVNISNPADVKDVFTNYED  125

Query  445  FQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            FQKP  NPL + L  GL +YE E+WAKHR+++NPAF+ EKLK M PAF LSCS
Sbjct  126  FQKPVINPLVKLLATGLPNYEGEKWAKHRKIINPAFHLEKLKRMLPAFHLSCS  178



>ref|XP_009602242.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=513

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 119/172 (69%), Gaps = 0/172 (0%)
 Frame = +1

Query  88   IYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMAS  267
            I  +L   + + L+ + WR++ WVW +P+ LEKC ++ G+ G+PYR L GD KE+ +M  
Sbjct  3    IVAILFSAIVIALVIWVWRMVNWVWLRPRKLEKCFRKQGMNGHPYRTLYGDTKEMAEMTK  62

Query  268  DAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELF  447
            +A  KP+ L+D++ PR+ P+Y H  +KYG +C+ W+GP P +F+  PEL+KE++    +F
Sbjct  63   EAKFKPIKLTDDILPRIFPFYHHTFNKYGNHCFAWIGPEPRIFVMKPELIKEIVTNNTIF  122

Query  448  QKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            +KP+  PL + LV G+ SYE ++WAKHR++LN AFY+EKLK M PA   SC 
Sbjct  123  KKPKPAPLVQLLVSGISSYEDDKWAKHRKILNTAFYAEKLKCMLPAMHTSCE  174



>emb|CDP15986.1| unnamed protein product [Coffea canephora]
Length=479

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/173 (53%), Positives = 120/173 (69%), Gaps = 1/173 (1%)
 Frame = +1

Query  88   IYTLLGVCVSVGLL-AFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMA  264
            ++T+   C+ + L+ A +W+ L WVWF+PK LEK LK+ G +GNPY++L GD KE+  M 
Sbjct  9    MFTVYSSCLLLLLVVAVSWKALNWVWFRPKKLEKRLKEQGFRGNPYKLLHGDFKEMSTMH  68

Query  265  SDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYEL  444
            ++A SK + LSD++ PRVIP Y     KYGKN Y+W GP P V I DP L+K V  K ++
Sbjct  69   TEAGSKNLNLSDDIVPRVIPQYLGAVKKYGKNTYLWFGPRPAVVIMDPNLIKAVTQKVDV  128

Query  445  FQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            F K   NPLGR L +GL +YE E+WAK R+LLNPAF+ EKLKLM PAF  S S
Sbjct  129  FHKLGVNPLGRLLAQGLRTYEGEKWAKQRKLLNPAFHVEKLKLMLPAFYKSAS  181



>ref|XP_009615907.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=516

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 125/176 (71%), Gaps = 1/176 (1%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVK  258
            ME++Y+++       +L + W+VL W WF PK +EKCL+Q GLKGNPY++L GD+ EL K
Sbjct  1    MEMMYSIIAAASIAIILVYTWKVLNWAWFGPKKMEKCLRQRGLKGNPYKLLYGDLNELTK  60

Query  259  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  438
               +A SKP+  SD++A R+IP++    +K GKN +VW+GP P+V I DPE +KE+  K 
Sbjct  61   SIIEAKSKPINFSDDIAQRLIPFFLDAINKNGKNSFVWLGPYPIVLITDPEHLKEIFTKN  120

Query  439  ELFQKPRN-NPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             ++QK  + NP  + L  GLVS E+++WAKHR++++PAF+ EKLK M PAF LSCS
Sbjct  121  YVYQKQTHPNPYAKLLAHGLVSLEEDKWAKHRKIISPAFHVEKLKHMLPAFYLSCS  176



>gb|ABC69419.1| CYP72A56 [Nicotiana tabacum]
Length=516

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 125/176 (71%), Gaps = 1/176 (1%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVK  258
            ME++Y+++       +L + W+VL W WF PK +EKCL+Q GLKGNPY++L GD+ EL K
Sbjct  1    MEMMYSIIAAASIAIILVYTWKVLNWAWFGPKKMEKCLRQRGLKGNPYKLLYGDLNELTK  60

Query  259  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  438
               +A SKP+  SD++A R+IP++    +K GKN +VW+GP P+V I DPE +KE+  K 
Sbjct  61   SIIEAKSKPINFSDDIAQRLIPFFLDAINKNGKNSFVWLGPYPIVLITDPEHLKEIFTKN  120

Query  439  ELFQKPRN-NPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             ++QK  + NP  + L  GLVS E+++WAKHR++++PAF+ EKLK M PAF LSCS
Sbjct  121  YVYQKQTHPNPYAKLLAHGLVSLEEDKWAKHRKIISPAFHVEKLKHMLPAFYLSCS  176



>emb|CDP19607.1| unnamed protein product [Coffea canephora]
Length=493

 Score =   189 bits (479),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 92/173 (53%), Positives = 121/173 (70%), Gaps = 1/173 (1%)
 Frame = +1

Query  88   IYTLLGVCVSVGLL-AFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMA  264
            ++T+   C+ + L+ A +W+ L WVWF+PK LEK LK+ G +GNPY++L GD KE+  + 
Sbjct  9    MFTVYSSCLLLLLVVAVSWKALNWVWFRPKKLEKLLKEQGFRGNPYKLLHGDFKEMSTLY  68

Query  265  SDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYEL  444
            ++A SK + LSD++ PRVIP Y     KYGKN Y+W GP P V I DP L+K V  K + 
Sbjct  69   TEAQSKNLNLSDDIVPRVIPQYLGAVKKYGKNTYLWFGPAPAVVIMDPNLIKAVTQKIDD  128

Query  445  FQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            F+K   NPLGR + +GLVSYE E+WAK R+LLNPAF+ EKLKLM PAF  S S
Sbjct  129  FRKLPVNPLGRLVAQGLVSYEGEKWAKQRKLLNPAFHVEKLKLMLPAFYKSAS  181



>ref|XP_011082966.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=515

 Score =   189 bits (480),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 83/175 (47%), Positives = 121/175 (69%), Gaps = 1/175 (1%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVK  258
            ME++Y+L+ V   V +   AWR L WVW +P+ +EK L++ G  GN YR L GD KE+  
Sbjct  1    MEILYSLVAVIFGVFVSVNAWRFLNWVWLEPRKVEKRLREQGFNGNSYRFLVGDSKEMSS  60

Query  259  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  438
            M  +A SKP+  S+++  RV+P+  H   KYG+NC++W GP P   I DPE++KE+++K 
Sbjct  61   MGEEAQSKPINFSNDIVHRVMPFIHHSLHKYGENCFIWFGPKPAALISDPEMIKEIMSKN  120

Query  439  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             +FQK  +NPL + L +G+ +YE ++W KHRRL+NPAF+ EKLK M P+F LSC+
Sbjct  121  YVFQKI-SNPLDQLLAKGVAAYEADKWDKHRRLINPAFHLEKLKHMVPSFYLSCA  174



>ref|XP_004243254.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=518

 Score =   189 bits (480),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 122/177 (69%), Gaps = 3/177 (2%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVG-LLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELV  255
            ME +  ++   + V  LL   W+VL W WF+PK LEK  +Q GL GN YR+L GD+KE  
Sbjct  1    METLNNIIIATIFVTILLVHTWKVLNWAWFRPKKLEKFFRQQGLCGNSYRLLHGDLKEFS  60

Query  256  KMASDAISKPMT-LSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLN  432
            K   +A SKP+  LS+++APR+IPY+     KYGKNC+VW GP PM+ I + E ++E+  
Sbjct  61   KSIKEAQSKPINNLSNDIAPRIIPYFIQTISKYGKNCFVWFGPKPMILIMESEQIREIFA  120

Query  433  KYELFQKPRN-NPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSC  600
            K  ++QKP + NP+   L RG+ +YE+++WAKHR++L PAF+ EKLKLM PAF LSC
Sbjct  121  KNYVYQKPHHSNPVANLLARGIANYEEDKWAKHRKILKPAFHMEKLKLMLPAFYLSC  177



>ref|XP_006598137.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Glycine 
max]
Length=520

 Score =   189 bits (479),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 111/156 (71%), Gaps = 0/156 (0%)
 Frame = +1

Query  136  AWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAPR  315
            +W+VL W+W +PK LEK L++ G +GNPY +  GD KE +KM  +A+SKPMTLSD++ PR
Sbjct  20   SWKVLNWLWLRPKRLEKLLREQGFRGNPYTLFFGDSKEFLKMRKEAVSKPMTLSDDIVPR  79

Query  316  VIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVRGL  495
            V  Y  H  +K+GKN ++W GPMP V I DPE +K+V NK   F KP  NPL + L  GL
Sbjct  80   VSAYVQHSVNKHGKNSFIWFGPMPRVTILDPEQIKDVFNKNYDFPKPNLNPLVKLLATGL  139

Query  496  VSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
              YE E+W+KHRR++NPAF  EKLK+M P FL SC+
Sbjct  140  AGYEGEKWSKHRRIINPAFNLEKLKIMLPLFLQSCN  175



>gb|KHN44056.1| Secologanin synthase [Glycine soja]
Length=520

 Score =   189 bits (479),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 111/156 (71%), Gaps = 0/156 (0%)
 Frame = +1

Query  136  AWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAPR  315
            +W+VL W+W +PK LEK L++ G +GNPY +  GD KE +KM  +A+SKPMTLSD++ PR
Sbjct  20   SWKVLNWLWLRPKRLEKLLREQGFRGNPYTLFFGDSKEFLKMRKEAVSKPMTLSDDIVPR  79

Query  316  VIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVRGL  495
            V  Y  H  +K+GKN ++W GPMP V I DPE +K+V NK   F KP  NPL + L  GL
Sbjct  80   VSAYVQHSVNKHGKNSFIWFGPMPRVTILDPEQIKDVFNKNYDFPKPNLNPLVKLLATGL  139

Query  496  VSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
              YE E+W+KHRR++NPAF  EKLK+M P FL SC+
Sbjct  140  AGYEGEKWSKHRRIINPAFNLEKLKIMLPLFLQSCN  175



>gb|AJD25167.1| cytochrome P450 CYP72A326 [Salvia miltiorrhiza]
Length=518

 Score =   188 bits (478),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 128/177 (72%), Gaps = 2/177 (1%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVGLL-AFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELV  255
            M+ +Y+++  C ++ ++  +AWR+L W + +PK LEK L++ GL GN Y  +SGDMKE+V
Sbjct  1    MQRVYSIVAACFAIAVVVTYAWRLLNWAYLRPKRLEKILRKQGLNGNSYIPVSGDMKEMV  60

Query  256  KMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNK  435
            K   +A SKP+ L D++ PR+ P+  +   K+G  C++W GP P+V I + EL+K+VLNK
Sbjct  61   KAMQEANSKPINLDDDIKPRLQPFLLNTIRKHGNECFMWKGPTPVVVITETELIKQVLNK  120

Query  436  YELFQKPRN-NPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            + +F+KPR  NPL R   +G+ S+EK++W+KHR+++NPAF+ +KLKLM PAF LSC 
Sbjct  121  HSVFEKPRVLNPLVRMFSQGIFSHEKDKWSKHRKIINPAFHLDKLKLMVPAFHLSCD  177



>emb|CDP19601.1| unnamed protein product [Coffea canephora]
Length=514

 Score =   188 bits (477),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 117/175 (67%), Gaps = 0/175 (0%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVK  258
            M+  Y+L+GV   + LL  AWR L W W  PK +EK L++ GL+GN YR L GD +++ +
Sbjct  1    MDFFYSLIGVSSVIVLLIGAWRFLNWAWITPKKMEKRLRRQGLQGNSYRFLFGDTRDMGR  60

Query  259  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  438
            M  +A SKP++L+D++ PR++P         GKN + W+GP P + I DPE VKEV  K 
Sbjct  61   MLEEAKSKPISLTDDIFPRIMPLINETMQHKGKNSFFWLGPRPAMVILDPEQVKEVFTKN  120

Query  439  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
              +QKPR NP+ + L  GL S + E+WAKHRRLLNPAF+ EKLK M PAF LSC+
Sbjct  121  FTYQKPRANPISKLLALGLASLDTEKWAKHRRLLNPAFHVEKLKYMVPAFYLSCN  175



>emb|CBI39884.3| unnamed protein product [Vitis vinifera]
Length=470

 Score =   187 bits (474),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 119/174 (68%), Gaps = 0/174 (0%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVK  258
            ME+ Y  + +  +  LL+ AWR    VW +P+ LE+CL++ GL GN YR L GD K++  
Sbjct  1    MEIAYDSVLIFCAFALLSLAWRAFYLVWLRPRRLERCLRRQGLMGNSYRPLHGDAKKVSI  60

Query  259  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  438
            M  +A S+P+ LSD++ PRVIP+      +YGKN + W+GP+P V I  PEL++EV  + 
Sbjct  61   MLKEANSRPINLSDDIVPRVIPFLYKTIQQYGKNSFTWVGPIPRVNIMKPELIREVFLEA  120

Query  439  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSC  600
              FQK + NPL   L+ GLVSYE E+WAKHR+LLNPAF+ EKLKLM PAF LSC
Sbjct  121  GRFQKQKPNPLANFLLTGLVSYEGEKWAKHRKLLNPAFHVEKLKLMSPAFHLSC  174



>gb|KGN66156.1| hypothetical protein Csa_1G574240 [Cucumis sativus]
Length=172

 Score =   178 bits (452),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 113/163 (69%), Gaps = 4/163 (2%)
 Frame = +1

Query  85   VIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMA  264
            +I+ +  VC    LL   WR L W+W  PK LEKCL++ G  GN YR+ SGD+K+LV M+
Sbjct  7    MIWFVFMVC----LLRCGWRFLNWIWLTPKKLEKCLREQGFAGNSYRLYSGDLKDLVAMS  62

Query  265  SDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYEL  444
             +A SKPM  S ++APRVIP   H  +KYGKN +VW+GP+P VFI DPE +K  L+ Y  
Sbjct  63   EEAKSKPMNFSHDIAPRVIPSIHHTIEKYGKNSFVWLGPIPRVFIMDPEQLKAALSLYND  122

Query  445  FQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKL  573
            FQKP  NPL + L  GL+++E E+W KHR+++N AF+ EKLK+
Sbjct  123  FQKPTINPLVKLLFDGLINHEGEKWVKHRKIVNHAFHFEKLKV  165



>ref|XP_006477947.1| PREDICTED: secologanin synthase-like [Citrus sinensis]
Length=263

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 114/165 (69%), Gaps = 0/165 (0%)
 Frame = +1

Query  106  VCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKP  285
              V V +L +AWRVL WVW +P+ LEK L+Q GLKGN YR+L GD+KE      +A ++P
Sbjct  11   TIVIVTVLTWAWRVLNWVWLRPEKLEKFLRQQGLKGNSYRLLFGDLKENSIELKEAKARP  70

Query  286  MTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNN  465
            ++L DN+A RV P+   L + YGKN ++W GP P V I +P+ +KE+  +   FQK  + 
Sbjct  71   LSLDDNIAIRVNPFLHKLVNDYGKNSFMWFGPTPRVNIMNPDQIKEIFTRINDFQKVNSI  130

Query  466  PLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSC  600
            PL R L+ GL + E E+WAKHR+L+NPAF+ EKLKLM PAF LSC
Sbjct  131  PLARLLIVGLATLEGEKWAKHRKLINPAFHQEKLKLMLPAFYLSC  175



>ref|XP_010644780.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Vitis vinifera]
Length=518

 Score =   187 bits (476),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 120/162 (74%), Gaps = 0/162 (0%)
 Frame = +1

Query  118  VGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLS  297
            + +L +AWRVL W+W +PK LE+CLKQ GL GN YR+L GD KE+  M  +A S+P+++S
Sbjct  16   ITILIYAWRVLNWMWLRPKRLERCLKQQGLAGNSYRLLYGDFKEMSMMIKEATSRPISIS  75

Query  298  DNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGR  477
            D++  RV P++ H   KYGK+ ++WMGP P V I +PEL+++VL+ + +F+KPR + L +
Sbjct  76   DDIVQRVAPFHYHSIKKYGKSSFIWMGPKPRVNIMEPELIRDVLSMHTVFRKPRVHALVK  135

Query  478  KLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             LV GL+  + E+WAKHR+++NPAF  EKLK M PAF LSCS
Sbjct  136  LLVSGLLFLDGEKWAKHRKIINPAFRLEKLKNMLPAFHLSCS  177



>ref|XP_004151605.1| PREDICTED: secologanin synthase-like, partial [Cucumis sativus]
Length=336

 Score =   183 bits (465),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 110/156 (71%), Gaps = 0/156 (0%)
 Frame = +1

Query  136  AWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAPR  315
             W++  W+WF+PK LEK L+Q G  GN YRIL GD+KE   M  +A+SKPM  S+++APR
Sbjct  20   GWKLADWIWFRPKKLEKLLRQQGFAGNSYRILHGDLKERAAMREEAMSKPMNFSNHIAPR  79

Query  316  VIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVRGL  495
            VIP   H   +YGKN ++W+GP+P V I DPE +K V + Y  FQKP  NP  + LV+G+
Sbjct  80   VIPSIYHTIQRYGKNSFMWLGPLPRVHIMDPEQLKTVFSFYNDFQKPTMNPFTKLLVQGI  139

Query  496  VSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            V+ + E+W KHR+++NPAF+ EKLK M PAF  SC+
Sbjct  140  VNLDGEKWVKHRKIINPAFHLEKLKDMVPAFYHSCN  175



>ref|XP_002263609.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=515

 Score =   187 bits (475),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 123/173 (71%), Gaps = 4/173 (2%)
 Frame = +1

Query  97   LLGVCVSVG----LLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMA  264
            L  V +S G    L++  WR+L WVW +PK LE+CL++ GL GN YR+L GD KE+ +M 
Sbjct  3    LSSVAISFGFLTVLISCVWRLLNWVWLRPKRLERCLREQGLAGNSYRLLQGDSKEMSRMM  62

Query  265  SDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYEL  444
             +A S+P++LSD++  RV+P++ H   KYGKN + W+GP P V I +PEL+++VL K  +
Sbjct  63   KEAYSRPISLSDDIVQRVLPFHCHFIKKYGKNFFTWVGPSPRVNIMEPELMRDVLLKSNI  122

Query  445  FQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            FQK  ++PL + LV GLV+ E EQWAK R+++NPAF+ EKLK M  AF LSCS
Sbjct  123  FQKTPSHPLVKLLVSGLVALEGEQWAKRRKIINPAFHPEKLKNMLSAFHLSCS  175



>ref|XP_002263652.1| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=516

 Score =   187 bits (475),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 119/174 (68%), Gaps = 0/174 (0%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVK  258
            ME+ Y  + +  +  LL+ AWR    VW +P+ LE+CL++ GL GN YR L GD K++  
Sbjct  1    MEIAYDSVLIFCAFALLSLAWRAFYLVWLRPRRLERCLRRQGLMGNSYRPLHGDAKKVSI  60

Query  259  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  438
            M  +A S+P+ LSD++ PRVIP+      +YGKN + W+GP+P V I  PEL++EV  + 
Sbjct  61   MLKEANSRPINLSDDIVPRVIPFLYKTIQQYGKNSFTWVGPIPRVNIMKPELIREVFLEA  120

Query  439  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSC  600
              FQK + NPL   L+ GLVSYE E+WAKHR+LLNPAF+ EKLKLM PAF LSC
Sbjct  121  GRFQKQKPNPLANFLLTGLVSYEGEKWAKHRKLLNPAFHVEKLKLMSPAFHLSC  174



>ref|XP_007212438.1| hypothetical protein PRUPE_ppa016770mg [Prunus persica]
 gb|EMJ13637.1| hypothetical protein PRUPE_ppa016770mg [Prunus persica]
Length=506

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 111/160 (69%), Gaps = 0/160 (0%)
 Frame = +1

Query  124  LLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDN  303
            ++ +AWRVL WVW +PK LE+CL+Q GL GN YR+L GD KE   M  +A SKPM LS +
Sbjct  6    IITWAWRVLNWVWLRPKKLERCLRQQGLAGNSYRLLVGDTKESSMMVKEAKSKPMNLSHD  65

Query  304  VAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKL  483
            + PRV+P+       YGKN ++W+GP P V I +P  VK+V   YE FQKP  NPL + L
Sbjct  66   ITPRVLPFLHQSVTTYGKNFFIWIGPTPRVNISNPADVKDVFTNYEDFQKPVINPLVKFL  125

Query  484  VRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
              GL +YE E+WAKHR+++NPAF+ EKLK M PAF  SCS
Sbjct  126  ATGLPNYEGEKWAKHRKIINPAFHLEKLKRMLPAFHQSCS  165



>ref|XP_002265784.2| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=526

 Score =   187 bits (475),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 117/164 (71%), Gaps = 0/164 (0%)
 Frame = +1

Query  112  VSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMT  291
            V + LL +AWR+L WVW +PK LE+CL+Q GL GN YR+L GD +E+ +M ++A S+P++
Sbjct  22   VFITLLIYAWRLLNWVWLRPKKLERCLRQQGLTGNSYRLLHGDFREMSRMINEANSRPIS  81

Query  292  LSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPL  471
             SD++  RV+P++ H   KYGKN ++W+GP P+V I  PEL+ +VL K+  FQK   +PL
Sbjct  82   FSDDIVQRVLPFHDHSIQKYGKNNFIWLGPKPVVNIMQPELISDVLLKHNAFQKAPRHPL  141

Query  472  GRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             + L  G+ S E EQW K R+++NPAF+ EKLK M  AF LSCS
Sbjct  142  RKLLASGIASLEGEQWTKRRKIINPAFHLEKLKHMVSAFQLSCS  185



>gb|KEH28455.1| cytochrome P450 family 72 protein [Medicago truncatula]
Length=415

 Score =   185 bits (469),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 124/175 (71%), Gaps = 2/175 (1%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVK  258
            ME   +++ + V+VGL+ +AWR+L W+W +PK LEK L++ GL+GNPYRIL GD+K+L+K
Sbjct  1    MEWYSSIIPIIVTVGLI-WAWRILNWLWLRPKKLEKLLREQGLQGNPYRILYGDIKDLLK  59

Query  259  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  438
            M  +A SK M L+D++ PRVIPY  H    +GKN ++W G  P V + +PE + +VLN  
Sbjct  60   MEKEARSKSMNLTDDIMPRVIPYIQHNVKIHGKNSFMWFGTKPRVILTEPEQIIDVLNNI  119

Query  439  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
              F K  N+ + + LV GL S E E+W+KHRRL+NPAF+SEKLK+M P F  SC+
Sbjct  120  SDFPK-NNHKIFKLLVSGLASLEGEKWSKHRRLINPAFHSEKLKVMTPTFFTSCN  173



>ref|XP_006598136.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X2 [Glycine 
max]
Length=389

 Score =   184 bits (467),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 111/156 (71%), Gaps = 0/156 (0%)
 Frame = +1

Query  136  AWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAPR  315
            AW+VL W+W +PK LEK L++ GL+GNPY +  GD KE +KM  +A+SKPM LSD++ PR
Sbjct  20   AWKVLIWLWLRPKRLEKLLREQGLQGNPYTLFVGDSKEFLKMRKEALSKPMNLSDDIIPR  79

Query  316  VIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVRGL  495
            V  Y  H  +K+GKN ++W+GP+P V I DPE +K+V NK   F KP  NPL + L  GL
Sbjct  80   VSSYEQHSVNKHGKNSFIWLGPIPRVTILDPEQIKDVFNKIYDFPKPNMNPLVKLLATGL  139

Query  496  VSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
              YE E+W+KHRR++NPAF  EKLK+M P F  SC+
Sbjct  140  AGYEGEKWSKHRRIINPAFNLEKLKIMLPLFFKSCN  175



>gb|KEH38475.1| cytochrome P450 family 72 protein [Medicago truncatula]
Length=518

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 120/173 (69%), Gaps = 5/173 (3%)
 Frame = +1

Query  85   VIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMA  264
            +++TL+ +      L +AWR+L W+W KPK LEK L++ GLKGN YR+L GD+K+L+K+ 
Sbjct  8    ILFTLMTLS-----LIWAWRILNWIWLKPKKLEKELREQGLKGNSYRLLVGDIKDLLKIR  62

Query  265  SDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYEL  444
             +A SKPM LSD++ PRV  +      K+GKN ++W GP P V I DPE +K+V+NK   
Sbjct  63   KEATSKPMNLSDDIVPRVYSFVQQTVAKHGKNSFIWFGPTPRVNITDPEQIKDVINKIYD  122

Query  445  FQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            FQKP  NPL R L  GLV  E EQW+KHR+++NPAF+ EKLK++ P F  SC 
Sbjct  123  FQKPNVNPLVRLLGCGLVCLEGEQWSKHRKIINPAFHLEKLKIILPIFHKSCD  175



>ref|XP_003634773.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
 emb|CBI22132.3| unnamed protein product [Vitis vinifera]
Length=518

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 120/162 (74%), Gaps = 0/162 (0%)
 Frame = +1

Query  118  VGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLS  297
            + +L +AWR+L W+W +PK LE+CLKQ GL GN YR+L GD KE+  M  +A S+P+++S
Sbjct  16   ITILIYAWRILNWMWLRPKRLERCLKQQGLAGNSYRLLHGDFKEMFMMIKEATSRPISIS  75

Query  298  DNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGR  477
            D++  R+ P++ H   KYGK+ ++WMGP P V I +PEL+++VL+ + +F+KPR + L +
Sbjct  76   DDIVQRIAPFHYHSIKKYGKSSFIWMGPKPRVNIMEPELIRDVLSMHTVFRKPRVHALVK  135

Query  478  KLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             LV GL+  + E+WAKHR+++NPAF  EK+K M PAF LSCS
Sbjct  136  LLVSGLLFLDGEKWAKHRKIINPAFRLEKVKNMLPAFHLSCS  177



>emb|CBI22131.3| unnamed protein product [Vitis vinifera]
Length=475

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 120/162 (74%), Gaps = 0/162 (0%)
 Frame = +1

Query  118  VGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLS  297
            + +L +AWR+L W+W +PK LE+CLKQ GL GN YR+L GD+KE+  M  +A S+P+++S
Sbjct  16   ITILIYAWRILNWMWLRPKRLERCLKQQGLAGNSYRLLHGDLKEMFMMIKEASSRPISIS  75

Query  298  DNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGR  477
            D++  R+ P+  H   KYGK+ ++WMGP P V I +PEL+++VL+ + +F+KPR + L +
Sbjct  76   DDIVQRIAPFQYHSIKKYGKSSFIWMGPKPRVNIMEPELIRDVLSMHTVFRKPRVHALVK  135

Query  478  KLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             LV GL+  + E+WAKHR+++NPAF  EKLK M PAF LSCS
Sbjct  136  LLVSGLLFLDGEKWAKHRKIINPAFRLEKLKNMLPAFHLSCS  177



>ref|XP_009356840.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=516

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 112/158 (71%), Gaps = 0/158 (0%)
 Frame = +1

Query  130  AFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVA  309
             +AWRV+ W+W +PK LE+ L+Q GL GN YR +SGDMKE+      A SKPM+LS ++A
Sbjct  18   TWAWRVVNWLWLRPKKLERYLRQQGLAGNLYRFMSGDMKEISMTTEQAYSKPMSLSHDIA  77

Query  310  PRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVR  489
            PRVIP++  L + YGKN +VWMG +P V I +PE +K +L K E+F +P  NPL + L  
Sbjct  78   PRVIPFHHRLVNTYGKNSFVWMGSIPRVIITNPEDLKYILTKMEVFPQPEPNPLVKLLAT  137

Query  490  GLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            G+  YE E+WAKHRR++NP F+ EKLK M PAF  SCS
Sbjct  138  GIAFYEGEKWAKHRRIINPVFHLEKLKRMLPAFYESCS  175



>ref|XP_009343587.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=516

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 112/158 (71%), Gaps = 0/158 (0%)
 Frame = +1

Query  130  AFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVA  309
             +AWRV+ W+W +PK LE+ L+Q GL GN YR +SGDMKE+      A SKPM+LS ++A
Sbjct  18   TWAWRVVNWLWLRPKKLERYLRQQGLAGNLYRFMSGDMKEISMTTEQAYSKPMSLSHDIA  77

Query  310  PRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVR  489
            PRVIP++  L + YGKN +VWMG +P V I +PE +K +L K E+F +P  NPL + L  
Sbjct  78   PRVIPFHHRLVNTYGKNSFVWMGSIPRVIITNPEDLKYILTKMEVFPQPEPNPLVKLLAT  137

Query  490  GLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            G+  YE E+WAKHRR++NP F+ EKLK M PAF  SCS
Sbjct  138  GIAFYEGEKWAKHRRIINPVFHLEKLKRMLPAFYESCS  175



>emb|CBI39886.3| unnamed protein product [Vitis vinifera]
Length=550

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 123/173 (71%), Gaps = 4/173 (2%)
 Frame = +1

Query  97   LLGVCVSVG----LLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMA  264
            L  V +S G    L++  WR+L WVW +PK LE+CL++ GL GN YR+L GD KE+ +M 
Sbjct  3    LSSVAISFGFLTVLISCVWRLLNWVWLRPKRLERCLREQGLAGNSYRLLQGDSKEMSRMM  62

Query  265  SDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYEL  444
             +A S+P++LSD++  RV+P++ H   KYGKN + W+GP P V I +PEL+++VL K  +
Sbjct  63   KEAYSRPISLSDDIVQRVLPFHCHFIKKYGKNFFTWVGPSPRVNIMEPELMRDVLLKSNI  122

Query  445  FQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            FQK  ++PL + LV GLV+ E EQWAK R+++NPAF+ EKLK M  AF LSCS
Sbjct  123  FQKTPSHPLVKLLVSGLVALEGEQWAKRRKIINPAFHPEKLKNMLSAFHLSCS  175



>gb|KJB12898.1| hypothetical protein B456_002G043200 [Gossypium raimondii]
Length=518

 Score =   186 bits (473),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 109/159 (69%), Gaps = 0/159 (0%)
 Frame = +1

Query  127  LAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNV  306
            + + WR L WVW  PK LE CL+Q G  GNPYR LSGD+KEL  M+    +KPM LSD++
Sbjct  20   MIWGWRTLNWVWLAPKRLESCLRQQGFAGNPYRFLSGDIKELFTMSRQTRAKPMPLSDDI  79

Query  307  APRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLV  486
             P V+P+    A++YGKN + W GP P   I DPE ++E+LNK+  FQK R NPL   LV
Sbjct  80   GPYVVPFQHQTANQYGKNSFTWFGPRPRANITDPEKIREILNKFNDFQKIRTNPLLNLLV  139

Query  487  RGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             GLV+ E ++W+K R+++NPAF+ +KLK M PAF  SCS
Sbjct  140  SGLVNLEGDRWSKRRKIINPAFHQDKLKNMLPAFYQSCS  178



>gb|EYU30744.1| hypothetical protein MIMGU_mgv1a004594mg [Erythranthe guttata]
Length=519

 Score =   186 bits (473),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 116/159 (73%), Gaps = 2/159 (1%)
 Frame = +1

Query  127  LAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMT-LSDN  303
            + +AW+VL WVWF+P+NLEK L+QLG +GN YR+L GD KE+  M  +A SKP++  S++
Sbjct  17   IVYAWKVLNWVWFRPRNLEKWLRQLGFEGNSYRVLFGDSKEMSNMIKEAKSKPISAFSND  76

Query  304  VAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKL  483
            +  RVIP   H    YG+ C +W GP P V + D EL++E+L+K  +FQK  +NPLGR+L
Sbjct  77   IVARVIPAIHHAVSMYGEKCILWFGPKPAVLVTDTELIREILSKSYVFQK-NSNPLGRQL  135

Query  484  VRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSC  600
             RG+ +YE ++WAKHRRL+NPAF  +K+K M P+F LSC
Sbjct  136  ARGVATYETDKWAKHRRLINPAFQPDKIKQMLPSFYLSC  174



>ref|XP_004243261.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=517

 Score =   186 bits (473),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 125/178 (70%), Gaps = 4/178 (2%)
 Frame = +1

Query  79   MEVIYT--LLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKEL  252
            ME+ Y   L  +CV++ LL + W+VL W WF+PK LEK L++ GLKGNPY++L GD+KEL
Sbjct  1    MEISYNTILTAICVAI-LLVYTWKVLNWAWFRPKKLEKYLRKSGLKGNPYKLLYGDLKEL  59

Query  253  VKMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLN  432
                ++A SKP+  SD +A R+ P++A+  DK GK+ +VW+GP P+V I +PE VKE+L 
Sbjct  60   KNKLNEAKSKPINFSDGIAQRINPFFANAIDKNGKSSFVWLGPYPIVLITEPEHVKEILT  119

Query  433  KYELFQKPRN-NPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            K  ++Q+  + NP  +KL  GL   E+++WAKHR+++ PAF  EKLK M PAF  SCS
Sbjct  120  KNYVYQRQTHANPFAKKLALGLAKLEEDKWAKHRKIIQPAFQVEKLKHMLPAFYQSCS  177



>ref|XP_010644781.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Vitis vinifera]
Length=518

 Score =   186 bits (472),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 120/162 (74%), Gaps = 0/162 (0%)
 Frame = +1

Query  118  VGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLS  297
            + +L +AWR+L W+W +PK LE+CLKQ GL GN YR+L GD+KE+  M  +A S+P+++S
Sbjct  16   ITILIYAWRILNWMWLRPKRLERCLKQQGLAGNSYRLLHGDLKEMFMMIKEASSRPISIS  75

Query  298  DNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGR  477
            D++  R+ P+  H   KYGK+ ++WMGP P V I +PEL+++VL+ + +F+KPR + L +
Sbjct  76   DDIVQRIAPFQYHSIKKYGKSSFIWMGPKPRVNIMEPELIRDVLSMHTVFRKPRVHALVK  135

Query  478  KLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             LV GL+  + E+WAKHR+++NPAF  EKLK M PAF LSCS
Sbjct  136  LLVSGLLFLDGEKWAKHRKIINPAFRLEKLKNMLPAFHLSCS  177



>ref|XP_008386388.1| PREDICTED: cytochrome P450 CYP72A219-like [Malus domestica]
Length=519

 Score =   186 bits (472),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 111/158 (70%), Gaps = 0/158 (0%)
 Frame = +1

Query  130  AFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVA  309
            A AWRVL WVW +PK LEKCL+Q GL GN YR+ SGD+KE+  M  +A+SKPM LS + A
Sbjct  21   ACAWRVLNWVWLRPKKLEKCLRQQGLAGNSYRLWSGDLKEISMMLKEAVSKPMNLSHDTA  80

Query  310  PRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVR  489
            PRV+PY       YGKN ++W+GP P V I +PE +K +  K+E F KP  +PL + L+ 
Sbjct  81   PRVVPYAHQSVSTYGKNSFIWIGPTPRVNITNPEDLKNIFTKHEDFPKPALSPLVKLLLT  140

Query  490  GLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            GL +Y  E+WAKHR+++ PAF+SEKLK M PA   SCS
Sbjct  141  GLANYGGEKWAKHRKIIKPAFHSEKLKRMLPAIYQSCS  178



>ref|XP_004166890.1| PREDICTED: LOW QUALITY PROTEIN: secologanin synthase-like [Cucumis 
sativus]
Length=524

 Score =   186 bits (472),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 110/156 (71%), Gaps = 0/156 (0%)
 Frame = +1

Query  136  AWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAPR  315
             W+++ W+WF+PK LEK L++ G  GN YRIL GD+KE   M  +A+SKPM  S+++APR
Sbjct  28   GWKIVDWIWFRPKKLEKLLRRQGFTGNSYRILHGDLKESAAMRKEAMSKPMNFSNHIAPR  87

Query  316  VIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVRGL  495
            VIP   H    YGKN ++W+GPMP V I DPE +K V +    FQKP  NPL R LV+G+
Sbjct  88   VIPSVYHTIQIYGKNSFMWLGPMPRVHIMDPEQIKTVFSFINDFQKPTMNPLTRLLVQGI  147

Query  496  VSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             + E E+WAKHR+++NPAF+ EKLK M PAF  SC+
Sbjct  148  ANLEGEKWAKHRKIINPAFHLEKLKDMVPAFYHSCN  183



>ref|XP_010465361.1| PREDICTED: cytochrome P450 72A13-like [Camelina sativa]
Length=513

 Score =   186 bits (471),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 110/155 (71%), Gaps = 0/155 (0%)
 Frame = +1

Query  139  WRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAPRV  318
            WR L WVWFKPK LE  L++ GL G PY  L GD+K    M ++A SKP+ L+D++ PRV
Sbjct  22   WRTLNWVWFKPKMLESYLRRQGLAGTPYTPLVGDVKRNSSMLAEARSKPIQLTDDITPRV  81

Query  319  IPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVRGLV  498
            +P++ H+   +G+  + W+GP+P V I DPEL+KEV N    FQK  +NPLGR +  GLV
Sbjct  82   VPFHLHMLKTHGRTFFTWLGPIPTVTIMDPELIKEVFNNVNDFQKAHSNPLGRLIATGLV  141

Query  499  SYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            SY+ ++WAKHRR++NPAF+ EK+K M PAF  SCS
Sbjct  142  SYDGDKWAKHRRIINPAFHLEKIKNMVPAFHQSCS  176



>dbj|BAF98466.1| cytochrome P450 [Coptis japonica var. dissecta]
Length=518

 Score =   186 bits (471),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 122/174 (70%), Gaps = 1/174 (1%)
 Frame = +1

Query  85   VIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMA  264
            +++TLL  C  + + ++AW+   WVW  P+ LEKCL++ G+KG  Y+ LSG++K++V   
Sbjct  5    ILFTLLVTCAVIYISSWAWKAFVWVWLNPRKLEKCLREQGIKGPSYKFLSGNLKDIVSAT  64

Query  265  SDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVL-NKYE  441
             +A +KPM LS  + PRV+P+     +KYGK  ++W GP   V I DP++++++L NK+ 
Sbjct  65   QEARAKPMELSHKIVPRVMPFVHQTVEKYGKLSFIWYGPYCRVNIMDPDMIRDILSNKFG  124

Query  442  LFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             F+K R NPLG+ L+ G+VSYE E+W KHRR+LNPAF+ EKLK+M PA   SCS
Sbjct  125  HFEKIRTNPLGKLLISGVVSYEGEKWVKHRRILNPAFHLEKLKMMLPAIYTSCS  178



>ref|XP_009615908.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Nicotiana 
tomentosiformis]
Length=514

 Score =   186 bits (471),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 122/171 (71%), Gaps = 2/171 (1%)
 Frame = +1

Query  94   TLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDA  273
            T+  V V++  L + W+VL WVWF+PK LEKCL+Q GLKGNPY++L GD+ EL K   +A
Sbjct  5    TIAVVSVAI-FLVYTWKVLNWVWFRPKKLEKCLRQRGLKGNPYKLLYGDLNELTKSIIEA  63

Query  274  ISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNK-YELFQ  450
             SKP+  SD++A R+IP++ +  +K GK  +VW+GP P+V I  PE VKE+L K Y   +
Sbjct  64   KSKPINFSDDIAQRLIPFFLNAINKNGKTSFVWLGPYPVVLITAPEHVKEILTKSYVYLK  123

Query  451  KPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            +   NPL + L + LV+ E+E+WAKHR+++NPAF+ EKLK M PAF  SCS
Sbjct  124  QTHPNPLTKLLAQSLVNLEEEKWAKHRKIINPAFHVEKLKHMLPAFYQSCS  174



>ref|XP_009339349.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=532

 Score =   186 bits (472),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 110/158 (70%), Gaps = 0/158 (0%)
 Frame = +1

Query  130  AFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVA  309
            A AWRVL WVW +PK LEKCL+Q GL GN YR+ SGD+KE+  M  +A+SKPM  S + A
Sbjct  34   ACAWRVLNWVWLRPKKLEKCLRQQGLAGNSYRLWSGDLKEISMMLKEAVSKPMNHSHDTA  93

Query  310  PRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVR  489
            PRV+PY       YGKN ++W+GP P V I +PE +K +  K+E F K   NPL + L+ 
Sbjct  94   PRVLPYAHQSVSTYGKNSFIWIGPTPRVNITNPEDLKNIFTKHEDFPKLTANPLVKLLLT  153

Query  490  GLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            GL +Y  E+WAKHR+++NPAF+SEKLK M PA   SCS
Sbjct  154  GLANYGGEKWAKHRKIINPAFHSEKLKRMLPAIYQSCS  191



>ref|XP_002262693.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=515

 Score =   186 bits (471),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 117/164 (71%), Gaps = 0/164 (0%)
 Frame = +1

Query  112  VSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMT  291
            V + LL +AWR+L WVW +PK LE+CL+Q GL GN Y  L GD KE+ +M ++A S+P++
Sbjct  11   VFITLLIYAWRLLNWVWLRPKKLERCLRQQGLTGNSYSCLYGDFKEMSRMINEANSRPIS  70

Query  292  LSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPL  471
             SD++  RV+P++ H   KYGKN + W+GP P+V I +PEL+++V  K+  FQK   +PL
Sbjct  71   FSDDIVQRVLPFHDHSIQKYGKNSFTWLGPKPVVNIMEPELIRDVFLKHNAFQKVPPHPL  130

Query  472  GRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            G+ L  G+V+ E EQW K R+++NPAF+ EKLK M  AF LSCS
Sbjct  131  GKLLATGVVALEGEQWTKRRKIINPAFHLEKLKHMVSAFQLSCS  174



>ref|XP_011082818.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=521

 Score =   186 bits (471),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 118/162 (73%), Gaps = 0/162 (0%)
 Frame = +1

Query  118  VGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLS  297
            VGL+ +A R+L WVWF+PK LEK L++ GL+GNPYR L GDMK L+ +  +  +K + LS
Sbjct  17   VGLITWAVRILNWVWFRPKKLEKLLRKQGLQGNPYRFLLGDMKTLISVTKEEQTKSIQLS  76

Query  298  DNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGR  477
            D++AP ++PYY  + ++YG+N ++W GP P + I DP+L+KE+L K E+F KP  +P+G 
Sbjct  77   DHLAPHILPYYHQIINEYGQNSFIWFGPSPRLNITDPQLMKEILTKPEVFHKPLPDPIGE  136

Query  478  KLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             +  GL+  E E+WA+HR+++NPAF+ EKLK M  A  LSCS
Sbjct  137  TIAGGLLFLEDEKWAQHRKIINPAFHMEKLKNMVSAIRLSCS  178



>ref|XP_006442294.1| hypothetical protein CICLE_v10024650mg [Citrus clementina]
 ref|XP_006442295.1| hypothetical protein CICLE_v10024650mg [Citrus clementina]
 gb|ESR55534.1| hypothetical protein CICLE_v10024650mg [Citrus clementina]
 gb|ESR55535.1| hypothetical protein CICLE_v10024650mg [Citrus clementina]
Length=266

 Score =   179 bits (454),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 113/165 (68%), Gaps = 0/165 (0%)
 Frame = +1

Query  106  VCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKP  285
              V V +L +AWRVL WVW +PK LEK L+Q GLKGN YR+L GD+KE      +A ++P
Sbjct  11   TIVIVTVLTWAWRVLNWVWLRPKKLEKFLRQQGLKGNSYRLLFGDLKENFIELKEAKARP  70

Query  286  MTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNN  465
            ++L D++A RV P+   L + YGKN ++W GP P V I +P+ +K +  +   FQK  + 
Sbjct  71   LSLDDDIAIRVNPFLHKLVNDYGKNSFMWFGPTPRVNIMNPDQIKAIFTRINDFQKVNSI  130

Query  466  PLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSC  600
            PL R L+ GL + E E+WAKHR+L+NPAF+ EKLKLM PAF LSC
Sbjct  131  PLARLLIVGLATLEGEKWAKHRKLINPAFHQEKLKLMLPAFYLSC  175



>ref|XP_008386157.1| PREDICTED: cytochrome P450 CYP72A219-like [Malus domestica]
Length=519

 Score =   185 bits (470),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 114/166 (69%), Gaps = 0/166 (0%)
 Frame = +1

Query  106  VCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKP  285
            V ++V ++A AWR+L W+W +PK LE+ L+Q GL GN YR  +GDMKE+  M   A SKP
Sbjct  13   VGITVIIIAGAWRLLNWLWLRPKKLERYLRQQGLTGNSYRFYTGDMKEISTMIKQAYSKP  72

Query  286  MTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNN  465
            ++LS ++APRVIP+   L + YGKN +VWMGP P V I DPE +K +L K + F KP  N
Sbjct  73   VSLSHDIAPRVIPFDYQLVNTYGKNYFVWMGPTPRVNITDPEDMKTILTKMDDFPKPXAN  132

Query  466  PLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            PL + L  G+   E E+WAKHRR++NP F+ EKLK M P F  SCS
Sbjct  133  PLXKLLXTGIALCEGEKWAKHRRIINPVFHIEKLKRMLPEFYQSCS  178



>ref|XP_004135800.1| PREDICTED: secologanin synthase-like [Cucumis sativus]
Length=521

 Score =   185 bits (470),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 109/156 (70%), Gaps = 0/156 (0%)
 Frame = +1

Query  136  AWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAPR  315
             WR L W+W  PK LEKCL++ G  GN YR+ SGD+K+LV M+ +A SKPM  S ++APR
Sbjct  24   GWRFLNWIWLTPKKLEKCLREQGFAGNSYRLYSGDLKDLVAMSEEAKSKPMNFSHDIAPR  83

Query  316  VIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVRGL  495
            VIP   H  +KYGKN +VW+GP+P VFI DPE +K  L+ Y  FQKP  NPL + L  GL
Sbjct  84   VIPSIHHTIEKYGKNSFVWLGPIPRVFIMDPEQLKAALSLYNDFQKPTINPLVKLLFDGL  143

Query  496  VSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            +++E E+W KHR+++N AF+ EKLK M P    SC+
Sbjct  144  INHEGEKWVKHRKIVNHAFHFEKLKDMVPTMFESCN  179



>ref|XP_009790251.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
 gb|ABC69391.1| CYP72A53v2 [Nicotiana tabacum]
Length=518

 Score =   185 bits (470),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 92/180 (51%), Positives = 119/180 (66%), Gaps = 5/180 (3%)
 Frame = +1

Query  79   MEVIYTLLGVCVS----VGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMK  246
            ME+ Y  L + +S    + +L +AW++L +VW KPK LEK L+Q G KGN Y+ L GDMK
Sbjct  1    MEIPYYSLKIAISSFAIIFVLRWAWKILNYVWLKPKELEKYLRQQGFKGNSYKFLFGDMK  60

Query  247  ELVKMASDAISKPMTLS-DNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKE  423
            E+ KM  +A+SKP+  S D + PRV+P+       YGKNC VW GP P V I DPELVKE
Sbjct  61   EMKKMGEEAMSKPINFSHDMIWPRVMPFIHKTITNYGKNCIVWFGPRPAVLITDPELVKE  120

Query  424  VLNKYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            VL K  ++QKP  NPL +    G+  YE ++WA HRRLLNPAF+ +KLK M PAF  + S
Sbjct  121  VLTKNFVYQKPLGNPLTKLAATGIAGYETDKWATHRRLLNPAFHLDKLKHMLPAFQFTAS  180



>ref|XP_003617766.1| Cytochrome P450 monooxygenase CYP72A59 [Medicago truncatula]
 gb|AET00725.1| cytochrome P450 family 72 protein [Medicago truncatula]
Length=516

 Score =   185 bits (470),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 124/175 (71%), Gaps = 2/175 (1%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVK  258
            ME   +++ + V+VGL+ +AWR+L W+W +PK LEK L++ GL+GNPYRIL GD+K+L+K
Sbjct  1    MEWYSSIIPIIVTVGLI-WAWRILNWLWLRPKKLEKLLREQGLQGNPYRILYGDIKDLLK  59

Query  259  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  438
            M  +A SK M L+D++ PRVIPY  H    +GKN ++W G  P V + +PE + +VLN  
Sbjct  60   MEKEARSKSMNLTDDIMPRVIPYIQHNVKIHGKNSFMWFGTKPRVILTEPEQIIDVLNNI  119

Query  439  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
              F K  N+ + + LV GL S E E+W+KHRRL+NPAF+SEKLK+M P F  SC+
Sbjct  120  SDFPK-NNHKIFKLLVSGLASLEGEKWSKHRRLINPAFHSEKLKVMTPTFFTSCN  173



>dbj|BAL45206.1| cytochrome P450 monooxygenase [Glycyrrhiza uralensis]
Length=522

 Score =   185 bits (470),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 85/168 (51%), Positives = 120/168 (71%), Gaps = 1/168 (1%)
 Frame = +1

Query  103  GVCVSVGL-LAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAIS  279
            G+ + + L + +AWR+L W+W +PK LE+ L++ GL+GNPYR++ GD+K+L+KM  +A S
Sbjct  12   GITLVIVLAVTWAWRMLNWLWLRPKKLERLLREQGLQGNPYRLIVGDLKDLMKMRKEAKS  71

Query  280  KPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPR  459
            KPM LSD++ PRV PY      K+GKN ++W GP+P V + DPE +K+VLNK   F K  
Sbjct  72   KPMNLSDDILPRVFPYVQQSVTKHGKNSFIWFGPIPRVTLTDPEQIKDVLNKIYDFPKSD  131

Query  460  NNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             + L + L  GLVSYE E+W+KHRR++NPAF  EKLK+M P F  SC+
Sbjct  132  GDRLVKLLATGLVSYEGEKWSKHRRIINPAFNLEKLKIMLPIFFQSCN  179



>gb|KEH38473.1| cytochrome P450 family 72 protein [Medicago truncatula]
Length=416

 Score =   183 bits (464),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/175 (47%), Positives = 114/175 (65%), Gaps = 5/175 (3%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVK  258
            M  I +++   +       AWR+L W+W KPK LEK L++ GLKGN YR+L GDM +L+K
Sbjct  1    MATITSIILFTLLTLFFILAWRILNWLWLKPKKLEKFLREQGLKGNSYRLLVGDMNDLLK  60

Query  259  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  438
            M  +A SKPM LSD++ PRV  +      K+GKN ++W GP P V I DP+++++V NK 
Sbjct  61   MRKEATSKPMNLSDDIVPRVFSFVQQSVAKHGKNSFIWFGPTPRVNITDPDMIRDVFNKM  120

Query  439  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
              FQKP  NPLG+ L  GL S+E EQW+KHR+++NPAF+     +M P +L  C 
Sbjct  121  YDFQKPNANPLGKLLANGLASHEGEQWSKHRKIINPAFH-----IMLPIYLKRCD  170



>gb|KHN44057.1| Secologanin synthase [Glycine soja]
Length=520

 Score =   185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 111/156 (71%), Gaps = 0/156 (0%)
 Frame = +1

Query  136  AWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAPR  315
            AW+VL W+W +PK LEK L++ GL+GNPY +  GD KE +KM  +A+SKPM LSD++ PR
Sbjct  20   AWKVLIWLWLRPKRLEKLLREQGLQGNPYTLFVGDSKEFLKMRKEALSKPMNLSDDIIPR  79

Query  316  VIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVRGL  495
            V  Y  H  +K+GKN ++W+GP+P V I DPE +K+V NK   F KP  NPL + L  GL
Sbjct  80   VSSYEQHSVNKHGKNSFIWLGPIPRVTILDPEQIKDVFNKIYDFPKPNMNPLVKLLATGL  139

Query  496  VSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
              YE E+W+KHRR++NPAF  EKLK+M P F  SC+
Sbjct  140  AGYEGEKWSKHRRIINPAFNLEKLKIMLPLFFKSCN  175



>ref|XP_007022096.1| Cytochrome P450, family 72, subfamily A, polypeptide 15, putative 
[Theobroma cacao]
 gb|EOY13621.1| Cytochrome P450, family 72, subfamily A, polypeptide 15, putative 
[Theobroma cacao]
Length=482

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 116/171 (68%), Gaps = 3/171 (2%)
 Frame = +1

Query  97   LLGVCVS---VGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMAS  267
            ++G+ +S   VG+L + WR++ WVW KPK LE+CL+Q GL GN YR LSGD+KE   M+ 
Sbjct  6    VIGISLSFLVVGILIWGWRIVDWVWVKPKRLERCLRQQGLTGNSYRFLSGDIKESFAMSR  65

Query  268  DAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELF  447
             A S+PM L D++   V P+       YGKN + W+GP+P V I +PE ++E+  K+  F
Sbjct  66   QARSQPMPLGDDITQYVGPFLHQTVKNYGKNSFSWVGPIPRVTIMEPEDIREIFTKFNDF  125

Query  448  QKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSC  600
            QKP  NPL   LV GLV+ + E+WAKHR+++NPAF+ +KLK M PAF  SC
Sbjct  126  QKPHTNPLVSLLVSGLVNLDGEEWAKHRKIINPAFHQDKLKNMLPAFYQSC  176



>ref|XP_003546751.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Glycine 
max]
Length=520

 Score =   185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 111/156 (71%), Gaps = 0/156 (0%)
 Frame = +1

Query  136  AWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAPR  315
            AW+VL W+W +PK LEK L++ GL+GNPY +  GD KE +KM  +A+SKPM LSD++ PR
Sbjct  20   AWKVLIWLWLRPKRLEKLLREQGLQGNPYTLFVGDSKEFLKMRKEALSKPMNLSDDIIPR  79

Query  316  VIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVRGL  495
            V  Y  H  +K+GKN ++W+GP+P V I DPE +K+V NK   F KP  NPL + L  GL
Sbjct  80   VSSYEQHSVNKHGKNSFIWLGPIPRVTILDPEQIKDVFNKIYDFPKPNMNPLVKLLATGL  139

Query  496  VSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
              YE E+W+KHRR++NPAF  EKLK+M P F  SC+
Sbjct  140  AGYEGEKWSKHRRIINPAFNLEKLKIMLPLFFKSCN  175



>ref|XP_009607556.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=516

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 79/167 (47%), Positives = 119/167 (71%), Gaps = 0/167 (0%)
 Frame = +1

Query  100  LGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAIS  279
            +   + +  L + W+ L WVW +PK +EK LK  G KG+ Y++L GDMKE+  M  +A +
Sbjct  10   VSFVIMIIFLRWVWKFLNWVWIQPKKMEKRLKMEGFKGSSYKLLLGDMKEINTMVEEAKT  69

Query  280  KPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPR  459
            KPM  +++   RV+P++  L  +YGKNC++W+GP P +FI DPEL++E+L+K  ++QK +
Sbjct  70   KPMNFTNDYVARVLPHFTKLMLQYGKNCFMWLGPKPTMFITDPELIREILSKSYIYQKIQ  129

Query  460  NNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSC  600
             NP+ + L +GL SYE E+WAKHRR++NPAF+ +KLK M P+F LSC
Sbjct  130  GNPITKLLAQGLASYETEKWAKHRRIINPAFHLDKLKHMLPSFYLSC  176



>ref|XP_006348901.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Solanum 
tuberosum]
Length=519

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 121/176 (69%), Gaps = 3/176 (2%)
 Frame = +1

Query  85   VIYTLLGVC--VSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVK  258
            V + ++  C  +++ LL   WRVL W+WF+PK LEK LK+ G+KGN Y IL GD KEL  
Sbjct  4    VQFIVISSCSAIAITLLLCLWRVLNWIWFRPKKLEKLLKEQGVKGNSYSILYGDTKELSL  63

Query  259  MASDAISKPMTL-SDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNK  435
               +  SK M+L  D++A R +P++     KYGK  ++W+GP P+VFI DP+L+KEV  K
Sbjct  64   RIKEVTSKSMSLYDDDIAQRSMPFFLDTIKKYGKKSFIWLGPKPLVFIMDPDLIKEVFTK  123

Query  436  YELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
              ++QK + NPL + L +GLV  E ++WAKHR+++NPAF+ EKLK M PAF LSC+
Sbjct  124  TYIYQKTKTNPLTKLLAQGLVREEGDKWAKHRKIINPAFHLEKLKHMLPAFCLSCT  179



>ref|XP_004171842.1| PREDICTED: LOW QUALITY PROTEIN: secologanin synthase-like [Cucumis 
sativus]
Length=587

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 109/156 (70%), Gaps = 0/156 (0%)
 Frame = +1

Query  136  AWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAPR  315
             WR L W+W  PK LEKCL++ G  GN YR+ SGD+K+LV M+ +A SKPM  S ++APR
Sbjct  90   GWRFLNWIWLTPKKLEKCLREQGFAGNSYRLYSGDLKDLVAMSEEAKSKPMNFSHDIAPR  149

Query  316  VIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVRGL  495
            VIP   H  +KYGKN +VW+GP+P VFI DPE +K  L+ Y  FQKP  NPL + L  GL
Sbjct  150  VIPSIHHTIEKYGKNSFVWLGPIPRVFIMDPEQLKAALSLYNDFQKPTINPLVKLLFDGL  209

Query  496  VSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            +++E E+W KHR+++N AF+ EKLK M P    SC+
Sbjct  210  INHEGEKWVKHRKIVNHAFHFEKLKDMVPTMFESCN  245



>gb|ABC69390.1| CYP72A53v1 [Nicotiana tabacum]
Length=518

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/180 (51%), Positives = 118/180 (66%), Gaps = 5/180 (3%)
 Frame = +1

Query  79   MEVIYTLLGVCVS----VGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMK  246
            ME+ Y  L + +S    + +L +AW++L +VW KPK LEK L+Q G KGN Y+ L GDMK
Sbjct  1    MEIPYYSLKIAISSFAIIFVLRWAWKILNYVWLKPKELEKYLRQQGFKGNSYKFLFGDMK  60

Query  247  ELVKMASDAISKPMTLS-DNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKE  423
            E  KM  +A+SKP+  S D + PRV+P+       YGKNC VW GP P V I DPELVKE
Sbjct  61   ETKKMGEEAMSKPINFSHDMIWPRVMPFIHKTITNYGKNCIVWFGPRPAVLITDPELVKE  120

Query  424  VLNKYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            VL K  ++QKP  NPL +    G+  YE ++WA HRRLLNPAF+ +KLK M PAF  + S
Sbjct  121  VLTKNFVYQKPLGNPLTKLAATGIAGYETDKWATHRRLLNPAFHLDKLKHMLPAFQFTAS  180



>ref|XP_010327256.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=399

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/180 (49%), Positives = 125/180 (69%), Gaps = 5/180 (3%)
 Frame = +1

Query  79   MEVIYTLLGVCV----SVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMK  246
            ME+ Y  L + +     + +L + WR+L  VWFKPK LEK L+Q GLKGN Y++L GDMK
Sbjct  20   MEISYYNLKIAIFSFAIIFVLRWTWRILNHVWFKPKKLEKQLRQQGLKGNSYKLLYGDMK  79

Query  247  ELVKMASDAISKPMTLS-DNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKE  423
            E+ KM  +A SKP+ LS D + PR+ P+       YGKNC+VW+GP P V I +P+L++E
Sbjct  80   EMKKMIEEATSKPINLSHDLIWPRINPFIHKTITNYGKNCFVWIGPKPAVLITEPKLIRE  139

Query  424  VLNKYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            VL K  ++QK R +PL + ++ GL ++EK++WA HRR+LNPAF+ +KLK M PAF L+ +
Sbjct  140  VLTKNYVYQKARGSPLSKLVISGLAAHEKDKWATHRRILNPAFHLDKLKHMLPAFKLTIN  199



>ref|XP_004243263.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=519

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 116/166 (70%), Gaps = 1/166 (1%)
 Frame = +1

Query  109  CVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPM  288
             +++ LL   W VL W+WF+PK LEK LK+ G+KGN Y IL GD KEL     +  SK M
Sbjct  14   VIAITLLLCIWSVLNWIWFRPKKLEKLLKEQGVKGNSYSILYGDTKELSMRIKEVTSKSM  73

Query  289  TL-SDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNN  465
            ++  D++APR +P++     KYGK  ++W+GP P+VFI DP+L+KEV  K  ++QK + N
Sbjct  74   SVYDDDIAPRSLPFFLDTIKKYGKKSFIWLGPKPLVFIMDPDLIKEVFTKTYIYQKTKTN  133

Query  466  PLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            PL + L +GLV  E ++WAKHR+++NPAF+ EKLK M PAF LSC+
Sbjct  134  PLTKLLAQGLVREEGDKWAKHRKIINPAFHLEKLKHMLPAFYLSCT  179



>emb|CAN67740.1| hypothetical protein VITISV_015554 [Vitis vinifera]
Length=518

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/162 (51%), Positives = 117/162 (72%), Gaps = 0/162 (0%)
 Frame = +1

Query  118  VGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLS  297
            + +L +AWRVL W+W +PK LE+CLKQ GL GN YR+L GD KE+  M  +A S+P++ S
Sbjct  16   ITILIYAWRVLNWMWLRPKRLERCLKQQGLAGNSYRLLYGDFKEMSMMIKEATSRPISFS  75

Query  298  DNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGR  477
            D++  RV P++ H   KYGK+ ++WMG  P V I +PEL+++VL+ + +F+KPR + LG+
Sbjct  76   DDILQRVAPFHYHSIKKYGKSSFIWMGLKPRVNIMEPELIRDVLSMHTVFRKPRVHALGK  135

Query  478  KLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            +   GL   E E+WAKHR+++NPAF  EKLK M PAF LSCS
Sbjct  136  QPASGLFFLEGEKWAKHRKIINPAFRLEKLKNMLPAFHLSCS  177



>ref|XP_009411225.1| PREDICTED: cytochrome P450 72A15-like [Musa acuminata subsp. 
malaccensis]
Length=191

 Score =   175 bits (444),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 109/153 (71%), Gaps = 1/153 (1%)
 Frame = +1

Query  124  LLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDN  303
            LL +A R L W W+ P+ LE+ L+  GL G PYR   GD+KE V++A +A+S PM L+ N
Sbjct  34   LLVWALRTLNWAWWTPRRLERALRAQGLNGTPYRFPKGDLKENVRLAEEALSTPMPLTHN  93

Query  304  VAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVL-NKYELFQKPRNNPLGRK  480
            + P V+P+     D+YGK C+ W GP+P V I DPELV+EVL NK+  F KP+ N LGR 
Sbjct  94   IVPHVLPFLHRAIDEYGKICFTWFGPVPRVTIMDPELVREVLSNKFGHFGKPKGNLLGRF  153

Query  481  LVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQ  579
            LVRGLVSYE E+W KHRR++NPAF+ EKLK+ +
Sbjct  154  LVRGLVSYEGEKWVKHRRIMNPAFHVEKLKVTR  186



>ref|XP_008367417.1| PREDICTED: cytochrome P450 CYP72A219-like [Malus domestica]
Length=238

 Score =   177 bits (448),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 109/158 (69%), Gaps = 0/158 (0%)
 Frame = +1

Query  130  AFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVA  309
             +AW+V+ W+W +PK LE+ L+Q G+ GN Y  +SGDMKE+      A SKPM+LS ++A
Sbjct  18   TWAWKVVNWLWLRPKKLERYLRQQGIAGNSYXFMSGDMKEISMTTEQAYSKPMSLSHDIA  77

Query  310  PRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVR  489
            PRVIP++  L + YGKN +VWMG +P V I +PE +K +L K   F +P  NPL + L  
Sbjct  78   PRVIPFHHRLVNTYGKNSFVWMGTIPRVIITNPEDLKYILTKMGEFPQPEPNPLVKLLAT  137

Query  490  GLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            G+  YE E+WAKHRR++NP F+ EKLK M PAF  SCS
Sbjct  138  GIALYEGEKWAKHRRIINPVFHLEKLKRMLPAFYESCS  175



>ref|XP_007149353.1| hypothetical protein PHAVU_005G063300g [Phaseolus vulgaris]
 gb|ESW21347.1| hypothetical protein PHAVU_005G063300g [Phaseolus vulgaris]
Length=520

 Score =   184 bits (466),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 109/157 (69%), Gaps = 0/157 (0%)
 Frame = +1

Query  133  FAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAP  312
            +AW++L W+WF PK LEK L++ G +GNPY++L GD KE +KM  +A+SKPM LSD++ P
Sbjct  19   WAWKILNWLWFNPKRLEKLLREQGFQGNPYKLLVGDSKEFLKMRKEALSKPMDLSDDIVP  78

Query  313  RVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVRG  492
            RV  Y  H    +GKN ++W+GP P V I DPE +K++ NK   F KP  NPL + L  G
Sbjct  79   RVSSYINHSVKSHGKNSFIWLGPTPRVTILDPEQIKDIFNKIYDFPKPDINPLFKLLATG  138

Query  493  LVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            L  YE E+W+KHRRL+NPAF  EKLK M P F  SC+
Sbjct  139  LAGYEGEKWSKHRRLINPAFNLEKLKAMLPLFFESCN  175



>ref|XP_006377672.1| hypothetical protein POPTR_0011s101202g, partial [Populus trichocarpa]
 gb|ERP55469.1| hypothetical protein POPTR_0011s101202g, partial [Populus trichocarpa]
Length=396

 Score =   181 bits (459),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 120/173 (69%), Gaps = 1/173 (1%)
 Frame = +1

Query  85   VIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMA  264
             + ++L   V V +L +AWRVL WVWF+PK +E+CL+Q G  G PYR+L GD KE   M 
Sbjct  4    TVTSILVSIVYVAVLRWAWRVLNWVWFRPKKVERCLRQQGFAGKPYRLLFGDWKENSDML  63

Query  265  SDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYEL  444
             +A +KP+ LSD + PRV+P+   L   YGKN ++W+GP P V I +P+ +++V  K   
Sbjct  64   KEARTKPIGLSDALLPRVMPFLHQLVKDYGKNSFMWIGPKPRVNIMNPDQIRDVFMKINE  123

Query  445  FQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            +QKP ++PL + L  GL S+E E+WAKHR+++NPAF+ EKLKLM PAF  SCS
Sbjct  124  YQKP-SHPLLKPLACGLASHEGEKWAKHRKIINPAFHQEKLKLMIPAFYESCS  175



>emb|CDP15972.1| unnamed protein product [Coffea canephora]
Length=400

 Score =   181 bits (459),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 116/175 (66%), Gaps = 1/175 (1%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVK  258
            ME     +  C+ + LL  AWR L  +W +PK LEKCL+  GL GN Y  + GD KE+V 
Sbjct  1    MENFMLAISPCL-IALLVCAWRALNSLWLRPKKLEKCLRAQGLSGNSYTPVYGDFKEMVS  59

Query  259  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  438
            M  +A SKP+ LSD+  PRVIP       KYG N ++W+GP P V I D E ++E++ KY
Sbjct  60   MIEEAYSKPINLSDDHVPRVIPMVTKTIKKYGGNSFIWLGPYPAVIILDSESIREIMVKY  119

Query  439  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             LFQKP  +PLG+ L++GLV+ E + WAKHR+++NPAF+ EKLKLM PAF L  +
Sbjct  120  NLFQKPHFHPLGKYLIQGLVASEGKIWAKHRKIINPAFHLEKLKLMLPAFHLCAT  174



>ref|XP_004244382.2| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=511

 Score =   183 bits (465),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 118/168 (70%), Gaps = 2/168 (1%)
 Frame = +1

Query  106  VCVSVGLLA--FAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAIS  279
            +C S  L+   + WR++ WVW +P+ +EKC ++ GL G+PYR L GD KE+ K+   A  
Sbjct  5    ICFSALLVTMIWMWRMVNWVWIRPRKIEKCFRKQGLNGHPYRTLYGDTKEMAKLTKQAKL  64

Query  280  KPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPR  459
            KPM L+D++  RV+P+Y +  +KYG NC++W+GP P +FI +PEL+++++    +F+KP+
Sbjct  65   KPMKLTDDILTRVLPFYHYTLNKYGNNCFIWIGPEPRIFIMEPELIRDIVMNNNIFKKPK  124

Query  460  NNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
              PL + LV G+ SYE ++WAKHR++LN AFY+EKLK M PA   SC 
Sbjct  125  PTPLVQLLVSGISSYEDQKWAKHRKILNTAFYTEKLKYMVPAMHKSCE  172



>ref|XP_007149352.1| hypothetical protein PHAVU_005G063200g [Phaseolus vulgaris]
 gb|ESW21346.1| hypothetical protein PHAVU_005G063200g [Phaseolus vulgaris]
Length=520

 Score =   183 bits (465),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 109/157 (69%), Gaps = 0/157 (0%)
 Frame = +1

Query  133  FAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAP  312
            +AW++L W+WF PK LEK L++ G +GNPY++L GD KE +KM  +A+SKPM LSD++ P
Sbjct  19   WAWKILNWLWFNPKRLEKLLREQGFQGNPYKLLVGDSKEFLKMRKEALSKPMDLSDDIVP  78

Query  313  RVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVRG  492
            RV  Y  H    +GKN ++W+GP P V I DPE +K++ NK   F KP  NPL + L  G
Sbjct  79   RVSSYINHSVKSHGKNSFIWLGPTPRVTILDPEQIKDIFNKIYDFPKPDINPLLKLLATG  138

Query  493  LVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            L  YE E+W+KHRRL+NPAF  EKLK M P F  SC+
Sbjct  139  LADYEGEKWSKHRRLINPAFNLEKLKAMLPLFFESCN  175



>gb|KDO52111.1| hypothetical protein CISIN_1g046539mg [Citrus sinensis]
Length=484

 Score =   182 bits (463),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 118/161 (73%), Gaps = 1/161 (1%)
 Frame = +1

Query  124  LLAF-AWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSD  300
            +LA+ AW++L W W KPK LE  L+Q G  GN Y+I  GD K++  M  +A ++P++LSD
Sbjct  13   ILAYCAWKILNWAWLKPKKLENFLRQQGFSGNSYKIFHGDTKDMSMMLKEAKARPISLSD  72

Query  301  NVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRK  480
            ++ PR++PY+ H+  KYGK  + WMGP P + ++DP+L++E+L K+++FQKP+ N LG+ 
Sbjct  73   DIVPRILPYHHHIISKYGKKSFKWMGPRPSINVQDPKLIREILLKHDIFQKPKGNSLGKL  132

Query  481  LVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            +V G+V+YE EQW+K R++ NPAF+ +KLK M P   LSC+
Sbjct  133  VVNGMVTYEGEQWSKVRKIANPAFHQDKLKDMLPKMYLSCN  173



>ref|XP_009758460.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
Length=525

 Score =   183 bits (465),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 115/157 (73%), Gaps = 1/157 (1%)
 Frame = +1

Query  136  AWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAPR  315
             W+VL W WF+PK +E CL+Q GLKGNPY++L GD+ EL K   +A SKP+  SD++A R
Sbjct  29   TWKVLNWAWFRPKKMENCLRQRGLKGNPYKLLYGDLNELTKSVIEAKSKPINFSDDIAQR  88

Query  316  VIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRN-NPLGRKLVRG  492
            +IP++ +  +K GKN +VW+GP P+V I DPE +KE+  K  ++QK  + NP  + L  G
Sbjct  89   LIPFFLNAINKNGKNSFVWLGPYPIVLITDPEHLKEIFTKNYVYQKQTHPNPYAKLLAHG  148

Query  493  LVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            L+S E+++WAKHR+++NPAF+ +KLK M P+F LSCS
Sbjct  149  LISLEEDKWAKHRKIINPAFHVQKLKHMLPSFYLSCS  185



>ref|XP_004166892.1| PREDICTED: LOW QUALITY PROTEIN: secologanin synthase-like [Cucumis 
sativus]
Length=516

 Score =   183 bits (465),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 110/156 (71%), Gaps = 0/156 (0%)
 Frame = +1

Query  136  AWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAPR  315
             W++  W+WF+PK LEK L+Q G  GN YRIL GD+KE   M  +A+SKPM  S+++APR
Sbjct  20   GWKLADWIWFRPKKLEKLLRQQGFAGNSYRILHGDLKERAAMREEAMSKPMNFSNHIAPR  79

Query  316  VIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVRGL  495
            VIP   H   +YGKN ++W+GP+P V I DPE +K V + Y  FQKP  NP  + LV+G+
Sbjct  80   VIPSIYHTIQRYGKNSFMWLGPIPRVHIMDPEQLKTVFSFYNDFQKPTMNPFTKLLVQGI  139

Query  496  VSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            V+ + E+W KHR+++NPAF+ EKLK M PAF  SC+
Sbjct  140  VNLDGEKWVKHRKIINPAFHLEKLKDMVPAFYHSCN  175



>ref|XP_009796418.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
Length=517

 Score =   183 bits (464),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 125/177 (71%), Gaps = 3/177 (2%)
 Frame = +1

Query  79   MEVIYTL---LGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKE  249
            ME ++ +   + + + +  L + W+ L WVW +PK +EK LK  G KG+ Y++L GDMKE
Sbjct  1    METLFNIKVAVSLVIVIIFLRWVWKFLNWVWIQPKKMEKRLKMEGFKGSSYKLLFGDMKE  60

Query  250  LVKMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVL  429
            +  M  +A +KPM  +++   RV+P++  L  +YGKN ++W+GP P +FI DPEL++E+L
Sbjct  61   INTMVEEAKTKPMNFTNDYVARVLPHFTKLMLQYGKNSFMWLGPKPTMFITDPELIREIL  120

Query  430  NKYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSC  600
            +K  ++QK + NP+ + L +GLVSYE E+WAKHR+++NPAF+ +KLK M P+F LSC
Sbjct  121  SKSYIYQKIQGNPITKLLAQGLVSYEAEKWAKHRKIINPAFHLDKLKHMLPSFYLSC  177



>emb|CBI22129.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   181 bits (460),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 117/162 (72%), Gaps = 0/162 (0%)
 Frame = +1

Query  118  VGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLS  297
            + +L +AWR+L W+W +PK LE+CLKQ GL GN YR+L GD KE+  M  +A S+P+++S
Sbjct  16   ITILIYAWRILNWMWLRPKRLERCLKQQGLAGNSYRLLHGDFKEMFMMIKEASSRPISIS  75

Query  298  DNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGR  477
            D++  R+ P++ H   KYGK+ ++WMGP P V I +PEL+++VL+ + +F+K R +   +
Sbjct  76   DDIVQRITPFHYHSIKKYGKSSFIWMGPKPRVNIMEPELIRDVLSMHTVFRKSRVHAFVK  135

Query  478  KLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             LV GL   + E+WAKHR+++NPAF  EKLK M PAF LSCS
Sbjct  136  LLVSGLPFLDGEKWAKHRKIINPAFRLEKLKNMLPAFHLSCS  177



>ref|XP_009628921.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=518

 Score =   183 bits (464),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 89/179 (50%), Positives = 118/179 (66%), Gaps = 5/179 (3%)
 Frame = +1

Query  79   MEVIYTLLGVCV----SVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMK  246
            ME+ Y  L + +     + +L +AW++L +VW KPK LEKC++Q G KGN Y+ L GDMK
Sbjct  1    MEIPYYSLKLTIFSFAIIFVLRWAWKILNYVWLKPKELEKCIRQQGFKGNSYKFLFGDMK  60

Query  247  ELVKMASDAISKPMTLS-DNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKE  423
            E+ KM  +A+SKP+  S D + PRV+P+       YGKNC+VW GP P V I DPELVKE
Sbjct  61   EIKKMGEEAMSKPINFSHDMIWPRVMPFIHKTITNYGKNCFVWFGPRPAVLITDPELVKE  120

Query  424  VLNKYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSC  600
            VL K  ++QKP   PL +    G+  YE ++WA HRRLLNPAF+ +KLK M PAF  + 
Sbjct  121  VLTKNFVYQKPPGTPLTKLAATGIAGYETDKWATHRRLLNPAFHLDKLKHMLPAFQFTA  179



>emb|CDX97593.1| BnaA05g24860D [Brassica napus]
Length=512

 Score =   183 bits (464),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 115/169 (68%), Gaps = 3/169 (2%)
 Frame = +1

Query  106  VCVSVGLLA---FAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAI  276
            V VSV ++A   + WR L WVWFKPK LE  L++ GL G PY  L GD++    M+ +A 
Sbjct  8    VTVSVAIVAVLWWVWRTLNWVWFKPKKLESYLRRQGLSGTPYTPLVGDVRRDYTMSMEAR  67

Query  277  SKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKP  456
            SKP+ ++D++ PRV+P+ +H+   YG   + W GP+P + I DPE +KEV NK   FQKP
Sbjct  68   SKPIRITDDIVPRVVPFPSHMLKTYGMTFFTWRGPIPTITITDPEQIKEVFNKIYDFQKP  127

Query  457  RNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             + PLGR +  GL SY+ ++WAKHRR++NPAF+ EK+K M PAF  SCS
Sbjct  128  HSFPLGRLIATGLFSYDGDKWAKHRRIINPAFHLEKIKNMVPAFHQSCS  176



>ref|XP_006477888.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Citrus sinensis]
Length=512

 Score =   183 bits (464),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 118/161 (73%), Gaps = 1/161 (1%)
 Frame = +1

Query  124  LLAF-AWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSD  300
            +LA+ AW++L W W KPK LE  L+Q G  GN Y+I  GD K++  M  +A ++P++LSD
Sbjct  13   ILAYCAWKILNWAWLKPKKLENFLRQQGFSGNSYKIFHGDTKDMSMMLKEAKARPISLSD  72

Query  301  NVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRK  480
            ++ PR++PY+ H+  KYGK  + WMGP P + ++DP+L++E+L K+++FQKP+ N LG+ 
Sbjct  73   DIVPRILPYHHHIISKYGKKSFKWMGPRPSINVQDPKLIREILLKHDIFQKPKGNSLGKL  132

Query  481  LVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            +V G+V+YE EQW+K R++ NPAF+ +KLK M P   LSC+
Sbjct  133  VVNGMVTYEGEQWSKVRKIANPAFHQDKLKDMLPKMYLSCN  173



>gb|ABC69389.1| CYP72A52v1 [Nicotiana tabacum]
Length=518

 Score =   183 bits (464),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 89/179 (50%), Positives = 118/179 (66%), Gaps = 5/179 (3%)
 Frame = +1

Query  79   MEVIYTLLGVCV----SVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMK  246
            ME+ Y  L + +     + +L +AW++L +VW KPK LEKC++Q G KGN Y+ L GDMK
Sbjct  1    MEIPYYSLKLTIFSFAIIFVLRWAWKILNYVWLKPKELEKCIRQQGFKGNSYKFLFGDMK  60

Query  247  ELVKMASDAISKPMTLS-DNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKE  423
            E+ KM  +A+SKP+  S D + PRV+P+       YGKNC+VW GP P V I DPELVKE
Sbjct  61   EIKKMGEEAMSKPINFSHDMIWPRVMPFIHKTITNYGKNCFVWFGPRPAVLITDPELVKE  120

Query  424  VLNKYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSC  600
            VL K  ++QKP   PL +    G+  YE ++WA HRRLLNPAF+ +KLK M PAF  + 
Sbjct  121  VLTKNFVYQKPPGTPLTKLAATGIAGYETDKWATHRRLLNPAFHLDKLKHMLPAFQFTA  179



>ref|XP_006442317.1| hypothetical protein CICLE_v10023602mg [Citrus clementina]
 gb|ESR55557.1| hypothetical protein CICLE_v10023602mg [Citrus clementina]
Length=512

 Score =   183 bits (464),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 118/161 (73%), Gaps = 1/161 (1%)
 Frame = +1

Query  124  LLAF-AWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSD  300
            +LA+ AW++L W W KPK LE  L+Q G  GN Y+I  GD K++  M  +A ++P++LSD
Sbjct  13   ILAYCAWKILNWAWLKPKKLENFLRQQGFSGNSYKIFHGDTKDMSMMLKEAKARPISLSD  72

Query  301  NVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRK  480
            ++ PR++PY+ H+  KYGK  + WMGP P + ++DP+L++E+L K+++FQKP+ N LG+ 
Sbjct  73   DIVPRILPYHHHIISKYGKKSFKWMGPRPSINVQDPKLIREILLKHDIFQKPKGNSLGKL  132

Query  481  LVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            +V G+V+YE EQW+K R++ NPAF+ +KLK M P   LSC+
Sbjct  133  VVNGMVTYEGEQWSKVRKIANPAFHQDKLKDMLPKMYLSCN  173



>emb|CDP15985.1| unnamed protein product [Coffea canephora]
Length=513

 Score =   182 bits (463),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 120/177 (68%), Gaps = 3/177 (2%)
 Frame = +1

Query  79   MEVIYTLLGVCVS---VGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKE  249
            ME  ++ +   VS   V L   AWRVL W WF+PK L+K LKQ G KGNPY+++ GD+K+
Sbjct  1    MEEAHSFMIALVSSCCVVLSVLAWRVLNWAWFQPKKLQKHLKQQGFKGNPYKLIYGDLKQ  60

Query  250  LVKMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVL  429
            +  +  +A SKP++LSD + PR+ P++    +KYGKN Y+W GP PM+ I DPEL+++V 
Sbjct  61   ISSLFQEANSKPISLSDGIVPRIAPHFLEAVNKYGKNTYLWSGPRPMMLIMDPELIRKVT  120

Query  430  NKYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSC  600
             K ++FQK + +P    LV G++ YE E+W K R+LLN AF+ EKLKLM PAF  S 
Sbjct  121  QKMDIFQKVKFHPQASLLVAGILGYEGEKWVKQRKLLNQAFHMEKLKLMVPAFYKSA  177



>gb|KHG14489.1| Secologanin synthase [Gossypium arboreum]
Length=521

 Score =   183 bits (464),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 82/165 (50%), Positives = 112/165 (68%), Gaps = 1/165 (1%)
 Frame = +1

Query  112  VSVGLLAF-AWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPM  288
            ++VG+L    W++L W W  PK LEKCL+Q G  GN YR+L G++KE+  M   A S+PM
Sbjct  15   LAVGVLILCGWKILNWAWLTPKKLEKCLRQQGFNGNSYRLLFGEIKEMFTMTRQARSRPM  74

Query  289  TLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNP  468
            +L+D++AP VIPYY      YGKN   W GP P V I DPEL++E+ NK+  FQKPR NP
Sbjct  75   SLTDDIAPYVIPYYHQTVTNYGKNSIRWFGPSPRVTIMDPELIREIFNKFNEFQKPRINP  134

Query  469  LGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            L   L  G+++ E E+WAKHR+++ P+F+ +KLK M PAF   C+
Sbjct  135  LITLLFSGILTLEGERWAKHRKIITPSFHLDKLKNMLPAFYECCT  179



>ref|XP_009146333.1| PREDICTED: cytochrome P450 72A13-like [Brassica rapa]
Length=512

 Score =   182 bits (463),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 116/169 (69%), Gaps = 3/169 (2%)
 Frame = +1

Query  106  VCVSVGLLA---FAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAI  276
            V VSV ++A   + WR L WVWFKPK LE  L++ GL G+PY  L GD++    M+ +A 
Sbjct  8    VTVSVAIVAVLWWVWRTLNWVWFKPKMLESYLRRQGLSGSPYTPLVGDVRRDYTMSMEAR  67

Query  277  SKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKP  456
            SKP+  +D++ PRV+P+ +H+   YG+  + W GP+P + I DPE +KEV NK   FQKP
Sbjct  68   SKPIKTTDDIIPRVVPFPSHMLKTYGRTFFTWRGPIPTITITDPEQIKEVFNKIYDFQKP  127

Query  457  RNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             + PLGR +  GL SY+ ++WAKHRR++NPAF+ EK+K M PAF  SCS
Sbjct  128  HSFPLGRLIATGLFSYDGDKWAKHRRIINPAFHLEKIKNMVPAFHQSCS  176



>ref|XP_004243257.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=523

 Score =   182 bits (463),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 82/176 (47%), Positives = 127/176 (72%), Gaps = 4/176 (2%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVK  258
            +E+I T   +CV++ L+ + W+VL W WF+PK  EK L++ GL GNPY++L GD+KEL  
Sbjct  9    VEMIAT---ICVAILLVIYTWKVLNWAWFRPKKFEKYLRKSGLNGNPYKLLYGDLKELTN  65

Query  259  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  438
              ++A SKP++ S +V  R+IP++    +K GKN + W+GP P+VFI +P L+K++  K+
Sbjct  66   KLNEAKSKPISFSGDVPQRLIPFFCDSINKNGKNSFAWLGPKPIVFITEPSLIKKIFEKH  125

Query  439  ELFQKPRN-NPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             ++ K ++ NP  + LV+GLV+ E+++WAKHR+++NPAF+ EKLK M PAF  SCS
Sbjct  126  YVYHKNKHSNPFAKLLVQGLVTLEEQKWAKHRKIINPAFHFEKLKHMVPAFYQSCS  181



>gb|EYU38228.1| hypothetical protein MIMGU_mgv1a004669mg [Erythranthe guttata]
Length=516

 Score =   182 bits (463),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 120/175 (69%), Gaps = 1/175 (1%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVK  258
            MEV   LL + V VGL+  + + + WVW KPK LEK L++ GL GNPY++L GDMK+L+ 
Sbjct  1    MEVGSILLSILV-VGLITLSAKFVNWVWIKPKKLEKLLRKEGLNGNPYKLLLGDMKQLIS  59

Query  259  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  438
            +  +   K +  SD++ P ++P+Y H   K+G+N ++W+GP P + I DP+L+KE+L K 
Sbjct  60   VMKEEQPKSIQFSDHLLPHILPHYHHNRTKFGENSFMWVGPSPKLIIADPQLMKEILEKP  119

Query  439  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             +FQKP  +P+G  +  GLV  E E+W KHRR++NPAF+ EKLK M PA  LSCS
Sbjct  120  NVFQKPHPDPIGETIAGGLVVLEDEKWTKHRRIINPAFHMEKLKKMVPAIRLSCS  174



>ref|XP_006495014.1| PREDICTED: secologanin synthase-like [Citrus sinensis]
Length=518

 Score =   182 bits (463),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 113/165 (68%), Gaps = 0/165 (0%)
 Frame = +1

Query  109  CVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPM  288
             V V ++ +A ++L W W KPK LEK L++ G +GN YR L GD+KE   ++  A SKP+
Sbjct  12   IVIVTVVTWACKILNWAWLKPKKLEKQLRRQGFRGNSYRFLFGDVKEHGILSRQAKSKPI  71

Query  289  TLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNP  468
            +L D++APRV+P Y      YGKN Y W+GP+PM+ I DP+ +KEV      FQKP+ NP
Sbjct  72   SLDDDIAPRVVPLYDQREKLYGKNTYWWIGPIPMINIMDPDQIKEVFTNINDFQKPKTNP  131

Query  469  LGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            LG+ L  GL   E E+WAKHR+++NPAF+ EKLKLM PAF  SC+
Sbjct  132  LGKILTTGLAIREGEKWAKHRKIINPAFHQEKLKLMLPAFYQSCT  176



>ref|XP_010327096.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=250

 Score =   176 bits (445),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 121/179 (68%), Gaps = 5/179 (3%)
 Frame = +1

Query  79   MEVIYTLLGVCVS----VGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMK  246
            ME+ Y  L + +     + +L + WR+L +VWFKPK LEK L+Q GLKGN Y++L GDMK
Sbjct  1    MEISYYNLKIAIFSFAIIFVLRWTWRILNYVWFKPKKLEKQLRQQGLKGNSYKLLYGDMK  60

Query  247  ELVKMASDAISKPMTLS-DNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKE  423
            E+  M  +A SKP+  S D + PR+ P+       YGKNC+VW+GP P V I +P+L++E
Sbjct  61   EMKMMIEEATSKPINFSHDLIWPRINPFIHKTITNYGKNCFVWIGPKPAVLITEPKLIRE  120

Query  424  VLNKYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSC  600
            VL K  ++ K R +PL +  + GL ++EK++WA HRR+LNPAF+ +KLK M PAF L+ 
Sbjct  121  VLTKNYVYHKARGSPLLKLAISGLAAHEKDKWATHRRILNPAFHFDKLKHMLPAFKLTV  179



>gb|KJB12905.1| hypothetical protein B456_002G043600 [Gossypium raimondii]
Length=380

 Score =   179 bits (455),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 107/158 (68%), Gaps = 0/158 (0%)
 Frame = +1

Query  127  LAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNV  306
            + + WR L WVW  PK LE+CL+Q G  GNPYR LSGD+KEL  M+    +KPM LSD++
Sbjct  20   MIWGWRALNWVWLAPKRLERCLRQQGFAGNPYRFLSGDIKELSTMSRQTRAKPMPLSDDI  79

Query  307  APRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLV  486
             P V P+     ++YGKN + W+GP   V I DPE ++E+  K+  FQK R NPL   LV
Sbjct  80   GPYVAPFLHQTVNQYGKNSFTWIGPRQRVNIMDPEKIREIFTKFNDFQKVRTNPLLTLLV  139

Query  487  RGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSC  600
             GLV+ E ++W+KHR+++NP+F+ +KLK M PAF  SC
Sbjct  140  SGLVNLEGDRWSKHRKIINPSFHQDKLKNMLPAFYQSC  177



>ref|XP_008226217.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Prunus 
mume]
Length=522

 Score =   182 bits (463),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 124/183 (68%), Gaps = 10/183 (5%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVGL------LAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGD  240
            ME+  +++ VCV++ +      +A+AWRVL WVW +P  LE+CL++ GL GN YR+L GD
Sbjct  1    MEI--SIIQVCVALSVVLVSIVIAWAWRVLNWVWLRPNKLERCLREQGLTGNSYRLLFGD  58

Query  241  MKELVKMASDAISKPMTLS--DNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPEL  414
             KE+  M   A SKP+ LS   ++APRVIP+   +   YG+N +VWMGP P V I +PE 
Sbjct  59   TKEISMMVEQAQSKPIKLSTTHDIAPRVIPFSHQIVYTYGRNSFVWMGPTPRVTIMNPED  118

Query  415  VKEVLNKYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLL  594
            +K+  NK + FQ+  +NP+ + + +GL S E E+WAKHR+++NPAF+ EKLK M P F  
Sbjct  119  LKDAFNKSDEFQRAISNPIVKSISQGLSSLEGEKWAKHRKIINPAFHLEKLKGMLPTFYQ  178

Query  595  SCS  603
            SCS
Sbjct  179  SCS  181



>ref|XP_010092742.1| Secologanin synthase [Morus notabilis]
 gb|EXB52087.1| Secologanin synthase [Morus notabilis]
Length=518

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 120/177 (68%), Gaps = 2/177 (1%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVGLL--AFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKEL  252
            MEV +  L   V   LL   +AWRVL WVW +PK LE CL++ GLKGN YR+ SGD+KE 
Sbjct  1    MEVSFLKLSSVVFAILLITTWAWRVLNWVWLRPKRLENCLRKQGLKGNSYRLWSGDLKES  60

Query  253  VKMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLN  432
              M  +A SKP+ LS+++  R+ P+  H  + YGK+ ++W+GP P V I +PE +K++ N
Sbjct  61   SLMIKEASSKPINLSEDITARIFPFGLHTVNNYGKDSFMWIGPTPRVSITNPEYIKDIFN  120

Query  433  KYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            K   F KP++ PL + L  G+ +YE E+W +HR+++NPAF+ EKLK + PAF LSCS
Sbjct  121  KLGDFPKPQSIPLVKLLATGVATYEGEKWTRHRKIINPAFHMEKLKRLVPAFYLSCS  177



>ref|XP_008450754.1| PREDICTED: cytochrome P450 CYP72A219-like [Cucumis melo]
Length=517

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 112/175 (64%), Gaps = 0/175 (0%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVK  258
            M+   +++     V LL   WR L W+W  PK LEKCL++ G  GNPYR+ SGD+ ++V 
Sbjct  1    MDFRNSMIWFVFMVCLLRCGWRFLNWIWLTPKKLEKCLREQGFAGNPYRLYSGDLNDVVA  60

Query  259  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  438
            M  +A SKPM  S ++ PRVIP   H   KYGKN ++W+GP P V I DPE +K  L+ Y
Sbjct  61   MEEEAKSKPMNFSHDIVPRVIPSMHHTIKKYGKNSFMWLGPNPRVLIMDPEQLKAALSLY  120

Query  439  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
              FQKP  NPL R L  GL+++E E+W KHR+++N AF+ EKLK M P    SC+
Sbjct  121  NDFQKPTTNPLVRLLFDGLINHEGEKWVKHRKIINHAFHFEKLKDMVPTMFESCN  175



>ref|XP_008366858.1| PREDICTED: cytochrome P450 CYP72A219-like [Malus domestica]
Length=516

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 120/176 (68%), Gaps = 1/176 (1%)
 Frame = +1

Query  79   MEVIYTLLGVC-VSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELV  255
            MEV  + +GV  V + + A+AWRV+ W+W +PK LE+ L+Q GL GN YR L GD+KE  
Sbjct  1    MEVSVSNIGVVLVGIIVTAWAWRVVNWLWLRPKKLERYLRQQGLAGNSYRFLVGDLKERT  60

Query  256  KMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNK  435
             M   A SKPM LS ++APRV+P+  H  + YGKN ++W GP+P V I +PE +K++L K
Sbjct  61   MMLKQAYSKPMNLSHDIAPRVLPFEYHSVNTYGKNSFIWAGPVPRVNIANPEDLKDILTK  120

Query  436  YELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             E F K ++NP  + LV G   YE E+W +HRR++NPAF+ +KLK M PAF LS S
Sbjct  121  IEDFPKLKSNPYVKLLVTGTAHYEGEKWRRHRRIINPAFHLDKLKGMLPAFYLSSS  176



>ref|XP_006348982.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Solanum tuberosum]
Length=860

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 122/167 (73%), Gaps = 1/167 (1%)
 Frame = +1

Query  106  VCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKP  285
             CV++ L+ + W+VL W WF+PK LEK L++ GLKGNPY++L GD+KEL    ++A SKP
Sbjct  32   TCVAILLVIYTWKVLNWAWFRPKKLEKYLRKSGLKGNPYKLLYGDLKELTNKLNEAKSKP  91

Query  286  MTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRN-  462
            +  SD+V  R+IP++    +K GKN + W+GP P+VFI +P L+K +  K+ ++ K ++ 
Sbjct  92   INFSDDVPQRIIPFFCDSINKNGKNSFAWLGPKPIVFITEPSLIKIIFEKHYVYNKNKHS  151

Query  463  NPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            NP  + LVRGLV+ E+++WAK+R+++NPAF+ EKLK M PAF  SCS
Sbjct  152  NPFAKLLVRGLVTLEEQKWAKYRKIINPAFHFEKLKHMVPAFYQSCS  198


 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 66/91 (73%), Gaps = 3/91 (3%)
 Frame = +1

Query  340  ADKY--GKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRN-NPLGRKLVRGLVSYEK  510
             DKY  GKN + W+GP P+VFI +P L+K +  K+ ++ K ++ NP  + LVRGLV+ E+
Sbjct  430  TDKYSAGKNSFAWLGPKPIVFITEPSLIKIIFEKHYVYNKNKHSNPFAKLLVRGLVTLEE  489

Query  511  EQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            ++WAK+R+++NPAF+ EKLK M  AF  SCS
Sbjct  490  QKWAKYRKIINPAFHFEKLKHMVLAFYQSCS  520



>ref|XP_004243260.1| PREDICTED: cytochrome P450 CYP72A219 [Solanum lycopersicum]
Length=517

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 126/178 (71%), Gaps = 4/178 (2%)
 Frame = +1

Query  79   MEVIY-TLLGV-CVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKEL  252
            ME++Y T++ + CV++ LL + WRVL W WF+PK LE  L+Q GLKGNPY++L GD+ EL
Sbjct  1    MEILYNTIIAIICVAI-LLVYTWRVLNWAWFRPKKLENFLRQRGLKGNPYKLLYGDLNEL  59

Query  253  VKMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLN  432
             K   +A SK + +SD++  R+IP++    +K GK+ ++W+GP P V I +PE VKE+L 
Sbjct  60   TKSIVEAKSKSINISDDITQRLIPFFLDSINKNGKSSFMWLGPYPTVLITNPEHVKEILT  119

Query  433  K-YELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            K Y   ++   NP  + L +GLV  E+++WAKHR+++NPAF+ EKLK M PAF +SCS
Sbjct  120  KNYVYLKQTHPNPFAKLLAQGLVLVEEDKWAKHRKIINPAFHVEKLKHMLPAFYMSCS  177



>ref|XP_008226302.1| PREDICTED: cytochrome P450 CYP72A219-like [Prunus mume]
Length=518

 Score =   182 bits (461),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 121/176 (69%), Gaps = 1/176 (1%)
 Frame = +1

Query  79   MEV-IYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELV  255
            ME+ + +++   + VGL+   W+V+ WVW KPK LE+ L+Q GL GN YR+L GD+ +  
Sbjct  1    MEISVSSMVVAILCVGLITLGWKVVNWVWLKPKKLERYLRQQGLSGNSYRLLIGDLTDNS  60

Query  256  KMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNK  435
            KM  +A+SKPM  S ++ P V+P      +KYGK  ++W+GP+P V I D EL++E L K
Sbjct  61   KMTKEALSKPMEFSHDIVPYVLPLLQETFNKYGKKSFIWLGPVPSVVIFDAELMRETLTK  120

Query  436  YELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            + +F+KP +NPL   LV GL+SYE ++W KH+R++NPAF+ +K+K M PAF  +C 
Sbjct  121  HRVFEKPHSNPLLSFLVTGLLSYEGDKWVKHKRIINPAFHIDKMKDMLPAFHAACE  176



>gb|ABC69417.1| CYP72A54 [Nicotiana tabacum]
Length=517

 Score =   182 bits (461),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 125/177 (71%), Gaps = 3/177 (2%)
 Frame = +1

Query  79   MEVIYTL---LGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKE  249
            ME ++ +   + + + +  L + W+ L WVW +PK +EK LK  G KG+ Y++L GDMKE
Sbjct  1    METLFNIKVAVSLVIVIIFLRWVWKFLNWVWIQPKKMEKRLKMEGFKGSSYKLLFGDMKE  60

Query  250  LVKMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVL  429
            +  M  +A +KPM  +++   RV+P++  L  +YGKN ++W+GP P +FI DPEL++E+L
Sbjct  61   INTMVEEAKTKPMNFTNDYVARVLPHFTKLMLQYGKNSFMWLGPKPTMFITDPELIREIL  120

Query  430  NKYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSC  600
            +K  ++Q+ + NP+ + L +GLVSYE E+WAKHR+++NPAF+ +KLK M P+F LSC
Sbjct  121  SKSYIYQEIQGNPITKLLAQGLVSYEAEKWAKHRKIINPAFHLDKLKHMLPSFYLSC  177



>ref|XP_011009102.1| PREDICTED: cytochrome P450 72A15-like isoform X1 [Populus euphratica]
 ref|XP_011009103.1| PREDICTED: cytochrome P450 72A15-like isoform X2 [Populus euphratica]
Length=542

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 123/179 (69%), Gaps = 2/179 (1%)
 Frame = +1

Query  70   RI*MEVIYT-LLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMK  246
            R+ M V  T +L   V V +L +AWRVL WVWF+PK +E+CL+Q G  G PYR+L GD K
Sbjct  22   RVKMTVTVTSILVSIVYVAVLRWAWRVLNWVWFRPKKVERCLRQQGFAGKPYRLLFGDWK  81

Query  247  ELVKMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEV  426
            E   M  +A +KP+ LSD + PRV+P+   L   YGKN ++W+GP P V I +P+ +++V
Sbjct  82   ENSDMLKEARTKPLGLSDALLPRVVPFLHQLVKDYGKNSFMWVGPKPRVNIMNPDQIRDV  141

Query  427  LNKYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
              K   +QKP ++PL + L  GL S+E E+WAKHR+++NPAF+ EKLKLM PAF  SCS
Sbjct  142  FMKINEYQKP-SHPLLKPLACGLASHEGEKWAKHRKIINPAFHQEKLKLMIPAFCESCS  199



>gb|AJD25170.1| cytochrome P450 CYP72A329 [Salvia miltiorrhiza]
Length=512

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 116/175 (66%), Gaps = 0/175 (0%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVK  258
            M+V  + + +  +   L + W++L WVWF PK LEK L+Q G  GN Y++  GD KE+  
Sbjct  1    MDVFISTVEISCAAVALIYLWKLLNWVWFTPKKLEKILRQQGFNGNSYKLFYGDFKEIRS  60

Query  259  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  438
            +A +A+SKPM  S+++APR IP Y     +YG+  + W GP P + I +PE+++E+ +K 
Sbjct  61   IAKEAVSKPMNFSNDIAPRAIPIYHQTCKRYGEKSFTWFGPKPAINITEPEMIREITSKN  120

Query  439  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             +F KP  NP G+ L +G+  YE ++WAKHR+L+NPAF+ +KLK M PAF +S +
Sbjct  121  YVFLKPTGNPFGKMLAKGVALYETDKWAKHRKLINPAFHVQKLKHMVPAFHVSTA  175



>gb|KJB12900.1| hypothetical protein B456_002G043400 [Gossypium raimondii]
Length=391

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 105/154 (68%), Gaps = 0/154 (0%)
 Frame = +1

Query  142  RVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAPRVI  321
            R L WVW  PK LE CL+Q G  GNPYR LSGD+KEL  M+    +KPM LSD++ P V+
Sbjct  25   RTLNWVWLAPKRLESCLRQQGFAGNPYRFLSGDIKELSTMSRQTRAKPMPLSDDIGPYVV  84

Query  322  PYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVRGLVS  501
            P+    A++YGKN + W GP P V I DPE ++E+LNK+  FQK   NPL   LV GL +
Sbjct  85   PFQHQTANQYGKNSFTWFGPRPRVNITDPEKIREILNKFNDFQKIHTNPLLNLLVSGLAN  144

Query  502  YEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             + ++W+K R+++NPAF+ +KLK M PAF  SCS
Sbjct  145  LDGDRWSKRRKIINPAFHQDKLKNMLPAFYQSCS  178



>gb|EYU31635.1| hypothetical protein MIMGU_mgv1a025572mg [Erythranthe guttata]
Length=515

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/175 (46%), Positives = 119/175 (68%), Gaps = 1/175 (1%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVK  258
            ME++ + L +C +V +L + W+++  VWF+P+ +EK L+Q G  G  YR L GD+ E+  
Sbjct  1    MELLQSFLALCCTVVVLIYGWKIMNLVWFRPRKMEKILRQQGFGGKSYRFLIGDLNEMKN  60

Query  259  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  438
            M  +A+SKP+  SD+  PR I +       +G+N +VW+GP   V I DPE V+EVL+K 
Sbjct  61   MGEEALSKPIDFSDDFVPRTISFIHKTVTNHGENSFVWLGPYAAVIISDPENVREVLSKS  120

Query  439  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             +FQKP  NPLG+ + +GL SYE ++WAKHRRL+NPAF+ +K+K M P+F  SC+
Sbjct  121  YVFQKPY-NPLGKLVAQGLASYETDKWAKHRRLINPAFHLDKVKHMLPSFHKSCA  174



>ref|XP_007022098.1| Cytochrome P450, family 72, subfamily A, polypeptide 15 isoform 
2 [Theobroma cacao]
 gb|EOY13623.1| Cytochrome P450, family 72, subfamily A, polypeptide 15 isoform 
2 [Theobroma cacao]
Length=518

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/171 (49%), Positives = 117/171 (68%), Gaps = 3/171 (2%)
 Frame = +1

Query  97   LLGVCVS---VGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMAS  267
            ++G+ +S   VG+L + WR+L WVW +PK LE+CL++ GL GN YR LSGD+KE   M+ 
Sbjct  6    VIGISLSFLVVGILVWGWRILDWVWMRPKRLERCLRKQGLTGNSYRFLSGDIKESFAMSR  65

Query  268  DAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELF  447
             A SKPM LSD++   V P+        GK+ + W+GP+P V I +PE ++E+  K+  F
Sbjct  66   QARSKPMPLSDDITQYVGPFLHQTVKNSGKSSFSWVGPIPRVTIMEPEEIREIFTKFNDF  125

Query  448  QKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSC  600
            QKP +NPL   LV GLV+ + E+WAKHR+++NPAF+ +KLK M PAF  SC
Sbjct  126  QKPHSNPLVSLLVSGLVNLDGEEWAKHRKIINPAFHQDKLKNMLPAFYQSC  176



>ref|XP_006348910.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 117/168 (70%), Gaps = 2/168 (1%)
 Frame = +1

Query  103  GVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISK  282
             +CV+V LL + WRVL W W KPK LEK L++ GLKGNPY++  GD+KE     ++A SK
Sbjct  11   AICVAV-LLVYTWRVLNWAWLKPKKLEKYLRKSGLKGNPYKLYHGDLKEFTNKLNEAKSK  69

Query  283  PMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRN  462
            P+  SD++A R+IP++    +K GK+ +VW+GP P+V I DPE VKE+  K  ++QK  +
Sbjct  70   PINFSDDIAQRLIPFFCDSINKNGKSSFVWLGPYPVVLITDPEHVKEIFTKNYVYQKETH  129

Query  463  -NPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             NP  + L  GL   E+++WAKHR+++NPAF +EKLK M PAF  SCS
Sbjct  130  PNPFSKLLAIGLAKLEEDKWAKHRKIINPAFQTEKLKHMLPAFYQSCS  177



>ref|XP_007022097.1| Cytochrome P450, family 72, subfamily A, polypeptide 15 isoform 
1 [Theobroma cacao]
 gb|EOY13622.1| Cytochrome P450, family 72, subfamily A, polypeptide 15 isoform 
1 [Theobroma cacao]
Length=518

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/171 (49%), Positives = 117/171 (68%), Gaps = 3/171 (2%)
 Frame = +1

Query  97   LLGVCVS---VGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMAS  267
            ++G+ +S   VG+L + WR+L WVW +PK LE+CL++ GL GN YR LSGD+KE   M+ 
Sbjct  6    VIGISLSFLVVGILVWGWRILDWVWMRPKRLERCLRKQGLTGNSYRFLSGDIKESFAMSR  65

Query  268  DAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELF  447
             A SKPM LSD++   V P+        GK+ + W+GP+P V I +PE ++E+  K+  F
Sbjct  66   QARSKPMPLSDDITQYVGPFLHQTVKNSGKSSFSWVGPIPRVTIMEPEEIREIFTKFNDF  125

Query  448  QKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSC  600
            QKP +NPL   LV GLV+ + E+WAKHR+++NPAF+ +KLK M PAF  SC
Sbjct  126  QKPHSNPLVSLLVSGLVNLDGEEWAKHRKIINPAFHQDKLKNMLPAFYQSC  176



>ref|XP_008226215.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X3 [Prunus 
mume]
Length=518

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/162 (51%), Positives = 113/162 (70%), Gaps = 2/162 (1%)
 Frame = +1

Query  124  LLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSD-  300
            ++A+AWRVL WVW +PK LEKCL++ GL GN YR+L GD K+L KM     SKP+ LS  
Sbjct  16   VIAWAWRVLNWVWLRPKKLEKCLREQGLAGNSYRLLFGDTKDLSKMLEQTQSKPIKLSTS  75

Query  301  -NVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGR  477
             ++AP V P++    + YGKN +VWMGP+P V I +PE +K+  N+++ F K   NP+ +
Sbjct  76   HDIAPHVTPFFHQTVNSYGKNSFVWMGPIPRVHIMNPEDLKDTFNRHDDFHKVVKNPIMK  135

Query  478  KLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             L +G+V  E EQWAKHR+++NPAF+ EKLK M P F  SCS
Sbjct  136  SLPQGIVGIEGEQWAKHRKIINPAFHLEKLKGMVPIFYRSCS  177



>sp|H2DH21.1|C7A29_PANGI RecName: Full=Cytochrome P450 CYP72A219; AltName: Full=Cytochrome 
P450 CYP72A129 [Panax ginseng]
 gb|AEY75218.1| cytochrome P450 CYP72A129 [Panax ginseng]
Length=518

 Score =   181 bits (459),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/176 (47%), Positives = 118/176 (67%), Gaps = 1/176 (1%)
 Frame = +1

Query  79   MEVIYTLLG-VCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELV  255
            ME++  L+   C  V ++   WR+  WVW +P+ LEK L+  G  GN YR+  GD+KE++
Sbjct  1    MELVLKLISSFCAIVVVILLGWRIFNWVWLRPRKLEKYLRNQGFNGNSYRLFFGDVKEMI  60

Query  256  KMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNK  435
             M  +A SKP+ L D++ PR+IP    +   YGKN ++W+GP PMV I +P+ +K+VL+K
Sbjct  61   VMLKEAKSKPINLYDDIIPRIIPLNQKIITNYGKNSFLWLGPKPMVHIMNPDHIKDVLSK  120

Query  436  YELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            +  FQKPR+NPL + L  G+   E ++WAKHR+L+NPAF+ EKLK M PA  LS S
Sbjct  121  FYQFQKPRHNPLTKLLATGVADAEGDRWAKHRKLINPAFHLEKLKNMLPAIYLSSS  176



>ref|XP_006477887.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Citrus sinensis]
Length=512

 Score =   181 bits (459),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 119/166 (72%), Gaps = 1/166 (1%)
 Frame = +1

Query  109  CVSVGLLAF-AWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKP  285
             ++  +LA+ AW++L W W KPK LE  L+Q G  GN Y+I  GDMK++  M  +A ++P
Sbjct  8    ALATIILAYCAWKILNWAWLKPKKLENFLRQQGFSGNSYKIFHGDMKDMSLMLKEAKARP  67

Query  286  MTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNN  465
            +++SD++ PR++PY+ H+  KYGK  + WMGP P + ++DP+L++E+L K+++FQKPR N
Sbjct  68   ISVSDDIVPRILPYHHHIISKYGKKSFKWMGPRPSINVQDPKLIREILLKHDIFQKPRGN  127

Query  466  PLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             L + +V G+V YE EQW+K R++ NPAF+ +KLK M P   LSC+
Sbjct  128  SLSKLVVNGMVMYEGEQWSKVRKIANPAFHQDKLKDMLPKMYLSCN  173



>ref|XP_006407055.1| hypothetical protein EUTSA_v10020534mg [Eutrema salsugineum]
 dbj|BAJ33634.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ48508.1| hypothetical protein EUTSA_v10020534mg [Eutrema salsugineum]
Length=512

 Score =   181 bits (459),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/176 (47%), Positives = 117/176 (66%), Gaps = 1/176 (1%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVGLLAF-AWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELV  255
            ME+    + V V++ ++++  WR L WVWFKPK LE  L++ GL G PY  L+GD K   
Sbjct  1    MEISAASVTVSVAIAVVSWWVWRTLNWVWFKPKTLESYLRRQGLVGTPYTPLAGDSKRTF  60

Query  256  KMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNK  435
             M+ +A SKP+ L+D++ PRV+P+  H+   YG+  + W G +P++ I DPE +KEV NK
Sbjct  61   NMSMEARSKPINLTDDIIPRVLPFSLHMLKTYGRTFFTWRGHIPVITIMDPEQIKEVFNK  120

Query  436  YELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
               FQKP   PLGR +  GL SY+ ++WA HRR++NPAF+ EK+K M PAF  +CS
Sbjct  121  IYDFQKPHTFPLGRLIATGLFSYDGDKWANHRRIINPAFHLEKIKNMVPAFHQTCS  176



>emb|CDP15976.1| unnamed protein product [Coffea canephora]
Length=525

 Score =   181 bits (459),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 117/178 (66%), Gaps = 3/178 (2%)
 Frame = +1

Query  79   MEVIYTLLGV---CVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKE  249
            ME+ Y+ + V   C+ + +   AWR   W W  PK LEK LK+ GL+GNPY++L GD KE
Sbjct  1    MEIAYSPIAVFSSCILLLISVLAWRAFKWAWLTPKKLEKRLKEQGLRGNPYKLLYGDFKE  60

Query  250  LVKMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVL  429
            +     +A SKP+ +S++  PRVIP++     KYG+N Y+W GP PMV I +PE ++E+ 
Sbjct  61   IATHFKEAHSKPINVSEDFIPRVIPHFCAAVKKYGENTYIWHGPKPMVLILNPEHIREIT  120

Query  430  NKYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             K  +FQK   NPL + L  GLVSY+ ++WAKHR+L+ PAF+ EKLK M P+F  S S
Sbjct  121  TKLYIFQKAPANPLTKLLATGLVSYDGDKWAKHRKLITPAFHVEKLKHMVPSFYASAS  178



>ref|XP_006364094.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score =   181 bits (459),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/180 (49%), Positives = 123/180 (68%), Gaps = 5/180 (3%)
 Frame = +1

Query  79   MEVIYTLLGVCV----SVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMK  246
            ME+ Y  L + +     + +L +AWR+L +VWFKPK LEK L+Q G KGN Y++L GDMK
Sbjct  1    MEISYYNLKIAIFSFAIILVLGWAWRILNYVWFKPKKLEKQLRQQGFKGNSYKLLYGDMK  60

Query  247  ELVKMASDAISKPMTLS-DNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKE  423
            E+ KM  +A SKP+  S D + PR+ P+       YGKNC+VW GP P V I +P+L+KE
Sbjct  61   EMKKMIEEATSKPIDFSHDLIWPRINPFIHKTITNYGKNCFVWFGPKPAVLITEPKLIKE  120

Query  424  VLNKYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            VL K  ++QK R +PL +  + GL ++EK++WA HRR+LNPAF+ +KLK M PAF L+ +
Sbjct  121  VLTKNYVYQKARGSPLLKLAISGLAAHEKDKWATHRRILNPAFHIDKLKHMLPAFKLTVN  180



>emb|CDY32348.1| BnaC01g36670D [Brassica napus]
Length=512

 Score =   181 bits (458),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 115/170 (68%), Gaps = 3/170 (2%)
 Frame = +1

Query  103  GVCVSVGLLA---FAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDA  273
             V VSV + A   + WR L WVWFKPK LE  L++ GL G PY +L GD+K    M ++A
Sbjct  7    SVTVSVAIAAVLWWIWRTLNWVWFKPKMLESYLRRQGLVGTPYTLLVGDVKREYSMTTEA  66

Query  274  ISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQK  453
             SKP+ L+D++ PRV+P+ +H+   YG+  + W GP+P + I +PE +KEVLNK   FQK
Sbjct  67   RSKPIKLTDDIVPRVLPFPSHMLKTYGRTFFTWRGPIPTITITNPEQIKEVLNKIYDFQK  126

Query  454  PRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            P   PL R +  GL SY+ ++WAKHRR++NPAF+ +K+K M PAF  SCS
Sbjct  127  PNTFPLSRLVASGLFSYDGDKWAKHRRIINPAFHLDKIKNMVPAFHQSCS  176



>ref|XP_009394213.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394214.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394215.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=522

 Score =   180 bits (457),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 120/175 (69%), Gaps = 1/175 (1%)
 Frame = +1

Query  82   EVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKM  261
            +V+++L      +  LA+A RVL W W++P+ LE+ L+  GL G PYR   GD+KE++++
Sbjct  8    DVLWSLGRGVAGLLFLAWALRVLNWAWWRPRRLERALRAQGLNGTPYRFPYGDVKEILRL  67

Query  262  ASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVL-NKY  438
              +A +KPM L+ N+ PR++P++    D+YGK  + W GP+P V I DPELV+EVL NK+
Sbjct  68   RKEARAKPMPLAHNIIPRLLPFFHRAMDEYGKISFTWFGPVPQVTITDPELVREVLSNKF  127

Query  439  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             +F KP  NPL R   +GL  YE E+W KHRR++NPAF++EKLK M PAF   CS
Sbjct  128  GIFGKPTQNPLSRFFSKGLFVYEGEKWVKHRRIMNPAFHAEKLKRMLPAFSACCS  182



>gb|KJB26994.1| hypothetical protein B456_004G270700 [Gossypium raimondii]
Length=521

 Score =   180 bits (457),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 82/173 (47%), Positives = 113/173 (65%), Gaps = 0/173 (0%)
 Frame = +1

Query  85   VIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMA  264
            +I  LL +     L+   W++L W W  PK LEKCL+Q G  GN YR+L G++KE+  M 
Sbjct  7    IIKPLLSLLAVGVLILCGWKILNWAWLTPKKLEKCLRQQGFNGNSYRLLFGEIKEMFTMT  66

Query  265  SDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYEL  444
              A SKPM+L+D++AP VIP+Y      YGKN   W GP P V I DPEL++E+ NK+  
Sbjct  67   RQARSKPMSLTDDIAPYVIPHYIRTVKNYGKNSIRWFGPSPRVTIMDPELIREIFNKFNE  126

Query  445  FQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            FQKPR NPL   L  G+++ E ++WAKHR+++ P+F+ +KLK M PAF   C+
Sbjct  127  FQKPRINPLITLLFSGILTLEGDRWAKHRKIITPSFHLDKLKNMLPAFYECCT  179



>ref|XP_008226216.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Prunus 
mume]
Length=521

 Score =   180 bits (457),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 85/168 (51%), Positives = 117/168 (70%), Gaps = 3/168 (2%)
 Frame = +1

Query  106  VCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKP  285
            V VS+ ++A+AWRVL WVW +P  LE+CL++ GL GN YR+L GD KE+  M   A SKP
Sbjct  14   VLVSI-VIAWAWRVLNWVWLRPNKLERCLREQGLTGNSYRLLFGDTKEISMMVEQAQSKP  72

Query  286  MTLSD--NVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPR  459
            + LS   ++APRVIP+   +   YG+N +VWMGP P V I +PE +K+  NK + FQ+  
Sbjct  73   IKLSTTHDIAPRVIPFSHQIVYTYGRNSFVWMGPTPRVTIMNPEDLKDAFNKSDEFQRAI  132

Query  460  NNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            +NP+ + + +GL S E E+WAKHR+++NPAF+ EKLK M P F  SCS
Sbjct  133  SNPIVKSISQGLSSLEGEKWAKHRKIINPAFHLEKLKGMLPTFYQSCS  180



>ref|XP_009594691.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Nicotiana 
tomentosiformis]
Length=419

 Score =   178 bits (452),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 79/171 (46%), Positives = 117/171 (68%), Gaps = 0/171 (0%)
 Frame = +1

Query  88   IYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMAS  267
            I   +   + + LL + WR + W+W +PK LEKCLK+LG +GN Y++L GDMKE+V M  
Sbjct  5    ISLAISFVIIIILLRWGWRFMNWLWLQPKCLEKCLKELGFRGNSYKLLYGDMKEVVMMDE  64

Query  268  DAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELF  447
            +A SKP+  S ++ PR++P+       YGKN ++W+ P P + I DPEL++E+L+K  +F
Sbjct  65   EAKSKPIKFSHDIVPRIMPFIHKTIIDYGKNSFIWLWPTPAMLITDPELIREILSKSNIF  124

Query  448  QKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSC  600
            QKP      + LV G++SYE ++WAKHRR++NPAF+ +KLK M P+F LS 
Sbjct  125  QKPPPTAHTKLLVEGILSYEADKWAKHRRIINPAFHLDKLKHMIPSFHLST  175



>ref|XP_009394212.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=527

 Score =   180 bits (457),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 120/175 (69%), Gaps = 1/175 (1%)
 Frame = +1

Query  82   EVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKM  261
            +V+++L      +  LA+A RVL W W++P+ LE+ L+  GL G PYR   GD+KE++++
Sbjct  8    DVLWSLGRGVAGLLFLAWALRVLNWAWWRPRRLERALRAQGLNGTPYRFPYGDVKEILRL  67

Query  262  ASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVL-NKY  438
              +A +KPM L+ N+ PR++P++    D+YGK  + W GP+P V I DPELV+EVL NK+
Sbjct  68   RKEARAKPMPLAHNIIPRLLPFFHRAMDEYGKISFTWFGPVPQVTITDPELVREVLSNKF  127

Query  439  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             +F KP  NPL R   +GL  YE E+W KHRR++NPAF++EKLK M PAF   CS
Sbjct  128  GIFGKPTQNPLSRFFSKGLFVYEGEKWVKHRRIMNPAFHAEKLKRMLPAFSACCS  182



>gb|AFO64616.1| cytochrome P450 mono-oxygenase [Artemisia annua]
Length=515

 Score =   180 bits (457),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 121/176 (69%), Gaps = 1/176 (1%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVK  258
            ME   +   + V+   +   +R+  W+WFKPK +EK L++ GL G  Y+ + GD+KELV+
Sbjct  1    MESPTSFFALGVASIFIYLIYRIANWLWFKPKKIEKFLRKQGLNGTSYKFMFGDLKELVQ  60

Query  259  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  438
            M+++A SKPM+L+ ++A RV+P+Y +    +GK C+ W+G  P+V + +P +++EVLN Y
Sbjct  61   MSNEAKSKPMSLNHDIANRVLPFYYNALSTHGKTCFTWLGIKPVVHLSEPTMIREVLNNY  120

Query  439  ELFQKPR-NNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
              +QKPR  NPL + L RG+   E +QW KHR+++NPAF+ EKLK M PAF +SCS
Sbjct  121  NQYQKPRAGNPLTKLLARGVADAEADQWVKHRKIINPAFHVEKLKHMVPAFYVSCS  176



>ref|XP_004294188.2| PREDICTED: cytochrome P450 72A15-like [Fragaria vesca subsp. 
vesca]
Length=540

 Score =   180 bits (457),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 114/168 (68%), Gaps = 4/168 (2%)
 Frame = +1

Query  106  VCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKP  285
            V VS+ ++ +AW VL W+W KPK LE+CL++ GL+GN YRI  GDMKE   M + A SKP
Sbjct  33   VFVSI-IVRWAWSVLDWLWLKPKKLERCLREQGLQGNSYRIFHGDMKENSVMLTQAKSKP  91

Query  286  MTLSD--NVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPR  459
            M LS   ++A R IP+       YG N +VWMGP P V I DPE VK+V  K E F++P 
Sbjct  92   MILSSSHDIASRFIPFLNQTVKTYGTNSFVWMGPTPRVNIMDPEDVKDVFTKLEDFRRP-  150

Query  460  NNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            +NPL + L+ GL SYE E+WAKHRR++NP F+ EKLK M PAF  SC 
Sbjct  151  SNPLMKLLITGLASYEDEKWAKHRRIINPTFHVEKLKRMLPAFHQSCD  198



>ref|XP_002882888.1| CYP72A15 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59147.1| CYP72A15 [Arabidopsis lyrata subsp. lyrata]
Length=512

 Score =   180 bits (456),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 117/176 (66%), Gaps = 1/176 (1%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVGLLAF-AWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELV  255
            ME+    + + V++ ++++  WR L WVWFKPK LE  L++ GL G PY  L GD+K   
Sbjct  1    MEISVASVTISVAIAVVSWWIWRTLQWVWFKPKMLESYLRRQGLVGTPYTPLVGDLKRNF  60

Query  256  KMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNK  435
             M ++A SKP+ L+D++ PR++PY   +   YG+  Y W+GP+P + I DPE +KEV NK
Sbjct  61   SMLAEARSKPINLTDDITPRIVPYPLQMFKTYGRTFYTWLGPIPTITIMDPEQIKEVFNK  120

Query  436  YELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
               FQK    PL R +  GLVSY+ ++WAKHRR++NPAF+ EK+K M PAF  SCS
Sbjct  121  VYDFQKSHTFPLARLIAAGLVSYDGDKWAKHRRIINPAFHLEKIKNMVPAFHRSCS  176



>ref|XP_008226213.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Prunus 
mume]
Length=521

 Score =   180 bits (456),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 85/168 (51%), Positives = 116/168 (69%), Gaps = 3/168 (2%)
 Frame = +1

Query  106  VCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKP  285
            V VS+ ++ +AWRVL WVW +PK LEKCL++ GL GN YR+L GD K+L KM     SKP
Sbjct  14   VWVSI-VITWAWRVLNWVWLRPKKLEKCLREQGLAGNSYRLLFGDTKDLSKMLEQTQSKP  72

Query  286  MTLSD--NVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPR  459
            + LS   ++AP V P++    + YGKN +VWMGP+P V I +PE +K+  N+++ F K  
Sbjct  73   IKLSTSHDIAPHVTPFFHQTVNSYGKNSFVWMGPIPRVHIMNPEDLKDTFNRHDDFHKVV  132

Query  460  NNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             NP+ + L +G+V  E EQWAKHR+++NPAF+ EKLK M P F  SCS
Sbjct  133  KNPIMKSLPQGIVGIEGEQWAKHRKIINPAFHLEKLKGMVPIFYRSCS  180



>gb|KHN36820.1| Secologanin synthase [Glycine soja]
Length=496

 Score =   179 bits (455),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 110/153 (72%), Gaps = 0/153 (0%)
 Frame = +1

Query  145  VLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAPRVIP  324
            +L W+W +PK LE+ L++ GL+GNPYRIL GD+KE+VK+  +A SKPM LS ++ PRV  
Sbjct  1    MLNWLWIRPKRLERLLREQGLQGNPYRILVGDLKEIVKLQMEARSKPMNLSHDIVPRVFA  60

Query  325  YYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVRGLVSY  504
            +      K+GKN ++W GP P V + DPEL+K+VLNK   F+KP  NPL + L  GLV+Y
Sbjct  61   HLHQSVLKHGKNSFIWFGPKPRVTLTDPELIKDVLNKISDFRKPEANPLAKLLATGLVNY  120

Query  505  EKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            + E+W KHRRL+NPAF  EKLK+M P F  SC+
Sbjct  121  DGEKWNKHRRLINPAFSLEKLKIMLPIFFKSCN  153



>ref|XP_009411224.1| PREDICTED: cytochrome P450 72A15-like [Musa acuminata subsp. 
malaccensis]
Length=378

 Score =   177 bits (448),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 110/161 (68%), Gaps = 1/161 (1%)
 Frame = +1

Query  124  LLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDN  303
            LL +A R L   W+ P+ LE+ L+  GL G PYR   GD+KE V++  +A+S PM L+ N
Sbjct  24   LLVWALRTLNRAWWTPRRLERALRAQGLNGTPYRFPKGDLKENVRLDKEALSTPMPLTHN  83

Query  304  VAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVL-NKYELFQKPRNNPLGRK  480
            + PRV+P+     D+YGK C+ W GP+P V I DPELV+EVL NK+  F KP+   LGR 
Sbjct  84   IVPRVLPFLRRAIDEYGKICFTWFGPVPRVTIMDPELVREVLSNKFGHFGKPKGILLGRF  143

Query  481  LVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            L RGLVSYE E+W KHRR++NPAF+ EKLK M PAF   CS
Sbjct  144  LFRGLVSYEGEKWVKHRRIMNPAFHVEKLKRMLPAFCACCS  184



>ref|XP_009343590.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=516

 Score =   179 bits (455),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 120/176 (68%), Gaps = 1/176 (1%)
 Frame = +1

Query  79   MEVIYTLLGVC-VSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELV  255
            MEV  + +GV  V + + A+AWRV+ W+W +PK LE+ L+Q GL GN YR L GD+KE  
Sbjct  1    MEVSVSNIGVVLVGIIVTAWAWRVVNWLWLRPKKLERYLRQQGLAGNSYRFLVGDLKERT  60

Query  256  KMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNK  435
             M   A SKPM LS ++APRV+P+  H  + YGKN ++W GP+P V I +PE +K++L K
Sbjct  61   MMLKQAYSKPMNLSHDIAPRVLPFEYHSVNTYGKNSFIWAGPVPRVNIANPEDLKDILTK  120

Query  436  YELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             E F K ++NP  + LV G   Y+ E+W +HRR++NPAF+ +KLK M PAF LS +
Sbjct  121  IEDFPKLKSNPYVKLLVTGTAHYQGEKWRRHRRIINPAFHLDKLKGMLPAFYLSSN  176



>gb|KGN55013.1| hypothetical protein Csa_4G622230 [Cucumis sativus]
Length=190

 Score =   171 bits (433),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 104/146 (71%), Gaps = 0/146 (0%)
 Frame = +1

Query  136  AWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAPR  315
             W++  W+WF+PK LEK L+Q G  GN YRIL GD+KE   M  +A+SKPM  S+++APR
Sbjct  20   GWKLADWIWFRPKKLEKLLRQQGFAGNSYRILHGDLKERAAMREEAMSKPMNFSNHIAPR  79

Query  316  VIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVRGL  495
            VIP   H   +YGKN ++W+GP+P V I DPE +K V + Y  FQKP  NP  + LV+G+
Sbjct  80   VIPSIYHTIQRYGKNSFMWLGPIPRVHIMDPEQLKTVFSFYNDFQKPTMNPFTKLLVQGI  139

Query  496  VSYEKEQWAKHRRLLNPAFYSEKLKL  573
            V+ + E+W KHR+++NPAF+ EKLK+
Sbjct  140  VNLDGEKWVKHRKIINPAFHLEKLKI  165



>ref|XP_011469476.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=363

 Score =   176 bits (446),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 113/170 (66%), Gaps = 4/170 (2%)
 Frame = +1

Query  106  VCVSVGLLAFA----WRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDA  273
            + +S+ LL+ A    WRVL WVW KPK LEKCL+Q GL GN YR+L GD+KE  ++  +A
Sbjct  32   IALSIVLLSIASSCAWRVLNWVWLKPKKLEKCLRQQGLAGNSYRVLIGDVKESFRVMKEA  91

Query  274  ISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQK  453
             SKPM LSD+ APRV+P+      K+GKN + W G  P V I +P+ + E+L KY+ F++
Sbjct  92   CSKPMNLSDDAAPRVLPFLHQTITKHGKNSFTWFGTTPRVTIMNPDYLNEILTKYDDFRR  151

Query  454  PRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            P   P+ + L  GL + E E+W K R+++NPAF+ EKLK M PA   SC+
Sbjct  152  PHTAPVVKLLSYGLANLEGEKWVKQRKIINPAFHIEKLKNMLPAIYQSCT  201



>ref|XP_006348908.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 122/178 (69%), Gaps = 4/178 (2%)
 Frame = +1

Query  79   MEVIYT--LLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKEL  252
            ME+ Y   +  +CV++ LL + W+VL W WFKPK LEK L++ GLKGNPY++L GD KEL
Sbjct  1    MEISYNRIIAAICVAI-LLVYTWKVLNWAWFKPKKLEKYLRKNGLKGNPYKLLYGDSKEL  59

Query  253  VKMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLN  432
                ++A SKP+  +D++A R+IP++    +K GKN +VW+GP P+V I DPE VK +  
Sbjct  60   TNKLNEARSKPINFNDDIAQRLIPFFLDSINKNGKNSFVWLGPYPIVLITDPEHVKVIFT  119

Query  433  KYELFQKPRN-NPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            K   +QK  + NP  + L  GL   E+++WAKHR+++NPAF+ EKLK M PAF  SCS
Sbjct  120  KNYGYQKQAHPNPFAKLLAIGLALLEEDKWAKHRKIINPAFHVEKLKHMLPAFYQSCS  177



>gb|KJB12904.1| hypothetical protein B456_002G043600 [Gossypium raimondii]
Length=518

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 107/158 (68%), Gaps = 0/158 (0%)
 Frame = +1

Query  127  LAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNV  306
            + + WR L WVW  PK LE+CL+Q G  GNPYR LSGD+KEL  M+    +KPM LSD++
Sbjct  20   MIWGWRALNWVWLAPKRLERCLRQQGFAGNPYRFLSGDIKELSTMSRQTRAKPMPLSDDI  79

Query  307  APRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLV  486
             P V P+     ++YGKN + W+GP   V I DPE ++E+  K+  FQK R NPL   LV
Sbjct  80   GPYVAPFLHQTVNQYGKNSFTWIGPRQRVNIMDPEKIREIFTKFNDFQKVRTNPLLTLLV  139

Query  487  RGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSC  600
             GLV+ E ++W+KHR+++NP+F+ +KLK M PAF  SC
Sbjct  140  SGLVNLEGDRWSKHRKIINPSFHQDKLKNMLPAFYQSC  177



>ref|XP_010694547.1| PREDICTED: cytochrome P450 72A15-like [Beta vulgaris subsp. vulgaris]
Length=521

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 120/174 (69%), Gaps = 5/174 (3%)
 Frame = +1

Query  97   LLGVCVSVGL-----LAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKM  261
            ++G+ +++G+     L + W++L WVWF+PK LEK L++ GLKGN Y+ L GDMKE  +M
Sbjct  1    MIGLFIAIGIALCVILTWVWKILNWVWFRPKKLEKQLRKQGLKGNSYKWLVGDMKETFRM  60

Query  262  ASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYE  441
             ++A  KP+  +++   RV+P+     +KYG+NC+ W GP+P + I +PEL++E   +  
Sbjct  61   RAEARGKPIPFTNDYYSRVLPFLDQHVNKYGENCWTWFGPVPAINIAEPELIREAFTRMN  120

Query  442  LFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             FQK R NPL   LV GLV YE E+WAKHR+L+NPAF+ EKLKLM PAF  S +
Sbjct  121  EFQKTRLNPLIGLLVPGLVGYEGEKWAKHRKLVNPAFHMEKLKLMIPAFGASVT  174



>ref|XP_006442316.1| hypothetical protein CICLE_v10024206mg [Citrus clementina]
 gb|ESR55556.1| hypothetical protein CICLE_v10024206mg [Citrus clementina]
Length=512

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 118/166 (71%), Gaps = 1/166 (1%)
 Frame = +1

Query  109  CVSVGLLAF-AWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKP  285
             ++  +LA+ AW++L W W KPK LE  L+Q G  GN Y+I  GDMK++  M  +  ++P
Sbjct  8    ALATIILAYCAWKILNWAWLKPKKLENFLRQQGFSGNSYKIFHGDMKDMSLMLKETKARP  67

Query  286  MTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNN  465
            ++LSD++ PR++PY+ H+  KYGK  + WMGP P + ++DP+L++E+L K+++FQKP+ N
Sbjct  68   ISLSDDIVPRILPYHHHIISKYGKKSFKWMGPRPSINVQDPKLIREILLKHDIFQKPKGN  127

Query  466  PLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             L + +V G+V YE EQW+K R++ NPAF+ +KLK M P   LSC+
Sbjct  128  SLSKLVVNGMVMYEGEQWSKVRKIANPAFHQDKLKDMLPKMYLSCN  173



>gb|KEH36886.1| cytochrome P450 family monooxygenase [Medicago truncatula]
Length=383

 Score =   176 bits (447),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 118/174 (68%), Gaps = 2/174 (1%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVK  258
            + + Y ++ + V++GL+ + WRVL W+W KPK LEK L++ G  GN YR++ GD+K+  K
Sbjct  5    LAIYYGIILITVTLGLV-YTWRVLNWIWLKPKRLEKLLREQGCNGNSYRLVLGDLKDSYK  63

Query  259  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  438
            M   A SKPM LSD++ PRVIPY   L   YGKN ++W G  P + + +PEL+K+VLN+ 
Sbjct  64   MGKKAKSKPMELSDDIIPRVIPYIQQLVQIYGKNPFIWSGTTPRLILTEPELIKDVLNRT  123

Query  439  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSC  600
               QKP+   + + L  GL+ +E E+W KHRRL+N AF  EKLK+M P+FL SC
Sbjct  124  SELQKPKYE-IFKFLFSGLIIHEGEKWRKHRRLMNAAFQLEKLKIMAPSFLTSC  176



>ref|XP_009394211.1| PREDICTED: cytochrome P450 CYP72A219-like [Musa acuminata subsp. 
malaccensis]
Length=196

 Score =   171 bits (433),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/173 (47%), Positives = 116/173 (67%), Gaps = 1/173 (1%)
 Frame = +1

Query  82   EVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKM  261
            +V+++L      +  LA+A RVL W W++P+ LE+ L+  GL G PY    GD+KE V++
Sbjct  8    DVLWSLGRGVAGLLFLAWALRVLNWAWWRPRRLERALRAQGLNGTPYGFPYGDVKETVRL  67

Query  262  ASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVL-NKY  438
              +A +KPM L+ N+ PR++P++    D+YGK  + W GP+P V I+DPELV+EVL NK+
Sbjct  68   REEARAKPMPLAHNIIPRLLPFFHRAMDEYGKISFTWFGPVPQVNIKDPELVREVLSNKF  127

Query  439  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLS  597
              F KP  NPL R   RGL  YE E+W KHRR+LNPAF++EKLK++   F  +
Sbjct  128  GHFGKPNQNPLARFFARGLALYEGEKWVKHRRILNPAFHAEKLKVIDSLFCTT  180



>ref|XP_011469477.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X3 [Fragaria 
vesca subsp. vesca]
Length=362

 Score =   176 bits (446),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 113/170 (66%), Gaps = 4/170 (2%)
 Frame = +1

Query  106  VCVSVGLLAFA----WRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDA  273
            + +S+ LL+ A    WRVL WVW KPK LEKCL+Q GL GN YR+L GD+KE  ++  +A
Sbjct  32   IALSIVLLSIASSCAWRVLNWVWLKPKKLEKCLRQQGLAGNSYRVLIGDVKESFRVMKEA  91

Query  274  ISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQK  453
             SKPM LSD+ APRV+P+      K+GKN + W G  P V I +P+ + E+L KY+ F++
Sbjct  92   CSKPMNLSDDAAPRVLPFLHQTITKHGKNSFTWFGTTPRVTIMNPDYLNEILTKYDDFRR  151

Query  454  PRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            P   P+ + L  GL + E E+W K R+++NPAF+ EKLK M PA   SC+
Sbjct  152  PHTAPVVKLLSYGLANLEGEKWVKQRKIINPAFHIEKLKNMLPAIYQSCT  201



>ref|XP_006477946.1| PREDICTED: secologanin synthase-like [Citrus sinensis]
Length=522

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 113/165 (68%), Gaps = 0/165 (0%)
 Frame = +1

Query  106  VCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKP  285
              V V +L +AWRVL WVW +PK LEK L+Q GLKGN YR+L GD+KE      +A ++P
Sbjct  11   TIVIVTVLTWAWRVLNWVWLRPKKLEKFLRQQGLKGNSYRLLFGDLKENSIELKEAKARP  70

Query  286  MTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNN  465
            ++L D++A RV P+   L + YGKN ++W GP P V I +P+ +K +  K   FQK  + 
Sbjct  71   LSLDDDIAIRVNPFLHKLVNDYGKNSFMWFGPTPRVNIMNPDQIKAIFTKINDFQKVNSI  130

Query  466  PLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSC  600
            PL R L+ GL + E E+WAKHR+L+NPAF+ EKLKLM PAF LSC
Sbjct  131  PLARLLIVGLATLEGEKWAKHRKLINPAFHQEKLKLMLPAFYLSC  175



>ref|XP_004294187.1| PREDICTED: cytochrome P450 CYP72A219-like [Fragaria vesca subsp. 
vesca]
Length=523

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 111/168 (66%), Gaps = 3/168 (2%)
 Frame = +1

Query  106  VCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKP  285
            V VS+ ++  AW VL WVW KPK LE+CL++ G KGN YRIL GD KE V M   A SKP
Sbjct  14   VFVSI-VVRLAWSVLDWVWLKPKKLERCLRKQGFKGNSYRILYGDTKENVIMLKKAKSKP  72

Query  286  MTLSD--NVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPR  459
            M LS   ++APRV P        YGKN  VWMGP+P V I +PE +K+V  +   FQKP 
Sbjct  73   MNLSTSHDIAPRVTPLLHQTVKTYGKNSLVWMGPIPQVNIMNPEDLKDVFTELSDFQKPH  132

Query  460  NNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            +NPL + L  GLV +E E+WAKHRR++NP F+ EKLK M PAF  SC 
Sbjct  133  SNPLVKFLATGLVIHEGEKWAKHRRIINPTFHFEKLKRMLPAFYQSCD  180



>ref|XP_004243258.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=517

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 116/178 (65%), Gaps = 4/178 (2%)
 Frame = +1

Query  79   MEVIYTLL--GVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKEL  252
            ME+ Y  +   +CV V LL + WRVL W WF+PK LEK L++ GLKGNPY++  GD+ E+
Sbjct  1    MEIPYNRIIEAICV-VTLLVYTWRVLNWAWFRPKKLEKYLRKSGLKGNPYKLFYGDLNEI  59

Query  253  VKMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLN  432
                ++A SKP+  SD++A R+IP++    +K GK  +VW+GP P V I DPE VKE+  
Sbjct  60   TNKVNEARSKPINFSDDIAQRLIPFFLDSINKNGKRSFVWLGPNPAVLITDPEHVKEIFT  119

Query  433  KYELFQK-PRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            K   +QK P  NP      +GL   E+++W KHR+++NPAF+ EK K M PAF  SCS
Sbjct  120  KNYAYQKIPHPNPFANSFAKGLAFLEEDKWTKHRKIINPAFHFEKFKHMLPAFYQSCS  177



>ref|XP_009594690.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Nicotiana 
tomentosiformis]
Length=513

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 116/167 (69%), Gaps = 0/167 (0%)
 Frame = +1

Query  100  LGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAIS  279
            +   + + LL + WR + W+W +PK LEKCLK+LG +GN Y++L GDMKE+V M  +A S
Sbjct  9    ISFVIIIILLRWGWRFMNWLWLQPKCLEKCLKELGFRGNSYKLLYGDMKEVVMMDEEAKS  68

Query  280  KPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPR  459
            KP+  S ++ PR++P+       YGKN ++W+ P P + I DPEL++E+L+K  +FQKP 
Sbjct  69   KPIKFSHDIVPRIMPFIHKTIIDYGKNSFIWLWPTPAMLITDPELIREILSKSNIFQKPP  128

Query  460  NNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSC  600
                 + LV G++SYE ++WAKHRR++NPAF+ +KLK M P+F LS 
Sbjct  129  PTAHTKLLVEGILSYEADKWAKHRRIINPAFHLDKLKHMIPSFHLST  175



>gb|KJB12906.1| hypothetical protein B456_002G043600 [Gossypium raimondii]
Length=557

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 107/158 (68%), Gaps = 0/158 (0%)
 Frame = +1

Query  127  LAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNV  306
            + + WR L WVW  PK LE+CL+Q G  GNPYR LSGD+KEL  M+    +KPM LSD++
Sbjct  20   MIWGWRALNWVWLAPKRLERCLRQQGFAGNPYRFLSGDIKELSTMSRQTRAKPMPLSDDI  79

Query  307  APRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLV  486
             P V P+     ++YGKN + W+GP   V I DPE ++E+  K+  FQK R NPL   LV
Sbjct  80   GPYVAPFLHQTVNQYGKNSFTWIGPRQRVNIMDPEKIREIFTKFNDFQKVRTNPLLTLLV  139

Query  487  RGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSC  600
             GLV+ E ++W+KHR+++NP+F+ +KLK M PAF  SC
Sbjct  140  SGLVNLEGDRWSKHRKIINPSFHQDKLKNMLPAFYQSC  177



>dbj|BAL45203.1| cytochrome P450 monooxygenase [Medicago truncatula]
Length=520

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 120/175 (69%), Gaps = 2/175 (1%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVK  258
            + + Y ++ + V++GL+ + WRVL W+W KPK LEK L++ G KGN YR++ GD+K+  K
Sbjct  5    LAIYYGIILITVTLGLV-YTWRVLNWIWLKPKRLEKLLREQGCKGNSYRLVLGDLKDSYK  63

Query  259  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  438
            M   A SKPM LSD++ PRVIPY   L   YGKN ++W G  P + + +PEL+K+VLN+ 
Sbjct  64   MGKQAKSKPMELSDDIIPRVIPYIQQLVQIYGKNPFIWSGTTPRLILTEPELIKDVLNRT  123

Query  439  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
               QKP+   + + L  GL+ +E E+W KHRRL+N AF  EKLK+M P+FL SC+
Sbjct  124  SELQKPKYE-IFKFLFSGLIIHEGEKWRKHRRLMNAAFQLEKLKIMAPSFLTSCT  177



>ref|XP_006348907.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 119/178 (67%), Gaps = 4/178 (2%)
 Frame = +1

Query  79   MEVIYTLL--GVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKEL  252
            ME+ Y  +   +CV++ LL + WRVL W WFKPK LEK L++ GLKGNPY++  GD+ EL
Sbjct  1    MEISYNRIIEAICVAI-LLVYTWRVLNWAWFKPKKLEKYLRKSGLKGNPYKLFYGDLNEL  59

Query  253  VKMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLN  432
                ++A SKP+  SD++A R+IP++     K GK+ +VW+GP P V I DPE VKE+  
Sbjct  60   TNKLNEARSKPINFSDDIAQRLIPFFLDSIYKNGKSSFVWLGPYPAVLITDPEHVKEIFT  119

Query  433  KYELFQKPRN-NPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            K   +QK  + NP  +   +GL   E+++WAKHR+++NPAF+ E LK M PAF  SCS
Sbjct  120  KNYGYQKIAHPNPFAKSFAKGLAFLEEDKWAKHRKIINPAFHFENLKHMLPAFYQSCS  177



>ref|XP_006349622.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=516

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 113/163 (69%), Gaps = 1/163 (1%)
 Frame = +1

Query  118  VGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLS  297
            + +L +AWR+L +VW KPK LEK L+Q G KGN Y+ L GDMKE+ KM  +A+SKP+  S
Sbjct  17   IFVLRWAWRILNYVWLKPKYLEKQLRQEGFKGNSYKFLFGDMKEMSKMGEEALSKPVNFS  76

Query  298  -DNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLG  474
             D + PRV P+   +   YGKN +VW GP P V I DPE++KEV+ K  +FQKP  NPL 
Sbjct  77   HDMIWPRVNPFIHKIITNYGKNSFVWFGPKPAVVIMDPEVIKEVMMKNYVFQKPGGNPLT  136

Query  475  RKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            + L  G+  YE ++WA HRRLLNPAF+ +KLK M PAF L+ S
Sbjct  137  KLLATGIADYEADKWAVHRRLLNPAFHLDKLKHMLPAFKLTAS  179



>ref|XP_006364093.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=536

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 122/180 (68%), Gaps = 5/180 (3%)
 Frame = +1

Query  79   MEVIYTLLGVCV----SVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMK  246
            ME+ Y  L + +     + +L + WR+L +VWFKPK LEK L+Q G KGN Y++L GDMK
Sbjct  20   MEISYYNLKIAIFSFAIIFVLRWTWRILNYVWFKPKKLEKQLRQQGFKGNSYKLLYGDMK  79

Query  247  ELVKMASDAISKPMTLS-DNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKE  423
            E+ KM  +A SKP+  S D + PR+ P+       YGKNC+VW+GP P V I +P+L++E
Sbjct  80   EMKKMIEEATSKPIDFSHDLIWPRINPFIHKTITNYGKNCFVWIGPKPAVLITEPKLIRE  139

Query  424  VLNKYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            VL K  ++ K R +PL + ++ GL  +EK++WA HRR+LNPAF+ +KLK M PAF L+ +
Sbjct  140  VLTKNYVYHKARGSPLSKLVISGLAGHEKDKWATHRRILNPAFHLDKLKHMLPAFKLTVN  199



>gb|KFK38823.1| hypothetical protein AALP_AA3G165300 [Arabis alpina]
Length=512

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 118/176 (67%), Gaps = 3/176 (2%)
 Frame = +1

Query  85   VIYTLLGVCVSVGLLAFAW---RVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELV  255
            +I +   V +SV ++  +W   R+L WVWFKPK LE  L+  GL G  Y +L GD+K   
Sbjct  1    MIISAKSVTISVAIVVVSWWIWRILKWVWFKPKMLESYLRGQGLPGTSYTLLVGDVKRNS  60

Query  256  KMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNK  435
             M  +A SKP+ L+D++A RV+PY   +A  +G+N + W+GP+P + + DPEL+KEV NK
Sbjct  61   NMLLEARSKPIKLTDDIASRVVPYPLQMAKTHGRNFFTWLGPIPSITLMDPELIKEVFNK  120

Query  436  YELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
               FQKP   PLGR +  GL SY+ ++WAKHRR++NPAF+ EK+K M PAF  SCS
Sbjct  121  IYNFQKPNVFPLGRLVATGLFSYDDDKWAKHRRIINPAFHIEKIKSMVPAFHQSCS  176



>gb|KHN14193.1| Secologanin synthase [Glycine soja]
Length=518

 Score =   178 bits (452),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 115/169 (68%), Gaps = 3/169 (2%)
 Frame = +1

Query  106  VCVSVGL---LAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAI  276
            VC+ V L   L  AWRVL W+W +PK LE+ L++ GL+GNPYR+L GD+KE++ M  +  
Sbjct  7    VCLVVILILALTLAWRVLNWLWLRPKRLERLLREQGLQGNPYRLLVGDLKEIMNMQKEVT  66

Query  277  SKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKP  456
            SKPM LS ++ PRV  +  H  + +GKN ++W G  P V I +PEL+K+VLNK   F KP
Sbjct  67   SKPMNLSHDIVPRVFSFLQHTLNTHGKNSFIWFGRKPRVIITEPELIKDVLNKMHDFPKP  126

Query  457  RNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
              +PL + L  GL+++E E+W KHRR+++PAF  EKLK M P F  SC+
Sbjct  127  DTSPLVKLLATGLLNHEGEKWNKHRRIISPAFNLEKLKNMLPIFYKSCN  175



>ref|XP_010502020.1| PREDICTED: cytochrome P450 72A13 isoform X2 [Camelina sativa]
Length=513

 Score =   178 bits (452),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 107/155 (69%), Gaps = 0/155 (0%)
 Frame = +1

Query  139  WRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAPRV  318
            WR L WVWFKPK LE  LK+ GL G PY  L GD+K    M + A SKP+ L+D++ PRV
Sbjct  22   WRTLQWVWFKPKMLESYLKRQGLAGTPYTPLVGDLKRNSSMLAVARSKPIKLTDDITPRV  81

Query  319  IPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVRGLV  498
            +P+  H+   +G+  + W GP+P++ I DPEL+KEV NK   FQK    PLGR +  GLV
Sbjct  82   VPFPLHMLKTHGRTFFTWFGPVPVITIMDPELIKEVFNKVYDFQKAHTFPLGRIIAAGLV  141

Query  499  SYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            SY+ ++WAKHRR++NPAF+ EK+K M PAF  SCS
Sbjct  142  SYDGDKWAKHRRIINPAFHLEKIKNMVPAFHQSCS  176



>gb|KJB12901.1| hypothetical protein B456_002G043400 [Gossypium raimondii]
Length=518

 Score =   178 bits (452),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 105/154 (68%), Gaps = 0/154 (0%)
 Frame = +1

Query  142  RVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAPRVI  321
            R L WVW  PK LE CL+Q G  GNPYR LSGD+KEL  M+    +KPM LSD++ P V+
Sbjct  25   RTLNWVWLAPKRLESCLRQQGFAGNPYRFLSGDIKELSTMSRQTRAKPMPLSDDIGPYVV  84

Query  322  PYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVRGLVS  501
            P+    A++YGKN + W GP P V I DPE ++E+LNK+  FQK   NPL   LV GL +
Sbjct  85   PFQHQTANQYGKNSFTWFGPRPRVNITDPEKIREILNKFNDFQKIHTNPLLNLLVSGLAN  144

Query  502  YEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             + ++W+K R+++NPAF+ +KLK M PAF  SCS
Sbjct  145  LDGDRWSKRRKIINPAFHQDKLKNMLPAFYQSCS  178



>ref|XP_010502032.1| PREDICTED: cytochrome P450 72A13-like isoform X2 [Camelina sativa]
Length=512

 Score =   178 bits (452),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 108/157 (69%), Gaps = 0/157 (0%)
 Frame = +1

Query  133  FAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAP  312
            + WR L WVWFKPK LE  L++ GL G PY +L GD+K    M ++A SKP+ L+D++ P
Sbjct  20   WVWRTLQWVWFKPKILESNLRRQGLSGTPYTLLVGDLKRHFSMLTEAKSKPIKLTDDITP  79

Query  313  RVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVRG  492
            R++PY   +   +G+  + W+GP+P + I DPE +KEV NK   FQK    PLGR +  G
Sbjct  80   RIVPYPLQMLKTHGRTFFTWLGPIPTITIMDPEQIKEVFNKVYDFQKAHTFPLGRLIAAG  139

Query  493  LVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            LVSY+ ++WAKHRR++NPAF+ EK+K M PAF  SCS
Sbjct  140  LVSYDGDKWAKHRRIINPAFHLEKIKNMVPAFHQSCS  176



>ref|XP_004295683.1| PREDICTED: cytochrome P450 CYP72A219-like [Fragaria vesca subsp. 
vesca]
Length=523

 Score =   178 bits (452),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 116/168 (69%), Gaps = 3/168 (2%)
 Frame = +1

Query  106  VCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKP  285
            V VS+ ++ +AW +L WVWFKPK LE+CL+Q G +GN YR+  GDMKE   M  +A SKP
Sbjct  14   VFVSI-IVRWAWSLLDWVWFKPKKLERCLRQQGFQGNAYRLFYGDMKENAIMVKEAKSKP  72

Query  286  MTLSD--NVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPR  459
            M LS   +++PRVIP        YGKN +VW+GP+P V I +PE +K+V  K   F KP 
Sbjct  73   MNLSTSHDISPRVIPLLDQTVKTYGKNSFVWVGPLPRVNIMNPEDLKDVFAKPSDFPKPV  132

Query  460  NNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            +NPL + L  GL +YE E+WAKHRR++NP F+SEK+K M PAF  SC+
Sbjct  133  SNPLIKLLSTGLANYEGEKWAKHRRIINPTFHSEKVKRMLPAFYQSCN  180



>ref|XP_008452438.1| PREDICTED: cytochrome P450 CYP72A219-like [Cucumis melo]
Length=521

 Score =   178 bits (452),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 106/155 (68%), Gaps = 0/155 (0%)
 Frame = +1

Query  136  AWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAPR  315
             W+++ W+WF+PK LEK L++ G  GN YRIL GD+KE   M  +A+SKPM  S+++APR
Sbjct  24   GWKLVDWIWFRPKKLEKILRRQGFAGNSYRILHGDLKESAAMREEAMSKPMNFSNHIAPR  83

Query  316  VIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVRGL  495
            VIP   H    YGK   +W+GPMP V I DPE +K V +    FQKP  NPL R LV+GL
Sbjct  84   VIPSVYHTIQLYGKKSMMWLGPMPRVHIMDPEQLKIVFSSINDFQKPTMNPLTRLLVQGL  143

Query  496  VSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSC  600
             S E ++W KHR+++NPAF+ EKLK M PAF  SC
Sbjct  144  ASLEGQKWVKHRKIINPAFHVEKLKDMVPAFYHSC  178



>gb|KEH37984.1| cytochrome P450 family 72 protein [Medicago truncatula]
Length=394

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/179 (47%), Positives = 118/179 (66%), Gaps = 6/179 (3%)
 Frame = +1

Query  79   MEVIYT----LLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMK  246
            ME+ +T    ++ + V+ GL+ +AWRVL W+W KPK +EK L++ GL+GNPYR+L GD K
Sbjct  1    MELFWTTNSAIILITVTFGLV-YAWRVLNWMWLKPKKMEKLLREQGLQGNPYRLLLGDAK  59

Query  247  ELVKMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEV  426
            +   M     SKPM LSD++APRV PY  H    +GK  ++W G  P V + +PE ++EV
Sbjct  60   DYFVMQKKVQSKPMNLSDDIAPRVAPYIHHAVQTHGKKSFIWFGTKPWVILNEPEQIREV  119

Query  427  LNKYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             NK   F K +   + + + RGLV  E E+W KHRR++NPAF+ EKLK+M P FL SC+
Sbjct  120  FNKISEFPKVQYKFM-KLITRGLVKLEGEKWTKHRRIINPAFHMEKLKIMTPTFLKSCN  177



>ref|XP_004243255.1| PREDICTED: cytochrome P450 CYP72A219 isoform X1 [Solanum lycopersicum]
Length=526

 Score =   178 bits (452),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 113/161 (70%), Gaps = 1/161 (1%)
 Frame = +1

Query  124  LLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDN  303
            LL + W+VL W WF PK LE CL+Q GLKGNPY++L GD+ EL K   +A SKP+  SD+
Sbjct  26   LLFYTWKVLNWAWFGPKKLENCLRQRGLKGNPYKLLYGDLNELTKSIVEAKSKPINFSDD  85

Query  304  VAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNK-YELFQKPRNNPLGRK  480
            +A R+IP++ +  +K GK+ ++W+GP P+V I  PE VKE+  K Y   ++   NP  + 
Sbjct  86   IAQRLIPFFLNSINKNGKSSFIWLGPYPIVLITKPEHVKEIFTKNYVYLKQTHPNPFTKL  145

Query  481  LVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            L +GLVS E+++WAKHR+++NP F+ EKLK M PAF + CS
Sbjct  146  LAKGLVSLEEDKWAKHRKIINPTFHVEKLKHMLPAFYVCCS  186



>gb|KEH38469.1| cytochrome P450 family 709 protein [Medicago truncatula]
Length=516

 Score =   178 bits (451),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 121/175 (69%), Gaps = 2/175 (1%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVK  258
            ME +  ++ + V++GL+ +AW+VL  +W +PK LEK L++ G +GN YRIL GD+K+L K
Sbjct  1    MEWVSGIILIIVTLGLI-WAWKVLSLLWLRPKKLEKLLREQGFQGNSYRILLGDIKDLFK  59

Query  259  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  438
            M  +A SK M LSD++ PRVIPY  H    +GKN Y+W G  P V + +PE +K+VLNK 
Sbjct  60   MEKEAKSKSMNLSDDITPRVIPYIQHSVKIHGKNSYIWFGIKPRVTLTEPEQIKDVLNKM  119

Query  439  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
              F KP N  + + L   L +YE E+W+KHR+L+NPAF+ EKLK+M PAF  SC+
Sbjct  120  SEFPKP-NYKIFKLLANALANYEGEKWSKHRKLINPAFHLEKLKIMTPAFFTSCN  173



>ref|XP_008386384.1| PREDICTED: cytochrome P450 CYP72A219-like [Malus domestica]
Length=511

 Score =   178 bits (451),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 110/159 (69%), Gaps = 0/159 (0%)
 Frame = +1

Query  112  VSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMT  291
            V VGL+A  W+V+ W+W KPK  E+ L+Q GL GN YR+L GD+ +  KM   A+SKPM 
Sbjct  6    VCVGLIALGWKVVNWIWLKPKKFERHLRQQGLSGNSYRLLIGDLNDNSKMTKAALSKPME  65

Query  292  LSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPL  471
            LS ++ P V+P    + +KYG+  +VW+GPMP V + D EL++E   KY +++KP +NPL
Sbjct  66   LSHDIVPYVLPLLHDIFNKYGRKSFVWLGPMPSVILFDAELMREAFTKYRVYEKPHSNPL  125

Query  472  GRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAF  588
               L  GLV +E ++W KHRR++NPAF+ EK+K M PAF
Sbjct  126  ISLLATGLVGHEGDKWVKHRRIINPAFHVEKMKDMLPAF  164



>ref|XP_006477948.1| PREDICTED: secologanin synthase-like [Citrus sinensis]
Length=522

 Score =   178 bits (451),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 113/165 (68%), Gaps = 0/165 (0%)
 Frame = +1

Query  106  VCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKP  285
              V V +L +AWRVL WVW +P+ LEK L+Q GLKGN YR+L GD+KE      +A ++P
Sbjct  11   TIVIVTVLTWAWRVLNWVWLRPEKLEKFLRQQGLKGNSYRLLFGDLKENSIELKEAKARP  70

Query  286  MTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNN  465
            ++L D++A RV P+   L + YGKN ++W GP P V I +P+ +K +  K   FQK  + 
Sbjct  71   LSLDDDIAIRVNPFLHKLVNDYGKNSFMWFGPTPRVNIMNPDQIKAIFTKINDFQKVNSI  130

Query  466  PLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSC  600
            PL R L+ GL + E E+WAKHR+L+NPAF+ EKLKLM PAF LSC
Sbjct  131  PLARLLIVGLATLEGEKWAKHRKLINPAFHQEKLKLMLPAFYLSC  175



>gb|AJD25172.1| cytochrome P450 CYP72A331 [Salvia miltiorrhiza]
Length=516

 Score =   177 bits (450),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 119/174 (68%), Gaps = 2/174 (1%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVK  258
            ME++Y++L +  +  L   AW+ L  VWF+P+ LEK L+Q G  GN YR + GD K+ + 
Sbjct  3    MEILYSILALFCAAFLSHNAWKFLTRVWFEPRKLEKRLRQEGFSGNSYRFMIGDSKQ-IA  61

Query  259  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  438
             A  A SKP+  S+++APRVIP+  H   KYG+NC++W G  P + I D E+ KE+L+K 
Sbjct  62   AAKQANSKPIAFSNDIAPRVIPFIHHSLLKYGENCFIWYGSKPTIVILDQEMTKEILSKN  121

Query  439  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSC  600
             +FQK  + PL + L +G+ +YE ++WAKHRRLLNPAF+ EKLKLM P F LSC
Sbjct  122  YVFQKT-STPLDKLLAQGVATYEADKWAKHRRLLNPAFHLEKLKLMLPLFYLSC  174



>emb|CDP15977.1| unnamed protein product [Coffea canephora]
Length=181

 Score =   169 bits (428),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 81/170 (48%), Positives = 112/170 (66%), Gaps = 3/170 (2%)
 Frame = +1

Query  79   MEVIYTLLGV---CVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKE  249
            ME+ Y+ + V   CV + +L   W+   WVW  PK LEK LK+ GL GNP ++L  D KE
Sbjct  1    MEIAYSPIAVFSSCVLLLILVLTWKAFDWVWLTPKKLEKRLKEQGLGGNPCKLLYEDFKE  60

Query  250  LVKMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVL  429
               +  +A SKP+ LS++  PRVIP++     KYGKN  VW+GP PMV I +PE  +E+ 
Sbjct  61   TSTLFEEAHSKPVNLSEDFVPRVIPHFCKAVKKYGKNTCVWLGPHPMVVIMNPEHTREIT  120

Query  430  NKYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQ  579
             K  +FQKP  NPL + L +GLVSY+ ++WAKHR+L+ PAF+ EKLK+ +
Sbjct  121  TKLYIFQKPHANPLIKLLAQGLVSYDGDKWAKHRKLIAPAFHVEKLKIYK  170



>ref|XP_004243259.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=517

 Score =   177 bits (450),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 121/178 (68%), Gaps = 4/178 (2%)
 Frame = +1

Query  79   MEVIYTLL--GVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKEL  252
            ME+ Y  +   +CV V LL + WRVL W WFKPK LEK L++ GLKGNPY++L GD KEL
Sbjct  1    MEISYNRIIEAICV-VTLLVYTWRVLNWAWFKPKKLEKYLRKSGLKGNPYKLLYGDSKEL  59

Query  253  VKMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLN  432
                ++A SKP+  SD++A R++P++    +K GK+ +VW+GP P+V I  PE VKE+  
Sbjct  60   TNKLNEARSKPINFSDDIAQRLVPFFIDSINKNGKSSFVWLGPCPIVLITYPEHVKEIFT  119

Query  433  KYELFQKPRN-NPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            K   +QK  + NP  + L  GL   E+++WAKHR+++NPAF+ EKLK M PAF  SC+
Sbjct  120  KNCAYQKQAHPNPFAKLLAIGLALLEEDKWAKHRKIINPAFHVEKLKHMLPAFYQSCT  177



>ref|XP_009356829.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=516

 Score =   177 bits (450),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 119/176 (68%), Gaps = 1/176 (1%)
 Frame = +1

Query  79   MEVIYTLLGVC-VSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELV  255
            MEV  + +GV  V + + A+AWRV+ W+W +PK LE+ L+Q GL GN YR L GD+ E  
Sbjct  1    MEVSVSNIGVVLVRIIVTAWAWRVVNWLWLRPKKLERYLRQQGLAGNSYRFLVGDLTERT  60

Query  256  KMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNK  435
             M   A SKPM LS ++APRV+P+  H  + YGKN ++W GP+P V I +PE +K++L K
Sbjct  61   MMLKQAYSKPMNLSHDIAPRVLPFEYHSVNTYGKNSFIWAGPVPRVNIANPEDLKDILTK  120

Query  436  YELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             E F K ++NP  + LV G   Y+ E+W +HRR++NPAF+ +KLK M PAF LS +
Sbjct  121  IEDFPKLKSNPYVKLLVTGTAHYQGEKWRRHRRIINPAFHLDKLKGMLPAFYLSSN  176



>emb|CDP06076.1| unnamed protein product [Coffea canephora]
Length=515

 Score =   177 bits (450),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 116/176 (66%), Gaps = 1/176 (1%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVGLLAF-AWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELV  255
            M+   ++L + V + LL F A R + WVW  PK +E+CL++ G  GNPYR+L GD KE+ 
Sbjct  1    MKTPLSVLVIFVLIMLLIFWAARTVNWVWLNPKRIERCLRKQGFNGNPYRLLYGDTKEIG  60

Query  256  KMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNK  435
             M   A SKP+ LSD++ PRV+P+  HL   YG+  + W+GP+  V I DPEL++E+L +
Sbjct  61   SMIKAANSKPIKLSDDILPRVLPFQLHLIKTYGEKSFFWVGPVAKVLIMDPELIREILAR  120

Query  436  YELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
              +F+KP  NPL + LV GL  YE E+WAKHRR++ PAFY EKLK M P     C+
Sbjct  121  NAIFKKPIPNPLAKFLVAGLAGYEDEKWAKHRRIVTPAFYVEKLKNMLPKMYFCCN  176



>ref|XP_011009101.1| PREDICTED: cytochrome P450 CYP72A219-like [Populus euphratica]
Length=547

 Score =   178 bits (451),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 84/173 (49%), Positives = 120/173 (69%), Gaps = 1/173 (1%)
 Frame = +1

Query  85   VIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMA  264
            ++ ++L   V V +L +AWRVL WVWF+PK +E+CL+Q G  G PYR+L GD KE   M 
Sbjct  33   IVTSILVSIVYVAVLRWAWRVLNWVWFRPKKVERCLRQQGFAGKPYRLLLGDWKESSDML  92

Query  265  SDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYEL  444
             +A +KP+ LS+ + PRV+P+   L   YGKN ++W+GP P V I +P+ +++V  K   
Sbjct  93   KEARTKPLGLSEALLPRVMPFLHQLVKDYGKNSFMWVGPKPRVNIMNPDQIRDVFMKINE  152

Query  445  FQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            +QK  ++PL + L  GL S+E E+WAKHR+++NPAF+ EKLKLM PAF  SCS
Sbjct  153  YQKA-SHPLLKALACGLASHEGEKWAKHRKIINPAFHQEKLKLMIPAFYESCS  204



>gb|AIA82924.1| SLS1 [Gentiana rigescens]
Length=519

 Score =   177 bits (449),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 110/159 (69%), Gaps = 1/159 (1%)
 Frame = +1

Query  127  LAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMT-LSDN  303
            L  A+ VL WVWFKPK +EK L++ GLKGNPYR+L GD+KE+ K    A S+P+   S  
Sbjct  20   LYVAYEVLNWVWFKPKKIEKQLQEQGLKGNPYRLLYGDLKEMQKTLKKACSQPVKGFSHA  79

Query  304  VAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKL  483
              PRVIP Y  +  KYGKN Y W GP   V + DPE +KEV  KY++F KP +NPL + L
Sbjct  80   FEPRVIPLYQDVVHKYGKNGYAWFGPEASVIVMDPESIKEVTLKYDVFNKPHSNPLSKLL  139

Query  484  VRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSC  600
            +RG+VSYE ++W KHR+++NPAF+ +KLK M P+F  S 
Sbjct  140  LRGVVSYEGDKWVKHRKIINPAFHQDKLKHMLPSFHTSA  178



>ref|XP_004242635.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=517

 Score =   177 bits (449),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 80/171 (47%), Positives = 115/171 (67%), Gaps = 0/171 (0%)
 Frame = +1

Query  88   IYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMAS  267
            I   +   + +  L + W+ L WVW  PK LEK LK  GLKG+ Y+ L GDMKE+  M  
Sbjct  6    IKIAISFVIVIIFLRWIWKFLDWVWIHPKKLEKRLKLEGLKGSSYKFLLGDMKEINSMVE  65

Query  268  DAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELF  447
            +A SKP+  +++   RV P++  L  +YGKNCY W+GP P + I +PE V+E+L+K  ++
Sbjct  66   EAKSKPINFTNDYISRVFPHFNKLMMQYGKNCYTWLGPKPTMLISEPEFVREILSKSYIY  125

Query  448  QKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSC  600
            QK + NP+ + L +GL SYE ++WAKHRR++NPAF+ +KLK M P+F LSC
Sbjct  126  QKIQGNPITKLLAQGLASYETDKWAKHRRIINPAFHLDKLKHMLPSFYLSC  176



>ref|XP_011098146.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=517

 Score =   177 bits (449),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 115/166 (69%), Gaps = 3/166 (2%)
 Frame = +1

Query  106  VCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKP  285
            + VS  L+    ++L WVWF+PK LEK L++ GL GNPYR+  GDM++L  +      K 
Sbjct  14   ILVSTALIV---KLLNWVWFRPKKLEKLLRKQGLNGNPYRLFRGDMQDLSNVMKTKQPKT  70

Query  286  MTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNN  465
            + LSD++ P ++PYY ++ DKYGK+ ++W+GP P + + DPE +KE+L+K  LF KP  +
Sbjct  71   LKLSDDLPPHILPYYHNIIDKYGKHSFIWVGPSPRLNVADPEHIKEILSKPGLFHKPLPD  130

Query  466  PLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            P+G  +V GL   E ++WAKHRR++NPAF+ EKLK M PA  LSCS
Sbjct  131  PIGETIVGGLAYLEDDRWAKHRRIMNPAFHMEKLKNMIPAMFLSCS  176



>ref|XP_010465357.1| PREDICTED: cytochrome P450 72A13-like [Camelina sativa]
Length=512

 Score =   177 bits (448),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 82/176 (47%), Positives = 117/176 (66%), Gaps = 1/176 (1%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVGLLAF-AWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELV  255
            ME+    + + V++ +++   WR L WVWFKPK LE  L++ GL G  Y  L GD+K   
Sbjct  1    MEISVASVTISVAIVVVSLWVWRTLQWVWFKPKMLESYLRRQGLAGTRYTPLVGDLKRNA  60

Query  256  KMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNK  435
             M ++A SKP+ L+D+  PR++P+  H+   +G+  + W+GP+P + I DPEL+KEV NK
Sbjct  61   NMLAEARSKPIKLTDDTRPRIVPFPLHMLKTHGRTFFTWLGPIPTITIMDPELIKEVFNK  120

Query  436  YELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
               FQK    PLGR +V GLVSY+ ++W KHRR++NPAF+ EK+K M PAF  SCS
Sbjct  121  VYDFQKAHTFPLGRLIVPGLVSYDGDKWTKHRRIINPAFHLEKIKNMVPAFHQSCS  176



>ref|XP_010275244.1| PREDICTED: cytochrome P450 CYP72A219-like [Nelumbo nucifera]
Length=518

 Score =   177 bits (448),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 120/167 (72%), Gaps = 1/167 (1%)
 Frame = +1

Query  106  VCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKP  285
            V  SV +L++   VL W+W++PK LE+ LKQ G+KG+PYR+L G+++E +++  +A++KP
Sbjct  11   VISSVLILSWVAIVLYWIWWRPKKLEQRLKQQGIKGHPYRLLFGNLREEMRLEKEAMAKP  70

Query  286  MTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVL-NKYELFQKPRN  462
            ++LS N+ PRVIP+       YG+    W G  P V+I DPEL+KE+L  K+  F++P+ 
Sbjct  71   ISLSHNIVPRVIPFVHQTIQNYGRMSISWFGRTPRVYITDPELIKEILFTKFGHFERPKP  130

Query  463  NPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            NPL +  +RGL+SYE E+WAKHRRL+N AF+ EKLK M PAF  SCS
Sbjct  131  NPLTKSFLRGLLSYEGEKWAKHRRLINGAFHLEKLKRMLPAFYASCS  177



>ref|XP_010487266.1| PREDICTED: cytochrome P450 72A13-like [Camelina sativa]
Length=513

 Score =   177 bits (448),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 108/155 (70%), Gaps = 0/155 (0%)
 Frame = +1

Query  139  WRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAPRV  318
            WR L WVWFKPK LE  L++ GL G  Y  L GD+K    M ++A SKP+ L+D + PRV
Sbjct  22   WRTLEWVWFKPKMLESYLRRQGLAGTHYTPLVGDLKRNSSMLAEARSKPINLTDEITPRV  81

Query  319  IPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVRGLV  498
            +P+  H+   +G+  + W+GP+P+V I DPEL+KEV NK   FQKP   PLGR +  GLV
Sbjct  82   VPFPLHMLKTHGRTFFTWLGPVPVVTIMDPELIKEVFNKVYDFQKPHTFPLGRIIAAGLV  141

Query  499  SYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            SY+ ++WAK+RR++NPAF+ EK+K M PAF  SCS
Sbjct  142  SYDGDKWAKYRRIINPAFHLEKIKNMVPAFHQSCS  176



>ref|XP_006343585.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 114/167 (68%), Gaps = 0/167 (0%)
 Frame = +1

Query  100  LGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAIS  279
            + + + +  L + W+ L WVW  PK +EK LK  G KG+ Y+ L GDMKE+  M  +A S
Sbjct  10   ISLVIVIIFLRWIWKFLDWVWIHPKKMEKRLKLEGFKGSSYKFLLGDMKEMNSMVEEAKS  69

Query  280  KPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPR  459
            KP+  +++   RV P++     +YGKNCY+W+GP P + I +PE ++E+L+K  ++QK +
Sbjct  70   KPINFTNDYISRVFPHFNKFMMQYGKNCYIWLGPKPTMLISEPEFIREILSKSYIYQKIQ  129

Query  460  NNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSC  600
             NP+ + L +GL SYE E+WAKHRR++NPAF+ +KLK M P+F LSC
Sbjct  130  GNPITKLLAQGLASYETEKWAKHRRIINPAFHLDKLKHMLPSFYLSC  176



>ref|XP_006348909.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 120/177 (68%), Gaps = 2/177 (1%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVG-LLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELV  255
            ME+ Y  +   +SV  LL + W+VL W WFKPK LEK L++ GLKGN Y++L GD+KEL 
Sbjct  1    MEISYNRIIAAISVAILLVYTWKVLNWAWFKPKKLEKYLRKSGLKGNKYKLLYGDLKELT  60

Query  256  KMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNK  435
               ++A SKP+  S +V  R+IP++    +K GK+ ++W+GP P+V I DPE VKE+L K
Sbjct  61   NKLNEAKSKPIHFSGDVPQRLIPFFCDSINKNGKSSFMWLGPYPVVLITDPEHVKEILTK  120

Query  436  YELFQKPRN-NPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
              ++Q+  + NP  +KL  GL   E+++WAKHR+++ PAF  EKLK M PAF  SCS
Sbjct  121  NYVYQRQTHPNPFAKKLALGLAKLEEDKWAKHRKIIQPAFQLEKLKHMLPAFYQSCS  177



>ref|XP_009394210.1| PREDICTED: cytochrome P450 CYP72A219-like [Musa acuminata subsp. 
malaccensis]
Length=526

 Score =   177 bits (448),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 116/175 (66%), Gaps = 1/175 (1%)
 Frame = +1

Query  82   EVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKM  261
            +V+++L      +  LA+A RVL W W++P+ LE+ L+  GLKG  YR   GD+KE  + 
Sbjct  8    DVLWSLGWGVAGLLFLAWASRVLNWAWWRPRRLERALRAQGLKGTAYRFPYGDLKENARF  67

Query  262  ASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVL-NKY  438
            + +A +K M L+ N+ PR++P+Y    D+YGK  + W GP+P V I DPELV+EVL NK+
Sbjct  68   SKEARAKSMPLAHNIIPRLLPFYHRAMDEYGKISFTWSGPVPQVAITDPELVREVLSNKF  127

Query  439  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
              F KP  NPL R   RGL  YE E+W KHRR+LNPAF++EKLK M PAF   CS
Sbjct  128  GHFGKPNQNPLARFFARGLAVYEGEKWVKHRRILNPAFHAEKLKRMLPAFSACCS  182



>emb|CDX98486.1| BnaC05g38890D [Brassica napus]
Length=512

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/169 (49%), Positives = 115/169 (68%), Gaps = 3/169 (2%)
 Frame = +1

Query  106  VCVSVGLLA---FAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAI  276
            V VSV ++A   + WR L WVWFKPK LE  L++ GL G+PY  L GD++    M+ +A 
Sbjct  8    VTVSVAIVAVLWWVWRTLNWVWFKPKMLESYLRRQGLSGSPYTPLVGDVRRDNNMSMEAR  67

Query  277  SKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKP  456
            SKP+ ++D++ PRV+P+ +H+   +GK  + W GP+P + I DPE +KEV NK    QKP
Sbjct  68   SKPIKITDDIVPRVVPFPSHMLKTHGKTFFTWRGPIPTITITDPEQIKEVFNKIYDCQKP  127

Query  457  RNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             + PL R +  GL SY+ ++WAKHRR++NPAF+ EK+K M PAF  SCS
Sbjct  128  HSFPLSRLIATGLFSYDGDKWAKHRRIINPAFHLEKIKNMVPAFHQSCS  176



>ref|XP_007227257.1| hypothetical protein PRUPE_ppa017915mg [Prunus persica]
 gb|EMJ28456.1| hypothetical protein PRUPE_ppa017915mg [Prunus persica]
Length=515

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 119/174 (68%), Gaps = 3/174 (2%)
 Frame = +1

Query  88   IYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMAS  267
            +  L+ V VS+ ++A+AWRVL WVW +PK LE+CLK+ G  GN YR+L GD K+   M  
Sbjct  5    VAVLIVVWVSI-VIAWAWRVLNWVWLRPKKLERCLKEQGFTGNSYRLLFGDTKDSSMMLR  63

Query  268  DAISKPMTLS--DNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYE  441
             A SKPM LS   ++APRV+P+     + YG+N +VW+GP+P V I +PE +KE+ NK+E
Sbjct  64   QAQSKPMKLSTSHDIAPRVMPFVHQTVNTYGRNSFVWVGPIPKVNILNPEDLKEIFNKHE  123

Query  442  LFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
              Q+   NP+   LV+GL S   E+WAKHR+++NPAF+ EKLK M P F  SCS
Sbjct  124  NIQRTVANPIIDLLVQGLGSTVDEKWAKHRKIINPAFHLEKLKGMLPTFYHSCS  177



>ref|XP_009343589.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=515

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 108/158 (68%), Gaps = 0/158 (0%)
 Frame = +1

Query  130  AFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVA  309
             +AWRV+ W+W +PK LE+ L+Q GL GN YR  SGDMKE+      A SKPM+LS  +A
Sbjct  18   TWAWRVVNWLWLRPKKLERYLRQQGLAGNLYRFKSGDMKEISMTTEQAYSKPMSLSHYIA  77

Query  310  PRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVR  489
            PRVIP++  L + Y KN +VWMG +P V I +PE +K +L K E F +P  NPL + L  
Sbjct  78   PRVIPFHHRLVNTYRKNSFVWMGTIPRVIITNPEDLKYILTKMEEFPQPEPNPLVKLLAT  137

Query  490  GLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            G+  YE E+WAKH+R++NP F+ EKLK M PAF  SCS
Sbjct  138  GIALYEGEKWAKHQRIINPVFHLEKLKRMLPAFYESCS  175



>ref|XP_004146005.1| PREDICTED: secologanin synthase-like [Cucumis sativus]
Length=530

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 106/158 (67%), Gaps = 2/158 (1%)
 Frame = +1

Query  136  AWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAPR  315
             W+++ W+WF+PK LEK L+Q G  GN YRIL GD+KE   M   AISKPM  S+ +APR
Sbjct  28   GWKLVDWIWFRPKKLEKLLRQQGFTGNSYRILHGDLKESAAMRDQAISKPMNFSNYIAPR  87

Query  316  VIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRN--NPLGRKLVR  489
            VIP   H    YGKN ++W+GPMP V I DPE +K V +    +QKP    NPL + L  
Sbjct  88   VIPSVHHTIQHYGKNSFMWIGPMPRVHIMDPEQLKTVFSLINDYQKPTASLNPLAKLLAD  147

Query  490  GLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            GL+++E ++W KHR+++NPAF+ EKLK M PAF  SC 
Sbjct  148  GLLNHEGQKWVKHRKIINPAFHLEKLKDMVPAFYHSCD  185



>ref|XP_004169020.1| PREDICTED: LOW QUALITY PROTEIN: secologanin synthase-like [Cucumis 
sativus]
Length=530

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 106/158 (67%), Gaps = 2/158 (1%)
 Frame = +1

Query  136  AWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAPR  315
             W+++ W+WF+PK LEK L+Q G  GN YRIL GD+KE   M   AISKPM  S+ +APR
Sbjct  28   GWKLVDWIWFRPKKLEKLLRQQGFTGNSYRILHGDLKERAAMRDQAISKPMNFSNYIAPR  87

Query  316  VIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRN--NPLGRKLVR  489
            VIP   H    YGKN ++W+GPMP V I DPE +K V +    +QKP    NPL + L  
Sbjct  88   VIPSVHHTIQHYGKNSFMWIGPMPRVHIMDPEQLKTVFSLINDYQKPTASLNPLAKLLAD  147

Query  490  GLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            GL+++E ++W KHR+++NPAF+ EKLK M PAF  SC 
Sbjct  148  GLLNHEGQKWVKHRKIINPAFHLEKLKDMVPAFYHSCD  185



>ref|XP_009339373.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=511

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 110/159 (69%), Gaps = 0/159 (0%)
 Frame = +1

Query  112  VSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMT  291
            V VGL+   W+V+ W+W KPK LE+ L+Q GL GN YR+L GD+ +  KM   A+SKPM 
Sbjct  6    VCVGLITLGWKVVNWIWLKPKKLERHLRQQGLSGNSYRLLIGDLNDNSKMTKAALSKPME  65

Query  292  LSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPL  471
             S ++ P V+P    + +KYG+  ++W+GP+P V + D EL++E   KY +++KP +NPL
Sbjct  66   FSHDIVPYVLPLLHDIFNKYGRKSFIWLGPIPSVILFDAELMREAFTKYRVYEKPHSNPL  125

Query  472  GRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAF  588
               LV GLV +E ++W KHRR++NPAF+ EK+K M PAF
Sbjct  126  ISLLVTGLVGHEGDKWVKHRRIINPAFHVEKMKDMLPAF  164



>ref|XP_008219216.1| PREDICTED: cytochrome P450 CYP72A219-like [Prunus mume]
Length=519

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 119/174 (68%), Gaps = 3/174 (2%)
 Frame = +1

Query  88   IYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMAS  267
            +  L  V VS+ ++A+AWRVL W+W +PK LE+CL++ G  GN YR+L GD K+   M  
Sbjct  5    VAVLSVVWVSI-VIAWAWRVLNWMWLRPKKLERCLREQGFTGNSYRLLFGDTKDSSMMLR  63

Query  268  DAISKPMTLSD--NVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYE  441
             A SKPM LS   ++APRV+P+   +   YG+N +VWMGPMP + I +PE +KE+ NK +
Sbjct  64   QAQSKPMKLSTSHDIAPRVMPFVHQIVKTYGRNSFVWMGPMPKLNIMNPEDLKEIFNKRQ  123

Query  442  LFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             FQ+P  NPL + LV+GL+  E  +WAKHR+++ PAF+ EKLK M P F  SCS
Sbjct  124  NFQRPSANPLIKLLVQGLLHIEDVKWAKHRKIIKPAFHLEKLKGMLPTFYQSCS  177



>ref|XP_009116688.1| PREDICTED: cytochrome P450 72A15-like [Brassica rapa]
Length=512

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 113/169 (67%), Gaps = 3/169 (2%)
 Frame = +1

Query  106  VCVSVGLLA---FAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAI  276
            V VSV + A   + WR L WVWFKPK LE  L++ GL G PY +L GD+K    M ++A 
Sbjct  8    VTVSVAIAAVLWWIWRTLNWVWFKPKMLESYLRRQGLVGTPYTLLVGDVKREYSMTTEAR  67

Query  277  SKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKP  456
            SKP+ L+D++ P V+P+ +H+   YG+  + W GP+P + I +PE +KEVLNK   FQKP
Sbjct  68   SKPIKLTDDIVPLVLPFPSHMLKTYGRTFFTWRGPIPTITITNPEQIKEVLNKIYDFQKP  127

Query  457  RNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
                L R +  GL SY+ ++WAKHRR++NPAF+ EK+K M PAF  SCS
Sbjct  128  NTFALSRLVASGLFSYDGDKWAKHRRIINPAFHLEKIKNMVPAFHQSCS  176



>emb|CDY20078.1| BnaA01g29240D [Brassica napus]
Length=512

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 112/169 (66%), Gaps = 3/169 (2%)
 Frame = +1

Query  106  VCVSVGLLA---FAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAI  276
            V VSV + A   + WR L WVWFKPK LE  L++ GL G PY +L GD+K    M ++A 
Sbjct  8    VTVSVAIAAVLWWIWRTLNWVWFKPKMLESYLRRQGLVGTPYTLLVGDVKREYSMTTEAR  67

Query  277  SKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKP  456
            SKP+ L+D++ P V+P+ +H+   YG+  + W GP+P + I  PE +KEVLNK   FQKP
Sbjct  68   SKPIKLTDDIVPLVLPFPSHMLKTYGRTFFTWRGPIPTITITSPEQIKEVLNKIYDFQKP  127

Query  457  RNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
                L R +  GL SY+ ++WAKHRR++NPAF+ EK+K M PAF  SCS
Sbjct  128  NTFALSRPVASGLFSYDGDKWAKHRRIINPAFHLEKIKNMVPAFHQSCS  176



>gb|ABC59075.1| cytochrome P450 monooxygenase CYP72A67 [Medicago truncatula]
 gb|KEH36885.1| cytochrome P450 family monooxygenase [Medicago truncatula]
Length=520

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 118/174 (68%), Gaps = 2/174 (1%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVK  258
            + + Y ++ + V++GL+ + WRVL W+W KPK LEK L++ G  GN YR++ GD+K+  K
Sbjct  5    LAIYYGIILITVTLGLV-YTWRVLNWIWLKPKRLEKLLREQGCNGNSYRLVLGDLKDSYK  63

Query  259  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  438
            M   A SKPM LSD++ PRVIPY   L   YGKN ++W G  P + + +PEL+K+VLN+ 
Sbjct  64   MGKKAKSKPMELSDDIIPRVIPYIQQLVQIYGKNPFIWSGTTPRLILTEPELIKDVLNRT  123

Query  439  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSC  600
               QKP+   + + L  GL+ +E E+W KHRRL+N AF  EKLK+M P+FL SC
Sbjct  124  SELQKPKYE-IFKFLFSGLIIHEGEKWRKHRRLMNAAFQLEKLKIMAPSFLTSC  176



>ref|NP_188087.1| cytochrome P450, family 72, subfamily A, polypeptide 15 [Arabidopsis 
thaliana]
 sp|Q9LUC5.1|C7A15_ARATH RecName: Full=Cytochrome P450 72A15 [Arabidopsis thaliana]
 dbj|BAB02401.1| cytochrome P450 [Arabidopsis thaliana]
 gb|AAK92762.1| putative cytochrome P450 protein [Arabidopsis thaliana]
 gb|AAM20382.1| putative cytochrome P450 protein [Arabidopsis thaliana]
 gb|AEE75556.1| cytochrome P450, family 72, subfamily A, polypeptide 15 [Arabidopsis 
thaliana]
Length=512

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 116/175 (66%), Gaps = 1/175 (1%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVGLLAF-AWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELV  255
            ME+    + + V + ++++  WR L WVWFKPK LE  L++ GL G PY  L GD+K+  
Sbjct  1    MEISVASVTISVVLAVVSWWIWRTLQWVWFKPKMLEHYLRRQGLAGTPYTPLVGDLKKNF  60

Query  256  KMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNK  435
             M S+A SKP+ L+D+++PRV+PY   +   YG+  + W GP+P + I DPE +KEV NK
Sbjct  61   TMLSEARSKPLKLTDDISPRVVPYPLQMFKTYGRTYFTWFGPIPTITIMDPEQIKEVFNK  120

Query  436  YELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSC  600
               FQKP   PL   + +GL +Y+ ++WAKHRR++NPAF+ EK+K M PAF  SC
Sbjct  121  VYDFQKPHTFPLATIIAKGLANYDGDKWAKHRRIINPAFHIEKIKNMVPAFHQSC  175



>ref|XP_004248734.1| PREDICTED: cytochrome P450 CYP72A219 [Solanum lycopersicum]
Length=516

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 112/161 (70%), Gaps = 1/161 (1%)
 Frame = +1

Query  118  VGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLS  297
            + +L +AWR+L +VW KPK LEK L++ G KG+ Y+ L GDMKE+ KM  +A SKP+  S
Sbjct  17   IFVLRWAWRILNYVWLKPKYLEKQLRKQGFKGHTYKFLFGDMKEMSKMGEEAWSKPVNFS  76

Query  298  -DNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLG  474
             D + PRV P+   +   YGKNC+VW GP P V I DPE++KEV+ K  +FQKP  NPL 
Sbjct  77   HDTIWPRVNPFIHKIITNYGKNCFVWFGPRPAVVIMDPEVIKEVMMKNYVFQKPGGNPLT  136

Query  475  RKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLS  597
            + L  G+  YE ++WA HRRLLNPAF+ +KLK M PAF L+
Sbjct  137  KLLATGIADYEADKWAVHRRLLNPAFHLDKLKHMLPAFKLT  177



>gb|AJD25168.1| cytochrome P450 CYP72A327 [Salvia miltiorrhiza]
Length=518

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 75/155 (48%), Positives = 114/155 (74%), Gaps = 1/155 (1%)
 Frame = +1

Query  142  RVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAPRVI  321
            ++L W + +PK LEK L++ GL GN YR+L GD+++ +K   +A +KP+ L D++  RV+
Sbjct  23   KLLNWAYLRPKRLEKALRKQGLNGNSYRLLIGDLRDFMKATEEAKTKPINLDDDIKTRVV  82

Query  322  PYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPR-NNPLGRKLVRGLV  498
            P++ +   K+GK+ + W GP P + + DP+L KE+L K +LF K R +NPL R LV+G++
Sbjct  83   PFFVNTLSKFGKDSFFWFGPHPTLIVTDPDLAKEILGKSDLFSKARSSNPLSRLLVQGVL  142

Query  499  SYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            S+EKE+WAKHR+++NPAF+ +KLKLM PAF LSC 
Sbjct  143  SHEKEKWAKHRKIINPAFHLDKLKLMIPAFCLSCD  177



>gb|KCW67646.1| hypothetical protein EUGRSUZ_F01394 [Eucalyptus grandis]
Length=510

 Score =   176 bits (445),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 119/172 (69%), Gaps = 0/172 (0%)
 Frame = +1

Query  88   IYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMAS  267
            I ++    V   L  +AWRV+ WVW +PK LE+ L+Q GL G PY  L GD+KE  ++ +
Sbjct  5    IQSIALATVLAVLTTWAWRVVNWVWLRPKRLERLLRQQGLSGKPYTFLFGDLKENSRLLT  64

Query  268  DAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELF  447
            +A SKP+++SD++ PR++P+    +  YGK+ ++W+GP P V I +PE +KE+ +K   +
Sbjct  65   EANSKPISVSDDIKPRLLPFLHQSSQTYGKDSFMWIGPTPRVRITNPEQLKEIFSKINDY  124

Query  448  QKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             +P +NPL + L  GL S+E E+WA+HR+++NPAF+ EKLKLM PAF  SC+
Sbjct  125  PRPGSNPLVKLLADGLASHEGEKWARHRKIINPAFHMEKLKLMLPAFYSSCT  176



>ref|XP_010060783.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
Length=510

 Score =   176 bits (445),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 119/172 (69%), Gaps = 0/172 (0%)
 Frame = +1

Query  88   IYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMAS  267
            I ++    V   L  +AWRV+ WVW +PK LE+ L+Q GL G PY  L GD+KE  ++ +
Sbjct  5    IQSIALATVLAVLTTWAWRVVNWVWLRPKRLERLLRQQGLSGKPYTFLFGDLKENSRLLT  64

Query  268  DAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELF  447
            +A SKP+++SD++ PR++P+    +  YGK+ ++W+GP P V I +PE +KE+ +K   +
Sbjct  65   EANSKPISVSDDIKPRLLPFLHQSSQTYGKDSFMWIGPTPRVRITNPEQLKEIFSKINDY  124

Query  448  QKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
             +P +NPL + L  GL S+E E+WA+HR+++NPAF+ EKLKLM PAF  SC+
Sbjct  125  PRPGSNPLVKLLADGLASHEGEKWARHRKIINPAFHMEKLKLMLPAFYSSCT  176



>ref|XP_008452436.1| PREDICTED: cytochrome P450 CYP72A219-like [Cucumis melo]
Length=529

 Score =   176 bits (445),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 106/158 (67%), Gaps = 2/158 (1%)
 Frame = +1

Query  136  AWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAPR  315
             W+++ W+WF+PK LEK L+Q G  GN YRIL GD+KE   M   AISKPM  S+++APR
Sbjct  27   GWKLVDWIWFRPKKLEKLLRQQGFTGNSYRILYGDLKERAAMRDQAISKPMNFSNHIAPR  86

Query  316  VIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRN--NPLGRKLVR  489
            VIP   H    YGKN ++W+GP+P V I DPE +K V +    +QKP    NPL + L  
Sbjct  87   VIPSVHHTIQHYGKNSFMWIGPIPRVHIMDPEQLKTVFSLINDYQKPTASLNPLAKLLAD  146

Query  490  GLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            GL+++E  +W KHR+++NPAF+ EKLK M PAF  SC 
Sbjct  147  GLLNHEGHKWVKHRKIINPAFHLEKLKDMVPAFYHSCD  184



>ref|XP_006377693.1| hypothetical protein POPTR_0011s10300g [Populus trichocarpa]
 gb|ERP55490.1| hypothetical protein POPTR_0011s10300g [Populus trichocarpa]
Length=518

 Score =   175 bits (444),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 82/173 (47%), Positives = 119/173 (69%), Gaps = 1/173 (1%)
 Frame = +1

Query  85   VIYTLLGVCVSVGLLAFAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMA  264
             + ++L   V V +L +AWR+L WVWF+PK +E+CL+Q G  G PYR+L GD KE   M 
Sbjct  4    TVSSILVSIVYVAVLRWAWRLLNWVWFRPKKVERCLRQQGFAGKPYRLLFGDWKESSDML  63

Query  265  SDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYEL  444
             +A +KP+ LSD + PRV+P+   L   YGKN ++W+GP P V I +P+ +K+V  K   
Sbjct  64   KEARTKPIGLSDALLPRVMPFLHQLVKDYGKNSFMWVGPKPRVNIMNPDQIKDVFMKINE  123

Query  445  FQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            +QKP ++PL + +  GL S+E E+W+ HR+++NPAF+ EK+KLM PAF  SCS
Sbjct  124  YQKP-SHPLLKAIACGLPSHEGEKWSNHRKIINPAFHQEKIKLMIPAFYESCS  175



>ref|XP_006299550.1| hypothetical protein CARUB_v10015724mg [Capsella rubella]
 gb|EOA32448.1| hypothetical protein CARUB_v10015724mg [Capsella rubella]
Length=512

 Score =   175 bits (444),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 115/176 (65%), Gaps = 1/176 (1%)
 Frame = +1

Query  79   MEVIYTLLGVCVSVGLLA-FAWRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELV  255
            ME+    + + ++V L++   WR L WVWFKPK LE  L++ GL G PY    GD+K   
Sbjct  1    MEISVASVTLSLAVVLMSWLVWRTLKWVWFKPKMLESYLRRQGLAGTPYSPFGGDLKRNF  60

Query  256  KMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNK  435
             M ++A SKP+ L+D++ PR++PY   +   +G+  Y W GP+P + I +PE +KEV NK
Sbjct  61   SMLAEARSKPIKLTDDITPRLVPYPLQMLKTHGRTFYTWFGPIPTITIMEPEQIKEVFNK  120

Query  436  YELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
               FQKP   PLG  + +GL +Y+ ++WAKHRR++NPAF+ EK+K M PAF  SCS
Sbjct  121  VYDFQKPHTFPLGTLIAKGLANYDGDKWAKHRRIINPAFHIEKIKNMVPAFYQSCS  176



>ref|XP_004307203.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=543

 Score =   176 bits (445),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 113/170 (66%), Gaps = 4/170 (2%)
 Frame = +1

Query  106  VCVSVGLLAFA----WRVLGWVWFKPKNLEKCLKQLGLKGNPYRILSGDMKELVKMASDA  273
            + +S+ LL+ A    WRVL WVW KPK LEKCL+Q GL GN YR+L GD+KE  ++  +A
Sbjct  32   IALSIVLLSIASSCAWRVLNWVWLKPKKLEKCLRQQGLAGNSYRVLIGDVKESFRVMKEA  91

Query  274  ISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQK  453
             SKPM LSD+ APRV+P+      K+GKN + W G  P V I +P+ + E+L KY+ F++
Sbjct  92   CSKPMNLSDDAAPRVLPFLHQTITKHGKNSFTWFGTTPRVTIMNPDYLNEILTKYDDFRR  151

Query  454  PRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKLKLMQPAFLLSCS  603
            P   P+ + L  GL + E E+W K R+++NPAF+ EKLK M PA   SC+
Sbjct  152  PHTAPVVKLLSYGLANLEGEKWVKQRKIINPAFHIEKLKNMLPAIYQSCT  201



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 802174409370