BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001F07

Length=551
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006365859.1|  PREDICTED: 60S ribosomal protein L6-like           263   2e-85   Solanum tuberosum [potatoes]
ref|XP_004239831.1|  PREDICTED: 60S ribosomal protein L6-like           263   3e-85   Solanum lycopersicum
ref|XP_004250254.1|  PREDICTED: 60S ribosomal protein L6-like           260   3e-84   Solanum lycopersicum
ref|XP_009772155.1|  PREDICTED: 60S ribosomal protein L6-like iso...    252   4e-81   Nicotiana sylvestris
ref|XP_007205607.1|  hypothetical protein PRUPE_ppa009054mg             254   4e-81   
ref|XP_009617384.1|  PREDICTED: 60S ribosomal protein L6-like           252   4e-81   Nicotiana tomentosiformis
ref|XP_009772157.1|  PREDICTED: 60S ribosomal protein L6-like iso...    252   5e-81   Nicotiana sylvestris
gb|KDO83483.1|  hypothetical protein CISIN_1g026785mg                   250   5e-81   Citrus sinensis [apfelsine]
ref|XP_011096185.1|  PREDICTED: 60S ribosomal protein L6-like           252   5e-81   Sesamum indicum [beniseed]
ref|XP_004309444.1|  PREDICTED: 60S ribosomal protein L6-1-like         251   1e-80   Fragaria vesca subsp. vesca
ref|XP_002278032.1|  PREDICTED: 60S ribosomal protein L6-1              250   2e-80   Vitis vinifera
gb|KGN45157.1|  hypothetical protein Csa_7G428940                       250   2e-80   Cucumis sativus [cucumbers]
gb|KDO83482.1|  hypothetical protein CISIN_1g026785mg                   250   2e-80   Citrus sinensis [apfelsine]
ref|XP_008461261.1|  PREDICTED: 60S ribosomal protein L6-1              250   2e-80   Cucumis melo [Oriental melon]
gb|KGN53829.1|  hypothetical protein Csa_4G153800                       252   2e-80   Cucumis sativus [cucumbers]
ref|XP_006482844.1|  PREDICTED: 60S ribosomal protein L6-like           250   3e-80   Citrus sinensis [apfelsine]
ref|XP_002265394.1|  PREDICTED: 60S ribosomal protein L6-3              250   4e-80   Vitis vinifera
ref|XP_006439069.1|  hypothetical protein CICLE_v10032636mg             249   4e-80   Citrus clementina [clementine]
ref|XP_006352371.1|  PREDICTED: 60S ribosomal protein L6-like           249   9e-80   Solanum tuberosum [potatoes]
ref|XP_004154716.1|  PREDICTED: 60S ribosomal protein L6-like           248   1e-79   
ref|XP_010557777.1|  PREDICTED: 60S ribosomal protein L6-1-like         248   1e-79   Tarenaya hassleriana [spider flower]
emb|CAN75087.1|  hypothetical protein VITISV_010816                     248   2e-79   Vitis vinifera
ref|XP_008227773.1|  PREDICTED: 60S ribosomal protein L6-like           248   2e-79   Prunus mume [ume]
gb|AAM65875.1|  60S ribosomal protein L6, putative                      247   4e-79   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009616341.1|  PREDICTED: 60S ribosomal protein L6-like           247   4e-79   Nicotiana tomentosiformis
emb|CDX81879.1|  BnaC08g37220D                                          247   5e-79   
ref|XP_004504017.1|  PREDICTED: 60S ribosomal protein L6-3-like i...    247   5e-79   Cicer arietinum [garbanzo]
gb|AFK48484.1|  unknown                                                 244   5e-79   Medicago truncatula
emb|CDX96716.1|  BnaA08g22590D                                          247   5e-79   
ref|XP_011468806.1|  PREDICTED: 60S ribosomal protein L6-like           246   6e-79   Fragaria vesca subsp. vesca
gb|ACJ84110.1|  unknown                                                 246   8e-79   Medicago truncatula
gb|AFK47926.1|  unknown                                                 246   1e-78   Medicago truncatula
ref|XP_010248308.1|  PREDICTED: 60S ribosomal protein L6                246   1e-78   Nelumbo nucifera [Indian lotus]
ref|XP_007149074.1|  hypothetical protein PHAVU_005G038900g             246   1e-78   Phaseolus vulgaris [French bean]
gb|KDP21512.1|  hypothetical protein JCGZ_21983                         246   1e-78   Jatropha curcas
ref|NP_173289.1|  60S ribosomal protein L6-1                            246   1e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004150161.1|  PREDICTED: 60S ribosomal protein L6-like           246   1e-78   
ref|XP_009369866.1|  PREDICTED: 60S ribosomal protein L6-like           246   1e-78   Pyrus x bretschneideri [bai li]
ref|XP_009775140.1|  PREDICTED: 60S ribosomal protein L6-like           245   2e-78   Nicotiana sylvestris
emb|CDY21701.1|  BnaA09g44520D                                          245   2e-78   Brassica napus [oilseed rape]
ref|XP_003602457.1|  60S ribosomal protein L6                           245   2e-78   Medicago truncatula
ref|XP_008461779.1|  PREDICTED: 60S ribosomal protein L6-1-like         245   2e-78   Cucumis melo [Oriental melon]
ref|XP_009117610.1|  PREDICTED: 60S ribosomal protein L6-1              245   2e-78   Brassica rapa
gb|EYU22781.1|  hypothetical protein MIMGU_mgv1a013134mg                245   2e-78   Erythranthe guttata [common monkey flower]
ref|XP_009352593.1|  PREDICTED: 60S ribosomal protein L6-like iso...    245   3e-78   Pyrus x bretschneideri [bai li]
ref|XP_008337622.1|  PREDICTED: 60S ribosomal protein L6-like           245   3e-78   Malus domestica [apple tree]
ref|XP_009110340.1|  PREDICTED: 60S ribosomal protein L6-1-like         245   3e-78   Brassica rapa
emb|CDX83840.1|  BnaC08g18050D                                          245   3e-78   
ref|XP_009352594.1|  PREDICTED: 60S ribosomal protein L6-like iso...    244   3e-78   Pyrus x bretschneideri [bai li]
ref|XP_007202511.1|  hypothetical protein PRUPE_ppa010838mg             244   3e-78   Prunus persica
sp|P34091.1|RL6_MESCR  RecName: Full=60S ribosomal protein L6; Al...    244   4e-78   Mesembryanthemum crystallinum
ref|XP_004149609.1|  PREDICTED: 60S ribosomal protein L6-like           244   4e-78   Cucumis sativus [cucumbers]
ref|XP_003602484.1|  60S ribosomal protein L6                           244   5e-78   Medicago truncatula
gb|ACU23780.1|  unknown                                                 244   5e-78   Glycine max [soybeans]
gb|KJB46350.1|  hypothetical protein B456_007G361900                    244   5e-78   Gossypium raimondii
ref|XP_008460790.1|  PREDICTED: 60S ribosomal protein L6-1-like         244   5e-78   Cucumis melo [Oriental melon]
emb|CDY19222.1|  BnaC05g14230D                                          244   6e-78   Brassica napus [oilseed rape]
ref|XP_006416595.1|  hypothetical protein EUTSA_v10008650mg             244   7e-78   Eutrema salsugineum [saltwater cress]
ref|XP_004504016.1|  PREDICTED: 60S ribosomal protein L6-3-like i...    244   8e-78   
gb|KJB16394.1|  hypothetical protein B456_002G228400                    242   8e-78   Gossypium raimondii
gb|KHN29114.1|  60S ribosomal protein L6                                244   1e-77   Glycine soja [wild soybean]
gb|KJB16393.1|  hypothetical protein B456_002G228400                    242   1e-77   Gossypium raimondii
ref|XP_008240963.1|  PREDICTED: 60S ribosomal protein L6-3-like         243   1e-77   Prunus mume [ume]
ref|XP_007159761.1|  hypothetical protein PHAVU_002G265000g             243   1e-77   Phaseolus vulgaris [French bean]
emb|CDY26150.1|  BnaA06g12670D                                          243   1e-77   Brassica napus [oilseed rape]
emb|CDX96510.1|  BnaA07g31210D                                          243   1e-77   
ref|XP_002524802.1|  60S ribosomal protein L6, putative                 243   1e-77   Ricinus communis
ref|XP_006294925.1|  hypothetical protein CARUB_v10023978mg             242   2e-77   
gb|KJB16391.1|  hypothetical protein B456_002G228400                    243   2e-77   Gossypium raimondii
ref|XP_008367370.1|  PREDICTED: 60S ribosomal protein L6-like           243   2e-77   
ref|XP_009106063.1|  PREDICTED: 60S ribosomal protein L6-2              243   2e-77   Brassica rapa
ref|XP_006294924.1|  hypothetical protein CARUB_v10023978mg             243   2e-77   Capsella rubella
ref|XP_003531382.1|  PREDICTED: 60S ribosomal protein L6-1-like         243   2e-77   Glycine max [soybeans]
ref|XP_007218306.1|  hypothetical protein PRUPE_ppa010851mg             243   2e-77   Prunus persica
ref|XP_007221500.1|  hypothetical protein PRUPE_ppa010844mg             243   3e-77   Prunus persica
ref|XP_009365032.1|  PREDICTED: 60S ribosomal protein L6-1-like         243   3e-77   Pyrus x bretschneideri [bai li]
ref|XP_006303330.1|  hypothetical protein CARUB_v10010178mg             241   3e-77   
ref|XP_009354690.1|  PREDICTED: 60S ribosomal protein L6-1-like         242   3e-77   Pyrus x bretschneideri [bai li]
ref|XP_008387243.1|  PREDICTED: 60S ribosomal protein L6-like           242   3e-77   
ref|XP_010067894.1|  PREDICTED: 60S ribosomal protein L6                242   3e-77   Eucalyptus grandis [rose gum]
ref|XP_011074965.1|  PREDICTED: 60S ribosomal protein L6-like           242   3e-77   Sesamum indicum [beniseed]
ref|XP_010416238.1|  PREDICTED: 60S ribosomal protein L6-3              242   4e-77   Camelina sativa [gold-of-pleasure]
ref|XP_009128023.1|  PREDICTED: 60S ribosomal protein L6-3-like         242   4e-77   Brassica rapa
ref|XP_006303329.1|  hypothetical protein CARUB_v10010178mg             242   4e-77   Capsella rubella
ref|XP_002513192.1|  60S ribosomal protein L6, putative                 242   4e-77   Ricinus communis
gb|AFK35906.1|  unknown                                                 242   4e-77   Lotus japonicus
gb|KJB15039.1|  hypothetical protein B456_002G156900                    242   5e-77   Gossypium raimondii
gb|ABX71676.1|  60S ribosomal protein L6-like protein                   242   5e-77   Panax quinquefolius
ref|NP_001235724.1|  uncharacterized protein LOC100500022               241   6e-77   Glycine max [soybeans]
gb|KDP43428.1|  hypothetical protein JCGZ_16715                         241   6e-77   Jatropha curcas
ref|XP_010257392.1|  PREDICTED: 60S ribosomal protein L6-like           241   6e-77   Nelumbo nucifera [Indian lotus]
ref|XP_010471497.1|  PREDICTED: 60S ribosomal protein L6-3-like         241   6e-77   Camelina sativa [gold-of-pleasure]
ref|XP_010416240.1|  PREDICTED: 60S ribosomal protein L6-3-like         241   6e-77   Camelina sativa [gold-of-pleasure]
ref|XP_002299962.1|  60S ribosomal protein L6                           241   7e-77   Populus trichocarpa [western balsam poplar]
ref|XP_002893003.1|  60S ribosomal protein L6                           241   7e-77   Arabidopsis lyrata subsp. lyrata
ref|XP_009356996.1|  PREDICTED: 60S ribosomal protein L6-like           241   8e-77   Pyrus x bretschneideri [bai li]
ref|XP_008350104.1|  PREDICTED: 60S ribosomal protein L6-1-like         241   8e-77   
ref|XP_009149298.1|  PREDICTED: 60S ribosomal protein L6-1              241   9e-77   Brassica rapa
ref|XP_011100659.1|  PREDICTED: 60S ribosomal protein L6-like           240   1e-76   Sesamum indicum [beniseed]
emb|CDY66361.1|  BnaAnng22110D                                          241   1e-76   Brassica napus [oilseed rape]
ref|XP_008231333.1|  PREDICTED: 60S ribosomal protein L6-3-like         241   1e-76   Prunus mume [ume]
ref|XP_003618018.1|  60S ribosomal protein L6                           241   1e-76   
gb|KHG19752.1|  60S ribosomal L6                                        241   1e-76   Gossypium arboreum [tree cotton]
ref|XP_010032395.1|  PREDICTED: 60S ribosomal protein L6-like           240   2e-76   Eucalyptus grandis [rose gum]
gb|KHG02479.1|  60S ribosomal protein L6-3                              240   2e-76   Gossypium arboreum [tree cotton]
gb|KHG02478.1|  60S ribosomal protein L6-3                              240   2e-76   Gossypium arboreum [tree cotton]
ref|XP_002313280.1|  60S ribosomal protein L6                           240   3e-76   Populus trichocarpa [western balsam poplar]
ref|XP_006390473.1|  hypothetical protein EUTSA_v10019079mg             239   3e-76   Eutrema salsugineum [saltwater cress]
ref|XP_010547238.1|  PREDICTED: 60S ribosomal protein L6-3-like         239   4e-76   Tarenaya hassleriana [spider flower]
ref|XP_006390471.1|  hypothetical protein EUTSA_v10019083mg             239   6e-76   Eutrema salsugineum [saltwater cress]
gb|KHN29113.1|  60S ribosomal protein L6                                239   7e-76   Glycine soja [wild soybean]
ref|XP_010471499.1|  PREDICTED: 60S ribosomal protein L6-3-like         239   8e-76   Camelina sativa [gold-of-pleasure]
gb|KHN49031.1|  60S ribosomal protein L6                                238   9e-76   Glycine soja [wild soybean]
ref|XP_008387244.1|  PREDICTED: 60S ribosomal protein L6-like           238   9e-76   
ref|XP_003546871.1|  PREDICTED: 60S ribosomal protein L6-like           238   1e-75   Glycine max [soybeans]
ref|XP_010477034.1|  PREDICTED: 60S ribosomal protein L6-1-like         238   2e-75   Camelina sativa [gold-of-pleasure]
ref|XP_011025023.1|  PREDICTED: 60S ribosomal protein L6-like           238   2e-75   Populus euphratica
ref|XP_010498252.1|  PREDICTED: 60S ribosomal protein L6-1              238   2e-75   Camelina sativa [gold-of-pleasure]
ref|XP_007028937.1|  60S ribosomal protein L6-1                         238   2e-75   Theobroma cacao [chocolate]
ref|XP_010428369.1|  PREDICTED: 60S ribosomal protein L6-3-like         238   2e-75   Camelina sativa [gold-of-pleasure]
emb|CDP10719.1|  unnamed protein product                                237   3e-75   Coffea canephora [robusta coffee]
gb|KHG17855.1|  60S ribosomal L6                                        237   3e-75   Gossypium arboreum [tree cotton]
gb|KJB76631.1|  hypothetical protein B456_012G100600                    235   4e-75   Gossypium raimondii
gb|KFK44022.1|  hypothetical protein AALP_AA1G205000                    237   4e-75   Arabis alpina [alpine rockcress]
ref|XP_010428373.1|  PREDICTED: 60S ribosomal protein L6-2-like         237   4e-75   Camelina sativa [gold-of-pleasure]
gb|KJB76628.1|  hypothetical protein B456_012G100600                    236   7e-75   Gossypium raimondii
ref|XP_007153319.1|  hypothetical protein PHAVU_003G025200g             236   7e-75   Phaseolus vulgaris [French bean]
ref|XP_010089731.1|  60S ribosomal protein L6                           240   8e-75   
ref|XP_010672706.1|  PREDICTED: 60S ribosomal protein L6-like           236   9e-75   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX73042.1|  BnaC06g34900D                                          236   9e-75   
ref|XP_002888961.1|  60S ribosomal protein L6                           236   9e-75   Arabidopsis lyrata subsp. lyrata
ref|XP_010498250.1|  PREDICTED: 60S ribosomal protein L6-1-like         236   1e-74   Camelina sativa [gold-of-pleasure]
ref|XP_010682142.1|  PREDICTED: 60S ribosomal protein L6-like           236   1e-74   
gb|KFK41843.1|  hypothetical protein AALP_AA2G178500                    236   1e-74   Arabis alpina [alpine rockcress]
ref|XP_003531428.1|  PREDICTED: 60S ribosomal protein L6-like           236   1e-74   Glycine max [soybeans]
ref|XP_011007361.1|  PREDICTED: 60S ribosomal protein L6-like           236   1e-74   Populus euphratica
ref|XP_006300334.1|  hypothetical protein CARUB_v10021263mg             236   1e-74   Capsella rubella
ref|XP_004236669.1|  PREDICTED: 60S ribosomal protein L6-like           235   2e-74   Solanum lycopersicum
ref|XP_006346775.1|  PREDICTED: 60S ribosomal protein L6-like           235   2e-74   Solanum tuberosum [potatoes]
gb|EYU28217.1|  hypothetical protein MIMGU_mgv1a013083mg                235   2e-74   Erythranthe guttata [common monkey flower]
emb|CDY45859.1|  BnaC02g22610D                                          235   2e-74   Brassica napus [oilseed rape]
ref|XP_010111399.1|  60S ribosomal protein L6                           235   3e-74   Morus notabilis
gb|KFK41845.1|  hypothetical protein AALP_AA2G178700                    234   3e-74   Arabis alpina [alpine rockcress]
ref|XP_010459474.1|  PREDICTED: 60S ribosomal protein L6-1-like         234   5e-74   Camelina sativa [gold-of-pleasure]
gb|KHN38225.1|  60S ribosomal protein L6                                234   6e-74   Glycine soja [wild soybean]
ref|NP_177545.1|  60S ribosomal protein L6-3                            233   1e-73   Arabidopsis thaliana [mouse-ear cress]
gb|KHN38226.1|  60S ribosomal protein L6                                233   1e-73   Glycine soja [wild soybean]
ref|XP_008379219.1|  PREDICTED: 60S ribosomal protein L6-3-like         233   2e-73   Malus domestica [apple tree]
ref|NP_001242380.1|  uncharacterized protein LOC100809343               231   3e-73   
ref|NP_001266146.1|  60S ribosomal protein L6-2-like                    232   3e-73   Cicer arietinum [garbanzo]
ref|NP_001235723.1|  uncharacterized protein LOC100499766               232   4e-73   Glycine max [soybeans]
ref|NP_177546.1|  60S ribosomal protein L6-2                            231   5e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008795742.1|  PREDICTED: 60S ribosomal protein L6-like           231   9e-73   Phoenix dactylifera
ref|XP_009418480.1|  PREDICTED: 60S ribosomal protein L6-like           231   1e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006579446.1|  PREDICTED: uncharacterized protein LOC100809...    231   1e-72   
ref|XP_007028938.1|  Ribosomal protein L6 family protein, putative      234   1e-72   
ref|XP_008800660.1|  PREDICTED: 60S ribosomal protein L6-like           230   2e-72   Phoenix dactylifera
ref|XP_008787289.1|  PREDICTED: 60S ribosomal protein L6-like           230   2e-72   Phoenix dactylifera
ref|XP_008782889.1|  PREDICTED: 60S ribosomal protein L6-like           229   2e-72   
ref|XP_002888962.1|  60S ribosomal protein L6                           230   3e-72   
gb|ABK26046.1|  unknown                                                 229   6e-72   Picea sitchensis
gb|ABK21588.1|  unknown                                                 229   6e-72   Picea sitchensis
gb|ABK26162.1|  unknown                                                 229   6e-72   Picea sitchensis
gb|KDO37112.1|  hypothetical protein CISIN_1g026764mg                   228   2e-71   Citrus sinensis [apfelsine]
ref|XP_006485022.1|  PREDICTED: 60S ribosomal protein L6-like           228   2e-71   Citrus sinensis [apfelsine]
ref|XP_003630109.1|  60S ribosomal protein L6                           226   3e-71   
dbj|BAH57003.1|  AT1G18540                                              224   4e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010928455.1|  PREDICTED: 60S ribosomal protein L6-like           227   4e-71   Elaeis guineensis
gb|ABK22151.1|  unknown                                                 226   5e-71   Picea sitchensis
ref|XP_006437047.1|  hypothetical protein CICLE_v10032633mg             226   7e-71   Citrus clementina [clementine]
emb|CBI24846.3|  unnamed protein product                                224   2e-70   Vitis vinifera
ref|XP_009394521.1|  PREDICTED: hydroxysteroid dehydrogenase-like...    233   4e-70   
ref|XP_008387473.1|  PREDICTED: 60S ribosomal protein L6-like           221   1e-69   
gb|EPS67805.1|  hypothetical protein M569_06970                         223   2e-69   Genlisea aurea
ref|XP_008349669.1|  PREDICTED: 60S ribosomal protein L6-3-like         222   2e-69   
ref|XP_009395533.1|  PREDICTED: 60S ribosomal protein L6-3-like         222   3e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010913926.1|  PREDICTED: 60S ribosomal protein L6-like           221   4e-69   Elaeis guineensis
ref|XP_009354339.1|  PREDICTED: 60S ribosomal protein L6-3-like         221   5e-69   Pyrus x bretschneideri [bai li]
emb|CBI30046.3|  unnamed protein product                                216   2e-67   Vitis vinifera
ref|XP_006850083.1|  hypothetical protein AMTR_s00022p00218700          217   2e-67   Amborella trichopoda
gb|KHN01929.1|  60S ribosomal protein L6                                214   1e-66   Glycine soja [wild soybean]
gb|ABK93247.1|  unknown                                                 211   4e-65   Populus trichocarpa [western balsam poplar]
emb|CDY11078.1|  BnaC06g23300D                                          210   4e-65   Brassica napus [oilseed rape]
ref|XP_001763096.1|  predicted protein                                  209   2e-64   
emb|CDP11071.1|  unnamed protein product                                209   2e-64   Coffea canephora [robusta coffee]
ref|XP_007029005.1|  Ribosomal protein L6 family protein                209   3e-64   
ref|XP_005647799.1|  ribosomal protein L6 component of cytosolic ...    207   2e-63   Coccomyxa subellipsoidea C-169
ref|XP_008356794.1|  PREDICTED: 60S ribosomal protein L6-3-like         207   3e-63   
ref|XP_001757885.1|  predicted protein                                  207   3e-63   
ref|XP_001770541.1|  predicted protein                                  206   4e-63   
ref|XP_001770480.1|  predicted protein                                  206   4e-63   
ref|XP_008363311.1|  PREDICTED: 60S ribosomal protein L6-3-like         202   2e-61   
gb|AFW62784.1|  hypothetical protein ZEAMMB73_027825                    196   6e-60   
ref|XP_004135912.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    197   8e-60   
gb|AFW62778.1|  hypothetical protein ZEAMMB73_276988                    196   8e-60   
ref|NP_001288419.1|  60S ribosomal protein L6-3-like                    196   1e-59   Zea mays [maize]
ref|NP_001130513.1|  uncharacterized protein LOC100191612               196   2e-59   Zea mays [maize]
ref|XP_004975938.1|  PREDICTED: 60S ribosomal protein L6-3-like         196   4e-59   Setaria italica
dbj|BAJ92124.1|  predicted protein                                      195   7e-59   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002448023.1|  hypothetical protein SORBIDRAFT_06g019800          194   1e-58   Sorghum bicolor [broomcorn]
gb|EMT00299.1|  60S ribosomal protein L6                                192   8e-58   
emb|CAH67436.1|  H0305E08.7                                             192   8e-58   Oryza sativa [red rice]
ref|NP_001053065.2|  Os04g0473400                                       192   8e-58   
ref|XP_002955353.1|  component of cytosolic 80S ribosome and 60S ...    192   2e-57   Volvox carteri f. nagariensis
gb|EMS51678.1|  60S ribosomal protein L6                                191   3e-57   Triticum urartu
pdb|3J61|E  Chain E, Localization Of The Large Subunit Ribosomal ...    190   6e-57   Triticum aestivum [Canadian hard winter wheat]
gb|EMT33645.1|  60S ribosomal protein L6                                189   6e-57   
ref|XP_002454094.1|  hypothetical protein SORBIDRAFT_04g024500          189   8e-57   Sorghum bicolor [broomcorn]
ref|XP_009605973.1|  PREDICTED: uncharacterized protein LOC104100450    192   9e-57   
ref|XP_005849340.1|  hypothetical protein CHLNCDRAFT_21468              189   1e-56   Chlorella variabilis
gb|ACN34500.1|  unknown                                                 189   1e-56   Zea mays [maize]
ref|XP_003571841.1|  PREDICTED: 60S ribosomal protein L6-like           189   2e-56   Brachypodium distachyon [annual false brome]
dbj|BAJ88608.1|  predicted protein                                      187   5e-56   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003575257.1|  PREDICTED: 60S ribosomal protein L6-3-like         187   6e-56   Brachypodium distachyon [annual false brome]
ref|XP_008645881.1|  PREDICTED: 60S ribosomal protein L6-like           189   6e-56   
ref|XP_011399116.1|  60S ribosomal protein L6                           187   9e-56   Auxenochlorella protothecoides
ref|XP_006652403.1|  PREDICTED: 60S ribosomal protein L6-3-like         186   3e-55   Oryza brachyantha
ref|NP_001047288.1|  Os02g0591700                                       185   5e-55   
ref|XP_006647437.1|  PREDICTED: 60S ribosomal protein L6-3-like         181   2e-53   Oryza brachyantha
ref|XP_010943581.1|  PREDICTED: 60S ribosomal protein L6-like           180   2e-53   Elaeis guineensis
ref|XP_008344225.1|  PREDICTED: 60S ribosomal protein L6-like           172   3e-51   
ref|XP_001689873.1|  ribosomal protein L6, component of cytosolic...    175   4e-51   Chlamydomonas reinhardtii
gb|KIZ07133.1|  60S ribosomal protein L6                                175   4e-51   Monoraphidium neglectum
gb|ACU44936.1|  60s ribosomal protein l6                                171   3e-49   Pfiesteria piscicida
gb|KJB16392.1|  hypothetical protein B456_002G228400                    165   3e-48   Gossypium raimondii
gb|KIZ06435.1|  60S ribosomal protein L6                                166   3e-48   Monoraphidium neglectum
gb|KII95092.1|  hypothetical protein PLICRDRAFT_693360                  168   4e-48   Plicaturopsis crispa FD-325 SS-3
gb|KIY49295.1|  hypothetical protein FISHEDRAFT_41710                   167   5e-48   Fistulina hepatica ATCC 64428
gb|EEE61175.1|  hypothetical protein OsJ_15159                          167   6e-48   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007315588.1|  hypothetical protein SERLADRAFT_461013             167   1e-47   Serpula lacrymans var. lacrymans S7.9
ref|XP_002470112.1|  60S ribosomal protein L6                           166   1e-47   
gb|KJB76633.1|  hypothetical protein B456_012G100600                    162   2e-47   Gossypium raimondii
gb|EIE89517.1|  hypothetical protein RO3G_14228                         164   8e-47   Rhizopus delemar RA 99-880
gb|EIE84065.1|  hypothetical protein RO3G_08770                         164   8e-47   Rhizopus delemar RA 99-880
ref|XP_001837246.1|  60S ribosomal protein L6                           164   2e-46   Coprinopsis cinerea okayama7#130
emb|CEI86592.1|  Putative 60S ribosomal protein L6                      163   2e-46   Rhizopus microsporus
gb|EMD40773.1|  hypothetical protein CERSUDRAFT_111358                  163   3e-46   Gelatoporia subvermispora B
ref|XP_007366018.1|  60S ribosomal protein L6                           162   7e-46   Dichomitus squalens LYAD-421 SS1
gb|EPT03739.1|  hypothetical protein FOMPIDRAFT_1022302                 162   9e-46   Fomitopsis pinicola FP-58527 SS1
gb|EPZ32906.1|  Ribosomal protein L2 2 domain-containing protein        161   1e-45   Rozella allomycis CSF55
emb|CDO71273.1|  hypothetical protein BN946_scf184908.g30               161   1e-45   Trametes cinnabarina
emb|CEG65908.1|  Putative 60S ribosomal protein L6                      161   1e-45   Rhizopus microsporus
emb|CDS08209.1|  hypothetical protein LRAMOSA02157                      161   2e-45   Lichtheimia ramosa
emb|CDS03075.1|  hypothetical protein LRAMOSA00477                      160   2e-45   Lichtheimia ramosa
emb|CDS03973.1|  hypothetical protein LRAMOSA06928                      160   2e-45   Lichtheimia ramosa
ref|XP_007844668.1|  60s ribosomal protein l6                           160   3e-45   
gb|KDR83654.1|  hypothetical protein GALMADRAFT_235972                  160   4e-45   Galerina marginata CBS 339.88
emb|CDH51903.1|  60s ribosomal protein l6                               160   4e-45   Lichtheimia corymbifera JMRC:FSU:9682
emb|CDH51902.1|  60s ribosomal protein l6                               160   4e-45   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_003037903.1|  60S ribosomal protein L6                           160   4e-45   Schizophyllum commune H4-8
ref|XP_001876718.1|  60S ribosomal protein L6                           160   5e-45   Laccaria bicolor S238N-H82
emb|CDH49411.1|  60s ribosomal protein l6                               160   9e-45   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_007381947.1|  hypothetical protein PUNSTDRAFT_51072              159   1e-44   Punctularia strigosozonata HHB-11173 SS5
gb|AFW62786.1|  hypothetical protein ZEAMMB73_027825                    155   1e-44   
ref|XP_007268402.1|  hypothetical protein FOMMEDRAFT_88995              158   2e-44   Fomitiporia mediterranea MF3/22
gb|KIM46098.1|  hypothetical protein M413DRAFT_441159                   158   2e-44   Hebeloma cylindrosporum h7
ref|XP_004340229.1|  ribosomal protein L6e, putative                    157   4e-44   Acanthamoeba castellanii str. Neff
gb|KJA30189.1|  hypothetical protein HYPSUDRAFT_61030                   157   6e-44   Hypholoma sublateritium FD-334 SS-4
ref|XP_001742739.1|  hypothetical protein                               157   7e-44   Monosiga brevicollis MX1
ref|XP_005825650.1|  large subunit ribosomal protein L6e, cytopla...    157   9e-44   Guillardia theta CCMP2712
gb|KIJ99380.1|  hypothetical protein K443DRAFT_174254                   156   1e-43   Laccaria amethystina LaAM-08-1
gb|KIJ20255.1|  hypothetical protein PAXINDRAFT_166362                  156   2e-43   Paxillus involutus ATCC 200175
gb|KIO12711.1|  hypothetical protein M404DRAFT_12868                    155   2e-43   Pisolithus tinctorius Marx 270
gb|KIP10729.1|  hypothetical protein PHLGIDRAFT_84728                   155   2e-43   Phlebiopsis gigantea 11061_1 CR5-6
emb|CCM03167.1|  predicted protein                                      161   2e-43   Fibroporia radiculosa
gb|EIE76789.1|  hypothetical protein RO3G_01493                         155   3e-43   Rhizopus delemar RA 99-880
gb|KIL00626.1|  hypothetical protein PAXRUDRAFT_821524                  155   3e-43   Paxillus rubicundulus Ve08.2h10
gb|KIK42511.1|  hypothetical protein CY34DRAFT_804839                   154   6e-43   Suillus luteus UH-Slu-Lm8-n1
ref|XP_007337822.1|  60S ribosomal protein L6                           154   7e-43   
ref|XP_006957849.1|  structural constituent of ribosome                 154   8e-43   Wallemia mellicola CBS 633.66
ref|XP_009266907.1|  60S ribosomal protein L6                           154   1e-42   Wallemia ichthyophaga EXF-994
ref|XP_007862440.1|  60S ribosomal protein L6                           152   1e-42   Gloeophyllum trabeum ATCC 11539
gb|EIE86660.1|  hypothetical protein RO3G_11371                         153   1e-42   Rhizopus delemar RA 99-880
ref|XP_007767895.1|  hypothetical protein CONPUDRAFT_122661             153   1e-42   Coniophora puteana RWD-64-598 SS2
gb|KIK68030.1|  hypothetical protein GYMLUDRAFT_81508                   153   1e-42   Gymnopus luxurians FD-317 M1
gb|KIM68802.1|  hypothetical protein SCLCIDRAFT_895738                  153   2e-42   Scleroderma citrinum Foug A
gb|KIM90895.1|  hypothetical protein PILCRDRAFT_811391                  152   2e-42   Piloderma croceum F 1598
gb|EXX57552.1|  ribosomal 60S subunit protein L6B                       153   2e-42   Rhizophagus irregularis DAOM 197198w
gb|ESA16450.1|  hypothetical protein GLOINDRAFT_335092                  153   3e-42   
ref|XP_571207.1|  structural constituent of ribosome                    152   3e-42   
ref|XP_001730309.1|  hypothetical protein MGL_2691                      152   3e-42   
ref|XP_010668568.1|  PREDICTED: 60S ribosomal protein L6-3-like         152   3e-42   
gb|AFR95584.1|  large subunit ribosomal protein L6e                     152   3e-42   
ref|XP_008035754.1|  hypothetical protein TRAVEDRAFT_144284             152   4e-42   
ref|XP_004173910.1|  PREDICTED: 60S ribosomal protein L6-like           149   5e-42   
gb|KDD75821.1|  ribosomal protein L6e                                   152   6e-42   
ref|XP_007329369.1|  hypothetical protein AGABI1DRAFT_113337            152   6e-42   
ref|XP_001633436.1|  predicted protein                                  151   9e-42   
ref|XP_004365977.1|  60S ribosomal protein L6                           152   9e-42   
emb|CEP07649.1|  hypothetical protein                                   151   1e-41   
gb|AGH70152.1|  60S ribosomal protein L6                                150   1e-41   
ref|XP_002109744.1|  expressed hypothetical protein                     151   1e-41   
gb|KDN51294.1|  hypothetical protein K437DRAFT_221668                   150   2e-41   
gb|KIJ70054.1|  hypothetical protein HYDPIDRAFT_142970                  150   2e-41   
gb|EPB89856.1|  50S ribosomal protein L6e                               150   3e-41   
emb|CDH52399.1|  60s ribosomal protein l6                               160   3e-41   
emb|CDH52398.1|  60s ribosomal protein l6                               159   3e-41   
gb|EKD03848.1|  structural constituent of ribosome                      150   3e-41   
gb|KIY74033.1|  60S ribosomal protein L6                                150   3e-41   
ref|XP_006460265.1|  hypothetical protein AGABI2DRAFT_192018            150   3e-41   
ref|XP_008232296.1|  PREDICTED: 60S ribosomal protein L6-like           148   5e-41   
gb|KGB79537.1|  60S ribosomal protein L6                                149   7e-41   
gb|KIR58975.1|  50S small subunit ribosomal protein L6e                 149   7e-41   
emb|CCU97454.1|  unnamed protein product                                149   9e-41   
gb|KIR45996.1|  50S small subunit ribosomal protein L6e                 149   1e-40   
gb|KDE02274.1|  large subunit ribosomal protein L6e                     148   1e-40   
gb|KFH70232.1|  large subunit ribosomal protein L6e                     148   2e-40   
emb|CCF51737.1|  probable 60S large subunit ribosomal protein L6        147   2e-40   
dbj|GAC72396.1|  60s ribosomal protein L6                               147   3e-40   
emb|CAB57309.1|  60S ribosomal protein L6 (YL 16 like)                  147   3e-40   
ref|XP_007882084.1|  hypothetical protein PFL1_06352                    150   3e-40   
ref|XP_002164071.1|  PREDICTED: 60S ribosomal protein L6-like           147   4e-40   
emb|CEP12571.1|  hypothetical protein                                   147   4e-40   
emb|CEJ01749.1|  Putative 60S ribosomal protein L6                      145   5e-40   
gb|KIR51715.1|  50S small subunit ribosomal protein L6e                 147   5e-40   
ref|XP_003194327.1|  structural constituent of ribosome                 147   6e-40   
gb|EJU05997.1|  60S ribosomal protein L6                                145   8e-40   
emb|CDI56387.1|  probable 60S large subunit ribosomal protein L6        146   8e-40   
gb|KIR84865.1|  50S small subunit ribosomal protein L6e                 146   8e-40   
ref|XP_007391777.1|  hypothetical protein PHACADRAFT_249494             144   1e-39   
gb|KIJ56606.1|  hypothetical protein M422DRAFT_218112                   146   1e-39   
gb|EPB89554.1|  50S ribosomal protein L6e                               145   1e-39   
gb|KDQ64573.1|  hypothetical protein JAAARDRAFT_117694                  145   1e-39   
emb|CBQ71005.1|  probable 60S large subunit ribosomal protein L6        145   1e-39   
emb|CEG68637.1|  Putative 60S ribosomal protein L6                      144   2e-39   
emb|CEI97588.1|  Putative 60S ribosomal protein L6                      144   2e-39   
gb|EST05804.1|  60s ribosomal protein L6                                145   2e-39   
dbj|GAC98788.1|  hypothetical protein PHSY_006383                       145   2e-39   
dbj|GAN11690.1|  60S ribosomal protein L6                               145   3e-39   
ref|XP_011388607.1|  ribosomal 60S subunit protein L6                   145   3e-39   
gb|KFH69464.1|  large subunit ribosomal protein L6e                     144   5e-39   
gb|EUC67500.1|  60S ribosomal protein L6                                144   5e-39   
ref|XP_007005726.1|  hypothetical protein TREMEDRAFT_57243              144   8e-39   
emb|CCA70597.1|  probable 60S large subunit ribosomal protein L6        144   1e-38   
gb|ELU37728.1|  60S ribosomal protein L6                                144   1e-38   
gb|KDN48054.1|  hypothetical protein RSAG8_03070                        143   1e-38   
ref|XP_007415387.1|  hypothetical protein MELLADRAFT_53640              142   1e-38   
ref|XP_008907464.1|  hypothetical protein PPTG_13499                    143   1e-38   
gb|KIL68059.1|  hypothetical protein M378DRAFT_72409                    143   2e-38   
ref|XP_009543617.1|  hypothetical protein HETIRDRAFT_314720             143   2e-38   
gb|EJT46902.1|  structural constituent of ribosome                      142   2e-38   
gb|ETK83775.1|  hypothetical protein L915_11124                         142   2e-38   
emb|CEL59326.1|  60S ribosomal protein L6 OS=Mesembryanthemum cry...    143   2e-38   
gb|ETM37694.1|  hypothetical protein L914_15819                         142   2e-38   
gb|AFK36891.1|  unknown                                                 142   3e-38   
gb|KEP55737.1|  60S ribosomal protein L6                                142   3e-38   
ref|XP_009515778.1|  hypothetical protein PHYSODRAFT_260330             142   3e-38   
ref|XP_008911615.1|  hypothetical protein PPTG_16072                    142   3e-38   
gb|ETM37695.1|  hypothetical protein, variant                           141   4e-38   
ref|XP_008911616.1|  hypothetical protein, variant                      141   4e-38   
gb|ETI37583.1|  hypothetical protein, variant                           141   4e-38   
gb|ETP07448.1|  hypothetical protein, variant                           141   4e-38   
ref|XP_007302379.1|  hypothetical protein STEHIDRAFT_55205              142   4e-38   
gb|ETI43691.1|  hypothetical protein F443_11432                         142   4e-38   
dbj|GAA96055.1|  hypothetical protein E5Q_02716                         140   5e-38   
ref|XP_001019693.2|  hypothetical protein TTHERM_00136120               140   6e-38   
dbj|GAN02772.1|  60S ribosomal protein L6                               141   6e-38   
gb|KDQ29365.1|  hypothetical protein PLEOSDRAFT_1055341                 140   6e-38   
dbj|BAD88438.1|  60S ribosomal protein L6 CgRPL6                        140   9e-38   
ref|XP_002293441.1|  RL6, ribosomal protein 6                           139   1e-37   
ref|XP_008613710.1|  50S ribosomal protein L6e                          140   1e-37   
ref|XP_002906369.1|  60S ribosomal protein L6, putative                 140   2e-37   
emb|CCI50863.1|  unnamed protein product                                140   2e-37   
gb|AIW62450.1|  60S ribosomal protein L6                                139   2e-37   
ref|XP_009515406.1|  hypothetical protein PHYSODRAFT_353483             139   3e-37   
gb|KDO27449.1|  hypothetical protein SPRG_07037                         139   4e-37   
ref|XP_007510665.1|  predicted protein                                  138   4e-37   
gb|AAX48836.1|  L6                                                      138   1e-36   
emb|CBJ27083.1|  conserved unknown protein                              136   1e-36   
emb|CCA26745.1|  60S ribosomal protein L6 putative                      138   1e-36   
gb|KDQ12739.1|  hypothetical protein BOTBODRAFT_112432                  137   1e-36   
ref|XP_008877495.1|  hypothetical protein H310_12272                    137   2e-36   
gb|EJY69284.1|  60S ribosomal protein L6                                135   3e-36   
gb|ABW90342.1|  putative ribosomal protein L6                           134   3e-36   
ref|XP_002906717.1|  60S ribosomal protein L6, putative                 137   3e-36   
gb|EJY84129.1|  60S ribosomal protein L6                                135   4e-36   
ref|XP_009827242.1|  hypothetical protein, variant                      135   5e-36   
ref|XP_002967792.1|  hypothetical protein SELMODRAFT_270686             135   5e-36   
ref|XP_002992626.1|  hypothetical protein SELMODRAFT_272281             134   5e-36   
gb|AIL48325.1|  large subunit ribosomal protein 6                       137   5e-36   
ref|XP_008877494.1|  hypothetical protein, variant 1                    136   8e-36   
emb|CCQ18652.1|  60S ribosomal protein L6                               136   8e-36   
ref|XP_009827241.1|  hypothetical protein H257_04428                    136   8e-36   
emb|CEF99205.1|  Ribosomal protein L2 domain 2                          134   1e-35   
ref|XP_003059594.1|  predicted protein                                  134   1e-35   
ref|XP_002504058.1|  predicted protein                                  134   2e-35   
ref|XP_788067.1|  PREDICTED: 60S ribosomal protein L6-like isoform 2    135   2e-35   
ref|WP_028833182.1|  hypothetical protein                               134   3e-35   
ref|XP_002787947.1|  60S ribosomal protein L6, putative                 132   3e-35   
ref|XP_002783590.1|  60S ribosomal protein L6, putative                 132   5e-35   
gb|ENN71617.1|  hypothetical protein YQE_11716                          134   9e-35   
ref|XP_005703146.1|  60S ribosomal protein L6e                          133   9e-35   
ref|XP_001423631.1|  hypothetical protein                               132   1e-34   
gb|ERL83321.1|  hypothetical protein D910_00215                         133   1e-34   
ref|XP_011115814.1|  hypothetical protein H072_10336                    131   1e-34   
pdb|4W20|E  Chain E, Structure Of The Mammalian 60s Ribosomal Sub...    132   2e-34   
gb|EGU10833.1|  60S ribosomal protein L6                                132   2e-34   
ref|XP_001452236.1|  hypothetical protein                               130   3e-34   
emb|CDR49048.1|  RHTO0S22e02014g1_1                                     131   3e-34   
ref|XP_006901041.1|  PREDICTED: 60S ribosomal protein L6                133   3e-34   
ref|XP_003885272.1|  hypothetical protein NCLIV_056680                  130   3e-34   
ref|XP_003420365.1|  PREDICTED: 60S ribosomal protein L6                132   4e-34   
ref|XP_007120719.1|  PREDICTED: 60S ribosomal protein L6-like           132   5e-34   
ref|XP_002364550.1|  60s ribosomal protein l6, putative                 130   5e-34   
ref|XP_004379121.1|  PREDICTED: 60S ribosomal protein L6                132   6e-34   
ref|XP_004281494.1|  PREDICTED: 60S ribosomal protein L6 isoform 1      132   6e-34   
ref|XP_001442892.1|  hypothetical protein                               130   6e-34   
ref|XP_006178158.1|  PREDICTED: 60S ribosomal protein L6                132   7e-34   
ref|NP_001038007.1|  60S ribosomal protein L6                           132   7e-34   
dbj|BAK02118.1|  predicted protein                                      129   7e-34   
ref|XP_007468646.1|  PREDICTED: 60S ribosomal protein L6 isoform X1     132   7e-34   
tpg|DAA34118.1|  TPA: 60S ribosomal protein L6                          130   7e-34   
gb|EWG89787.1|  Rpl6bp                                                  129   7e-34   
ref|XP_006870524.1|  PREDICTED: 60S ribosomal protein L6 isoform X1     132   8e-34   
ref|NP_001026926.1|  60S ribosomal protein L6                           132   8e-34   
tpg|DAA15998.1|  TPA: ribosomal protein L6-like                         132   8e-34   
ref|XP_005716705.1|  unnamed protein product                            130   8e-34   
ref|XP_005971781.1|  PREDICTED: 60S ribosomal protein L6-like           132   9e-34   
ref|XP_006053052.1|  PREDICTED: 60S ribosomal protein L6                132   9e-34   
ref|XP_009492511.1|  50S ribosomal protein L6e                          129   1e-33   
ref|XP_007936372.1|  PREDICTED: 60S ribosomal protein L6                132   1e-33   
ref|XP_002719802.1|  PREDICTED: 60S ribosomal protein L6                132   1e-33   
ref|XP_006768997.1|  PREDICTED: 60S ribosomal protein L6                132   1e-33   
emb|CDR46117.1|  CYFA0S22e00210g1_1                                     129   1e-33   
ref|XP_001440737.1|  hypothetical protein                               129   1e-33   
ref|XP_004448235.1|  PREDICTED: 60S ribosomal protein L6                131   2e-33   
ref|XP_001644462.1|  hypothetical protein Kpol_520p26                   128   2e-33   
ref|XP_005696303.1|  PREDICTED: 60S ribosomal protein L6-like           131   2e-33   
ref|XP_005709463.1|  PREDICTED: LOW QUALITY PROTEIN: ribosomal pr...    131   2e-33   
ref|XP_004017395.1|  PREDICTED: 60S ribosomal protein L6-like           131   2e-33   
ref|XP_004004943.1|  PREDICTED: 60S ribosomal protein L6-like           131   2e-33   
ref|XP_005012631.1|  PREDICTED: 60S ribosomal protein L6                130   2e-33   
gb|KIM25965.1|  hypothetical protein M408DRAFT_330944                   130   2e-33   
emb|CAA57513.1|  M-TAXREB107                                            131   2e-33   
ref|XP_004709715.1|  PREDICTED: 60S ribosomal protein L6                130   2e-33   
gb|AAP20201.1|  60S ribosomal protein L6                                130   2e-33   
ref|XP_006908630.1|  PREDICTED: 60S ribosomal protein L6                131   2e-33   
ref|XP_007058386.1|  PREDICTED: 60S ribosomal protein L6                130   2e-33   
ref|XP_001643951.1|  hypothetical protein Kpol_1001p5                   128   2e-33   
ref|XP_005538035.1|  60S ribosomal protein L6                           129   2e-33   
ref|XP_003684148.1|  60S ribosomal protein L6                           128   2e-33   
ref|NP_001086390.1|  ribosomal protein L6                               130   2e-33   
ref|XP_011354120.1|  PREDICTED: 60S ribosomal protein L6                130   2e-33   
ref|XP_005298643.1|  PREDICTED: 60S ribosomal protein L6                130   3e-33   
ref|NP_035420.2|  60S ribosomal protein L6                              130   3e-33   
dbj|BAE28577.1|  unnamed protein product                                130   3e-33   
ref|XP_008140959.1|  PREDICTED: 60S ribosomal protein L6                130   3e-33   
ref|XP_006121841.1|  PREDICTED: 60S ribosomal protein L6                130   3e-33   
ref|XP_008845728.1|  PREDICTED: 60S ribosomal protein L6                130   3e-33   
ref|XP_005876275.1|  PREDICTED: 60S ribosomal protein L6                130   3e-33   
ref|XP_004691131.1|  PREDICTED: 60S ribosomal protein L6                130   4e-33   
ref|XP_003684269.1|  60S ribosomal protein L6                           127   4e-33   
ref|XP_007563512.1|  PREDICTED: 60S ribosomal protein L6                129   4e-33   
gb|ACV20915.1|  large subunit ribosomal protein 6                       129   4e-33   
ref|XP_003761184.1|  PREDICTED: 60S ribosomal protein L6                130   4e-33   
gb|AAY64002.1|  ribosomal protein L6                                    127   5e-33   
ref|XP_009861667.1|  PREDICTED: 60S ribosomal protein L6 isoform X2     129   5e-33   
ref|XP_003307124.2|  hypothetical protein PGTG_00074                    131   6e-33   
ref|NP_001269292.1|  60S ribosomal protein L6                           130   6e-33   
ref|XP_001443347.1|  hypothetical protein                               127   6e-33   
gb|AFW62783.1|  hypothetical protein ZEAMMB73_027825                    125   6e-33   
ref|XP_003958946.1|  hypothetical protein KAFR_0I00300                  127   6e-33   
ref|XP_004876341.1|  PREDICTED: 60S ribosomal protein L6                129   6e-33   
gb|EKC33856.1|  60S ribosomal protein L6                                127   6e-33   
emb|CDQ75049.1|  unnamed protein product                                129   6e-33   
ref|XP_003462998.2|  PREDICTED: 60S ribosomal protein L6                129   6e-33   
ref|XP_011418236.1|  PREDICTED: 60S ribosomal protein L6-like           127   6e-33   
ref|XP_007528949.1|  PREDICTED: 60S ribosomal protein L6 isoform X1     129   7e-33   
gb|KFO85014.1|  60S ribosomal protein L6                                129   7e-33   
gb|ABY28366.1|  ribosomal protein L6                                    129   7e-33   
ref|XP_002178385.1|  predicted protein                                  127   7e-33   
ref|XP_007528955.1|  PREDICTED: 60S ribosomal protein L6 isoform X2     129   7e-33   
ref|NP_985008.1|  60S ribosomal protein L6                              126   8e-33   
ref|XP_004753325.1|  PREDICTED: 60S ribosomal protein L6                129   8e-33   
emb|CCX10829.1|  Similar to 60S ribosomal protein L6-B; acc. no. ...    127   8e-33   
ref|NP_013553.1|  ribosomal 60S subunit protein L6B                     126   9e-33   
ref|XP_006970838.1|  PREDICTED: 60S ribosomal protein L6                129   9e-33   
ref|XP_004393253.1|  PREDICTED: 60S ribosomal protein L6-like           129   9e-33   
gb|ACN36161.1|  unknown                                                 124   9e-33   
gb|KGL89444.1|  60S ribosomal protein L6                                129   9e-33   
ref|XP_002611830.1|  hypothetical protein BRAFLDRAFT_114734             128   9e-33   
ref|XP_005612645.1|  PREDICTED: 60S ribosomal protein L6 isoform X1     129   9e-33   
ref|XP_008632287.1|  PREDICTED: 60S ribosomal protein L6 isoform X2     128   9e-33   
ref|NP_001135169.1|  60S ribosomal protein L6                           128   1e-32   
gb|ACV20908.1|  large subunit ribosomal protein 6                       128   1e-32   
ref|XP_007170954.1|  PREDICTED: 60S ribosomal protein L6 isoform X2     129   1e-32   
ref|XP_005612646.1|  PREDICTED: 60S ribosomal protein L6 isoform X2     129   1e-32   
gb|ACV20906.1|  large subunit ribosomal protein 6                       128   1e-32   
ref|XP_004611117.1|  PREDICTED: 60S ribosomal protein L6                129   1e-32   
ref|XP_010215311.1|  PREDICTED: 60S ribosomal protein L6                129   1e-32   
gb|AAH62880.1|  Ribosomal protein L6                                    129   1e-32   
ref|NP_001291831.1|  ribosomal protein L6                               129   1e-32   
ref|XP_009878611.1|  PREDICTED: 60S ribosomal protein L6                129   1e-32   
ref|XP_010732553.1|  PREDICTED: 60S ribosomal protein L6                128   1e-32   
gb|KGL78879.1|  60S ribosomal protein L6                                129   1e-32   
ref|XP_006735806.1|  PREDICTED: 60S ribosomal protein L6 isoform X2     129   1e-32   
gb|AAH61784.1|  Rpl6 protein                                            129   1e-32   
ref|XP_005336887.1|  PREDICTED: 60S ribosomal protein L6                129   1e-32   
ref|XP_007636336.1|  PREDICTED: 60S ribosomal protein L6 isoform X1     129   1e-32   
ref|XP_006938548.1|  PREDICTED: 60S ribosomal protein L6                129   1e-32   



>ref|XP_006365859.1| PREDICTED: 60S ribosomal protein L6-like [Solanum tuberosum]
Length=229

 Score =   263 bits (672),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 143/164 (87%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = +1

Query  58   MAAKKSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkF  237
            MAAKK+ RNPELIRGVGKFSRSK+YHK+GLWAIK KNGGK P HEKKP A  AA KPPKF
Sbjct  1    MAAKKTIRNPELIRGVGKFSRSKMYHKKGLWAIKKKNGGKLPLHEKKPAATVAAVKPPKF  60

Query  238  YPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPF  417
            YPADDVKKPLVNKHKPK TKLR+SITPGTVLIILAGRFKGKRVVFLKQL SGLLLVTGPF
Sbjct  61   YPADDVKKPLVNKHKPKPTKLRASITPGTVLIILAGRFKGKRVVFLKQLTSGLLLVTGPF  120

Query  418  KINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            K+NGVPLRRVNQAYVI T+TKVD+ GVNVEKIDDKYF KQ EKK
Sbjct  121  KLNGVPLRRVNQAYVIGTSTKVDVSGVNVEKIDDKYFAKQVEKK  164



>ref|XP_004239831.1| PREDICTED: 60S ribosomal protein L6-like [Solanum lycopersicum]
Length=229

 Score =   263 bits (671),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 143/164 (87%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = +1

Query  58   MAAKKSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkF  237
            MAAKK+ RNPELIRGVGKFSRSK+YHK+GLWAIK KNGGK P HEKKP  A AA KPPKF
Sbjct  1    MAAKKTIRNPELIRGVGKFSRSKMYHKKGLWAIKKKNGGKLPLHEKKPAVAVAAVKPPKF  60

Query  238  YPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPF  417
            YPADDVKKPLVNKHKPK TKLR+SITPGTVLIILAGRFKGKRVVFLKQL SGLLLVTGPF
Sbjct  61   YPADDVKKPLVNKHKPKPTKLRASITPGTVLIILAGRFKGKRVVFLKQLTSGLLLVTGPF  120

Query  418  KINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            K+NGVPLRRVNQAYVI T+TKVD+ GVNVEKIDDKYF KQ EKK
Sbjct  121  KLNGVPLRRVNQAYVIGTSTKVDVSGVNVEKIDDKYFAKQVEKK  164



>ref|XP_004250254.1| PREDICTED: 60S ribosomal protein L6-like [Solanum lycopersicum]
Length=229

 Score =   260 bits (665),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = +1

Query  58   MAAKKSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkF  237
            MAAKK+ RNPELIRGVGKFSRSK+YHK+GLWAIK KNGG  P H KKP  AP AEK PKF
Sbjct  1    MAAKKTARNPELIRGVGKFSRSKMYHKKGLWAIKKKNGGALPVHSKKPAVAPVAEKAPKF  60

Query  238  YPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPF  417
            YPADDVKKPLVNKHKPK TKLRSSITPGTVLIILAGRFKGKRVVFLKQL SGLLLVTGPF
Sbjct  61   YPADDVKKPLVNKHKPKPTKLRSSITPGTVLIILAGRFKGKRVVFLKQLVSGLLLVTGPF  120

Query  418  KINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            K NGVPLRRVNQAYVI T+TKVDI GVNV+KIDDKYF KQ EKK
Sbjct  121  KFNGVPLRRVNQAYVIGTSTKVDISGVNVDKIDDKYFAKQVEKK  164



>ref|XP_009772155.1| PREDICTED: 60S ribosomal protein L6-like isoform X1 [Nicotiana 
sylvestris]
Length=230

 Score =   252 bits (644),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = +1

Query  58   MAAKKSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkF  237
            MAAKKSPRNPELIRGVGK SRSK+YHK+GLWAIK KNGG FP H+K    AP A KPPKF
Sbjct  1    MAAKKSPRNPELIRGVGKLSRSKMYHKKGLWAIKKKNGGSFPVHKKAAAVAPPAVKPPKF  60

Query  238  YPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPF  417
            YPADDV KPLVNKHKPK TKLR+SITPGTVLIILAGRFKGKRVVFLKQL SGLLLV+GPF
Sbjct  61   YPADDVAKPLVNKHKPKPTKLRASITPGTVLIILAGRFKGKRVVFLKQLKSGLLLVSGPF  120

Query  418  KINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYF  528
            K+NGVPLRRVNQAYVI T+TKVDI GVNVEKIDDKYF
Sbjct  121  KLNGVPLRRVNQAYVIGTSTKVDISGVNVEKIDDKYF  157



>ref|XP_007205607.1| hypothetical protein PRUPE_ppa009054mg [Prunus persica]
 gb|EMJ06806.1| hypothetical protein PRUPE_ppa009054mg [Prunus persica]
Length=308

 Score =   254 bits (650),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 147/169 (87%), Gaps = 4/169 (2%)
 Frame = +1

Query  55   SMAAK----KSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaae  222
            +MAAK    +  RNP+LIRGVGKFSRSK+YHKRGLWAIKAKNGG FP H+ KP A    E
Sbjct  75   AMAAKARLPRKTRNPDLIRGVGKFSRSKMYHKRGLWAIKAKNGGVFPRHDPKPTAETGPE  134

Query  223  kppkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLL  402
            K PKFYPADDVKKPLVNK K K TKLR+S+TPGTVLIILAGRFKGKRVVFLKQLPSGLLL
Sbjct  135  KVPKFYPADDVKKPLVNKRKLKPTKLRASVTPGTVLIILAGRFKGKRVVFLKQLPSGLLL  194

Query  403  VTGPFKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            VTGPFKINGVPLRRVNQ+YVIAT+TKVDI GVNVEK DDKYF KQ EKK
Sbjct  195  VTGPFKINGVPLRRVNQSYVIATSTKVDISGVNVEKFDDKYFAKQVEKK  243



>ref|XP_009617384.1| PREDICTED: 60S ribosomal protein L6-like [Nicotiana tomentosiformis]
Length=229

 Score =   252 bits (643),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = +1

Query  58   MAAKKSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkF  237
            MAAKKSPRNPELIRGVGK SRSK+YHK+GLWAIK KNGG FP H+K   AAP A KPPKF
Sbjct  1    MAAKKSPRNPELIRGVGKLSRSKMYHKKGLWAIKKKNGGSFPVHKKAAAAAPPAVKPPKF  60

Query  238  YPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPF  417
            YPADDV KPLVNKHKPK TKLR+SITPGTVLIILAGRFKGKRVVFLKQL SGLLLV+GPF
Sbjct  61   YPADDVAKPLVNKHKPKPTKLRASITPGTVLIILAGRFKGKRVVFLKQLKSGLLLVSGPF  120

Query  418  KINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYF  528
            K+NGVPLRRVNQAYVI T+TKVD+ GVNVEKIDDKYF
Sbjct  121  KLNGVPLRRVNQAYVIGTSTKVDVSGVNVEKIDDKYF  157



>ref|XP_009772157.1| PREDICTED: 60S ribosomal protein L6-like isoform X2 [Nicotiana 
sylvestris]
Length=229

 Score =   252 bits (643),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = +1

Query  58   MAAKKSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkF  237
            MAAKKSPRNPELIRGVGK SRSK+YHK+GLWAIK KNGG FP H+K    AP A KPPKF
Sbjct  1    MAAKKSPRNPELIRGVGKLSRSKMYHKKGLWAIKKKNGGSFPVHKKAAAVAPPAVKPPKF  60

Query  238  YPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPF  417
            YPADDV KPLVNKHKPK TKLR+SITPGTVLIILAGRFKGKRVVFLKQL SGLLLV+GPF
Sbjct  61   YPADDVAKPLVNKHKPKPTKLRASITPGTVLIILAGRFKGKRVVFLKQLKSGLLLVSGPF  120

Query  418  KINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYF  528
            K+NGVPLRRVNQAYVI T+TKVDI GVNVEKIDDKYF
Sbjct  121  KLNGVPLRRVNQAYVIGTSTKVDISGVNVEKIDDKYF  157



>gb|KDO83483.1| hypothetical protein CISIN_1g026785mg [Citrus sinensis]
Length=184

 Score =   250 bits (638),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 134/157 (85%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNPELIRG+GKFSRSK+YHKRGLWAIKAKNGG FP H+ KP AA  AEKPPKFYPADDVK
Sbjct  12   RNPELIRGIGKFSRSKMYHKRGLWAIKAKNGGVFPRHDPKPKAAAPAEKPPKFYPADDVK  71

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPLVNK KPK TKLR+SITPGTVLIILAGRFKGKRVVFLKQLPSGLLLV+GPFKINGVPL
Sbjct  72   KPLVNKRKPKPTKLRASITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVSGPFKINGVPL  131

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            RRVNQ+YVI T+TKVDI GVNV+K DDKYF K+ E+K
Sbjct  132  RRVNQSYVIGTSTKVDISGVNVDKFDDKYFAKEVERK  168



>ref|XP_011096185.1| PREDICTED: 60S ribosomal protein L6-like [Sesamum indicum]
Length=229

 Score =   252 bits (643),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 139/162 (86%), Positives = 145/162 (90%), Gaps = 0/162 (0%)
 Frame = +1

Query  58   MAAKKSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkF  237
            MA K+  RNPELI GV K SRSK+YHKRGLWAIKAKNGGKFPHHEK P AAP AEKPPKF
Sbjct  1    MAPKQRTRNPELIPGVRKVSRSKMYHKRGLWAIKAKNGGKFPHHEKAPAAAPVAEKPPKF  60

Query  238  YPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPF  417
            YPADDVKKPL NK KPK TKLR+SITPGTVLIIL+GRFKGKRVVFLKQL SGLLLVTGP+
Sbjct  61   YPADDVKKPLSNKRKPKPTKLRASITPGTVLIILSGRFKGKRVVFLKQLSSGLLLVTGPY  120

Query  418  KINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAE  543
            KINGVPLRRVNQAYVIAT+TKVDI GVNVEK DDKYF KQ E
Sbjct  121  KINGVPLRRVNQAYVIATSTKVDISGVNVEKFDDKYFAKQVE  162



>ref|XP_004309444.1| PREDICTED: 60S ribosomal protein L6-1-like [Fragaria vesca subsp. 
vesca]
Length=232

 Score =   251 bits (640),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNP+LIRGVGK+SRS++YHKRGLWAIKAK+GG FP H+ KP A   A KPPKFYPA+DVK
Sbjct  12   RNPDLIRGVGKYSRSQMYHKRGLWAIKAKHGGVFPRHDAKPAAEAPAVKPPKFYPAEDVK  71

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPLVNKHKPK TKLR+SITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFK+NGVPL
Sbjct  72   KPLVNKHKPKPTKLRASITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKVNGVPL  131

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            RRVNQ+YVI T+TKVDI GVNVEK DDKYFGK  EKK
Sbjct  132  RRVNQSYVIGTSTKVDISGVNVEKFDDKYFGKAVEKK  168



>ref|XP_002278032.1| PREDICTED: 60S ribosomal protein L6-1 [Vitis vinifera]
Length=231

 Score =   250 bits (639),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 138/167 (83%), Positives = 148/167 (89%), Gaps = 3/167 (2%)
 Frame = +1

Query  58   MAAKKSPR---NPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekp  228
            MA +K+PR   NP+LIRGVGKFSRSK+YHKRGLWAIKAKNGG FP HEKKPVA    EK 
Sbjct  1    MAPRKTPRTSRNPDLIRGVGKFSRSKMYHKRGLWAIKAKNGGVFPCHEKKPVAPAPLEKL  60

Query  229  pkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVT  408
            PKFYPADDVKKPL+NKHK K TKLR+SITPGTVLIILAGRFKGKRVVFLKQL SGLLL+T
Sbjct  61   PKFYPADDVKKPLINKHKAKPTKLRASITPGTVLIILAGRFKGKRVVFLKQLSSGLLLIT  120

Query  409  GPFKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            GPFKINGVPLRRVNQAYVIAT+TKVDI  VNVEK DDKYF K+ +KK
Sbjct  121  GPFKINGVPLRRVNQAYVIATSTKVDISKVNVEKFDDKYFAKEVQKK  167



>gb|KGN45157.1| hypothetical protein Csa_7G428940 [Cucumis sativus]
Length=231

 Score =   250 bits (639),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 147/163 (90%), Gaps = 3/163 (2%)
 Frame = +1

Query  64   AKKSPR---NPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppk  234
            A K+PR   NP+LIRGVGK+SRSK+YHKRGLWAIKAKNGG FP H+ +P AA  AEKPPK
Sbjct  2    APKTPRVTRNPDLIRGVGKYSRSKMYHKRGLWAIKAKNGGVFPRHDAQPKAAAPAEKPPK  61

Query  235  FYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGP  414
            FYPADDVKKPLVNK K KLTKLR+SITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGP
Sbjct  62   FYPADDVKKPLVNKRKAKLTKLRASITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGP  121

Query  415  FKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAE  543
            FKINGVPLRRVNQ+YVIAT+TKVDI GVN EK DDKYF K+A+
Sbjct  122  FKINGVPLRRVNQSYVIATSTKVDISGVNSEKFDDKYFSKEAQ  164



>gb|KDO83482.1| hypothetical protein CISIN_1g026785mg [Citrus sinensis]
Length=233

 Score =   250 bits (639),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 134/157 (85%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNPELIRG+GKFSRSK+YHKRGLWAIKAKNGG FP H+ KP AA  AEKPPKFYPADDVK
Sbjct  12   RNPELIRGIGKFSRSKMYHKRGLWAIKAKNGGVFPRHDPKPKAAAPAEKPPKFYPADDVK  71

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPLVNK KPK TKLR+SITPGTVLIILAGRFKGKRVVFLKQLPSGLLLV+GPFKINGVPL
Sbjct  72   KPLVNKRKPKPTKLRASITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVSGPFKINGVPL  131

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            RRVNQ+YVI T+TKVDI GVNV+K DDKYF K+ E+K
Sbjct  132  RRVNQSYVIGTSTKVDISGVNVDKFDDKYFAKEVERK  168



>ref|XP_008461261.1| PREDICTED: 60S ribosomal protein L6-1 [Cucumis melo]
Length=231

 Score =   250 bits (639),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 147/163 (90%), Gaps = 3/163 (2%)
 Frame = +1

Query  64   AKKSPR---NPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppk  234
            A K+PR   NP+LIRGVGK+SRSK+YHKRGLWAIKAKNGG FP H+ KP AA  AEKPPK
Sbjct  2    APKTPRVTRNPDLIRGVGKYSRSKMYHKRGLWAIKAKNGGVFPRHDAKPKAAVPAEKPPK  61

Query  235  FYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGP  414
            FYPADDVKKPLVNK K KLTKLR+SITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGP
Sbjct  62   FYPADDVKKPLVNKRKAKLTKLRASITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGP  121

Query  415  FKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAE  543
            FKINGVPLRRVNQ+YVIAT+TKVDI GVN EK DDKYF K+A+
Sbjct  122  FKINGVPLRRVNQSYVIATSTKVDISGVNSEKFDDKYFSKEAQ  164



>gb|KGN53829.1| hypothetical protein Csa_4G153800 [Cucumis sativus]
Length=284

 Score =   252 bits (643),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 147/168 (88%), Gaps = 2/168 (1%)
 Frame = +1

Query  52   SSMAAKKS--PRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaek  225
            SSMA K +   RNPELIRGVGK+SRSK+YHKRGLWAIKAKNGG FP H+ KP A   AEK
Sbjct  52   SSMAPKTARVSRNPELIRGVGKYSRSKMYHKRGLWAIKAKNGGVFPRHDAKPKADSPAEK  111

Query  226  ppkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLV  405
            PPKFYPADDVKKPLVNK KPK TKLRSSITPGTVLIIL GRFKGKRVVFLKQLPSGLLLV
Sbjct  112  PPKFYPADDVKKPLVNKRKPKPTKLRSSITPGTVLIILTGRFKGKRVVFLKQLPSGLLLV  171

Query  406  TGPFKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            TGPFK+NGVPLRRVNQ+YVIAT+TKVDI GVNVEK  DKYF K+  +K
Sbjct  172  TGPFKVNGVPLRRVNQSYVIATSTKVDIAGVNVEKFGDKYFSKEVHQK  219



>ref|XP_006482844.1| PREDICTED: 60S ribosomal protein L6-like [Citrus sinensis]
Length=233

 Score =   250 bits (638),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 134/157 (85%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNPELIRG+GKFSRSK+YHKRGLWAIKAKNGG FP H+ KP AA  AEKPPKFYPADDVK
Sbjct  12   RNPELIRGIGKFSRSKMYHKRGLWAIKAKNGGVFPRHDPKPKAAAPAEKPPKFYPADDVK  71

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPLVNK KPK TKLR+SITPGTVLIILAGRFKGKRVVFLKQLPSGLLLV+GPFKINGVPL
Sbjct  72   KPLVNKRKPKPTKLRASITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVSGPFKINGVPL  131

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            RRVNQ+YVI T+TKVDI GVNV+K DDKYF K+ E+K
Sbjct  132  RRVNQSYVIGTSTKVDISGVNVDKFDDKYFAKEVERK  168



>ref|XP_002265394.1| PREDICTED: 60S ribosomal protein L6-3 [Vitis vinifera]
Length=233

 Score =   250 bits (638),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNP LIRG+GK SRSK+YHKRGLWAIKAKNGG FP H+ KP A   AEK PKFYPADDVK
Sbjct  12   RNPNLIRGIGKHSRSKMYHKRGLWAIKAKNGGVFPRHDAKPKAPAPAEKSPKFYPADDVK  71

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPLVN+HK KLTKLR+SITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL
Sbjct  72   KPLVNRHKSKLTKLRASITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  131

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAE  543
            RRVNQAY+IAT+TKVDI GVNVEK DDKYF K+ +
Sbjct  132  RRVNQAYIIATSTKVDISGVNVEKFDDKYFAKETQ  166



>ref|XP_006439069.1| hypothetical protein CICLE_v10032636mg [Citrus clementina]
 gb|ESR52309.1| hypothetical protein CICLE_v10032636mg [Citrus clementina]
Length=233

 Score =   249 bits (637),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 134/157 (85%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNPELIRG+GKFSRSK+YHKRGLWAIKAKNGG FP H+ KP AA  AEKPPKFYPADDVK
Sbjct  12   RNPELIRGIGKFSRSKMYHKRGLWAIKAKNGGVFPRHDPKPKAAAPAEKPPKFYPADDVK  71

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPLVNK KPK TKLR+SITPGTVLIILAGRFKGKRVVFLKQLPSGLLLV+GPFKINGVPL
Sbjct  72   KPLVNKRKPKPTKLRASITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVSGPFKINGVPL  131

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            RRVNQ YVI T+TKVDI GVNV+K DDKYF K+ E+K
Sbjct  132  RRVNQTYVIGTSTKVDISGVNVDKFDDKYFAKEVERK  168



>ref|XP_006352371.1| PREDICTED: 60S ribosomal protein L6-like [Solanum tuberosum]
Length=229

 Score =   249 bits (635),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = +1

Query  58   MAAKKSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkF  237
            MAAKK+ RNPELIRGVGKFSRSK+YHK+GLWAIK KNGG  P H KKP AAPAAEK PKF
Sbjct  1    MAAKKTARNPELIRGVGKFSRSKMYHKKGLWAIKKKNGGALPVHSKKPAAAPAAEKSPKF  60

Query  238  YPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPF  417
            YPADDVKKPLVNKHKPK TKLRSSITPGTVLIILAGRFKGKRVVFLKQL SGLLLVTGPF
Sbjct  61   YPADDVKKPLVNKHKPKPTKLRSSITPGTVLIILAGRFKGKRVVFLKQLVSGLLLVTGPF  120

Query  418  KINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYF  528
            K NGVPLRRVNQAYVI T+TKVDI GV+V+KIDDKYF
Sbjct  121  KFNGVPLRRVNQAYVIGTSTKVDISGVSVDKIDDKYF  157



>ref|XP_004154716.1| PREDICTED: 60S ribosomal protein L6-like [Cucumis sativus]
Length=231

 Score =   248 bits (634),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 133/157 (85%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNPELIRGVGK+SRSK+YHKRGLWAIKAKNGG FP H+ KP A   AEKPPKFYPADDVK
Sbjct  10   RNPELIRGVGKYSRSKMYHKRGLWAIKAKNGGVFPRHDAKPKADSPAEKPPKFYPADDVK  69

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPLVNK KPK TKLRSSITPGTVLIIL GRFKGKRVVFLKQLPSGLLLVTGPFK+NGVPL
Sbjct  70   KPLVNKRKPKPTKLRSSITPGTVLIILTGRFKGKRVVFLKQLPSGLLLVTGPFKVNGVPL  129

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            RRVNQ+YVIAT+TKVDI GVNVEK  DKYF K+  +K
Sbjct  130  RRVNQSYVIATSTKVDIAGVNVEKFGDKYFSKEVHQK  166



>ref|XP_010557777.1| PREDICTED: 60S ribosomal protein L6-1-like [Tarenaya hassleriana]
Length=232

 Score =   248 bits (634),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNP+LIRGVGKFSRSK+YHKRGLWAIKAKNGGKFPHH+ KP     AEK PKFYPA+DVK
Sbjct  11   RNPDLIRGVGKFSRSKMYHKRGLWAIKAKNGGKFPHHDPKPKPEAPAEKTPKFYPAEDVK  70

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPLVNK KPK TKLR+SITPGTVLIILAGRFKGKRVVFLKQL SGLLLVTGPFKINGVPL
Sbjct  71   KPLVNKRKPKPTKLRASITPGTVLIILAGRFKGKRVVFLKQLSSGLLLVTGPFKINGVPL  130

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQA  540
            RRVNQ+YVI T+TKVDI G+NVEK DDKYF K A
Sbjct  131  RRVNQSYVIGTSTKVDISGINVEKFDDKYFAKVA  164



>emb|CAN75087.1| hypothetical protein VITISV_010816 [Vitis vinifera]
Length=231

 Score =   248 bits (633),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 137/167 (82%), Positives = 147/167 (88%), Gaps = 3/167 (2%)
 Frame = +1

Query  58   MAAKKSPR---NPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekp  228
            MA +K+PR   NP+LIRGVGKFSRSK+YHK GLWAIKAKNGG FP HEKKPVA    EK 
Sbjct  1    MAPRKTPRTSRNPDLIRGVGKFSRSKMYHKCGLWAIKAKNGGVFPCHEKKPVAPAPLEKL  60

Query  229  pkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVT  408
            PKFYPADDVKKPL+NKHK K TKLR+SITPGTVLIILAGRFKGKRVVFLKQL SGLLL+T
Sbjct  61   PKFYPADDVKKPLINKHKAKXTKLRASITPGTVLIILAGRFKGKRVVFLKQLSSGLLLIT  120

Query  409  GPFKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            GPFKINGVPLRRVNQAYVIAT+TKVDI  VNVEK DDKYF K+ +KK
Sbjct  121  GPFKINGVPLRRVNQAYVIATSTKVDISKVNVEKFDDKYFAKEVQKK  167



>ref|XP_008227773.1| PREDICTED: 60S ribosomal protein L6-like [Prunus mume]
Length=233

 Score =   248 bits (633),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNP+LIRGVGKFSRSK+YHKRGLWAIKAKNGG FP H+ KP A    +KPPKFYPADD K
Sbjct  12   RNPDLIRGVGKFSRSKMYHKRGLWAIKAKNGGVFPRHDPKPAAEAPTQKPPKFYPADDAK  71

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPLVNK KPK T LR++ITPGTVLIILAGRFKGKRVVFLKQL SGLLLVTGPFKINGVPL
Sbjct  72   KPLVNKRKPKPTNLRATITPGTVLIILAGRFKGKRVVFLKQLTSGLLLVTGPFKINGVPL  131

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            RRVNQ+YVIAT+TKVDI GVNVEK DDKYF K+ EKK
Sbjct  132  RRVNQSYVIATSTKVDISGVNVEKFDDKYFAKEVEKK  168



>gb|AAM65875.1| 60S ribosomal protein L6, putative [Arabidopsis thaliana]
Length=233

 Score =   247 bits (631),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 143/164 (87%), Gaps = 3/164 (2%)
 Frame = +1

Query  61   AAKKSP---RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekpp  231
            AAK++P   RNP+LIRGVGK+SRS++YHKRGLWAIKAKNGG FP H+ +P      EKP 
Sbjct  3    AAKRTPKVNRNPDLIRGVGKYSRSQMYHKRGLWAIKAKNGGVFPRHDAQPKVDAPVEKPA  62

Query  232  kFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTG  411
            KFYPA+DVKKPLVN+ KPK TKL++S TPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTG
Sbjct  63   KFYPAEDVKKPLVNRRKPKPTKLKASTTPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTG  122

Query  412  PFKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAE  543
            PFKINGVPLRRVNQAYVI T+TKVDI GVN EK DDKYFGK AE
Sbjct  123  PFKINGVPLRRVNQAYVIGTSTKVDISGVNTEKFDDKYFGKVAE  166



>ref|XP_009616341.1| PREDICTED: 60S ribosomal protein L6-like [Nicotiana tomentosiformis]
Length=229

 Score =   247 bits (630),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = +1

Query  58   MAAKKSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkF  237
            MA KKS RNPELI G+GKFSRSK+YHK+GLWAIK KNGG FP H KKP AA  A KPPKF
Sbjct  1    MAPKKSLRNPELIPGLGKFSRSKMYHKKGLWAIKKKNGGTFPSHNKKPTAAAPAIKPPKF  60

Query  238  YPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPF  417
            YPADDV KPLVNKHKPK TKLR+SITPGTVLIILAGRFKGKRVVFLKQL SGLLLVTGPF
Sbjct  61   YPADDVAKPLVNKHKPKPTKLRASITPGTVLIILAGRFKGKRVVFLKQLGSGLLLVTGPF  120

Query  418  KINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYF  528
            KINGVPLRRVNQAYVI T+TKVD+ GVNVEKIDDKYF
Sbjct  121  KINGVPLRRVNQAYVIGTSTKVDVSGVNVEKIDDKYF  157



>emb|CDX81879.1| BnaC08g37220D [Brassica napus]
Length=234

 Score =   247 bits (630),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = +1

Query  70   KSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPAD  249
            K  RNP+LIRGVGK+SRS++YHKRGLWAIKAKNGG FP H+ K       EKP KFYPA+
Sbjct  10   KVSRNPDLIRGVGKYSRSQMYHKRGLWAIKAKNGGVFPRHDAKSKVDAPVEKPAKFYPAE  69

Query  250  DVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKING  429
            DVKKPL N+ KPK TKL+SSITPGTVLIILAGRFKGKRVVFLKQL SGLLLVTGPFKING
Sbjct  70   DVKKPLANRRKPKPTKLKSSITPGTVLIILAGRFKGKRVVFLKQLSSGLLLVTGPFKING  129

Query  430  VPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            VPLRRVNQ+YVI T+TKVDI GVNVEK DDKYFGK AEKK
Sbjct  130  VPLRRVNQSYVIGTSTKVDISGVNVEKFDDKYFGKVAEKK  169



>ref|XP_004504017.1| PREDICTED: 60S ribosomal protein L6-3-like isoform X2 [Cicer 
arietinum]
Length=234

 Score =   247 bits (630),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNPELIRG+GK+S+SK+YHKRG+WAIKAKNGG  P H+ KP     AEKPPKFYPADDVK
Sbjct  13   RNPELIRGIGKYSKSKMYHKRGIWAIKAKNGGVLPRHDPKPKPESPAEKPPKFYPADDVK  72

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPL NKHKPK TKLR+SITPGTVLI+LAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL
Sbjct  73   KPLRNKHKPKPTKLRASITPGTVLILLAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  132

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            RRVNQ+YVI T+TKVDI  VNV+K DDKYF K+A KK
Sbjct  133  RRVNQSYVIGTSTKVDISAVNVDKFDDKYFSKEAPKK  169



>gb|AFK48484.1| unknown [Medicago truncatula]
Length=170

 Score =   244 bits (624),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNPELIRG+GK+SRS +YHKRGLWAIKAK+GG FP H+     A   EKPPKFYPADDVK
Sbjct  12   RNPELIRGIGKYSRSAMYHKRGLWAIKAKHGGAFPRHDPVAKPAAPVEKPPKFYPADDVK  71

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPL NKH+PK TKLR+SITPGTVLI+LAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL
Sbjct  72   KPLRNKHRPKPTKLRASITPGTVLILLAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  131

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            RRVNQAYVI T+TKVDI  VNV+K DDKYF K+++KK
Sbjct  132  RRVNQAYVIGTSTKVDISSVNVDKFDDKYFSKESQKK  168



>emb|CDX96716.1| BnaA08g22590D [Brassica napus]
Length=234

 Score =   247 bits (630),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = +1

Query  70   KSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPAD  249
            K  RNP+LIRGVGK+SRS++YHKRGLWAIKAKNGG FP H+ K      AEK  KFYPA+
Sbjct  10   KVSRNPDLIRGVGKYSRSQMYHKRGLWAIKAKNGGVFPRHDAKSKVVAPAEKAAKFYPAE  69

Query  250  DVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKING  429
            DVKKPL N+ KPK TKL++SITPGTVLIILAGRFKGKRVVFLKQL SGLLLVTGPFKING
Sbjct  70   DVKKPLANRRKPKPTKLKASITPGTVLIILAGRFKGKRVVFLKQLTSGLLLVTGPFKING  129

Query  430  VPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            VPLRRVNQ+YVI T+TKVDI GVN+EK DDKYFGK AEKK
Sbjct  130  VPLRRVNQSYVIGTSTKVDISGVNIEKFDDKYFGKVAEKK  169



>ref|XP_011468806.1| PREDICTED: 60S ribosomal protein L6-like [Fragaria vesca subsp. 
vesca]
Length=234

 Score =   246 bits (629),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNP LIRG+GK+SRSK+YHKRGLWAIKAKNGG FP H+KKP A   A KPPKFYPADDVK
Sbjct  13   RNPNLIRGIGKYSRSKMYHKRGLWAIKAKNGGSFPRHDKKPAADVPAVKPPKFYPADDVK  72

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPL+NKHKPK TKLR+SITPGTVLIILAGRFKGKRVVFLKQL SGLLLVTGPFKINGVPL
Sbjct  73   KPLINKHKPKPTKLRASITPGTVLIILAGRFKGKRVVFLKQLSSGLLLVTGPFKINGVPL  132

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAE  543
            RRVNQ+YVI T+TKVDI GVNVEK DDKYF K+ +
Sbjct  133  RRVNQSYVIGTSTKVDISGVNVEKFDDKYFSKEVQ  167



>gb|ACJ84110.1| unknown [Medicago truncatula]
Length=234

 Score =   246 bits (629),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNP+LIRG+GKFS+S++YHK+G+WAIKAKNGG FP H+ KP    AAEKPPKFYPADDVK
Sbjct  13   RNPDLIRGIGKFSKSQMYHKKGIWAIKAKNGGVFPRHDPKPKPETAAEKPPKFYPADDVK  72

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPL NKHKPK TKLR+SITPGTVLI+LAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL
Sbjct  73   KPLRNKHKPKQTKLRASITPGTVLILLAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  132

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            RRVNQAYVI T+TKVDI GVNV+ +DDKYF K+A KK
Sbjct  133  RRVNQAYVIGTSTKVDISGVNVDNLDDKYFSKEAPKK  169



>gb|AFK47926.1| unknown [Medicago truncatula]
Length=234

 Score =   246 bits (628),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNP+LIRG+GKFS+S++YHK+G+WAIKAKNGG FP H+ KP    AAEKPPKFYPADDVK
Sbjct  13   RNPDLIRGIGKFSKSQMYHKKGIWAIKAKNGGVFPRHDPKPKPETAAEKPPKFYPADDVK  72

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPL NKHKPK TKLR+SITPGTVLI+LAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL
Sbjct  73   KPLRNKHKPKQTKLRASITPGTVLILLAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  132

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            RRVNQAYVI T+TKVDI GVNV+ +DDKYF K+A KK
Sbjct  133  RRVNQAYVIGTSTKVDISGVNVDNLDDKYFSKEAPKK  169



>ref|XP_010248308.1| PREDICTED: 60S ribosomal protein L6 [Nelumbo nucifera]
Length=233

 Score =   246 bits (628),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNP+LIRGVGK+SRS++YHKRGLWAIKAKNGG FP H+ KP  A   EKPPKFYPADDVK
Sbjct  12   RNPDLIRGVGKYSRSQMYHKRGLWAIKAKNGGAFPRHDPKPAEAKPVEKPPKFYPADDVK  71

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPL+NK KPK TKLR+SITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFK+NGVPL
Sbjct  72   KPLINKRKPKPTKLRASITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKVNGVPL  131

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYF  528
            RRVNQ+YVIAT+TKVDI GVNVEK DDKYF
Sbjct  132  RRVNQSYVIATSTKVDISGVNVEKFDDKYF  161



>ref|XP_007149074.1| hypothetical protein PHAVU_005G038900g [Phaseolus vulgaris]
 gb|ESW21068.1| hypothetical protein PHAVU_005G038900g [Phaseolus vulgaris]
Length=232

 Score =   246 bits (628),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 147/167 (88%), Gaps = 3/167 (2%)
 Frame = +1

Query  58   MAAKK---SPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekp  228
            MA KK   + RNPELIRG+GK+SRS++YHKRG+WAIKAKNGG FP H+ KP     A+KP
Sbjct  1    MAPKKPRSTSRNPELIRGIGKYSRSQMYHKRGIWAIKAKNGGVFPRHDPKPKPDSLAQKP  60

Query  229  pkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVT  408
            PKFYPADDV+KPL+NKHKPK  KLR+S+TPGTVLI+LAGRFKGKRVVFLKQLPSGLLLVT
Sbjct  61   PKFYPADDVRKPLLNKHKPKPAKLRASVTPGTVLILLAGRFKGKRVVFLKQLPSGLLLVT  120

Query  409  GPFKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            GPFKINGVPLRRVNQ+YVI T+TKVDI GVNV++ DDKYF K A+KK
Sbjct  121  GPFKINGVPLRRVNQSYVIGTSTKVDISGVNVDRFDDKYFSKDAKKK  167



>gb|KDP21512.1| hypothetical protein JCGZ_21983 [Jatropha curcas]
Length=231

 Score =   246 bits (627),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNP+L+RG+GKFSRS++YHKRGLWAIKAKNGG FP H+ KP  +   EKPPKFYPADD K
Sbjct  10   RNPDLVRGIGKFSRSQMYHKRGLWAIKAKNGGVFPKHDPKPKPSAPTEKPPKFYPADDAK  69

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPL+NK KPK TKLRSSITPGTVLIILAGRFKGKRVVFLKQL SGLLLVTGPFKINGVPL
Sbjct  70   KPLLNKRKPKPTKLRSSITPGTVLIILAGRFKGKRVVFLKQLSSGLLLVTGPFKINGVPL  129

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            RRVNQ+YVIAT++KVDI GVNV+K DDKYF KQ EKK
Sbjct  130  RRVNQSYVIATSSKVDISGVNVDKFDDKYFAKQFEKK  166



>ref|NP_173289.1| 60S ribosomal protein L6-1 [Arabidopsis thaliana]
 sp|Q9FZ76.1|RL61_ARATH RecName: Full=60S ribosomal protein L6-1 [Arabidopsis thaliana]
 gb|AAF98420.1|AC026238_12 Putative 60S ribosomal protein L6 [Arabidopsis thaliana]
 gb|AAK96866.1| Putative 60S ribosomal protein L6 [Arabidopsis thaliana]
 gb|AAL66911.1| putative 60S ribosomal protein L6 [Arabidopsis thaliana]
 gb|AEE29727.1| 60S ribosomal protein L6-1 [Arabidopsis thaliana]
Length=233

 Score =   246 bits (627),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 143/164 (87%), Gaps = 3/164 (2%)
 Frame = +1

Query  61   AAKKSP---RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekpp  231
            AAK++P   RNP+LIRGVGK+SRS++YHKRGLWAIKAKNGG FP H+ +P      EKP 
Sbjct  3    AAKRTPKVNRNPDLIRGVGKYSRSQMYHKRGLWAIKAKNGGVFPRHDAQPKVDAPVEKPA  62

Query  232  kFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTG  411
            KFYPA+DVKKPLVN+ KPK TKL++SITPGTVLIILAGRFKGKRVVFLKQL SGLLLVTG
Sbjct  63   KFYPAEDVKKPLVNRRKPKPTKLKASITPGTVLIILAGRFKGKRVVFLKQLSSGLLLVTG  122

Query  412  PFKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAE  543
            PFKINGVPLRRVNQAYVI T+TK+DI GVN EK DDKYFGK AE
Sbjct  123  PFKINGVPLRRVNQAYVIGTSTKIDISGVNTEKFDDKYFGKVAE  166



>ref|XP_004150161.1| PREDICTED: 60S ribosomal protein L6-like [Cucumis sativus]
Length=231

 Score =   246 bits (627),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNPELIRGVGK+SRSK+YHKRGLWAIKAKNGG FP H+ KP A   AEKPPKFYPADDVK
Sbjct  10   RNPELIRGVGKYSRSKMYHKRGLWAIKAKNGGVFPRHDAKPKADSPAEKPPKFYPADDVK  69

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPLVNK KPK TKLRSSITPGTVLIIL GRFKGKRVVFLKQLP GLLLVTGPFK+NGVPL
Sbjct  70   KPLVNKRKPKPTKLRSSITPGTVLIILTGRFKGKRVVFLKQLPFGLLLVTGPFKVNGVPL  129

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            RRVNQ+YVIAT+TKVDI GVNVEK  DKYF K+  +K
Sbjct  130  RRVNQSYVIATSTKVDIAGVNVEKFGDKYFSKEVHQK  166



>ref|XP_009369866.1| PREDICTED: 60S ribosomal protein L6-like [Pyrus x bretschneideri]
Length=233

 Score =   246 bits (627),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 143/162 (88%), Gaps = 4/162 (2%)
 Frame = +1

Query  58   MAAK----KSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaek  225
            MAAK    +  RNP+L+RGVGKFSRSK+YHKRGLWAIKAKNGG FP H+ KP A  A EK
Sbjct  1    MAAKARNPRKTRNPDLVRGVGKFSRSKMYHKRGLWAIKAKNGGVFPCHDPKPAAETAPEK  60

Query  226  ppkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLV  405
            PPKFYPADDVKKPLVNK KPK TKLR+SITPGTVLIILAGRFKGKRVVFLKQLPSGLLLV
Sbjct  61   PPKFYPADDVKKPLVNKRKPKPTKLRASITPGTVLIILAGRFKGKRVVFLKQLPSGLLLV  120

Query  406  TGPFKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFG  531
            TGPFKINGVPLRRVNQ+YVI T+TKVDI GVNVEK DDKYF 
Sbjct  121  TGPFKINGVPLRRVNQSYVIGTSTKVDISGVNVEKFDDKYFA  162



>ref|XP_009775140.1| PREDICTED: 60S ribosomal protein L6-like [Nicotiana sylvestris]
Length=229

 Score =   245 bits (626),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = +1

Query  58   MAAKKSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkF  237
            MA KK+ RNPELI G+GKFSRSK+YHK+GLWAIK KNGG FP H KKP  A  A KPPKF
Sbjct  1    MAPKKTLRNPELIPGLGKFSRSKMYHKKGLWAIKKKNGGTFPSHSKKPTTAAPAIKPPKF  60

Query  238  YPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPF  417
            YPADDV KPLVNKHKPK TKLR+SITPGTVLIILAGRFKGKRVVFLKQL SGLLLVTGPF
Sbjct  61   YPADDVAKPLVNKHKPKPTKLRASITPGTVLIILAGRFKGKRVVFLKQLGSGLLLVTGPF  120

Query  418  KINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYF  528
            K+NGVPLRRVNQAYVI T+TKVD+ GVNVEKIDDKYF
Sbjct  121  KLNGVPLRRVNQAYVIGTSTKVDVSGVNVEKIDDKYF  157



>emb|CDY21701.1| BnaA09g44520D [Brassica napus]
Length=234

 Score =   245 bits (626),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/160 (80%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = +1

Query  70   KSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPAD  249
            K  RNP+LIRGVGK+SRS++YHKRGLWAIKAKNGG FP H+ K       EKP KFYPA+
Sbjct  10   KVSRNPDLIRGVGKYSRSQMYHKRGLWAIKAKNGGVFPRHDAKSKVDSPVEKPAKFYPAE  69

Query  250  DVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKING  429
            DVKKPL N+ KPK TKL+SSITPGTVLIILAGRFKGKRVVFLKQL SGLLLVTGPFKING
Sbjct  70   DVKKPLANRRKPKPTKLKSSITPGTVLIILAGRFKGKRVVFLKQLSSGLLLVTGPFKING  129

Query  430  VPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            VPLRRVNQ+YVI T+TKVDI GV+VEK DDKYFGK AEKK
Sbjct  130  VPLRRVNQSYVIGTSTKVDISGVSVEKFDDKYFGKVAEKK  169



>ref|XP_003602457.1| 60S ribosomal protein L6 [Medicago truncatula]
 gb|AES72708.1| 60S ribosomal L6-like protein [Medicago truncatula]
Length=233

 Score =   245 bits (626),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNPELIRG+GK+SRS +YHKRGLWAIKAK+GG FP H+     A   EKPPKFYPADDVK
Sbjct  12   RNPELIRGIGKYSRSAMYHKRGLWAIKAKHGGAFPRHDPVAKPAAPVEKPPKFYPADDVK  71

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPL NKH+PK TKLR+SITPGTVLI+LAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL
Sbjct  72   KPLRNKHRPKPTKLRASITPGTVLILLAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  131

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            RRVNQAYVI T+TKVDI  VNV+K DDKYF K+++KK
Sbjct  132  RRVNQAYVIGTSTKVDISSVNVDKFDDKYFSKESQKK  168



>ref|XP_008461779.1| PREDICTED: 60S ribosomal protein L6-1-like [Cucumis melo]
Length=231

 Score =   245 bits (626),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNP+LIRGVGK+SRSK+YHKRGLWAIKAKNGG FP H+ KP     AEKPPKFYPADDVK
Sbjct  10   RNPDLIRGVGKYSRSKMYHKRGLWAIKAKNGGVFPRHDAKPKPEAPAEKPPKFYPADDVK  69

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPLVNK K K TKLR+SITPGTVLIIL GRFKGKRVVFLKQLPSGLLLVTGPFK+NGVPL
Sbjct  70   KPLVNKRKAKPTKLRASITPGTVLIILTGRFKGKRVVFLKQLPSGLLLVTGPFKVNGVPL  129

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAE  543
            RRVNQ+YVIAT+TKVDI GVNVEK DDKYF K+ +
Sbjct  130  RRVNQSYVIATSTKVDITGVNVEKFDDKYFSKEVQ  164



>ref|XP_009117610.1| PREDICTED: 60S ribosomal protein L6-1 [Brassica rapa]
Length=234

 Score =   245 bits (626),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/160 (80%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = +1

Query  70   KSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPAD  249
            K  RNP+LIRGVGK+SRS++YHKRGLWAIKAKNGG FP H+ K       EKP KFYPA+
Sbjct  10   KVSRNPDLIRGVGKYSRSQMYHKRGLWAIKAKNGGVFPRHDAKSKVDAPVEKPAKFYPAE  69

Query  250  DVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKING  429
            DVKKPL N+ KPK TKL+SSITPGTVLIILAGRFKGKRVVFLKQL SGLLLVTGPFKING
Sbjct  70   DVKKPLANRRKPKPTKLKSSITPGTVLIILAGRFKGKRVVFLKQLASGLLLVTGPFKING  129

Query  430  VPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            VPLRRVNQ+YVI T+TKVDI GV+VEK DDKYFGK AEKK
Sbjct  130  VPLRRVNQSYVIGTSTKVDISGVSVEKFDDKYFGKVAEKK  169



>gb|EYU22781.1| hypothetical protein MIMGU_mgv1a013134mg [Erythranthe guttata]
Length=229

 Score =   245 bits (625),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 134/164 (82%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = +1

Query  58   MAAKKSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkF  237
            MA K+  RNPELI GV K SRS +YHKRGLWAIKAKNGGKFPHHEK   AAP AEKPPKF
Sbjct  1    MAPKQRTRNPELIPGVRKVSRSAMYHKRGLWAIKAKNGGKFPHHEKAVAAAPVAEKPPKF  60

Query  238  YPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPF  417
            YPADD+KKPL N  K K TKLR+SITPGTVLIIL+GRFKGKRVVFLKQL SGLLLVTGP+
Sbjct  61   YPADDIKKPLSNTRKAKPTKLRASITPGTVLIILSGRFKGKRVVFLKQLSSGLLLVTGPY  120

Query  418  KINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            KINGVPLRRVNQAYVI T+TKVD+ GVNVEK DDKYF KQ EKK
Sbjct  121  KINGVPLRRVNQAYVIGTSTKVDLSGVNVEKFDDKYFAKQVEKK  164



>ref|XP_009352593.1| PREDICTED: 60S ribosomal protein L6-like isoform X1 [Pyrus x 
bretschneideri]
Length=233

 Score =   245 bits (625),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 142/162 (88%), Gaps = 4/162 (2%)
 Frame = +1

Query  58   MAAK----KSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaek  225
            MAAK    +  RNP+L+RGVGKFSRSK+YHKRGLWAIKAKNGG FP H+ KP A    EK
Sbjct  1    MAAKARNPRKTRNPDLVRGVGKFSRSKMYHKRGLWAIKAKNGGVFPRHDAKPAAETQPEK  60

Query  226  ppkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLV  405
            PPKFYPADDVKKPLVNK KPK TKLR+SITPGTVLIILAGRFKGKRVVFLKQL SGLLLV
Sbjct  61   PPKFYPADDVKKPLVNKRKPKPTKLRASITPGTVLIILAGRFKGKRVVFLKQLSSGLLLV  120

Query  406  TGPFKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFG  531
            TGPFKINGVPLRRVNQ+YVIAT+TKVDI G+NVEK DDKYF 
Sbjct  121  TGPFKINGVPLRRVNQSYVIATSTKVDISGLNVEKFDDKYFA  162



>ref|XP_008337622.1| PREDICTED: 60S ribosomal protein L6-like [Malus domestica]
 ref|XP_008352349.1| PREDICTED: 60S ribosomal protein L6-like [Malus domestica]
Length=233

 Score =   245 bits (625),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 142/162 (88%), Gaps = 4/162 (2%)
 Frame = +1

Query  58   MAAK----KSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaek  225
            MAAK    +  RNP+L+RGVGKFSRSK+YHKRGLWAIKAKNGG FP H+ KP A    EK
Sbjct  1    MAAKARNPRKTRNPDLVRGVGKFSRSKMYHKRGLWAIKAKNGGVFPRHDAKPAAETQPEK  60

Query  226  ppkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLV  405
            PPKFYPADDVKKPLVNK KPK TKLR+SITPGTVLIILAGRFKGKRVVFLKQL SGLLLV
Sbjct  61   PPKFYPADDVKKPLVNKRKPKPTKLRASITPGTVLIILAGRFKGKRVVFLKQLSSGLLLV  120

Query  406  TGPFKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFG  531
            TGPFKINGVPLRRVNQ+YVIAT+TKVDI G+NVEK DDKYF 
Sbjct  121  TGPFKINGVPLRRVNQSYVIATSTKVDISGLNVEKFDDKYFA  162



>ref|XP_009110340.1| PREDICTED: 60S ribosomal protein L6-1-like [Brassica rapa]
Length=234

 Score =   245 bits (625),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = +1

Query  70   KSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPAD  249
            K  RNP+LIRGVGK+SRS++YHKRGLWAIKAKNGG FP H+ K      AEK  KFYPA+
Sbjct  10   KVSRNPDLIRGVGKYSRSQMYHKRGLWAIKAKNGGVFPRHDAKSKVVAPAEKAAKFYPAE  69

Query  250  DVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKING  429
            DVKKPL N+ KPK TKL++SITPGTVLIILAGRFKGKRVVFLKQL SGLLLVTGPFKING
Sbjct  70   DVKKPLANRRKPKPTKLKASITPGTVLIILAGRFKGKRVVFLKQLTSGLLLVTGPFKING  129

Query  430  VPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            VPLRRVNQ+YVI T+TKVDI GV++EK DDKYFGK AEKK
Sbjct  130  VPLRRVNQSYVIGTSTKVDISGVSIEKFDDKYFGKVAEKK  169



>emb|CDX83840.1| BnaC08g18050D [Brassica napus]
Length=234

 Score =   245 bits (625),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 138/160 (86%), Gaps = 0/160 (0%)
 Frame = +1

Query  70   KSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPAD  249
            K  RNP+LIRGVGK+SRS++YHKRGLWAIKAKNGG FP H+ K       EK  KFYPA+
Sbjct  10   KVSRNPDLIRGVGKYSRSQMYHKRGLWAIKAKNGGVFPRHDAKSKVEAPVEKAAKFYPAE  69

Query  250  DVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKING  429
            DVKKPL N+ KPK TKL++SITPGTVLIILAGRFKGKRVVFLKQL SGLLLVTGPFKING
Sbjct  70   DVKKPLANRRKPKPTKLKASITPGTVLIILAGRFKGKRVVFLKQLTSGLLLVTGPFKING  129

Query  430  VPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            VPLRRVNQ+YVI T+TKVDI GV++EK DDKYFGK AEKK
Sbjct  130  VPLRRVNQSYVIGTSTKVDISGVSIEKFDDKYFGKVAEKK  169



>ref|XP_009352594.1| PREDICTED: 60S ribosomal protein L6-like isoform X2 [Pyrus x 
bretschneideri]
Length=217

 Score =   244 bits (623),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 142/162 (88%), Gaps = 4/162 (2%)
 Frame = +1

Query  58   MAAK----KSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaek  225
            MAAK    +  RNP+L+RGVGKFSRSK+YHKRGLWAIKAKNGG FP H+ KP A    EK
Sbjct  1    MAAKARNPRKTRNPDLVRGVGKFSRSKMYHKRGLWAIKAKNGGVFPRHDAKPAAETQPEK  60

Query  226  ppkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLV  405
            PPKFYPADDVKKPLVNK KPK TKLR+SITPGTVLIILAGRFKGKRVVFLKQL SGLLLV
Sbjct  61   PPKFYPADDVKKPLVNKRKPKPTKLRASITPGTVLIILAGRFKGKRVVFLKQLSSGLLLV  120

Query  406  TGPFKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFG  531
            TGPFKINGVPLRRVNQ+YVIAT+TKVDI G+NVEK DDKYF 
Sbjct  121  TGPFKINGVPLRRVNQSYVIATSTKVDISGLNVEKFDDKYFA  162



>ref|XP_007202511.1| hypothetical protein PRUPE_ppa010838mg [Prunus persica]
 gb|EMJ03710.1| hypothetical protein PRUPE_ppa010838mg [Prunus persica]
Length=233

 Score =   244 bits (624),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 141/162 (87%), Gaps = 4/162 (2%)
 Frame = +1

Query  58   MAAK----KSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaek  225
            MAAK    +  RNP+L+RGVGKFSRSK+YHKRGLWAIKAKNGG FP H+ KP A    +K
Sbjct  1    MAAKARNPRKTRNPDLVRGVGKFSRSKMYHKRGLWAIKAKNGGVFPRHDAKPAAVTQPQK  60

Query  226  ppkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLV  405
            PPKFYPADDVKKPLVNK K K TKLR+SITPGTVLIILAGRFKGKRVVFLKQLPSGLLLV
Sbjct  61   PPKFYPADDVKKPLVNKRKAKPTKLRASITPGTVLIILAGRFKGKRVVFLKQLPSGLLLV  120

Query  406  TGPFKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFG  531
            TGPFKINGVPLRRVNQAYVI T+TKVDI GVNVEK DDKYF 
Sbjct  121  TGPFKINGVPLRRVNQAYVIGTSTKVDISGVNVEKFDDKYFA  162



>sp|P34091.1|RL6_MESCR RecName: Full=60S ribosomal protein L6; AltName: Full=YL16-like 
[Mesembryanthemum crystallinum]
 emb|CAA49175.1| ribosomal protein YL16 [Mesembryanthemum crystallinum]
Length=234

 Score =   244 bits (624),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNPEL+RG+GK+SRSK+YHKRGLWAIKAKNGG FP H  K   + A EKPPKFYPADDVK
Sbjct  13   RNPELVRGIGKYSRSKMYHKRGLWAIKAKNGGVFPKHAPKSADSKAVEKPPKFYPADDVK  72

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPL+NK KPK TKLR+SITPGTVLIILAGRFKGKRVVFLKQL SGLLLVTGPFK+NGVPL
Sbjct  73   KPLINKRKPKPTKLRASITPGTVLIILAGRFKGKRVVFLKQLSSGLLLVTGPFKVNGVPL  132

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYF  528
            RRVNQAYVIAT+TKVDI GVNVEK DDKYF
Sbjct  133  RRVNQAYVIATSTKVDISGVNVEKFDDKYF  162



>ref|XP_004149609.1| PREDICTED: 60S ribosomal protein L6-like [Cucumis sativus]
 ref|XP_004173570.1| PREDICTED: 60S ribosomal protein L6-like [Cucumis sativus]
 gb|KGN58615.1| hypothetical protein Csa_3G698560 [Cucumis sativus]
Length=231

 Score =   244 bits (623),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNP+LIRGVGK+SRSK+YHKRGLWAIKAKNGG FP H+ KP A   AEKPPKFYPADDVK
Sbjct  10   RNPDLIRGVGKYSRSKMYHKRGLWAIKAKNGGVFPRHDAKPKAEAPAEKPPKFYPADDVK  69

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KP+VNK K K TKLRSSITPGTVLIIL GRFKGKRVVFLKQLPSGLLLVTGPFK+NGVPL
Sbjct  70   KPIVNKRKAKPTKLRSSITPGTVLIILTGRFKGKRVVFLKQLPSGLLLVTGPFKVNGVPL  129

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAE  543
            RRVNQ+YVIAT+TKVDI GV+VEK DDKYF K+ +
Sbjct  130  RRVNQSYVIATSTKVDITGVSVEKFDDKYFSKEVQ  164



>ref|XP_003602484.1| 60S ribosomal protein L6 [Medicago truncatula]
 gb|ACJ84057.1| unknown [Medicago truncatula]
 gb|ACJ84272.1| unknown [Medicago truncatula]
 gb|AES72735.1| 60S ribosomal L6-like protein [Medicago truncatula]
 gb|AFK37280.1| unknown [Medicago truncatula]
Length=233

 Score =   244 bits (624),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNPELIRG+GK+SRS +YHKRGLWAIKAK+GG FP H+     A   EKPPKFYPADDVK
Sbjct  12   RNPELIRGIGKYSRSAMYHKRGLWAIKAKHGGAFPRHDPVAKPAAPVEKPPKFYPADDVK  71

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPL NKHKPK TKLR+SITPGTVLI+LAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL
Sbjct  72   KPLRNKHKPKPTKLRASITPGTVLILLAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  131

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            RRVNQAYVI T+TKVDI  VN +K DDKYF K+++KK
Sbjct  132  RRVNQAYVIGTSTKVDISSVNADKFDDKYFSKESQKK  168



>gb|ACU23780.1| unknown [Glycine max]
Length=232

 Score =   244 bits (623),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 141/162 (87%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   AKKSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYP  243
             +K  RNPELIRG+GK+SRS++YHKRG+WAIKAKNGG  P H+ KP      EKPPKFYP
Sbjct  6    TRKVSRNPELIRGIGKYSRSQMYHKRGIWAIKAKNGGVLPRHDPKPKPETPTEKPPKFYP  65

Query  244  ADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKI  423
            ADDVKKPLVNKHKPK  KLR+SITPGTVLI+LAGRFKGKRVVFLKQLPSGLLLVTGPFK+
Sbjct  66   ADDVKKPLVNKHKPKPAKLRASITPGTVLILLAGRFKGKRVVFLKQLPSGLLLVTGPFKV  125

Query  424  NGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            NGVPLRRVNQAYVI T+TKVD+  VNV   DDKYFGK+A++K
Sbjct  126  NGVPLRRVNQAYVIGTSTKVDVSAVNVNNFDDKYFGKEAQRK  167



>gb|KJB46350.1| hypothetical protein B456_007G361900 [Gossypium raimondii]
Length=233

 Score =   244 bits (623),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 147/168 (88%), Gaps = 4/168 (2%)
 Frame = +1

Query  58   MAAK-KSP---RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaek  225
            MAAK K+P   RNP+LIRGVGK+SRSK+YHKRGLWAIKAKNGG FP HE  P  A A EK
Sbjct  1    MAAKRKTPIKTRNPDLIRGVGKYSRSKMYHKRGLWAIKAKNGGVFPRHEPNPKPATAVEK  60

Query  226  ppkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLV  405
            PPKFYPADDVKKPL+NK KPK TKLR+SITPGTVLI+LAGRF GKRVVFLKQL SGLLLV
Sbjct  61   PPKFYPADDVKKPLLNKRKPKPTKLRASITPGTVLILLAGRFMGKRVVFLKQLTSGLLLV  120

Query  406  TGPFKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            TGPFKINGVPLRRVNQ+YVIAT+TK+DI GVN++K DDKYF K+ E K
Sbjct  121  TGPFKINGVPLRRVNQSYVIATSTKIDISGVNLDKFDDKYFAKEVENK  168



>ref|XP_008460790.1| PREDICTED: 60S ribosomal protein L6-1-like [Cucumis melo]
Length=231

 Score =   244 bits (623),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNPELIRGVGK+SRSK+YHKRGLWAIKAKNGG FP H+ KP A   AEKPPKFYPA DVK
Sbjct  10   RNPELIRGVGKYSRSKMYHKRGLWAIKAKNGGIFPRHDAKPKADSPAEKPPKFYPAVDVK  69

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPLVNK KPK TKLRSSITPGTVLIIL GRFKGKRVVFLKQLPSGLLLVTGPFK+NGVPL
Sbjct  70   KPLVNKRKPKPTKLRSSITPGTVLIILTGRFKGKRVVFLKQLPSGLLLVTGPFKVNGVPL  129

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAE  543
            RRVNQ+YVIAT+TKVDI GVNVEK  DKYF K+ +
Sbjct  130  RRVNQSYVIATSTKVDIAGVNVEKFHDKYFSKEVQ  164



>emb|CDY19222.1| BnaC05g14230D [Brassica napus]
Length=234

 Score =   244 bits (623),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 140/160 (88%), Gaps = 0/160 (0%)
 Frame = +1

Query  70   KSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPAD  249
            K  RNP+LIRGVGK+SRS++YHKRGLWAIKAKNGG FP H+ K   A   EKP KFYPA+
Sbjct  10   KVSRNPDLIRGVGKYSRSQMYHKRGLWAIKAKNGGVFPRHDAKSKVAAPVEKPAKFYPAE  69

Query  250  DVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKING  429
            DVKKPL N+ KPK TKL++SITPGTVLIILAGRFKGKRVVFLKQL SGLLLVTGPFKING
Sbjct  70   DVKKPLANRRKPKPTKLKASITPGTVLIILAGRFKGKRVVFLKQLASGLLLVTGPFKING  129

Query  430  VPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            VPLRRVNQ+YVI T+TKVDI GV++EK DDKYFGK AEKK
Sbjct  130  VPLRRVNQSYVIGTSTKVDISGVSIEKFDDKYFGKVAEKK  169



>ref|XP_006416595.1| hypothetical protein EUTSA_v10008650mg [Eutrema salsugineum]
 gb|ESQ34948.1| hypothetical protein EUTSA_v10008650mg [Eutrema salsugineum]
Length=234

 Score =   244 bits (623),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = +1

Query  70   KSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPAD  249
            K  RNP+LIRGVGK+SRS++YHKRGLWAIKAKNGG FP H+ K       EKP KFYPA+
Sbjct  10   KVSRNPDLIRGVGKYSRSQMYHKRGLWAIKAKNGGVFPRHDAKSKVEAPVEKPAKFYPAE  69

Query  250  DVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKING  429
            DVKKPL N+ KPK TKL+SSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKING
Sbjct  70   DVKKPLANRRKPKPTKLKSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKING  129

Query  430  VPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQA  540
            VPLRRVNQ+YVI T+TKVDI GVNVEK DDKYFGK A
Sbjct  130  VPLRRVNQSYVIGTSTKVDISGVNVEKFDDKYFGKVA  166



>ref|XP_004504016.1| PREDICTED: 60S ribosomal protein L6-3-like isoform X1 [Cicer 
arietinum]
Length=235

 Score =   244 bits (622),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNPELIRG+GK+S+SK+YHKRG+WAIKAKNGG  P H+ KP     AEKPPKFYPADDVK
Sbjct  13   RNPELIRGIGKYSKSKMYHKRGIWAIKAKNGGVLPRHDPKPKPESPAEKPPKFYPADDVK  72

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPL NKHKPK TKLR+SITPGTVLI+LAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL
Sbjct  73   KPLRNKHKPKPTKLRASITPGTVLILLAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  132

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            RRVNQ+YVI T+TKVDI  VNV+K DDKYF K+A KK
Sbjct  133  RRVNQSYVIGTSTKVDISAVNVDKFDDKYFSKEAPKK  169



>gb|KJB16394.1| hypothetical protein B456_002G228400 [Gossypium raimondii]
Length=187

 Score =   242 bits (618),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 149/168 (89%), Gaps = 4/168 (2%)
 Frame = +1

Query  58   MAAK-KSP---RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaek  225
            MAAK K+P   RNP+LIRGVGK+SRSK+YHKRGLWAIKAKNGG FP H+ KP A  AAEK
Sbjct  1    MAAKRKTPVKTRNPDLIRGVGKYSRSKMYHKRGLWAIKAKNGGAFPRHDPKPKAPAAAEK  60

Query  226  ppkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLV  405
            PPKFYPA+DVKKPL+NK KPK TKLR+SITPGTVLI+LAGRF GKRVVFLKQL SGLLLV
Sbjct  61   PPKFYPAEDVKKPLLNKRKPKPTKLRASITPGTVLILLAGRFMGKRVVFLKQLTSGLLLV  120

Query  406  TGPFKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            TGPFKINGVPLRRVNQ+YVIAT+TKVDI GV V+K DDKYF K+ EK+
Sbjct  121  TGPFKINGVPLRRVNQSYVIATSTKVDISGVIVDKFDDKYFAKEVEKR  168



>gb|KHN29114.1| 60S ribosomal protein L6 [Glycine soja]
Length=253

 Score =   244 bits (623),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 129/173 (75%), Positives = 146/173 (84%), Gaps = 2/173 (1%)
 Frame = +1

Query  31   ETAIVA*SSMAAKKSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaa  210
            E AI+A      +K  RNPELIRG+GK+SRS++YHKRG+WAIKAKNGG  P H  KP   
Sbjct  19   EEAIMA--PKITRKVSRNPELIRGIGKYSRSQMYHKRGIWAIKAKNGGVLPRHGPKPKPE  76

Query  211  paaekppkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPS  390
              AEKPPKFYPADDVKKPLVNKHKPK  KLR+SITPGTVLI+LAGRFKGKRVVFLKQLPS
Sbjct  77   TPAEKPPKFYPADDVKKPLVNKHKPKPAKLRASITPGTVLILLAGRFKGKRVVFLKQLPS  136

Query  391  GLLLVTGPFKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            GLLLVTGPFKINGVPLRRVNQ+YVI T+TK ++  VNV++ DDKYF K+A+KK
Sbjct  137  GLLLVTGPFKINGVPLRRVNQSYVIGTSTKANVSAVNVDQFDDKYFAKEAQKK  189



>gb|KJB16393.1| hypothetical protein B456_002G228400 [Gossypium raimondii]
Length=184

 Score =   242 bits (617),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 149/168 (89%), Gaps = 4/168 (2%)
 Frame = +1

Query  58   MAAK-KSP---RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaek  225
            MAAK K+P   RNP+LIRGVGK+SRSK+YHKRGLWAIKAKNGG FP H+ KP A  AAEK
Sbjct  1    MAAKRKTPVKTRNPDLIRGVGKYSRSKMYHKRGLWAIKAKNGGAFPRHDPKPKAPAAAEK  60

Query  226  ppkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLV  405
            PPKFYPA+DVKKPL+NK KPK TKLR+SITPGTVLI+LAGRF GKRVVFLKQL SGLLLV
Sbjct  61   PPKFYPAEDVKKPLLNKRKPKPTKLRASITPGTVLILLAGRFMGKRVVFLKQLTSGLLLV  120

Query  406  TGPFKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            TGPFKINGVPLRRVNQ+YVIAT+TKVDI GV V+K DDKYF K+ EK+
Sbjct  121  TGPFKINGVPLRRVNQSYVIATSTKVDISGVIVDKFDDKYFAKEVEKR  168



>ref|XP_008240963.1| PREDICTED: 60S ribosomal protein L6-3-like [Prunus mume]
Length=233

 Score =   243 bits (621),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 131/162 (81%), Positives = 141/162 (87%), Gaps = 4/162 (2%)
 Frame = +1

Query  58   MAAK----KSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaek  225
            MAAK    +  RNP+L+RGVGKFSRSK+YHKRGLWAIKAKNGG FP H+ KP A    +K
Sbjct  1    MAAKARNPRKTRNPDLVRGVGKFSRSKMYHKRGLWAIKAKNGGVFPRHDAKPAAETQPQK  60

Query  226  ppkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLV  405
            PPKFYPADDV+KPLVNK K K TKLR++ITPGTVLIILAGRFKGKRVVFLKQLPSGLLLV
Sbjct  61   PPKFYPADDVRKPLVNKRKAKPTKLRATITPGTVLIILAGRFKGKRVVFLKQLPSGLLLV  120

Query  406  TGPFKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFG  531
            TGPFKINGVPLRRVNQAYVI T+TKVDI GVNVEK DDKYF 
Sbjct  121  TGPFKINGVPLRRVNQAYVIGTSTKVDISGVNVEKFDDKYFA  162



>ref|XP_007159761.1| hypothetical protein PHAVU_002G265000g [Phaseolus vulgaris]
 gb|ESW31755.1| hypothetical protein PHAVU_002G265000g [Phaseolus vulgaris]
Length=233

 Score =   243 bits (621),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +1

Query  64   AKKSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYP  243
             +K  RNPELIRG+GK+SRS++YHKRG+WAIKAKNGG FP H+  P     A+KPPKFYP
Sbjct  7    TRKVSRNPELIRGIGKYSRSQMYHKRGIWAIKAKNGGVFPRHDPTPKPETPAQKPPKFYP  66

Query  244  ADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKI  423
            ADDVKKPL+NKHKPK+TKLR+S+TPGTVLI+LAGRFKGKRVVFLKQLPSGLLLVTGPFKI
Sbjct  67   ADDVKKPLLNKHKPKITKLRASVTPGTVLILLAGRFKGKRVVFLKQLPSGLLLVTGPFKI  126

Query  424  NGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYF  528
            NGVPLRRVNQ+YVIAT+TKVD+  VNV+K DDKYF
Sbjct  127  NGVPLRRVNQSYVIATSTKVDVSAVNVDKFDDKYF  161



>emb|CDY26150.1| BnaA06g12670D [Brassica napus]
Length=234

 Score =   243 bits (621),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 140/160 (88%), Gaps = 0/160 (0%)
 Frame = +1

Query  70   KSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPAD  249
            K  RNP+LIRGVGK+SRS++YHKRGLWAIKAKNGG FP H+ K       EKPPKFYPA+
Sbjct  10   KVSRNPDLIRGVGKYSRSQMYHKRGLWAIKAKNGGVFPRHDAKSKVEAPVEKPPKFYPAE  69

Query  250  DVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKING  429
            DVKKPL N+ KPK TKL++SITPGTVLIILAGRFKGKRVVFLKQL SGLLLVTGPFKING
Sbjct  70   DVKKPLANRRKPKPTKLKASITPGTVLIILAGRFKGKRVVFLKQLASGLLLVTGPFKING  129

Query  430  VPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            VPLRRVNQ+YVI T+TKVDI GV++EK DDKYFGK AEKK
Sbjct  130  VPLRRVNQSYVIGTSTKVDISGVSIEKFDDKYFGKVAEKK  169



>emb|CDX96510.1| BnaA07g31210D [Brassica napus]
Length=233

 Score =   243 bits (620),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 128/160 (80%), Positives = 141/160 (88%), Gaps = 0/160 (0%)
 Frame = +1

Query  70   KSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPAD  249
            K  RNP+LIRGVGK+SRS++YHKRGLWAIKAKNGG FP H+ K  A    EKPPKFYPA+
Sbjct  9    KVSRNPDLIRGVGKYSRSQMYHKRGLWAIKAKNGGVFPRHDAKSKADAPVEKPPKFYPAE  68

Query  250  DVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKING  429
            DVKKPL N+  PK TKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLV+GPFKING
Sbjct  69   DVKKPLANRRNPKPTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVSGPFKING  128

Query  430  VPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            VPLRRVNQ+YVI T+TKVDI GV+++K DDKYFGK AEKK
Sbjct  129  VPLRRVNQSYVIGTSTKVDISGVSLDKFDDKYFGKVAEKK  168



>ref|XP_002524802.1| 60S ribosomal protein L6, putative [Ricinus communis]
 gb|EEF37645.1| 60S ribosomal protein L6, putative [Ricinus communis]
Length=231

 Score =   243 bits (620),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNP L+RG+GK+SRS++YHKRGLWAIKAKNGG FP H+ KP  A  AEKPPKFYPADD+K
Sbjct  10   RNPNLVRGIGKYSRSQMYHKRGLWAIKAKNGGVFPKHDPKPKPASPAEKPPKFYPADDIK  69

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPL NK KPK TKLR+SITPGTVLIILAGRFKGKRVVFLKQL SGLLLVTGPFKINGVPL
Sbjct  70   KPLHNKRKPKPTKLRASITPGTVLIILAGRFKGKRVVFLKQLSSGLLLVTGPFKINGVPL  129

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            RRVNQ+YVIAT+TKVDI GVN +K DDKYF KQAEK+
Sbjct  130  RRVNQSYVIATSTKVDISGVNADKFDDKYFAKQAEKR  166



>ref|XP_006294925.1| hypothetical protein CARUB_v10023978mg [Capsella rubella]
 gb|EOA27823.1| hypothetical protein CARUB_v10023978mg [Capsella rubella]
Length=194

 Score =   242 bits (617),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNP+LIRGVGK+SRS++YHKRGLWAIKAKNGG FP H+         EKP KFYPA+DVK
Sbjct  13   RNPDLIRGVGKYSRSQMYHKRGLWAIKAKNGGVFPRHDATSKVVAPVEKPAKFYPAEDVK  72

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPL NK KPK TKL+SSITPGTVLIILAGRFKGKRVVFLKQL SGLLLVTGPFKINGVPL
Sbjct  73   KPLANKRKPKPTKLKSSITPGTVLIILAGRFKGKRVVFLKQLSSGLLLVTGPFKINGVPL  132

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAE  543
            RRVNQAYVI T+TKVDI GV+ EK DDKYFGK AE
Sbjct  133  RRVNQAYVIGTSTKVDISGVDTEKFDDKYFGKVAE  167



>gb|KJB16391.1| hypothetical protein B456_002G228400 [Gossypium raimondii]
Length=233

 Score =   243 bits (620),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 149/168 (89%), Gaps = 4/168 (2%)
 Frame = +1

Query  58   MAAK-KSP---RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaek  225
            MAAK K+P   RNP+LIRGVGK+SRSK+YHKRGLWAIKAKNGG FP H+ KP A  AAEK
Sbjct  1    MAAKRKTPVKTRNPDLIRGVGKYSRSKMYHKRGLWAIKAKNGGAFPRHDPKPKAPAAAEK  60

Query  226  ppkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLV  405
            PPKFYPA+DVKKPL+NK KPK TKLR+SITPGTVLI+LAGRF GKRVVFLKQL SGLLLV
Sbjct  61   PPKFYPAEDVKKPLLNKRKPKPTKLRASITPGTVLILLAGRFMGKRVVFLKQLTSGLLLV  120

Query  406  TGPFKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            TGPFKINGVPLRRVNQ+YVIAT+TKVDI GV V+K DDKYF K+ EK+
Sbjct  121  TGPFKINGVPLRRVNQSYVIATSTKVDISGVIVDKFDDKYFAKEVEKR  168



>ref|XP_008367370.1| PREDICTED: 60S ribosomal protein L6-like [Malus domestica]
Length=233

 Score =   243 bits (619),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 143/162 (88%), Gaps = 4/162 (2%)
 Frame = +1

Query  58   MAAK----KSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaek  225
            MAAK    +  RNP+L+RG GKFSRSK+YHKRGLWAIKAKNGG FP H+ KP A  A+EK
Sbjct  1    MAAKARNPRKTRNPDLVRGXGKFSRSKMYHKRGLWAIKAKNGGVFPSHDPKPAAETASEK  60

Query  226  ppkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLV  405
            PPKFYPADDVKKPLVNK KPK TKLR+SIT GT+LIILAGRFKGKRVVFLKQLPSGLLLV
Sbjct  61   PPKFYPADDVKKPLVNKRKPKPTKLRASITRGTLLIILAGRFKGKRVVFLKQLPSGLLLV  120

Query  406  TGPFKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFG  531
            TGPFKINGVPLRRVNQ+YVIAT+TKVDI GVNVEK DDKYF 
Sbjct  121  TGPFKINGVPLRRVNQSYVIATSTKVDISGVNVEKFDDKYFA  162



>ref|XP_009106063.1| PREDICTED: 60S ribosomal protein L6-2 [Brassica rapa]
Length=233

 Score =   243 bits (619),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 141/160 (88%), Gaps = 0/160 (0%)
 Frame = +1

Query  70   KSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPAD  249
            K  RNP+LIRG+GK+SRS++YHKRGLWAIKAKNGG FP H+ K  A    EKPPKFYPA+
Sbjct  9    KVSRNPDLIRGIGKYSRSQMYHKRGLWAIKAKNGGVFPRHDAKSKADAPVEKPPKFYPAE  68

Query  250  DVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKING  429
            DVKKPL N+  PK TKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLV+GPFKING
Sbjct  69   DVKKPLANRRNPKPTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVSGPFKING  128

Query  430  VPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            VPLRRVNQ+YVI T+TKVDI GV+++K DDKYFGK AEKK
Sbjct  129  VPLRRVNQSYVIGTSTKVDISGVSLDKFDDKYFGKVAEKK  168



>ref|XP_006294924.1| hypothetical protein CARUB_v10023978mg [Capsella rubella]
 gb|EOA27822.1| hypothetical protein CARUB_v10023978mg [Capsella rubella]
Length=234

 Score =   243 bits (619),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNP+LIRGVGK+SRS++YHKRGLWAIKAKNGG FP H+         EKP KFYPA+DVK
Sbjct  13   RNPDLIRGVGKYSRSQMYHKRGLWAIKAKNGGVFPRHDATSKVVAPVEKPAKFYPAEDVK  72

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPL NK KPK TKL+SSITPGTVLIILAGRFKGKRVVFLKQL SGLLLVTGPFKINGVPL
Sbjct  73   KPLANKRKPKPTKLKSSITPGTVLIILAGRFKGKRVVFLKQLSSGLLLVTGPFKINGVPL  132

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAE  543
            RRVNQAYVI T+TKVDI GV+ EK DDKYFGK AE
Sbjct  133  RRVNQAYVIGTSTKVDISGVDTEKFDDKYFGKVAE  167



>ref|XP_003531382.1| PREDICTED: 60S ribosomal protein L6-1-like [Glycine max]
Length=232

 Score =   243 bits (619),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 140/162 (86%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   AKKSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYP  243
             +K  RNPELIRG+GK+SRS++YHKRG+WAIKAKNGG  P H+ KP      EKPPKFYP
Sbjct  6    TRKVSRNPELIRGIGKYSRSQMYHKRGIWAIKAKNGGVLPRHDPKPKPETPTEKPPKFYP  65

Query  244  ADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKI  423
            ADDVKKPLVNKHKPK  KLR+SITPGTVLI+LAGRFKGKRVVFLKQLPSGLLLVTGPFK+
Sbjct  66   ADDVKKPLVNKHKPKPAKLRASITPGTVLILLAGRFKGKRVVFLKQLPSGLLLVTGPFKV  125

Query  424  NGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            NGVPLRRVNQAYVI T+TKVD+  VNV   DDKYF K+A++K
Sbjct  126  NGVPLRRVNQAYVIGTSTKVDVSAVNVNNFDDKYFAKEAQRK  167



>ref|XP_007218306.1| hypothetical protein PRUPE_ppa010851mg [Prunus persica]
 gb|EMJ19505.1| hypothetical protein PRUPE_ppa010851mg [Prunus persica]
Length=233

 Score =   243 bits (619),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNP+LIRG+GK+SRSK+YHKRGLWAIKAKNGG FP H+KKP A   A KPPKFYPADDVK
Sbjct  12   RNPDLIRGIGKYSRSKMYHKRGLWAIKAKNGGAFPRHDKKPAADVPAVKPPKFYPADDVK  71

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPLVNK KPK TKLR+SITPGTVLI+LAGRFKGKRVVFLKQL SGLLLVTGPFKINGVPL
Sbjct  72   KPLVNKRKPKPTKLRNSITPGTVLILLAGRFKGKRVVFLKQLSSGLLLVTGPFKINGVPL  131

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAE  543
            RRVNQAYVI T+TKVDI GVNV+K DDKYF K+ +
Sbjct  132  RRVNQAYVIGTSTKVDISGVNVDKFDDKYFAKEVQ  166



>ref|XP_007221500.1| hypothetical protein PRUPE_ppa010844mg [Prunus persica]
 gb|EMJ22699.1| hypothetical protein PRUPE_ppa010844mg [Prunus persica]
Length=233

 Score =   243 bits (619),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNP+LIRGVGKFSRSK+YHKRGLWAIKAKNGG FP H+ KP A    +KPPKFYPADDVK
Sbjct  12   RNPDLIRGVGKFSRSKMYHKRGLWAIKAKNGGVFPRHDPKPAAETPTQKPPKFYPADDVK  71

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPLVNK KPK T LR+SITPGTVLIILAGRFKGKRV+FLKQL SGLLLVTGPFKINGVPL
Sbjct  72   KPLVNKRKPKPTNLRASITPGTVLIILAGRFKGKRVIFLKQLTSGLLLVTGPFKINGVPL  131

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFG  531
            RRVNQ+YVIAT+TKVDI GVNVEK DDKYF 
Sbjct  132  RRVNQSYVIATSTKVDISGVNVEKFDDKYFA  162



>ref|XP_009365032.1| PREDICTED: 60S ribosomal protein L6-1-like [Pyrus x bretschneideri]
Length=233

 Score =   243 bits (619),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNP+LIRG+GK+SRSK+YHKRGLWAIKAKNGG FP HEKKP A   A KPPKFYPADDVK
Sbjct  12   RNPDLIRGIGKYSRSKMYHKRGLWAIKAKNGGAFPCHEKKPAADAPAVKPPKFYPADDVK  71

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPLVNK KPK TKLR+SITPGTVLIILAGRFKGKRVVFLKQL SGLLLVTGPFKINGVPL
Sbjct  72   KPLVNKRKPKPTKLRASITPGTVLIILAGRFKGKRVVFLKQLSSGLLLVTGPFKINGVPL  131

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAE  543
            RRVNQ+YVI T+TK+DI GVNV+K DDKYF K+ +
Sbjct  132  RRVNQSYVIGTSTKIDISGVNVDKFDDKYFAKEVQ  166



>ref|XP_006303330.1| hypothetical protein CARUB_v10010178mg [Capsella rubella]
 gb|EOA36228.1| hypothetical protein CARUB_v10010178mg [Capsella rubella]
Length=193

 Score =   241 bits (615),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNP+L+RGVGK+SRS++YHKRGLWAIKAKNGG FP H+ K       EKP KFYPA+DVK
Sbjct  13   RNPDLVRGVGKYSRSQMYHKRGLWAIKAKNGGAFPRHDAKSKVDAPVEKPAKFYPAEDVK  72

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPL N+ KPK TKL++SITPGTVLIILAGRFKGKRVVFLKQL SGLLLVTGPFKINGVPL
Sbjct  73   KPLANRRKPKPTKLKASITPGTVLIILAGRFKGKRVVFLKQLSSGLLLVTGPFKINGVPL  132

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAE  543
            RRVNQAYVI T+TKVDI GVN EK DDKYFGK AE
Sbjct  133  RRVNQAYVIGTSTKVDISGVNTEKFDDKYFGKVAE  167



>ref|XP_009354690.1| PREDICTED: 60S ribosomal protein L6-1-like [Pyrus x bretschneideri]
Length=233

 Score =   242 bits (618),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNP+LIRG+GK+SRSK+YHKRGLWAIKAKNGG FP H+KKP A   A KPPKFYPADDVK
Sbjct  12   RNPDLIRGIGKYSRSKMYHKRGLWAIKAKNGGTFPCHDKKPAADAPAVKPPKFYPADDVK  71

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPLVNK KPK TKLR+SITPGTVLI+LAGRFKGKRVVFLKQL SGLLLVTGPFKINGVPL
Sbjct  72   KPLVNKRKPKPTKLRASITPGTVLILLAGRFKGKRVVFLKQLSSGLLLVTGPFKINGVPL  131

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            RRVNQ+YVI T+TK+DI GVNV+K DDKYF K+ + K
Sbjct  132  RRVNQSYVIGTSTKIDISGVNVDKFDDKYFAKEVQAK  168



>ref|XP_008387243.1| PREDICTED: 60S ribosomal protein L6-like [Malus domestica]
Length=233

 Score =   242 bits (618),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 134/162 (83%), Positives = 142/162 (88%), Gaps = 4/162 (2%)
 Frame = +1

Query  58   MAAK----KSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaek  225
            MAAK    +  RNP+L+RGVGKFSRSK+YHKRGLWAIKAKNGG FP H+ KP A  A EK
Sbjct  1    MAAKARNPRKTRNPDLVRGVGKFSRSKMYHKRGLWAIKAKNGGVFPCHDPKPAAETAPEK  60

Query  226  ppkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLV  405
            PPKFYPADDVKKPLVNK KPK TKLR+SIT GTVLIILAGRFKGKRVVFLKQLPSGLLLV
Sbjct  61   PPKFYPADDVKKPLVNKRKPKPTKLRASITXGTVLIILAGRFKGKRVVFLKQLPSGLLLV  120

Query  406  TGPFKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFG  531
            TGPFKINGVPLRRVNQ+YVI T+TKVDI GVNVEK DDKYF 
Sbjct  121  TGPFKINGVPLRRVNQSYVIGTSTKVDISGVNVEKFDDKYFA  162



>ref|XP_010067894.1| PREDICTED: 60S ribosomal protein L6 [Eucalyptus grandis]
 gb|KCW66136.1| hypothetical protein EUGRSUZ_G03401 [Eucalyptus grandis]
Length=228

 Score =   242 bits (617),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 139/158 (88%), Gaps = 1/158 (1%)
 Frame = +1

Query  58   MAAKKSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkF  237
            MA K+S RNPELIRGVGKFSRSK+YHKRGLWAIKAKNGG FP H+     +PAA KP KF
Sbjct  1    MAPKQS-RNPELIRGVGKFSRSKMYHKRGLWAIKAKNGGVFPRHDPVAKPSPAAAKPSKF  59

Query  238  YPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPF  417
            YPADDVKKPL+NK  P+ TKLR+SI PGTVLIILAGRFKGKRVVFLKQL SGLLL+TGPF
Sbjct  60   YPADDVKKPLLNKRNPRPTKLRASIAPGTVLIILAGRFKGKRVVFLKQLSSGLLLITGPF  119

Query  418  KINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFG  531
            K+NGVPLRRVNQ+YVIAT+TKVD+ GVNVEK DDKYF 
Sbjct  120  KVNGVPLRRVNQSYVIATSTKVDVSGVNVEKFDDKYFA  157



>ref|XP_011074965.1| PREDICTED: 60S ribosomal protein L6-like [Sesamum indicum]
Length=231

 Score =   242 bits (618),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNPELI GV K SRSK+YHKRGLWAIKAKNGGKFPHH+K P A P  EKPPKFYPADD+K
Sbjct  10   RNPELIPGVRKISRSKMYHKRGLWAIKAKNGGKFPHHDKAPAATPVVEKPPKFYPADDIK  69

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPL NK KPK TKLR+SI PGTVLI+LAGRFKGKRVVFLKQL SGLLLVTGP+KINGVPL
Sbjct  70   KPLSNKRKPKPTKLRASIIPGTVLILLAGRFKGKRVVFLKQLSSGLLLVTGPYKINGVPL  129

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAE  543
            RRVNQAYVI T+TKVDI GVNVEK DDKYF KQ E
Sbjct  130  RRVNQAYVIGTSTKVDISGVNVEKFDDKYFAKQVE  164



>ref|XP_010416238.1| PREDICTED: 60S ribosomal protein L6-3 [Camelina sativa]
Length=233

 Score =   242 bits (618),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNP+LIRGVGK+SRS++YHKRGLWAIKAKNGG FP H+ K      AEKPPKFYPA+DVK
Sbjct  12   RNPDLIRGVGKYSRSQMYHKRGLWAIKAKNGGVFPRHDAKSKVDAPAEKPPKFYPAEDVK  71

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPL N+  PK TKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL
Sbjct  72   KPLANRRTPKPTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  131

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAE  543
            RRVNQAYVI T+TKVDI GV ++K DDKYFGK AE
Sbjct  132  RRVNQAYVIGTSTKVDISGVTLDKFDDKYFGKVAE  166



>ref|XP_009128023.1| PREDICTED: 60S ribosomal protein L6-3-like [Brassica rapa]
Length=233

 Score =   242 bits (618),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 128/160 (80%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = +1

Query  70   KSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPAD  249
            K  RNP+LIRGVGK+SRS++YHKRGLWAIKAKNGG FP H+ K   A  AEKPPKFYPA+
Sbjct  9    KVSRNPDLIRGVGKYSRSQMYHKRGLWAIKAKNGGVFPRHDAKSKVAAVAEKPPKFYPAE  68

Query  250  DVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKING  429
            DVKKPL N+ K K TKLRSSITPGTVL+ILAGRFKGKRVVFLKQLPSGLLLV+GPFKING
Sbjct  69   DVKKPLANRRKAKPTKLRSSITPGTVLMILAGRFKGKRVVFLKQLPSGLLLVSGPFKING  128

Query  430  VPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            VPLRRVNQ+YVI T+TKVD+ GV++EK DDKYFGK AEKK
Sbjct  129  VPLRRVNQSYVIGTSTKVDVSGVSLEKFDDKYFGKVAEKK  168



>ref|XP_006303329.1| hypothetical protein CARUB_v10010178mg [Capsella rubella]
 gb|EOA36227.1| hypothetical protein CARUB_v10010178mg [Capsella rubella]
Length=234

 Score =   242 bits (618),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNP+L+RGVGK+SRS++YHKRGLWAIKAKNGG FP H+ K       EKP KFYPA+DVK
Sbjct  13   RNPDLVRGVGKYSRSQMYHKRGLWAIKAKNGGAFPRHDAKSKVDAPVEKPAKFYPAEDVK  72

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPL N+ KPK TKL++SITPGTVLIILAGRFKGKRVVFLKQL SGLLLVTGPFKINGVPL
Sbjct  73   KPLANRRKPKPTKLKASITPGTVLIILAGRFKGKRVVFLKQLSSGLLLVTGPFKINGVPL  132

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAE  543
            RRVNQAYVI T+TKVDI GVN EK DDKYFGK AE
Sbjct  133  RRVNQAYVIGTSTKVDISGVNTEKFDDKYFGKVAE  167



>ref|XP_002513192.1| 60S ribosomal protein L6, putative [Ricinus communis]
 gb|EEF49183.1| 60S ribosomal protein L6, putative [Ricinus communis]
Length=233

 Score =   242 bits (618),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNP+L+RG+GK+SRS++YHKRGLWAIKAKNGG FP H+ KP  A  AEKPPKFYPADDVK
Sbjct  12   RNPDLVRGIGKYSRSQMYHKRGLWAIKAKNGGVFPKHDPKPKPAAPAEKPPKFYPADDVK  71

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPL+NK KPK TKLR+SITPGTVLIILAGRFKGKRVVFLKQL SGLLL+TGPFKINGVPL
Sbjct  72   KPLLNKRKPKPTKLRASITPGTVLIILAGRFKGKRVVFLKQLSSGLLLITGPFKINGVPL  131

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQA  540
            RRVNQ+YVIAT+TKVDI GVNV+K DDK+F KQA
Sbjct  132  RRVNQSYVIATSTKVDISGVNVDKFDDKFFAKQA  165



>gb|AFK35906.1| unknown [Lotus japonicus]
Length=233

 Score =   242 bits (617),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 144/166 (87%), Gaps = 4/166 (2%)
 Frame = +1

Query  58   MAAKKSP----RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaek  225
            MAAK+      RNP+LIRG+GK+S+S++YHKRG+WA+KAKNGG FPHH+ KP     A K
Sbjct  1    MAAKQRTKRVTRNPDLIRGIGKYSKSQMYHKRGIWALKAKNGGAFPHHDPKPKPEAPAVK  60

Query  226  ppkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLV  405
             PKFYPADDVKKPL+NKHKP+ TKLR+SITPGTVLI+L GRFKGKRVVFLKQLPSGLLLV
Sbjct  61   APKFYPADDVKKPLLNKHKPRPTKLRASITPGTVLILLVGRFKGKRVVFLKQLPSGLLLV  120

Query  406  TGPFKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAE  543
            TGP+KINGVPLRRVNQ+YVI T+TKVD+  VNV+K DDKYF K+A+
Sbjct  121  TGPYKINGVPLRRVNQSYVIGTSTKVDVSAVNVDKFDDKYFSKEAQ  166



>gb|KJB15039.1| hypothetical protein B456_002G156900 [Gossypium raimondii]
Length=234

 Score =   242 bits (617),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 146/167 (87%), Gaps = 5/167 (3%)
 Frame = +1

Query  58   MAAK-KSP---RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaek  225
            MAAK K+P   RNP+LIRGVGK+SRSK+YHKRGLWAIKAKNGG FP H+ KP A  AA +
Sbjct  1    MAAKRKTPVKSRNPDLIRGVGKYSRSKMYHKRGLWAIKAKNGGVFPRHDPKPKAPAAAAE  60

Query  226  ppk-FYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLL  402
             P  FYPA+DVKKPL+NK KPK TKLR+SITPGTVLI+LAGRF GKRVVFLKQLPSGLLL
Sbjct  61   KPPKFYPAEDVKKPLLNKRKPKPTKLRASITPGTVLILLAGRFMGKRVVFLKQLPSGLLL  120

Query  403  VTGPFKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAE  543
            VTGPFKINGVPLRRVNQ+YVIAT+TKVDI GVNVEK DDKYF K+ +
Sbjct  121  VTGPFKINGVPLRRVNQSYVIATSTKVDISGVNVEKFDDKYFAKEVD  167



>gb|ABX71676.1| 60S ribosomal protein L6-like protein [Panax quinquefolius]
Length=233

 Score =   242 bits (617),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = +1

Query  70   KSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPAD  249
            K+ RNP+LIRGVGKFSRSK+YHKRGLWAIKAKNGG FP H  KP A  A  KPPKFYPAD
Sbjct  9    KTTRNPDLIRGVGKFSRSKMYHKRGLWAIKAKNGGVFPRHGSKPAALEAVVKPPKFYPAD  68

Query  250  DVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKING  429
            DVKKPLVNK K K TKLR+SITPGTVLIILAGRFKGKRVVFLKQL SGLLL+TGPFKING
Sbjct  69   DVKKPLVNKRKEKPTKLRASITPGTVLIILAGRFKGKRVVFLKQLTSGLLLITGPFKING  128

Query  430  VPLRRVNQAYVIATATKVDICGVNVEKIDDKYFG  531
            VPLRRVNQ+YVIAT+TKVD+ GVNVEK DDKYF 
Sbjct  129  VPLRRVNQSYVIATSTKVDVSGVNVEKYDDKYFA  162



>ref|NP_001235724.1| uncharacterized protein LOC100500022 [Glycine max]
 gb|ACU14632.1| unknown [Glycine max]
Length=231

 Score =   241 bits (616),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 141/162 (87%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   AKKSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYP  243
             +K  RNPELIRG+GK+SRS++YHKRG+WAIKAKNGG  P H  KP     AEKPPKFYP
Sbjct  6    TRKVSRNPELIRGIGKYSRSQMYHKRGIWAIKAKNGGVLPRHGPKPKPETPAEKPPKFYP  65

Query  244  ADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKI  423
            ADDVKKPLVNKHKPK  KLR+SITPGTVLI+LAGRFKGKRVVFLKQLPSGLLLVTGPFKI
Sbjct  66   ADDVKKPLVNKHKPKPAKLRASITPGTVLILLAGRFKGKRVVFLKQLPSGLLLVTGPFKI  125

Query  424  NGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            NGVPLRRVNQ+YVI T+TK ++  VNVE+ DDKYF K+A+KK
Sbjct  126  NGVPLRRVNQSYVIGTSTKANVSAVNVEQFDDKYFTKEAQKK  167



>gb|KDP43428.1| hypothetical protein JCGZ_16715 [Jatropha curcas]
Length=231

 Score =   241 bits (616),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNP+L+RG+ K+SRSK+YHKRGLWAIKAK+GG FP H+ KP  A  AEKP KFYPADDVK
Sbjct  10   RNPDLVRGIAKYSRSKMYHKRGLWAIKAKHGGVFPKHDPKPKPAAPAEKPVKFYPADDVK  69

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPL+NK KPK TKLR+SITPGTVLIILAGRFKGKRVVFLKQL SGLLLVTGPFKINGVPL
Sbjct  70   KPLLNKRKPKPTKLRASITPGTVLIILAGRFKGKRVVFLKQLSSGLLLVTGPFKINGVPL  129

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQA  540
            RRVNQ+YVIAT+TKVDI GVNV+K DDKYF KQA
Sbjct  130  RRVNQSYVIATSTKVDIAGVNVDKFDDKYFAKQA  163



>ref|XP_010257392.1| PREDICTED: 60S ribosomal protein L6-like [Nelumbo nucifera]
Length=233

 Score =   241 bits (616),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNP+LIRGVGK+SRS++YHKRGLWAIKAKNGG FP H+ KP     AEKPPKFYPADDVK
Sbjct  12   RNPDLIRGVGKYSRSQMYHKRGLWAIKAKNGGVFPRHDAKPAEPKPAEKPPKFYPADDVK  71

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPLVNK  P  TKLR+SITPGTVLI+LAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL
Sbjct  72   KPLVNKRNPNPTKLRASITPGTVLILLAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  131

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYF  528
            RRVNQ+YVIAT+TKVDI GVNVEK DDKYF
Sbjct  132  RRVNQSYVIATSTKVDISGVNVEKFDDKYF  161



>ref|XP_010471497.1| PREDICTED: 60S ribosomal protein L6-3-like [Camelina sativa]
Length=233

 Score =   241 bits (616),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNP+LIRGVGK+SRS++YHKRGLWAIKAKNGG FP H+ K      AEKPPKFYPA+DVK
Sbjct  12   RNPDLIRGVGKYSRSQMYHKRGLWAIKAKNGGVFPRHDAKSKVDTPAEKPPKFYPAEDVK  71

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPL N+  PK TKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFK+NGVPL
Sbjct  72   KPLANRRTPKPTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKVNGVPL  131

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAE  543
            RRVNQAYVI T+TKVDI GV ++K DDKYFGK AE
Sbjct  132  RRVNQAYVIGTSTKVDISGVTLDKFDDKYFGKVAE  166



>ref|XP_010416240.1| PREDICTED: 60S ribosomal protein L6-3-like [Camelina sativa]
Length=233

 Score =   241 bits (616),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNP+LIRGVGK+SRS++YHKRGLWAIKAKNGG FP H+ K      AEKPPKFYPA+DVK
Sbjct  12   RNPDLIRGVGKYSRSQMYHKRGLWAIKAKNGGVFPRHDAKSKVGAPAEKPPKFYPAEDVK  71

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPL N+  PK TKLRSSITPGTVLIILAGRFKGKRVVFLKQL SGLLLV+GPFK+NGVPL
Sbjct  72   KPLANRRTPKPTKLRSSITPGTVLIILAGRFKGKRVVFLKQLASGLLLVSGPFKVNGVPL  131

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            RRVNQAYVI T+TKVDI GV V+K DDKYFGK AEKK
Sbjct  132  RRVNQAYVIGTSTKVDISGVTVDKFDDKYFGKVAEKK  168



>ref|XP_002299962.1| 60S ribosomal protein L6 [Populus trichocarpa]
 gb|EEE84767.1| 60S ribosomal protein L6 [Populus trichocarpa]
Length=232

 Score =   241 bits (616),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 141/160 (88%), Gaps = 3/160 (2%)
 Frame = +1

Query  58   MAAKKSP---RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekp  228
            MA +K+P   RNP+L+RG+GK+SRS++YHKRGLWAIKAKNGG FP H  K  A  +AEKP
Sbjct  1    MAPRKTPQVTRNPDLVRGIGKYSRSQMYHKRGLWAIKAKNGGVFPKHAPKAKAPTSAEKP  60

Query  229  pkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVT  408
            PKFYPADDVKKPL NK KPK TKLR SITPGTVLIILAGRFKGKRVVFLKQL SGLLLVT
Sbjct  61   PKFYPADDVKKPLPNKRKPKPTKLRDSITPGTVLIILAGRFKGKRVVFLKQLTSGLLLVT  120

Query  409  GPFKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYF  528
            GPFKINGVPLRRVNQ+Y+IAT+TKVDI GVNVEK DDKYF
Sbjct  121  GPFKINGVPLRRVNQSYLIATSTKVDISGVNVEKFDDKYF  160



>ref|XP_002893003.1| 60S ribosomal protein L6 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69262.1| 60S ribosomal protein L6 [Arabidopsis lyrata subsp. lyrata]
Length=234

 Score =   241 bits (616),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 135/154 (88%), Gaps = 0/154 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNP+LIRGVGK+SRS++YHKRGLWAIKAKNGG FP H+ K       EKP KFYPA+DVK
Sbjct  13   RNPDLIRGVGKYSRSQMYHKRGLWAIKAKNGGVFPRHDAKSKVDAPVEKPAKFYPAEDVK  72

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPLVN+ KPK TKL+SSITPGTVLIILAGRFKGKRVVFLKQL SGLLLVTGPFKINGVPL
Sbjct  73   KPLVNRRKPKPTKLKSSITPGTVLIILAGRFKGKRVVFLKQLSSGLLLVTGPFKINGVPL  132

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQA  540
            RRVNQAYVI T+TK+DI GVN EK DDKYFGK A
Sbjct  133  RRVNQAYVIGTSTKIDISGVNTEKFDDKYFGKVA  166



>ref|XP_009356996.1| PREDICTED: 60S ribosomal protein L6-like [Pyrus x bretschneideri]
Length=233

 Score =   241 bits (615),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 142/162 (88%), Gaps = 4/162 (2%)
 Frame = +1

Query  58   MAAK----KSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaek  225
            MAAK    +  RNP+L+RGVGKFSRSK+YHKRGLWAIKAKNGG FP H+ KP A  A+EK
Sbjct  1    MAAKARNPRKTRNPDLVRGVGKFSRSKMYHKRGLWAIKAKNGGVFPSHDPKPAAEIASEK  60

Query  226  ppkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLV  405
            PPKFYPADDVKKPLVNK KPK T LR+ ITPGTVLIIL+GRFKGKRVVFLKQLPSGLLLV
Sbjct  61   PPKFYPADDVKKPLVNKRKPKPTTLRAIITPGTVLIILSGRFKGKRVVFLKQLPSGLLLV  120

Query  406  TGPFKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFG  531
            TGPFKINGVPLRRVNQ+YVI T+TKVDI GVNVEK DDKYF 
Sbjct  121  TGPFKINGVPLRRVNQSYVIGTSTKVDISGVNVEKFDDKYFA  162



>ref|XP_008350104.1| PREDICTED: 60S ribosomal protein L6-1-like [Malus domestica]
Length=233

 Score =   241 bits (615),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNP+LIRG+GK+SRSK+YHKRGLWAIKAKNGG FP HEKKP A   A KPPKFYPADDVK
Sbjct  12   RNPDLIRGIGKYSRSKMYHKRGLWAIKAKNGGAFPCHEKKPAADAPAVKPPKFYPADDVK  71

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPLVNK KPK TKLR+SITPGTVLIILAGRFKGKRVVFLKQL SGLLLVTGPFKINGVPL
Sbjct  72   KPLVNKRKPKXTKLRASITPGTVLIILAGRFKGKRVVFLKQLSSGLLLVTGPFKINGVPL  131

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAE  543
            RRVNQ+YVI T+TK+DI GVN +K DDKYF K+ +
Sbjct  132  RRVNQSYVIGTSTKIDISGVNXDKFDDKYFAKEVQ  166



>ref|XP_009149298.1| PREDICTED: 60S ribosomal protein L6-1 [Brassica rapa]
Length=234

 Score =   241 bits (615),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 138/160 (86%), Gaps = 0/160 (0%)
 Frame = +1

Query  70   KSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPAD  249
            K  RNP+LIRGVGK+SRS++YHKRGLWAIKAKNGG FP H+ K       EKP KFYPA+
Sbjct  10   KVSRNPDLIRGVGKYSRSQMYHKRGLWAIKAKNGGVFPRHDAKSKVEAPVEKPAKFYPAE  69

Query  250  DVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKING  429
            DVKKPL N+ KPK TKL++SITPGTVLIILAGRFKGKRVVFLKQL SGLLLVTGPFKING
Sbjct  70   DVKKPLANRRKPKPTKLKASITPGTVLIILAGRFKGKRVVFLKQLASGLLLVTGPFKING  129

Query  430  VPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            VPLRRVNQ+Y+I T+TKVDI GV +EK DDKYFGK AEKK
Sbjct  130  VPLRRVNQSYMIGTSTKVDISGVIIEKFDDKYFGKVAEKK  169



>ref|XP_011100659.1| PREDICTED: 60S ribosomal protein L6-like [Sesamum indicum]
Length=216

 Score =   240 bits (613),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNPE I GV K SRSK+YHKRGLWAI AKNGGKFPHH+K P A P  EKPPKFYPADD+K
Sbjct  10   RNPEFIPGVRKISRSKMYHKRGLWAINAKNGGKFPHHDKAPAATPVVEKPPKFYPADDIK  69

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPL NK KPK TKLR+SI PGTVLI+LAGRFKGKRVVFLKQLPSGLLLVTGP+KINGVPL
Sbjct  70   KPLSNKQKPKPTKLRASIIPGTVLILLAGRFKGKRVVFLKQLPSGLLLVTGPYKINGVPL  129

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAE  543
             RVNQAYVI T+TKVDI GVNVEK DDKYF KQ E
Sbjct  130  SRVNQAYVIGTSTKVDISGVNVEKFDDKYFAKQVE  164



>emb|CDY66361.1| BnaAnng22110D [Brassica napus]
Length=233

 Score =   241 bits (614),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 140/160 (88%), Gaps = 0/160 (0%)
 Frame = +1

Query  70   KSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPAD  249
            K  RNP+LIRGVGK+SRS++YHKRGLWAIKAKNGG FP H+ K      AEKPPKFYPA+
Sbjct  9    KVSRNPDLIRGVGKYSRSQMYHKRGLWAIKAKNGGVFPRHDAKSKVDAVAEKPPKFYPAE  68

Query  250  DVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKING  429
            DVKKPL N+ K   TKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLV+GPFKING
Sbjct  69   DVKKPLANRRKANPTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVSGPFKING  128

Query  430  VPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            VPLRRVNQ+YVI T+TKVD+ GV++EK DDKYFGK AEKK
Sbjct  129  VPLRRVNQSYVIGTSTKVDVSGVSLEKFDDKYFGKVAEKK  168



>ref|XP_008231333.1| PREDICTED: 60S ribosomal protein L6-3-like [Prunus mume]
Length=233

 Score =   241 bits (614),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNP+LIRG+GK+SRSK+YHKRGLWAIKAKNGG FP H+KKP A   A KPPKFYPADDVK
Sbjct  12   RNPDLIRGIGKYSRSKMYHKRGLWAIKAKNGGAFPRHDKKPAADVPAVKPPKFYPADDVK  71

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
             PLVNK KPK TKLR SITPGTVLI+LAGRFKGKRVVFLKQL SGLLLVTGPFKINGVPL
Sbjct  72   TPLVNKRKPKPTKLRDSITPGTVLILLAGRFKGKRVVFLKQLSSGLLLVTGPFKINGVPL  131

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAE  543
            RRVNQAYVI T+TKVDI GVNV+K DDKYF K+ +
Sbjct  132  RRVNQAYVIGTSTKVDISGVNVDKFDDKYFSKEVQ  166



>ref|XP_003618018.1| 60S ribosomal protein L6 [Medicago truncatula]
 gb|AET00977.1| 60S ribosomal L6-like protein [Medicago truncatula]
Length=234

 Score =   241 bits (614),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 142/162 (88%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   AKKSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYP  243
            A +  RN +LIRG+GKFS+S++YHK+G+W IKAKNGG FPHH+ KP    A EKPPKFYP
Sbjct  8    ASRVSRNSDLIRGIGKFSKSQMYHKKGIWVIKAKNGGVFPHHDPKPKPETAVEKPPKFYP  67

Query  244  ADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKI  423
            ADDVKKPL NKHKPK TKLR+SITPGTVLI+LAGRFKGKRVVFLKQLPSGLLLVTGPFKI
Sbjct  68   ADDVKKPLRNKHKPKQTKLRASITPGTVLILLAGRFKGKRVVFLKQLPSGLLLVTGPFKI  127

Query  424  NGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            NGVPLR VNQAYVI T+TKVDI GVNV+ +DDKYF K+A KK
Sbjct  128  NGVPLRCVNQAYVIGTSTKVDISGVNVDNLDDKYFSKEAPKK  169



>gb|KHG19752.1| 60S ribosomal L6 [Gossypium arboreum]
Length=233

 Score =   241 bits (614),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 143/166 (86%), Gaps = 3/166 (2%)
 Frame = +1

Query  61   AAKKSP---RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekpp  231
            A +K+P   RNP+LIRGVGK+SRSK+YHKRGLWAIKAKNGG FP HE  P    A EKPP
Sbjct  3    AERKTPIKTRNPDLIRGVGKYSRSKMYHKRGLWAIKAKNGGVFPRHEPNPKPTTAVEKPP  62

Query  232  kFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTG  411
            KFYPADDVKKPL+NK K K TKLR+SITPGTVLI+LAGRF GKRVVFLKQL SGLLLVTG
Sbjct  63   KFYPADDVKKPLLNKRKTKPTKLRASITPGTVLILLAGRFMGKRVVFLKQLSSGLLLVTG  122

Query  412  PFKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            PFKINGVPLRRVNQ+YVIAT+TK+DI GVN++K DDKYF K+ E K
Sbjct  123  PFKINGVPLRRVNQSYVIATSTKIDISGVNLDKFDDKYFAKEVENK  168



>ref|XP_010032395.1| PREDICTED: 60S ribosomal protein L6-like [Eucalyptus grandis]
Length=234

 Score =   240 bits (613),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 128/163 (79%), Positives = 140/163 (86%), Gaps = 5/163 (3%)
 Frame = +1

Query  58   MAAKKS-----PRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaae  222
            MAA KS      RNPELIRG+GK+SRS++YHKRGLWAIKAKNGG FP H+  P  AP A 
Sbjct  1    MAAAKSKSGKGSRNPELIRGIGKYSRSRMYHKRGLWAIKAKNGGAFPRHDPAPKPAPPAA  60

Query  223  kppkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLL  402
            K PKFYPADDVKKPL+NK  P+ TKLR S++PGTVLIILAGRFKGKRVVFLKQLPSGLLL
Sbjct  61   KAPKFYPADDVKKPLLNKRTPRPTKLRPSVSPGTVLIILAGRFKGKRVVFLKQLPSGLLL  120

Query  403  VTGPFKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFG  531
            +TGPFKINGVPLRRVNQ+YVIAT+TKVDI GVNVEK DDKYF 
Sbjct  121  ITGPFKINGVPLRRVNQSYVIATSTKVDISGVNVEKFDDKYFA  163



>gb|KHG02479.1| 60S ribosomal protein L6-3 [Gossypium arboreum]
Length=239

 Score =   240 bits (613),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 147/170 (86%), Gaps = 8/170 (5%)
 Frame = +1

Query  58   MAAK-KSP---RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaa----p  213
            MAAK K+P   RNP+LIRGVGK+SRSK+YHKRGLWAIKAKNGG FP H+ +         
Sbjct  1    MAAKRKTPVKSRNPDLIRGVGKYSRSKMYHKRGLWAIKAKNGGFFPRHDPRHDPKPKVPA  60

Query  214  aaekppkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSG  393
            +AEKPPKFYPA+DVKKPL+NK KPK TKLR+SITPGTVLI+LAGRF GKRVVFLKQLPSG
Sbjct  61   SAEKPPKFYPAEDVKKPLLNKRKPKPTKLRASITPGTVLILLAGRFMGKRVVFLKQLPSG  120

Query  394  LLLVTGPFKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAE  543
            LLLVTGPFKINGVPLRRVNQ+YVIAT+TKVDI GVNVEK DDKYF K+ +
Sbjct  121  LLLVTGPFKINGVPLRRVNQSYVIATSTKVDISGVNVEKFDDKYFAKEVD  170



>gb|KHG02478.1| 60S ribosomal protein L6-3 [Gossypium arboreum]
Length=237

 Score =   240 bits (613),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 147/170 (86%), Gaps = 8/170 (5%)
 Frame = +1

Query  58   MAAK-KSP---RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaa----p  213
            MAAK K+P   RNP+LIRGVGK+SRSK+YHKRGLWAIKAKNGG FP H+ +         
Sbjct  1    MAAKRKTPVKSRNPDLIRGVGKYSRSKMYHKRGLWAIKAKNGGFFPRHDPRHDPKPKVPA  60

Query  214  aaekppkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSG  393
            +AEKPPKFYPA+DVKKPL+NK KPK TKLR+SITPGTVLI+LAGRF GKRVVFLKQLPSG
Sbjct  61   SAEKPPKFYPAEDVKKPLLNKRKPKPTKLRASITPGTVLILLAGRFMGKRVVFLKQLPSG  120

Query  394  LLLVTGPFKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAE  543
            LLLVTGPFKINGVPLRRVNQ+YVIAT+TKVDI GVNVEK DDKYF K+ +
Sbjct  121  LLLVTGPFKINGVPLRRVNQSYVIATSTKVDISGVNVEKFDDKYFAKEVD  170



>ref|XP_002313280.1| 60S ribosomal protein L6 [Populus trichocarpa]
 gb|ABK93076.1| unknown [Populus trichocarpa]
 gb|EEE87235.1| 60S ribosomal protein L6 [Populus trichocarpa]
Length=232

 Score =   240 bits (612),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 128/160 (80%), Positives = 139/160 (87%), Gaps = 3/160 (2%)
 Frame = +1

Query  58   MAAKKSP---RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekp  228
            MA +K+P   RNP+L+RG+GK+SRS++YHKRGLWAIKAKNGG FP H  K   A  AEKP
Sbjct  1    MAPRKTPQVSRNPDLVRGIGKYSRSQMYHKRGLWAIKAKNGGVFPKHAPKVKDAAPAEKP  60

Query  229  pkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVT  408
            PKFYPADDVKKPL N+ KPK TKLR SITPGTVLIIL GRFKGKRVVFLKQLPSGLLLVT
Sbjct  61   PKFYPADDVKKPLPNRRKPKPTKLRDSITPGTVLIILVGRFKGKRVVFLKQLPSGLLLVT  120

Query  409  GPFKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYF  528
            GPFKINGVPLRRVNQ+YVI T+TKVDI GVNVEK DDKYF
Sbjct  121  GPFKINGVPLRRVNQSYVIGTSTKVDISGVNVEKFDDKYF  160



>ref|XP_006390473.1| hypothetical protein EUTSA_v10019079mg [Eutrema salsugineum]
 dbj|BAJ34166.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ27759.1| hypothetical protein EUTSA_v10019079mg [Eutrema salsugineum]
Length=233

 Score =   239 bits (611),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = +1

Query  70   KSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPAD  249
            K  RNP+LIRGVGK+SRS++YHKRGLWAIKAKNGG FP H+ K     AAEKPPKFYPA+
Sbjct  9    KVSRNPDLIRGVGKYSRSQMYHKRGLWAIKAKNGGVFPRHDAKSKVDAAAEKPPKFYPAE  68

Query  250  DVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKING  429
            DVKKPL N+ KPK TKLR+SITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKING
Sbjct  69   DVKKPLANRRKPKPTKLRASITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKING  128

Query  430  VPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQA  540
            VPLRRVNQ+YVI T+TKVDI GV+++K DDKYFGK A
Sbjct  129  VPLRRVNQSYVIGTSTKVDISGVSLDKFDDKYFGKVA  165



>ref|XP_010547238.1| PREDICTED: 60S ribosomal protein L6-3-like [Tarenaya hassleriana]
Length=232

 Score =   239 bits (611),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNP+LIRGVGKFSRSK+YHKRGLWAIKAKNGGKFPHH+ KP     AEK PKFYPA+DVK
Sbjct  11   RNPDLIRGVGKFSRSKMYHKRGLWAIKAKNGGKFPHHDPKPKPEAPAEKAPKFYPAEDVK  70

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPLVNK K K TKLR+SITPGTVLIILAGRFKGKRVVFLKQL SGLLLVTGPF++NGVPL
Sbjct  71   KPLVNKRKLKPTKLRASITPGTVLIILAGRFKGKRVVFLKQLSSGLLLVTGPFRVNGVPL  130

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQA  540
            RRVNQ+YVI T+TKVDI  VNV+K DDKYF K A
Sbjct  131  RRVNQSYVIGTSTKVDISAVNVDKFDDKYFAKVA  164



>ref|XP_006390471.1| hypothetical protein EUTSA_v10019083mg [Eutrema salsugineum]
 gb|ESQ27757.1| hypothetical protein EUTSA_v10019083mg [Eutrema salsugineum]
Length=233

 Score =   239 bits (610),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = +1

Query  70   KSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPAD  249
            K  RNP+LIRGVGK+SRS++YHKRGLWAIKAKNGG FP H+ K      AEKPPKFYPA+
Sbjct  9    KVSRNPDLIRGVGKYSRSQMYHKRGLWAIKAKNGGVFPRHDAKSKVDTTAEKPPKFYPAE  68

Query  250  DVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKING  429
            DVKKPL N+ KPK TKLR+SITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKING
Sbjct  69   DVKKPLANRRKPKPTKLRASITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKING  128

Query  430  VPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGK  534
            VPLRRVNQ+YVI T+TKVDI GV+++K DDKYFGK
Sbjct  129  VPLRRVNQSYVIGTSTKVDISGVSLDKFDDKYFGK  163



>gb|KHN29113.1| 60S ribosomal protein L6 [Glycine soja]
Length=232

 Score =   239 bits (609),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 138/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   AKKSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYP  243
             +K  RNPELIRG+GK+SRS++YH  G+WAIKAKNGG  P H+ KP      EKPPKFYP
Sbjct  6    TRKVSRNPELIRGIGKYSRSQMYHNSGIWAIKAKNGGVLPRHDPKPKPETPTEKPPKFYP  65

Query  244  ADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKI  423
            ADDVKKPLVNKHKPK  KLR+SITPGTVLI+LAGRFKGKRVVFLKQLPSGLLLVTGPFK+
Sbjct  66   ADDVKKPLVNKHKPKPAKLRASITPGTVLILLAGRFKGKRVVFLKQLPSGLLLVTGPFKV  125

Query  424  NGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            NGVPLRRVNQAYVI T+TKVD+  VNV   DDKYF K+A++K
Sbjct  126  NGVPLRRVNQAYVIGTSTKVDVSAVNVNNFDDKYFAKEAQRK  167



>ref|XP_010471499.1| PREDICTED: 60S ribosomal protein L6-3-like [Camelina sativa]
Length=233

 Score =   239 bits (609),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNP+LIRGVGK+SRS++YHKRGLWAIKAKNGG FP H+ K      AEKPPKFYPA+DVK
Sbjct  12   RNPDLIRGVGKYSRSQMYHKRGLWAIKAKNGGVFPRHDAKSKVDAPAEKPPKFYPAEDVK  71

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPL N+   K TKLRSSITPGTVLIILAGRFKGKRVVFLKQL SGLLLV+GPFK+NGVPL
Sbjct  72   KPLANRRTQKPTKLRSSITPGTVLIILAGRFKGKRVVFLKQLASGLLLVSGPFKVNGVPL  131

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            RRVNQAYVI T+TKVDI GV V+K DDKYFGK AEKK
Sbjct  132  RRVNQAYVIGTSTKVDISGVTVDKFDDKYFGKVAEKK  168



>gb|KHN49031.1| 60S ribosomal protein L6 [Glycine soja]
Length=232

 Score =   238 bits (608),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 141/160 (88%), Gaps = 3/160 (2%)
 Frame = +1

Query  58   MAAKK---SPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekp  228
            MA KK   + RNP+L+RG+GK+SRS++YHKRG+WAIKAKNGG  P H+ KP     A+KP
Sbjct  1    MAPKKPRTTTRNPDLVRGIGKYSRSQMYHKRGIWAIKAKNGGVLPRHDPKPKPEAPAQKP  60

Query  229  pkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVT  408
            PKFYPADDVKKPLVNKHKPK  KLR+SITPGTVLI+LAGRFKGKRVVFLKQLPSGLLLVT
Sbjct  61   PKFYPADDVKKPLVNKHKPKPAKLRASITPGTVLILLAGRFKGKRVVFLKQLPSGLLLVT  120

Query  409  GPFKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYF  528
            GPFKINGVPLRRVNQ+YVI T+TKVDI GVNV+K DDKYF
Sbjct  121  GPFKINGVPLRRVNQSYVIGTSTKVDISGVNVDKFDDKYF  160



>ref|XP_008387244.1| PREDICTED: 60S ribosomal protein L6-like [Malus domestica]
Length=233

 Score =   238 bits (608),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNP+L+RGVGKFSRSK+YHKRGLWAIKAKNGG FP H+ KP A  A EKP KFYPADDVK
Sbjct  12   RNPDLVRGVGKFSRSKMYHKRGLWAIKAKNGGVFPCHDPKPAAETAPEKPXKFYPADDVK  71

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPLVNK KPK TKLR+SIT G VLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL
Sbjct  72   KPLVNKRKPKPTKLRASITXGXVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  131

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFG  531
            RRVNQ+YVI T+TKVDI GVNVEK DDKYF 
Sbjct  132  RRVNQSYVIGTSTKVDISGVNVEKFDDKYFA  162



>ref|XP_003546871.1| PREDICTED: 60S ribosomal protein L6-like [Glycine max]
Length=232

 Score =   238 bits (608),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 141/160 (88%), Gaps = 3/160 (2%)
 Frame = +1

Query  58   MAAKK---SPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekp  228
            MA KK   + RNP+L+RG+GK+SRS++YHKRG+WAIKAKNGG  P H+ KP     A+KP
Sbjct  1    MAPKKPRTTTRNPDLVRGIGKYSRSQMYHKRGIWAIKAKNGGVLPRHDPKPKPEAPAQKP  60

Query  229  pkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVT  408
            PKFYPADDVKKPLVNKHKPK  KLR+SITPGTVLI+LAGRFKGKRVVFLKQLPSGLLLVT
Sbjct  61   PKFYPADDVKKPLVNKHKPKPAKLRASITPGTVLILLAGRFKGKRVVFLKQLPSGLLLVT  120

Query  409  GPFKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYF  528
            GPFKINGVPLRRVNQ+YVI T+TKVDI GVNV+K DDKYF
Sbjct  121  GPFKINGVPLRRVNQSYVIGTSTKVDISGVNVDKFDDKYF  160



>ref|XP_010477034.1| PREDICTED: 60S ribosomal protein L6-1-like [Camelina sativa]
Length=234

 Score =   238 bits (607),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNP+LIRGVGK+SRS++YHKRGLWAIKAKNGG FP H+ K       EKP KFYPA+DVK
Sbjct  13   RNPDLIRGVGKYSRSQMYHKRGLWAIKAKNGGVFPRHDAKSKVDAPVEKPAKFYPAEDVK  72

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPL N+ KP  TKL++SITPGTVLIILAGRFKGKRVVFLKQL SGLLLVTGPFKINGVPL
Sbjct  73   KPLPNRRKPNPTKLKASITPGTVLIILAGRFKGKRVVFLKQLSSGLLLVTGPFKINGVPL  132

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQA  540
            RRVNQAYVI T+TKVDI GVNVEK DDKYFGK A
Sbjct  133  RRVNQAYVIGTSTKVDISGVNVEKFDDKYFGKVA  166



>ref|XP_011025023.1| PREDICTED: 60S ribosomal protein L6-like [Populus euphratica]
 ref|XP_011025024.1| PREDICTED: 60S ribosomal protein L6-like [Populus euphratica]
Length=232

 Score =   238 bits (607),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 128/160 (80%), Positives = 140/160 (88%), Gaps = 3/160 (2%)
 Frame = +1

Query  58   MAAKKSP---RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekp  228
            MA +K+P   RNP+L+RG+GK+SRS++YHKRGLWAIKAKNGG FP H  K  A  +AEKP
Sbjct  1    MAPRKTPQVTRNPDLVRGIGKYSRSQMYHKRGLWAIKAKNGGVFPKHAPKVKAPTSAEKP  60

Query  229  pkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVT  408
            PKFYPADDVKKPL NK K K TKLR S+TPGTVLIILAGRFKGKRVVFLKQL SGLLLVT
Sbjct  61   PKFYPADDVKKPLPNKRKLKPTKLRDSVTPGTVLIILAGRFKGKRVVFLKQLTSGLLLVT  120

Query  409  GPFKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYF  528
            GPFKINGVPLRRVNQ YVIAT+TKVDI GVNVEK+DDKYF
Sbjct  121  GPFKINGVPLRRVNQCYVIATSTKVDISGVNVEKLDDKYF  160



>ref|XP_010498252.1| PREDICTED: 60S ribosomal protein L6-1 [Camelina sativa]
Length=234

 Score =   238 bits (607),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNP+LIRGVGK+SRS++YHKRGLWAIKAKNGG FP H+ K       EKP KFYPA+DVK
Sbjct  13   RNPDLIRGVGKYSRSQMYHKRGLWAIKAKNGGVFPRHDAKSKVDAPVEKPAKFYPAEDVK  72

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPL N+ KP  TKL++SITPGTVLIILAGRFKGKRVVFLKQL SGLLLVTGPFKINGVPL
Sbjct  73   KPLANRRKPNPTKLKASITPGTVLIILAGRFKGKRVVFLKQLSSGLLLVTGPFKINGVPL  132

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQA  540
            RRVNQAYVI T+TKVDI GVN EK DDKYFGK A
Sbjct  133  RRVNQAYVIGTSTKVDISGVNTEKFDDKYFGKVA  166



>ref|XP_007028937.1| 60S ribosomal protein L6-1 [Theobroma cacao]
 gb|EOY09439.1| 60S ribosomal protein L6-1 [Theobroma cacao]
Length=233

 Score =   238 bits (606),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNP+LIRGVGK+SRSK+YHKRGLWAIKAKNGG FP H+ KP A  AAEK PKFYPADDVK
Sbjct  12   RNPDLIRGVGKYSRSKMYHKRGLWAIKAKNGGVFPRHDPKPKAPAAAEKLPKFYPADDVK  71

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPL+NK KPK TKLR+SITPGTVLI+LAGRF GKRVVFLKQL SGLLLVTGPFKINGVPL
Sbjct  72   KPLLNKRKPKPTKLRASITPGTVLILLAGRFMGKRVVFLKQLTSGLLLVTGPFKINGVPL  131

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFG  531
            RRVNQ+YVIAT+TKVDI G+NVEK DDKYF 
Sbjct  132  RRVNQSYVIATSTKVDISGLNVEKFDDKYFA  162



>ref|XP_010428369.1| PREDICTED: 60S ribosomal protein L6-3-like [Camelina sativa]
 ref|XP_010428371.1| PREDICTED: 60S ribosomal protein L6-3-like [Camelina sativa]
Length=233

 Score =   238 bits (606),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNP+LIRGVGK+SRS++YHKRGLWAIKAKNGG FP H+ K      AEKPPKFYPA+DVK
Sbjct  12   RNPDLIRGVGKYSRSQMYHKRGLWAIKAKNGGVFPRHDAKSKVDTPAEKPPKFYPAEDVK  71

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPL N+  PK TKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLV+GPFK+NGVPL
Sbjct  72   KPLPNRRTPKPTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVSGPFKVNGVPL  131

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAE  543
            RRVNQAYVI T+TKVDI GV ++K DDKYF K AE
Sbjct  132  RRVNQAYVIGTSTKVDISGVTLDKFDDKYFAKVAE  166



>emb|CDP10719.1| unnamed protein product [Coffea canephora]
Length=233

 Score =   237 bits (605),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 137/164 (84%), Gaps = 4/164 (2%)
 Frame = +1

Query  58   MAAK--KSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekp-  228
            MAAK  K  RNP+LIRGVGK+SRSK+YHKRGLWAIKAK+GG FP H KK           
Sbjct  1    MAAKQKKVSRNPDLIRGVGKYSRSKMYHKRGLWAIKAKHGGAFPTHPKKAPEEVKPAVEK  60

Query  229  -pkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLV  405
              KFYPADDVKKPL NK KPK TKLR+SITPGTVLIILAGRFKGKRVVFLKQL SGLLLV
Sbjct  61   PAKFYPADDVKKPLANKRKPKPTKLRASITPGTVLIILAGRFKGKRVVFLKQLTSGLLLV  120

Query  406  TGPFKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQ  537
            TGPFKINGVPLRRVNQ+YVIAT+TKVDI GV+++K DDKYF KQ
Sbjct  121  TGPFKINGVPLRRVNQSYVIATSTKVDISGVSLDKFDDKYFAKQ  164



>gb|KHG17855.1| 60S ribosomal L6 [Gossypium arboreum]
Length=232

 Score =   237 bits (605),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 131/162 (81%), Positives = 143/162 (88%), Gaps = 4/162 (2%)
 Frame = +1

Query  58   MAAK-KSP---RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaek  225
            MAAK K+P   RNP+LIRGVGK+SRSK+YHKRGLWAIKAK+GG FP H+ KP A  A EK
Sbjct  1    MAAKRKTPVKTRNPDLIRGVGKYSRSKMYHKRGLWAIKAKHGGVFPRHDPKPKAPVAPEK  60

Query  226  ppkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLV  405
             PKFYPA+DVKKPL+NK KPK TKLR+SITPGTVLI+LAGRF GKRVVFLKQL SGLLLV
Sbjct  61   APKFYPAEDVKKPLLNKRKPKPTKLRASITPGTVLILLAGRFMGKRVVFLKQLTSGLLLV  120

Query  406  TGPFKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFG  531
            TGPFKINGVPLRRVNQ+YVIAT+TKVDI GVNVEK DDKYF 
Sbjct  121  TGPFKINGVPLRRVNQSYVIATSTKVDISGVNVEKYDDKYFA  162



>gb|KJB76631.1| hypothetical protein B456_012G100600 [Gossypium raimondii]
Length=187

 Score =   235 bits (600),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 130/162 (80%), Positives = 143/162 (88%), Gaps = 4/162 (2%)
 Frame = +1

Query  58   MAAK-KSP---RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaek  225
            MAAK K+P   RNP+LIRGVGK+SRSK+YHKRGLWAIKAK+GG FP H+ KP A  A EK
Sbjct  1    MAAKRKTPVKTRNPDLIRGVGKYSRSKMYHKRGLWAIKAKHGGVFPRHDPKPKAPVAPEK  60

Query  226  ppkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLV  405
             PKFYPA+DVKKPL+NK KPK TKLR+SITPGTVLI+LAGRF GKRVVFLKQL SGLLLV
Sbjct  61   APKFYPAEDVKKPLLNKRKPKPTKLRASITPGTVLILLAGRFMGKRVVFLKQLTSGLLLV  120

Query  406  TGPFKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFG  531
            TGPFKINGVPLRR+NQ+YVIAT+TKVDI GVNVEK DDKYF 
Sbjct  121  TGPFKINGVPLRRLNQSYVIATSTKVDISGVNVEKFDDKYFA  162



>gb|KFK44022.1| hypothetical protein AALP_AA1G205000 [Arabis alpina]
Length=233

 Score =   237 bits (604),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = +1

Query  70   KSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPAD  249
            K  RNP+L+RGV KFSR K+YHK G WAIKAKNGG FPHH+ K       EKP KFYPA+
Sbjct  9    KVSRNPDLVRGVSKFSRHKMYHKSGKWAIKAKNGGVFPHHDAKSKVEAPVEKPAKFYPAE  68

Query  250  DVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKING  429
            DVKKPL N+ KPK TKL+SSITPGTVLIILAGRFKGKRVVFLKQL SGLLLVTGPFKING
Sbjct  69   DVKKPLANRRKPKPTKLKSSITPGTVLIILAGRFKGKRVVFLKQLASGLLLVTGPFKING  128

Query  430  VPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQA  540
            VPLRRVNQAYVI T+TKVDI GV++EK+DDKYFGK A
Sbjct  129  VPLRRVNQAYVIGTSTKVDISGVSIEKLDDKYFGKVA  165



>ref|XP_010428373.1| PREDICTED: 60S ribosomal protein L6-2-like [Camelina sativa]
Length=233

 Score =   237 bits (604),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNP+LIRGVGK+SRS++YHKRGLWAIKAKNGG FP H+ K      AEKPPKFYPA+DVK
Sbjct  12   RNPDLIRGVGKYSRSQMYHKRGLWAIKAKNGGVFPRHDAKSKVDAPAEKPPKFYPAEDVK  71

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPL N+   K TKLRSSITPGTVLIILAGRFKGKRVVFLKQL SGLLLV+GPFK+NGVPL
Sbjct  72   KPLANRRTQKPTKLRSSITPGTVLIILAGRFKGKRVVFLKQLASGLLLVSGPFKVNGVPL  131

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            RRVNQAYVI T+TKVDI GV V+K DDKYF K AEKK
Sbjct  132  RRVNQAYVIGTSTKVDISGVTVDKFDDKYFAKVAEKK  168



>gb|KJB76628.1| hypothetical protein B456_012G100600 [Gossypium raimondii]
 gb|KJB76629.1| hypothetical protein B456_012G100600 [Gossypium raimondii]
 gb|KJB76630.1| hypothetical protein B456_012G100600 [Gossypium raimondii]
 gb|KJB76632.1| hypothetical protein B456_012G100600 [Gossypium raimondii]
Length=232

 Score =   236 bits (603),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 130/162 (80%), Positives = 143/162 (88%), Gaps = 4/162 (2%)
 Frame = +1

Query  58   MAAK-KSP---RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaek  225
            MAAK K+P   RNP+LIRGVGK+SRSK+YHKRGLWAIKAK+GG FP H+ KP A  A EK
Sbjct  1    MAAKRKTPVKTRNPDLIRGVGKYSRSKMYHKRGLWAIKAKHGGVFPRHDPKPKAPVAPEK  60

Query  226  ppkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLV  405
             PKFYPA+DVKKPL+NK KPK TKLR+SITPGTVLI+LAGRF GKRVVFLKQL SGLLLV
Sbjct  61   APKFYPAEDVKKPLLNKRKPKPTKLRASITPGTVLILLAGRFMGKRVVFLKQLTSGLLLV  120

Query  406  TGPFKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFG  531
            TGPFKINGVPLRR+NQ+YVIAT+TKVDI GVNVEK DDKYF 
Sbjct  121  TGPFKINGVPLRRLNQSYVIATSTKVDISGVNVEKFDDKYFA  162



>ref|XP_007153319.1| hypothetical protein PHAVU_003G025200g [Phaseolus vulgaris]
 gb|ESW25313.1| hypothetical protein PHAVU_003G025200g [Phaseolus vulgaris]
Length=232

 Score =   236 bits (602),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 137/157 (87%), Gaps = 3/157 (2%)
 Frame = +1

Query  58   MAAKK---SPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekp  228
            MA KK   + RNPELIRG+GK+SRS++YHKRG+WAIKAKNGG FP H   P     A+KP
Sbjct  1    MAPKKPRSTSRNPELIRGIGKYSRSQMYHKRGIWAIKAKNGGAFPRHAPTPKPDAPAQKP  60

Query  229  pkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVT  408
            PKFYPADDVKKPLVNKHKPK  KLR+S+TPGTVLI+LAGRFKGKRVVFLKQLPSGLLLVT
Sbjct  61   PKFYPADDVKKPLVNKHKPKPAKLRASVTPGTVLILLAGRFKGKRVVFLKQLPSGLLLVT  120

Query  409  GPFKINGVPLRRVNQAYVIATATKVDICGVNVEKIDD  519
            GPFKINGVPLRRVNQ+YVI T+TKVDI GVNV++ DD
Sbjct  121  GPFKINGVPLRRVNQSYVIGTSTKVDISGVNVDRFDD  157



>ref|XP_010089731.1| 60S ribosomal protein L6 [Morus notabilis]
 gb|EXB38292.1| 60S ribosomal protein L6 [Morus notabilis]
Length=360

 Score =   240 bits (613),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 144/168 (86%), Gaps = 4/168 (2%)
 Frame = +1

Query  58   MAAK----KSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaek  225
            MAAK    +  RNP+LI+GVGK+SRS++YHKRGLWAIKAKNGG FP H+ KP      +K
Sbjct  1    MAAKARNPRKTRNPDLIKGVGKYSRSQMYHKRGLWAIKAKNGGVFPRHDPKPAIDSPLQK  60

Query  226  ppkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLV  405
            PPKFYPADDVKKPLVNK KPK TKLR+SIT GTVLIILAGRFKGKRVVFLKQL SGLLLV
Sbjct  61   PPKFYPADDVKKPLVNKRKPKPTKLRASITLGTVLIILAGRFKGKRVVFLKQLSSGLLLV  120

Query  406  TGPFKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            TGPFKINGVPLRRVNQ+YVI T+TKVDI GVNVEK DDKYF KQ+ +K
Sbjct  121  TGPFKINGVPLRRVNQSYVIGTSTKVDISGVNVEKFDDKYFAKQSGRK  168



>ref|XP_010672706.1| PREDICTED: 60S ribosomal protein L6-like [Beta vulgaris subsp. 
vulgaris]
Length=230

 Score =   236 bits (601),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = +1

Query  67   KKSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPA  246
            +K  RNP+L++G+GKFSRSK+YHKRGLWAIKAKNGG FP H  K  A   AEKP KFYPA
Sbjct  5    RKVSRNPDLVKGIGKFSRSKMYHKRGLWAIKAKNGGVFPTHPPKSAAPAQAEKPAKFYPA  64

Query  247  DDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKIN  426
            DDVKKPL+NK KPK TKLR+SITPGTVLI+LAGRFKGKRVVFLKQL SGLLL+TGPFKIN
Sbjct  65   DDVKKPLINKRKPKPTKLRASITPGTVLIVLAGRFKGKRVVFLKQLSSGLLLITGPFKIN  124

Query  427  GVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFG  531
            GVPLRRVNQAYVI T+TKVD+ GV+V  IDDK+F 
Sbjct  125  GVPLRRVNQAYVIGTSTKVDVSGVDVSSIDDKFFA  159



>emb|CDX73042.1| BnaC06g34900D [Brassica napus]
Length=233

 Score =   236 bits (602),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = +1

Query  70   KSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPAD  249
            K  RNP+LIRGVGK+SRS++YHKRGLWAIKAKN G FP H+ K  A   AEKP KFYPA+
Sbjct  9    KVSRNPDLIRGVGKYSRSQMYHKRGLWAIKAKNDGVFPRHDAKSKADAPAEKPSKFYPAE  68

Query  250  DVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKING  429
            DVKKPL N+  PK TKLRS+I+PGTVLIILAGRFKGKRVVFLKQLPSGLLLV+GPFKING
Sbjct  69   DVKKPLANRRNPKPTKLRSNISPGTVLIILAGRFKGKRVVFLKQLPSGLLLVSGPFKING  128

Query  430  VPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            VPLRRVNQ+YVI T+TKV I GV+++K DDKYFGK AEKK
Sbjct  129  VPLRRVNQSYVIGTSTKVGISGVSLDKFDDKYFGKVAEKK  168



>ref|XP_002888961.1| 60S ribosomal protein L6 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65220.1| 60S ribosomal protein L6 [Arabidopsis lyrata subsp. lyrata]
Length=233

 Score =   236 bits (602),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNP+LIRGVGK+SRS++YHKRGLWAIKAKNGG FP H+ K      AEKPPKFYPA+DVK
Sbjct  12   RNPDLIRGVGKYSRSQMYHKRGLWAIKAKNGGVFPRHDAKSKVDTPAEKPPKFYPAEDVK  71

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPL N+  PK TKLR+SITPGTVLIILAGRFKGKRVVFLKQL SGLLLVTGPFK+NGVPL
Sbjct  72   KPLPNRRTPKPTKLRASITPGTVLIILAGRFKGKRVVFLKQLASGLLLVTGPFKVNGVPL  131

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAE  543
            RRVNQAYVI T+TKVDI GV ++K DDKYFGK AE
Sbjct  132  RRVNQAYVIGTSTKVDISGVTLDKFDDKYFGKVAE  166



>ref|XP_010498250.1| PREDICTED: 60S ribosomal protein L6-1-like [Camelina sativa]
Length=234

 Score =   236 bits (602),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNP+LIRGVGK+SRS++YHKRGLWAIKAKNGG FP H+ K       EKP KFYPA+DVK
Sbjct  13   RNPDLIRGVGKYSRSQMYHKRGLWAIKAKNGGVFPRHDAKSKVDAPVEKPAKFYPAEDVK  72

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPL N+ KP  TKL++SITPGTVLIILAGRFKGKRVVFLKQL SGLLLVTGPFKINGVPL
Sbjct  73   KPLANRRKPNPTKLKASITPGTVLIILAGRFKGKRVVFLKQLSSGLLLVTGPFKINGVPL  132

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQA  540
            RRVNQAYVI T+TKVDI GV+ EK DDKYFGK A
Sbjct  133  RRVNQAYVIGTSTKVDISGVSTEKFDDKYFGKVA  166



>ref|XP_010682142.1| PREDICTED: 60S ribosomal protein L6-like [Beta vulgaris subsp. 
vulgaris]
Length=230

 Score =   236 bits (601),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = +1

Query  67   KKSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPA  246
            +K  RNP+L++G+GKFSRSK+YHKRGLWAIKAKNGG FP H  K  +   AEKP KFYPA
Sbjct  5    RKVSRNPDLVKGIGKFSRSKMYHKRGLWAIKAKNGGVFPTHPPKSASPAQAEKPSKFYPA  64

Query  247  DDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKIN  426
            DD+KKPL+NK KPK TKLR+SITPGTVLI+LAGRFKGKRVVFLKQL SGLLL+TGPFKIN
Sbjct  65   DDIKKPLINKRKPKPTKLRASITPGTVLIVLAGRFKGKRVVFLKQLSSGLLLITGPFKIN  124

Query  427  GVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFG  531
            GVPLRRVNQAYVI T+TKVDI GV+V  IDDK+F 
Sbjct  125  GVPLRRVNQAYVIGTSTKVDISGVDVSNIDDKFFA  159



>gb|KFK41843.1| hypothetical protein AALP_AA2G178500 [Arabis alpina]
Length=233

 Score =   236 bits (601),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 136/158 (86%), Gaps = 0/158 (0%)
 Frame = +1

Query  70   KSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPAD  249
            K  RNP+LIRGVGK SR ++YHKRGLWAIKAKNGG FP H+ K       EKPPKFYPA+
Sbjct  9    KVSRNPDLIRGVGKCSRHEMYHKRGLWAIKAKNGGVFPRHDAKSKVDSPVEKPPKFYPAE  68

Query  250  DVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKING  429
            DVKKPL N+ KPK TKLR+SITPGTVLIILAGRFKGKRVVFLKQL SGLLLVTGPFK+NG
Sbjct  69   DVKKPLANRRKPKPTKLRASITPGTVLIILAGRFKGKRVVFLKQLTSGLLLVTGPFKVNG  128

Query  430  VPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAE  543
            VPLRRVNQAYVI T+TKVDI GV+++K DDKYFGK AE
Sbjct  129  VPLRRVNQAYVIGTSTKVDISGVSIDKFDDKYFGKVAE  166



>ref|XP_003531428.1| PREDICTED: 60S ribosomal protein L6-like [Glycine max]
 gb|KHN29202.1| 60S ribosomal protein L6 [Glycine soja]
Length=232

 Score =   236 bits (601),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 140/160 (88%), Gaps = 3/160 (2%)
 Frame = +1

Query  58   MAAKK---SPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekp  228
            MA KK   + RNP+L+RG+GK+SRS++YHKRG+WAIKAKNGG  P H+ KP     A+KP
Sbjct  1    MAPKKPRTTSRNPDLVRGIGKYSRSQMYHKRGIWAIKAKNGGVLPLHDPKPKPEAPAQKP  60

Query  229  pkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVT  408
            PKFYPADDVKKPLVNKHKPK  KLR+SITPGTVLI+LAGRFKGKRVVFLKQLPSGLLLVT
Sbjct  61   PKFYPADDVKKPLVNKHKPKPAKLRASITPGTVLILLAGRFKGKRVVFLKQLPSGLLLVT  120

Query  409  GPFKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYF  528
            GPFKINGVPLRRVNQ+YVI T+TKVDI  VNV+K DDKYF
Sbjct  121  GPFKINGVPLRRVNQSYVIGTSTKVDISDVNVDKFDDKYF  160



>ref|XP_011007361.1| PREDICTED: 60S ribosomal protein L6-like [Populus euphratica]
Length=232

 Score =   236 bits (601),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 138/160 (86%), Gaps = 3/160 (2%)
 Frame = +1

Query  58   MAAKKSP---RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekp  228
            MA +K+P   RNP+L+RG+GK+SRS++Y KRGLWAIKAKNGG FP H  K   A  AEKP
Sbjct  1    MAPRKTPHVSRNPDLVRGIGKYSRSQMYRKRGLWAIKAKNGGVFPKHAPKVKDAAPAEKP  60

Query  229  pkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVT  408
            PKFYPADDVK+PL N+ KPK TKLR SITPGTVLIIL GRFKGKRVVFLKQLPSGLLLVT
Sbjct  61   PKFYPADDVKRPLPNRRKPKPTKLRDSITPGTVLIILVGRFKGKRVVFLKQLPSGLLLVT  120

Query  409  GPFKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYF  528
            GPFKINGVPLRRVNQ+YVI T+TKVDI GVNVEK DDKYF
Sbjct  121  GPFKINGVPLRRVNQSYVIGTSTKVDISGVNVEKFDDKYF  160



>ref|XP_006300334.1| hypothetical protein CARUB_v10021263mg [Capsella rubella]
 gb|EOA33232.1| hypothetical protein CARUB_v10021263mg [Capsella rubella]
Length=233

 Score =   236 bits (601),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 135/154 (88%), Gaps = 0/154 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNP+LIRGVGK+SRS++YHKRGLWA+KAKNGG FP H+ K      AEKPPKFYPA+DVK
Sbjct  12   RNPDLIRGVGKYSRSQMYHKRGLWAVKAKNGGVFPRHDAKSKVDAPAEKPPKFYPAEDVK  71

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPL N+  PK TKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL
Sbjct  72   KPLANRRTPKPTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  131

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQA  540
            R VNQAYVI T+TKVDI GV ++K DDKYFGK A
Sbjct  132  RCVNQAYVIGTSTKVDISGVTLDKFDDKYFGKVA  165



>ref|XP_004236669.1| PREDICTED: 60S ribosomal protein L6-like [Solanum lycopersicum]
Length=229

 Score =   235 bits (600),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 148/157 (94%), Gaps = 0/157 (0%)
 Frame = +1

Query  58   MAAKKSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkF  237
            MAAKK+ RNPELIRGVGKFSRSK+YHK+GLWAIK KNGGKFP H+KKP++AP AEK PKF
Sbjct  1    MAAKKTLRNPELIRGVGKFSRSKMYHKKGLWAIKKKNGGKFPQHQKKPISAPPAEKSPKF  60

Query  238  YPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPF  417
            YPADDVKKPLVNKHKPK TKLR+SI+PGTVLIILAGRFKGKRVVFLKQL SGLLLVTGPF
Sbjct  61   YPADDVKKPLVNKHKPKPTKLRASISPGTVLIILAGRFKGKRVVFLKQLLSGLLLVTGPF  120

Query  418  KINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYF  528
            K+NGVPLRRVNQAYVI T+TKVD+ GVNVEKIDDKYF
Sbjct  121  KLNGVPLRRVNQAYVIGTSTKVDVSGVNVEKIDDKYF  157



>ref|XP_006346775.1| PREDICTED: 60S ribosomal protein L6-like [Solanum tuberosum]
Length=229

 Score =   235 bits (599),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 148/157 (94%), Gaps = 0/157 (0%)
 Frame = +1

Query  58   MAAKKSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkF  237
            MAAKK+ RNPELIRGVGKFSRSK+YHK+GLWAIK KNGGKFP H+KKP++AP AEK PKF
Sbjct  1    MAAKKTLRNPELIRGVGKFSRSKMYHKKGLWAIKKKNGGKFPQHQKKPISAPPAEKSPKF  60

Query  238  YPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPF  417
            YPADDVKKPLVNKHKPK TKLR+SI+PGTVLIILAGRFKGKRVVFLKQL SGLLLVTGPF
Sbjct  61   YPADDVKKPLVNKHKPKPTKLRASISPGTVLIILAGRFKGKRVVFLKQLLSGLLLVTGPF  120

Query  418  KINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYF  528
            K+NGVPLRRVNQAYVI T+TKVD+ GVNVEKIDDKYF
Sbjct  121  KLNGVPLRRVNQAYVIGTSTKVDVSGVNVEKIDDKYF  157



>gb|EYU28217.1| hypothetical protein MIMGU_mgv1a013083mg [Erythranthe guttata]
Length=231

 Score =   235 bits (599),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNPELI GV K SRS++YHKRGLWAIKAKNGGKFP H+K   A PA EKPPKFYPADD+K
Sbjct  10   RNPELIPGVRKISRSQMYHKRGLWAIKAKNGGKFPQHDKAAAATPAVEKPPKFYPADDIK  69

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPL N  KPK TKLR+S+TPGTVLIIL GRFKGKRVVFLKQL SGLLLVTGP+KINGVPL
Sbjct  70   KPLSNTRKPKPTKLRASVTPGTVLIILTGRFKGKRVVFLKQLSSGLLLVTGPYKINGVPL  129

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAE  543
            RRVNQAYVI T+TKVDI  VNV K DDKYF KQ E
Sbjct  130  RRVNQAYVIGTSTKVDISAVNVNKFDDKYFAKQVE  164



>emb|CDY45859.1| BnaC02g22610D [Brassica napus]
Length=232

 Score =   235 bits (599),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 138/160 (86%), Gaps = 0/160 (0%)
 Frame = +1

Query  70   KSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPAD  249
            K  RNP+LIRGVGK+SRS++YHKRGLWAIKAKNGG FP H+ K      AEKPPKFYPA+
Sbjct  9    KVSRNPDLIRGVGKYSRSQMYHKRGLWAIKAKNGGVFPRHDAKSKVDAVAEKPPKFYPAE  68

Query  250  DVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKING  429
            DVKKPL N+ K   TKLRSSITPGTVLIILAGRFKGKRVVFLKQL SGLLLV+GPFKING
Sbjct  69   DVKKPLANRRKANPTKLRSSITPGTVLIILAGRFKGKRVVFLKQLSSGLLLVSGPFKING  128

Query  430  VPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            VPLRRVNQ+YVI T++KVD+ GV +EK DDKYFGK AEKK
Sbjct  129  VPLRRVNQSYVIGTSSKVDVSGVILEKFDDKYFGKVAEKK  168



>ref|XP_010111399.1| 60S ribosomal protein L6 [Morus notabilis]
 gb|EXC30877.1| 60S ribosomal protein L6 [Morus notabilis]
Length=234

 Score =   235 bits (599),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 138/162 (85%), Gaps = 5/162 (3%)
 Frame = +1

Query  58   MAAKK-----SPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaae  222
            MAAKK       RNP+LIRGVGK+SRSK+YHKRGLWAIK KNGG FP H+ KP A    +
Sbjct  1    MAAKKVRNPRKSRNPDLIRGVGKYSRSKMYHKRGLWAIKTKNGGVFPRHDAKPAAEAPPQ  60

Query  223  kppkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLL  402
            KPPKFYPADDVKKPLVNK K K TKLR+SITPGTVLIILAGRFKGKRVVFLKQL SGLLL
Sbjct  61   KPPKFYPADDVKKPLVNKRKHKPTKLRASITPGTVLIILAGRFKGKRVVFLKQLSSGLLL  120

Query  403  VTGPFKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYF  528
            VTGPF INGVPLRRVNQ+YVI T+TKVDI G+NVEK DDKYF
Sbjct  121  VTGPFNINGVPLRRVNQSYVIGTSTKVDILGLNVEKFDDKYF  162



>gb|KFK41845.1| hypothetical protein AALP_AA2G178700 [Arabis alpina]
Length=233

 Score =   234 bits (598),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = +1

Query  70   KSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPAD  249
            K  RNP+LIRGV K+SR ++YHKRGLWAIKAKNGG+FP H+ K       EKPPKFYPA+
Sbjct  9    KVSRNPDLIRGVSKYSRHQMYHKRGLWAIKAKNGGEFPRHDAKSKVDSPVEKPPKFYPAE  68

Query  250  DVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKING  429
            DVKKPL N+ KPK TKLR+SITPGTVLIILAGRFKGKRVVFLKQL SGLLLVTGPFKING
Sbjct  69   DVKKPLANRRKPKPTKLRASITPGTVLIILAGRFKGKRVVFLKQLTSGLLLVTGPFKING  128

Query  430  VPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQA  540
            VPLRRVNQAYVI T+TKVDI GV+++K DDKYFGK A
Sbjct  129  VPLRRVNQAYVIGTSTKVDISGVSLDKFDDKYFGKVA  165



>ref|XP_010459474.1| PREDICTED: 60S ribosomal protein L6-1-like [Camelina sativa]
Length=234

 Score =   234 bits (597),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 132/154 (86%), Gaps = 0/154 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNP+LIRGVGK+SRS++YHKRGLWAIKAKNGG FP H+ K       EKP KFYPA+DVK
Sbjct  13   RNPDLIRGVGKYSRSQMYHKRGLWAIKAKNGGVFPRHDAKSKVDAPVEKPAKFYPAEDVK  72

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPL N+ K   TKL++SITPGTVLIILAGRFKGKRVVFLKQL SGLLLVTGPFKINGVPL
Sbjct  73   KPLANRRKHNPTKLKASITPGTVLIILAGRFKGKRVVFLKQLSSGLLLVTGPFKINGVPL  132

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQA  540
            RRVNQAYVI T+TKVDI GVN EK DDKYFGK A
Sbjct  133  RRVNQAYVIGTSTKVDISGVNTEKFDDKYFGKVA  166



>gb|KHN38225.1| 60S ribosomal protein L6 [Glycine soja]
Length=232

 Score =   234 bits (596),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 135/154 (88%), Gaps = 0/154 (0%)
 Frame = +1

Query  64   AKKSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYP  243
             +K  RNPELIRG+GK+SRS++YHKRG+WAIKAKNGG  P H+ KP     AEKPPKFYP
Sbjct  6    TRKVSRNPELIRGIGKYSRSQMYHKRGIWAIKAKNGGVLPRHDPKPKPETPAEKPPKFYP  65

Query  244  ADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKI  423
            ADD+KKPLVNKHKPK  KLR+SITPGTVLI+LAGRFKGKRVVFLKQLPSGLLLVTGPFK+
Sbjct  66   ADDIKKPLVNKHKPKPAKLRASITPGTVLILLAGRFKGKRVVFLKQLPSGLLLVTGPFKV  125

Query  424  NGVPLRRVNQAYVIATATKVDICGVNVEKIDDKY  525
            NGVPLRRVNQAYVI T+TKVDI  VNV+  DDKY
Sbjct  126  NGVPLRRVNQAYVIGTSTKVDISAVNVDSFDDKY  159



>ref|NP_177545.1| 60S ribosomal protein L6-3 [Arabidopsis thaliana]
 sp|Q9C9C5.1|RL63_ARATH RecName: Full=60S ribosomal protein L6-3 [Arabidopsis thaliana]
 gb|AAG52527.1|AC016662_21 putative 60S ribosomal protein L6; 24498-25922 [Arabidopsis thaliana]
 gb|AAK96764.1| putative 60S ribosomal protein L6 [Arabidopsis thaliana]
 gb|AAL91194.1| putative 60S ribosomal protein L6 [Arabidopsis thaliana]
 gb|AAM47960.1| putative 60S ribosomal protein L6 [Arabidopsis thaliana]
 gb|AAM64875.1| putative 60S ribosomal protein L6 [Arabidopsis thaliana]
 gb|AEE35542.1| 60S ribosomal protein L6-3 [Arabidopsis thaliana]
Length=233

 Score =   233 bits (594),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNP+LIRGVGK+SRS++YHKRGLWAIKAKNGG FP H+ K       EKPPKFYPA+DVK
Sbjct  12   RNPDLIRGVGKYSRSQMYHKRGLWAIKAKNGGVFPRHDAKSKVDAPVEKPPKFYPAEDVK  71

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPL N+   K TKLR+SITPGTVLIILAGRFKGKRVVFLKQL SGLLLVTGPFKINGVPL
Sbjct  72   KPLPNRRTAKPTKLRASITPGTVLIILAGRFKGKRVVFLKQLASGLLLVTGPFKINGVPL  131

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAE  543
            RRVNQAYVI T+TKVDI GV ++K DDKYFGK AE
Sbjct  132  RRVNQAYVIGTSTKVDISGVTLDKFDDKYFGKVAE  166



>gb|KHN38226.1| 60S ribosomal protein L6 [Glycine soja]
Length=232

 Score =   233 bits (594),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 136/154 (88%), Gaps = 0/154 (0%)
 Frame = +1

Query  64   AKKSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYP  243
             +K  RNPELIRG+GK+SRS++YHKRG+WAIKAKNGG  P H+ KP     AEKPPKFYP
Sbjct  6    TRKVSRNPELIRGIGKYSRSQMYHKRGIWAIKAKNGGVLPRHDPKPKPEAPAEKPPKFYP  65

Query  244  ADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKI  423
            ADD+KKPLVNKHKPK  KLR+SITPGTVLI+LAGRFKGKRVVFLKQLPSGLLLVTGPFKI
Sbjct  66   ADDIKKPLVNKHKPKPAKLRASITPGTVLILLAGRFKGKRVVFLKQLPSGLLLVTGPFKI  125

Query  424  NGVPLRRVNQAYVIATATKVDICGVNVEKIDDKY  525
            NGVPLRRVNQ+YVI T+TKVD+  VNV++ DDKY
Sbjct  126  NGVPLRRVNQSYVIGTSTKVDVSAVNVDQFDDKY  159



>ref|XP_008379219.1| PREDICTED: 60S ribosomal protein L6-3-like [Malus domestica]
Length=233

 Score =   233 bits (593),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNP+LIRG+GK+SRS +YHKRGLWAIKA NGG FP H+KK  A   A KPPKFYPADDVK
Sbjct  12   RNPDLIRGIGKYSRSMMYHKRGLWAIKAINGGVFPRHDKKAAAVAPAVKPPKFYPADDVK  71

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPLVNK K K TKLR+SITPGTVLIILAGRF GKRVVFLKQL SGLLLVTGPFKINGVPL
Sbjct  72   KPLVNKRKAKPTKLRASITPGTVLIILAGRFMGKRVVFLKQLSSGLLLVTGPFKINGVPL  131

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAE  543
            RRVNQ+YVI T+TK+DI GVNV+K DDKYF K+ +
Sbjct  132  RRVNQSYVIGTSTKIDISGVNVDKFDDKYFAKEVQ  166



>ref|NP_001242380.1| uncharacterized protein LOC100809343 [Glycine max]
 gb|ACU21407.1| unknown [Glycine max]
Length=210

 Score =   231 bits (590),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = +1

Query  64   AKKSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYP  243
             +K  RNPELIRG+GK+SRS++YHKRG+WAIKAKNGG  P H+ KP     AEKPPKFYP
Sbjct  6    TRKVSRNPELIRGIGKYSRSQMYHKRGIWAIKAKNGGVLPRHDPKPKPETPAEKPPKFYP  65

Query  244  ADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKI  423
            ADD+KKPLVNKHKPK  KLR+SITPGTVLI+LAGRFKGKRVVFLKQLPSGLLLVTGPFK+
Sbjct  66   ADDIKKPLVNKHKPKPAKLRASITPGTVLILLAGRFKGKRVVFLKQLPSGLLLVTGPFKV  125

Query  424  NGVPLRRVNQAYVIATATKVDICGVNVEKIDDKY  525
            NGVPLRRVNQAYVI T+TKVDI  VNV+   DKY
Sbjct  126  NGVPLRRVNQAYVIGTSTKVDISAVNVDSFGDKY  159



>ref|NP_001266146.1| 60S ribosomal protein L6-2-like [Cicer arietinum]
 emb|CAB76914.1| 60S ribosomal protein L6 [Cicer arietinum]
Length=233

 Score =   232 bits (591),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNP+LIRG+GK+S+S +YHKRGLWAIKAK+GG FP H+ KP     AEK PKFYPA DV+
Sbjct  12   RNPDLIRGIGKYSKSAMYHKRGLWAIKAKHGGAFPKHDPKPKPEAPAEKAPKFYPAHDVQ  71

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPL NKHKPK TKLR++ITPGTVLI+LAGRFKGKRVVFLKQLPSGLL  +GPFKINGVPL
Sbjct  72   KPLRNKHKPKPTKLRANITPGTVLILLAGRFKGKRVVFLKQLPSGLLTCSGPFKINGVPL  131

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            RRVNQ+YVI T+TKVD+  VNV+K DDKYF K AEKK
Sbjct  132  RRVNQSYVIGTSTKVDVSSVNVDKFDDKYFSKVAEKK  168



>ref|NP_001235723.1| uncharacterized protein LOC100499766 [Glycine max]
 gb|ACU13550.1| unknown [Glycine max]
Length=232

 Score =   232 bits (591),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 136/154 (88%), Gaps = 0/154 (0%)
 Frame = +1

Query  64   AKKSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYP  243
             +K  RNPELIRG+GK+SRS++YHKRG+WAIKAKNGG  P H+ KP     AEKPPKFYP
Sbjct  6    TRKVSRNPELIRGIGKYSRSQMYHKRGIWAIKAKNGGVLPRHDPKPKPEAPAEKPPKFYP  65

Query  244  ADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKI  423
            ADD+KKPLVNKHKPK  KLR+SITPGTVLI+LAGRFKGKRVVFL+QLPSGLLLVTGPFKI
Sbjct  66   ADDIKKPLVNKHKPKPAKLRASITPGTVLILLAGRFKGKRVVFLEQLPSGLLLVTGPFKI  125

Query  424  NGVPLRRVNQAYVIATATKVDICGVNVEKIDDKY  525
            NGVPLRRVNQ+YVI T+TKVD+  VNV++ DDKY
Sbjct  126  NGVPLRRVNQSYVIGTSTKVDVSAVNVDQFDDKY  159



>ref|NP_177546.1| 60S ribosomal protein L6-2 [Arabidopsis thaliana]
 sp|Q9C9C6.1|RL62_ARATH RecName: Full=60S ribosomal protein L6-2 [Arabidopsis thaliana]
 gb|AAG52524.1|AC016662_18 putative 60S ribosomal protein L6; 21879-23145 [Arabidopsis thaliana]
 gb|AAL32700.1| putative 60S ribosomal protein L6 [Arabidopsis thaliana]
 gb|AAO00948.1| putative 60S ribosomal protein L6 [Arabidopsis thaliana]
 gb|AEE35544.1| 60S ribosomal protein L6-2 [Arabidopsis thaliana]
Length=233

 Score =   231 bits (590),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNP+LIRGVGK+SRS++YHKRGLWAIKAKNGG FP H+ K       EKPPKFYPA+DVK
Sbjct  12   RNPDLIRGVGKYSRSQMYHKRGLWAIKAKNGGVFPRHDAKSKVDAPVEKPPKFYPAEDVK  71

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPL N+   K  KLR+SITPGTVLIILAGRFKGKRVVFLKQL SGLLLVTGPFKINGVPL
Sbjct  72   KPLPNRRTAKPAKLRASITPGTVLIILAGRFKGKRVVFLKQLASGLLLVTGPFKINGVPL  131

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAE  543
            RRVNQAYVI T+TKVDI GV ++K DDKYFGK AE
Sbjct  132  RRVNQAYVIGTSTKVDISGVTLDKFDDKYFGKVAE  166



>ref|XP_008795742.1| PREDICTED: 60S ribosomal protein L6-like [Phoenix dactylifera]
Length=232

 Score =   231 bits (589),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 135/160 (84%), Gaps = 3/160 (2%)
 Frame = +1

Query  58   MAAKK---SPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekp  228
            MAAKK   + RNPELIRG+GK+SRSK+YHKRG+WAIKAK GG  P HE K       EKP
Sbjct  1    MAAKKARVTSRNPELIRGIGKYSRSKMYHKRGIWAIKAKYGGALPCHEPKAAPPKPTEKP  60

Query  229  pkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVT  408
            PKFYPADDVK P+ N+ KPK TKLR SITPGTVLI+LAGRF GKRVVFLKQLPSGLLLVT
Sbjct  61   PKFYPADDVKIPIPNRRKPKPTKLRPSITPGTVLILLAGRFMGKRVVFLKQLPSGLLLVT  120

Query  409  GPFKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYF  528
            GPFKINGVPLRRVNQAYVI T+TK+DI GV+VEK DDKYF
Sbjct  121  GPFKINGVPLRRVNQAYVIGTSTKIDISGVDVEKFDDKYF  160



>ref|XP_009418480.1| PREDICTED: 60S ribosomal protein L6-like [Musa acuminata subsp. 
malaccensis]
Length=234

 Score =   231 bits (588),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 134/151 (89%), Gaps = 1/151 (1%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekpp-kFYPADDV  255
            RNP L+RG+GKFSRSK+YHKRG+WAIKAK+GG FP HE KP +AP A   P KFYPADDV
Sbjct  12   RNPSLVRGIGKFSRSKMYHKRGIWAIKAKHGGSFPRHEPKPASAPTAAVKPPKFYPADDV  71

Query  256  KKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVP  435
            K P+ N+ KPK TKLR+SITPGTVLI+LAGRF GKRVVFLKQLPSGLLLVTGPFKINGVP
Sbjct  72   KTPIPNRRKPKPTKLRASITPGTVLILLAGRFMGKRVVFLKQLPSGLLLVTGPFKINGVP  131

Query  436  LRRVNQAYVIATATKVDICGVNVEKIDDKYF  528
            LRRVNQAYVIAT+TKVDI GVNV+K DDKYF
Sbjct  132  LRRVNQAYVIATSTKVDISGVNVDKFDDKYF  162



>ref|XP_006579446.1| PREDICTED: uncharacterized protein LOC100809343 isoform X1 [Glycine 
max]
Length=232

 Score =   231 bits (588),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = +1

Query  64   AKKSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYP  243
             +K  RNPELIRG+GK+SRS++YHKRG+WAIKAKNGG  P H+ KP     AEKPPKFYP
Sbjct  6    TRKVSRNPELIRGIGKYSRSQMYHKRGIWAIKAKNGGVLPRHDPKPKPETPAEKPPKFYP  65

Query  244  ADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKI  423
            ADD+KKPLVNKHKPK  KLR+SITPGTVLI+LAGRFKGKRVVFLKQLPSGLLLVTGPFK+
Sbjct  66   ADDIKKPLVNKHKPKPAKLRASITPGTVLILLAGRFKGKRVVFLKQLPSGLLLVTGPFKV  125

Query  424  NGVPLRRVNQAYVIATATKVDICGVNVEKIDDKY  525
            NGVPLRRVNQAYVI T+TKVDI  VNV+   DKY
Sbjct  126  NGVPLRRVNQAYVIGTSTKVDISAVNVDSFGDKY  159



>ref|XP_007028938.1| Ribosomal protein L6 family protein, putative [Theobroma cacao]
 gb|EOY09440.1| Ribosomal protein L6 family protein, putative [Theobroma cacao]
Length=356

 Score =   234 bits (598),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 127/149 (85%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNP+LIRGVGK+SRSK+YHKRGLWAIKAKNGG FP H+ KP A  AAEK PKFYPADDVK
Sbjct  135  RNPDLIRGVGKYSRSKMYHKRGLWAIKAKNGGVFPRHDPKPKAPAAAEKLPKFYPADDVK  194

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPL NK KPK TKLR+SITPGTVLI+LAGRF GKRVVFLKQL SGLLLVTGPFKINGVPL
Sbjct  195  KPLFNKRKPKPTKLRASITPGTVLILLAGRFMGKRVVFLKQLTSGLLLVTGPFKINGVPL  254

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKY  525
            RRVNQ+YVIAT+TKVDI GVNVEK DDKY
Sbjct  255  RRVNQSYVIATSTKVDISGVNVEKFDDKY  283



>ref|XP_008800660.1| PREDICTED: 60S ribosomal protein L6-like [Phoenix dactylifera]
Length=232

 Score =   230 bits (586),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 136/160 (85%), Gaps = 3/160 (2%)
 Frame = +1

Query  58   MAAKKS---PRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekp  228
            MAAKK+    RNPELIRG+GK+SRSK+YHKRG+WAIKAK+GG  P HE K      AEKP
Sbjct  1    MAAKKATAKSRNPELIRGIGKYSRSKMYHKRGIWAIKAKHGGALPRHEPKVAPPKPAEKP  60

Query  229  pkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVT  408
            PKFYPADDVK P+ N+ KPK TKLR SITPGTVLI+LAGRF GKRVVFLKQL SGLLLVT
Sbjct  61   PKFYPADDVKTPIPNRRKPKPTKLRPSITPGTVLILLAGRFMGKRVVFLKQLSSGLLLVT  120

Query  409  GPFKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYF  528
            GPFKINGVPLRRVNQAYVI T+TK+DI GV+VEK DDKYF
Sbjct  121  GPFKINGVPLRRVNQAYVIGTSTKIDISGVDVEKFDDKYF  160



>ref|XP_008787289.1| PREDICTED: 60S ribosomal protein L6-like [Phoenix dactylifera]
Length=232

 Score =   230 bits (586),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 135/154 (88%), Gaps = 0/154 (0%)
 Frame = +1

Query  67   KKSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPA  246
            + S RNPELIRG+GK+SRSK+YHKRG+WAIKAK+GG FP HE K      AEKPPK+YPA
Sbjct  7    RASSRNPELIRGIGKYSRSKMYHKRGVWAIKAKHGGVFPRHEPKAAPPKPAEKPPKYYPA  66

Query  247  DDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKIN  426
            DDVK+P+ N HK K TKLR+SITPGTVLI+LAGRF GKRVVFLKQLPSGLLLVTGPFKIN
Sbjct  67   DDVKQPIPNHHKHKPTKLRASITPGTVLILLAGRFMGKRVVFLKQLPSGLLLVTGPFKIN  126

Query  427  GVPLRRVNQAYVIATATKVDICGVNVEKIDDKYF  528
            GVPLRRVNQAYVIAT+TKVDI GV+ EK DDKYF
Sbjct  127  GVPLRRVNQAYVIATSTKVDISGVSAEKFDDKYF  160



>ref|XP_008782889.1| PREDICTED: 60S ribosomal protein L6-like [Phoenix dactylifera]
Length=228

 Score =   229 bits (585),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/157 (78%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = +1

Query  58   MAAKKSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkF  237
            M  + S RNPELI G+GK+SRSK+YHKRG+WA+KAK+GG FP HE K  A   AEKPPK+
Sbjct  1    MKPRASSRNPELIHGIGKYSRSKMYHKRGIWAVKAKHGGVFPLHEPKAAAPTPAEKPPKY  60

Query  238  YPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPF  417
            YPA+DVK P+ N+ K KLTKLR+SITPGTVLI+LAGRF GKRVVFLKQLPSGLLLVTGPF
Sbjct  61   YPAEDVKHPIPNRRKHKLTKLRASITPGTVLILLAGRFMGKRVVFLKQLPSGLLLVTGPF  120

Query  418  KINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYF  528
            KINGVPLRRVNQAYVIAT+TKVDI GVN EK DDKYF
Sbjct  121  KINGVPLRRVNQAYVIATSTKVDISGVNAEKFDDKYF  157



>ref|XP_002888962.1| 60S ribosomal protein L6 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65221.1| 60S ribosomal protein L6 [Arabidopsis lyrata subsp. lyrata]
Length=235

 Score =   230 bits (586),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 135/157 (86%), Gaps = 2/157 (1%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNP+LIRGVGK+SRS++YHKRGLWAIKAKNGG FP H+ K      AEKPPKFYPA+DVK
Sbjct  12   RNPDLIRGVGKYSRSQMYHKRGLWAIKAKNGGVFPRHDAKSKVDAPAEKPPKFYPAEDVK  71

Query  259  KPLVNKHKPKLTKLR--SSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGV  432
            KPL N+  PK TKLR  +SIT GTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGV
Sbjct  72   KPLPNRRTPKPTKLRYSASITSGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGV  131

Query  433  PLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAE  543
            PLRRVNQAYVI T+TKVDI GV ++  DDKYFGK AE
Sbjct  132  PLRRVNQAYVIGTSTKVDISGVTLDNFDDKYFGKVAE  168



>gb|ABK26046.1| unknown [Picea sitchensis]
Length=231

 Score =   229 bits (583),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 138/167 (83%), Gaps = 3/167 (2%)
 Frame = +1

Query  58   MAAKKSPR---NPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekp  228
            MA  + PR   N ELIRGVG+FSRSK+YHKRG+WA+K KNGG FP H+K+P  A A EK 
Sbjct  1    MAKSEKPRVSRNKELIRGVGRFSRSKMYHKRGIWALKEKNGGSFPRHDKQPPQAKAVEKA  60

Query  229  pkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVT  408
            PKFYPADD  KPL+NK KPK TKLRSSITPGTVLI+LAGRFKGKRVVFLKQL SGLLLVT
Sbjct  61   PKFYPADDEPKPLINKRKPKPTKLRSSITPGTVLILLAGRFKGKRVVFLKQLESGLLLVT  120

Query  409  GPFKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            GPFK+NGVP+RRVNQAYVIAT+TK+DI  V+  K  DKYF K+  +K
Sbjct  121  GPFKLNGVPIRRVNQAYVIATSTKIDISTVDASKFTDKYFEKEVVRK  167



>gb|ABK21588.1| unknown [Picea sitchensis]
 gb|ABK22094.1| unknown [Picea sitchensis]
 gb|ABK22176.1| unknown [Picea sitchensis]
 gb|ACN41064.1| unknown [Picea sitchensis]
 gb|ACN41132.1| unknown [Picea sitchensis]
Length=231

 Score =   229 bits (583),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 138/167 (83%), Gaps = 3/167 (2%)
 Frame = +1

Query  58   MAAKKSPR---NPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekp  228
            MA  + PR   N ELIRGVG+FSRSK+YHKRG+WA+K KNGG FP H+K+P  A A EK 
Sbjct  1    MAKSEKPRVSRNKELIRGVGRFSRSKMYHKRGIWALKEKNGGSFPRHDKQPPQAKAVEKA  60

Query  229  pkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVT  408
            PKFYPADD  KPL+NK KPK TKLRSSITPGTVLI+LAGRFKGKRVVFLKQL SGLLLVT
Sbjct  61   PKFYPADDEPKPLINKRKPKPTKLRSSITPGTVLILLAGRFKGKRVVFLKQLESGLLLVT  120

Query  409  GPFKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            GPFK+NGVP+RRVNQAYVIAT+TK+DI  V+  K  DKYF K+  +K
Sbjct  121  GPFKLNGVPIRRVNQAYVIATSTKIDISTVDASKFTDKYFEKEVVRK  167



>gb|ABK26162.1| unknown [Picea sitchensis]
Length=231

 Score =   229 bits (583),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 138/167 (83%), Gaps = 3/167 (2%)
 Frame = +1

Query  58   MAAKKSPR---NPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekp  228
            MA  + PR   N ELIRGVG+FSRSK+YHKRG+WA+K KNGG FP H+K+P  A A EK 
Sbjct  1    MAKSEKPRVSRNKELIRGVGRFSRSKMYHKRGIWALKEKNGGSFPRHDKQPPQAKAVEKA  60

Query  229  pkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVT  408
            PKFYPADD  KPL+NK KPK TKLRSSITPGTVLI+LAGRFKGKRVVFLKQL SGLLLVT
Sbjct  61   PKFYPADDEPKPLINKRKPKPTKLRSSITPGTVLILLAGRFKGKRVVFLKQLESGLLLVT  120

Query  409  GPFKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            GPFK+NGVP+RRVNQAYVIAT+TK+DI  V+  K  DKYF K+  +K
Sbjct  121  GPFKLNGVPIRRVNQAYVIATSTKIDISTVDASKFTDKYFEKEVVRK  167



>gb|KDO37112.1| hypothetical protein CISIN_1g026764mg [Citrus sinensis]
Length=233

 Score =   228 bits (580),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = +1

Query  61   AAKKSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFY  240
            A  ++ RNP+LIRGVGKFSRSK+YHKRGLWAIKAKNGG FP H+ KP AA    KPPKFY
Sbjct  6    ATGRTSRNPDLIRGVGKFSRSKMYHKRGLWAIKAKNGGVFPKHDPKPAAAETPAKPPKFY  65

Query  241  PADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFK  420
            PADDVKKPLVNK K K TKLR+SITPGTV I+LAGRF GKRVVFLKQL SGLLLVTGPFK
Sbjct  66   PADDVKKPLVNKRKHKPTKLRASITPGTVFILLAGRFMGKRVVFLKQLTSGLLLVTGPFK  125

Query  421  INGVPLRRVNQAYVIATATKVDICGVNVEKIDDKY  525
            +NGVPLRRVNQ+YVIAT+TKVDI GV++ K DD+Y
Sbjct  126  VNGVPLRRVNQSYVIATSTKVDISGVDLGKFDDQY  160



>ref|XP_006485022.1| PREDICTED: 60S ribosomal protein L6-like [Citrus sinensis]
Length=233

 Score =   228 bits (580),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = +1

Query  61   AAKKSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFY  240
            A  ++ RNP+LIRGVGKFSRSK+YHKRGLWAIKAKNGG FP H+ KP AA    KPPKFY
Sbjct  6    ATGRTSRNPDLIRGVGKFSRSKMYHKRGLWAIKAKNGGVFPKHDPKPAAAETPAKPPKFY  65

Query  241  PADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFK  420
            PADDVKKPLVNK K K TKLR+SITPGTV I+LAGRF GKRVVFLKQL SGLLLVTGPFK
Sbjct  66   PADDVKKPLVNKRKHKPTKLRASITPGTVFILLAGRFMGKRVVFLKQLTSGLLLVTGPFK  125

Query  421  INGVPLRRVNQAYVIATATKVDICGVNVEKIDDKY  525
            +NGVPLRRVNQ+YVIAT+TKVDI GV++ K DD+Y
Sbjct  126  VNGVPLRRVNQSYVIATSTKVDISGVDLGKFDDQY  160



>ref|XP_003630109.1| 60S ribosomal protein L6 [Medicago truncatula]
 gb|AET04585.1| 60S ribosomal L6-like protein [Medicago truncatula]
Length=219

 Score =   226 bits (577),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 130/157 (83%), Gaps = 15/157 (10%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNP+LIRG+GKFS+S++YHK+G+WAIK +   + P               PKFYPADDVK
Sbjct  13   RNPDLIRGIGKFSKSQMYHKKGIWAIKPETAAEKP---------------PKFYPADDVK  57

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPL NKHKPK TKLR+SITPGTVLI+LAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL
Sbjct  58   KPLRNKHKPKQTKLRASITPGTVLILLAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  117

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            RRVNQAYVI T+TKVDI GVNV+ +DDKYF K+A KK
Sbjct  118  RRVNQAYVIGTSTKVDISGVNVDNLDDKYFSKEAPKK  154



>dbj|BAH57003.1| AT1G18540 [Arabidopsis thaliana]
Length=165

 Score =   224 bits (572),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 133/152 (88%), Gaps = 3/152 (2%)
 Frame = +1

Query  61   AAKKSP---RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekpp  231
            AAK++P   RNP+LIRGVGK+SRS++YHKRGLWAIKAKNGG FP H+ +P      EKP 
Sbjct  3    AAKRTPKVNRNPDLIRGVGKYSRSQMYHKRGLWAIKAKNGGVFPRHDAQPKVDAPVEKPA  62

Query  232  kFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTG  411
            KFYPA+DVKKPLVN+ KPK TKL++SITPGTVLIILAGRFKGKRVVFLKQL SGLLLVTG
Sbjct  63   KFYPAEDVKKPLVNRRKPKPTKLKASITPGTVLIILAGRFKGKRVVFLKQLSSGLLLVTG  122

Query  412  PFKINGVPLRRVNQAYVIATATKVDICGVNVE  507
            PFKINGVPLRRVNQAYVI T+TK+DI GVN E
Sbjct  123  PFKINGVPLRRVNQAYVIGTSTKIDISGVNTE  154



>ref|XP_010928455.1| PREDICTED: 60S ribosomal protein L6-like [Elaeis guineensis]
Length=232

 Score =   227 bits (578),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 135/160 (84%), Gaps = 3/160 (2%)
 Frame = +1

Query  58   MAAKK---SPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekp  228
            MAAKK   + RNPELIRG+ K+SRSK+YHKRG+WAIKAK+GG FP HE K      AEKP
Sbjct  1    MAAKKASLTSRNPELIRGIRKYSRSKMYHKRGIWAIKAKHGGVFPRHEPKAAPPKPAEKP  60

Query  229  pkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVT  408
            PKFYPADDVK P+ N  K K TKLR SITPGTVLI+LAGRF GKRVVFLKQLPSGLLLVT
Sbjct  61   PKFYPADDVKTPIPNHRKHKPTKLRPSITPGTVLILLAGRFMGKRVVFLKQLPSGLLLVT  120

Query  409  GPFKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYF  528
            GPFKINGVPLRRVNQAYVI T+TK+DI GV+VEK DDKYF
Sbjct  121  GPFKINGVPLRRVNQAYVIGTSTKIDISGVDVEKFDDKYF  160



>gb|ABK22151.1| unknown [Picea sitchensis]
Length=231

 Score =   226 bits (577),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 136/162 (84%), Gaps = 1/162 (1%)
 Frame = +1

Query  55   SMAAKKS-PRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekpp  231
            +MA K+   RN ELIRGVG+FSRSK+YHKRG+WA+K KNGG FP H K+P    A EK P
Sbjct  2    TMAGKQRVSRNKELIRGVGRFSRSKMYHKRGIWALKEKNGGSFPQHAKQPQVPKADEKAP  61

Query  232  kFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTG  411
            KFYPA+DV KPL+N+ KPK TKLRSSITPGTVLI+LAGRFKGKRVVFLKQL SGLLL+TG
Sbjct  62   KFYPAEDVPKPLINRRKPKPTKLRSSITPGTVLILLAGRFKGKRVVFLKQLESGLLLITG  121

Query  412  PFKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQ  537
            PFK+NGVP+RRVNQAYVIAT+TK+D+  ++  K  DKYF K+
Sbjct  122  PFKLNGVPIRRVNQAYVIATSTKIDVSSIDASKFTDKYFEKE  163



>ref|XP_006437047.1| hypothetical protein CICLE_v10032633mg [Citrus clementina]
 gb|ESR50287.1| hypothetical protein CICLE_v10032633mg [Citrus clementina]
Length=233

 Score =   226 bits (576),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = +1

Query  61   AAKKSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFY  240
            A  ++ RNP+LIRGVGKFSRSK+YHKRGLWAIKAKNGG FP H+ KP AA    KPPKFY
Sbjct  6    ATGRTSRNPDLIRGVGKFSRSKMYHKRGLWAIKAKNGGVFPKHDPKPAAAETPAKPPKFY  65

Query  241  PADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFK  420
            PADDVKKPLVNK K K TKLR+SITPGTV I+LAGRF GKRVVFLKQL SGLLLVTGPFK
Sbjct  66   PADDVKKPLVNKRKHKPTKLRASITPGTVFILLAGRFMGKRVVFLKQLTSGLLLVTGPFK  125

Query  421  INGVPLRRVNQAYVIATATKVDICGVNVEKIDDKY  525
            +NGVPL+RVNQ+YVIAT+TKVDI GV++ K DD+Y
Sbjct  126  VNGVPLKRVNQSYVIATSTKVDISGVDLGKFDDQY  160



>emb|CBI24846.3| unnamed protein product [Vitis vinifera]
Length=206

 Score =   224 bits (571),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +1

Query  127  IYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVKKPLVNKHKPKLTKLRS  306
            +YHKRGLWAIKAKNGG FP H+ KP A   AEK PKFYPADDVKKPLVN+HK KLTKLR+
Sbjct  1    MYHKRGLWAIKAKNGGVFPRHDAKPKAPAPAEKSPKFYPADDVKKPLVNRHKSKLTKLRA  60

Query  307  SITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPLRRVNQAYVIATATKVD  486
            SITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPLRRVNQAY+IAT+TKVD
Sbjct  61   SITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPLRRVNQAYIIATSTKVD  120

Query  487  ICGVNVEKIDDKYFGKQAE  543
            I GVNVEK DDKYF K+ +
Sbjct  121  ISGVNVEKFDDKYFAKETQ  139



>ref|XP_009394521.1| PREDICTED: hydroxysteroid dehydrogenase-like protein 2 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=549

 Score =   233 bits (595),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 136/164 (83%), Gaps = 5/164 (3%)
 Frame = +1

Query  55   SMAAKK----SPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaae  222
            +MAA K    + RNP LIRG+GKFSRSK+YHKRG+WAIKAKNGG FPHH+ KP     + 
Sbjct  315  AMAAPKKVRAASRNPSLIRGIGKFSRSKMYHKRGIWAIKAKNGGSFPHHDPKPAEPAQSS  374

Query  223  kpp-kFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLL  399
              P KFYPADDVK P+ N+ KPK TKLR+SITPGTVLI+LAGRF GKRVVFLKQLPSGLL
Sbjct  375  AKPPKFYPADDVKTPIPNRRKPKPTKLRASITPGTVLILLAGRFMGKRVVFLKQLPSGLL  434

Query  400  LVTGPFKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFG  531
            LVTGPFKINGVPLRRVNQ+YV+AT+TKVDI GVN +K  DKYF 
Sbjct  435  LVTGPFKINGVPLRRVNQSYVVATSTKVDISGVNADKFHDKYFA  478



>ref|XP_008387473.1| PREDICTED: 60S ribosomal protein L6-like [Malus domestica]
 ref|XP_008354425.1| PREDICTED: 60S ribosomal protein L6-like [Malus domestica]
Length=185

 Score =   221 bits (563),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 137/168 (82%), Gaps = 13/168 (8%)
 Frame = +1

Query  58   MAAK----KSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaek  225
            MAAK    +  RNP L+RGVGKFSRSK+YHKRGLWA+KAKNGG FP H+ KP A    EK
Sbjct  1    MAAKARNPRKTRNPNLVRGVGKFSRSKMYHKRGLWALKAKNGGVFPRHDAKPAAETQPEK  60

Query  226  ppkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLV  405
            PPKFYPADDVKKPLVNK KP+ TKLR+SITPGTVLI+LAGRFKGKRVVFLKQL SGLLLV
Sbjct  61   PPKFYPADDVKKPLVNKRKPRPTKLRASITPGTVLIVLAGRFKGKRVVFLKQLSSGLLLV  120

Query  406  TGPFKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            TGPFKINGVPLRRVNQ+YVIAT+         ++K DDKYF K+  KK
Sbjct  121  TGPFKINGVPLRRVNQSYVIATS---------IDKFDDKYFAKEVAKK  159



>gb|EPS67805.1| hypothetical protein M569_06970, partial [Genlisea aurea]
Length=231

 Score =   223 bits (567),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 133/152 (88%), Gaps = 1/152 (1%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekpp-kFYPADDV  255
            RNPELI G+ K+SRS +YHKRGLWAIKAKNGG+FPHHEK+ VAAP   + P KFYPADDV
Sbjct  9    RNPELIPGIRKYSRSAMYHKRGLWAIKAKNGGEFPHHEKQAVAAPPVAEKPPKFYPADDV  68

Query  256  KKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVP  435
            KKPL NK K K TKLR+SITPGTVLI+L GRFKGKRVVFLKQL SGLLL+TGPFKINGVP
Sbjct  69   KKPLPNKRKAKPTKLRASITPGTVLILLVGRFKGKRVVFLKQLSSGLLLITGPFKINGVP  128

Query  436  LRRVNQAYVIATATKVDICGVNVEKIDDKYFG  531
            LRRVNQA+VI T+TK+DI GV++EK DDKYF 
Sbjct  129  LRRVNQAFVIGTSTKIDISGVDIEKFDDKYFA  160



>ref|XP_008349669.1| PREDICTED: 60S ribosomal protein L6-3-like [Malus domestica]
Length=232

 Score =   222 bits (566),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 130/157 (83%), Gaps = 0/157 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNP LIR + K SRSK+YHKRGLWAIKAKNGG FP H+KK  A   A KPPKFYPADDVK
Sbjct  12   RNPNLIREIRKQSRSKMYHKRGLWAIKAKNGGVFPRHDKKAEADAPAVKPPKFYPADDVK  71

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KP+VNK   K TKLR+SITPGTVLIILAGRF GKRVVFLKQL SGLLLVTGPFKINGVPL
Sbjct  72   KPIVNKRNAKPTKLRASITPGTVLIILAGRFMGKRVVFLKQLSSGLLLVTGPFKINGVPL  131

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            RRVNQ+YVI T TK+DI  VN  K DDKYF K+ +KK
Sbjct  132  RRVNQSYVIGTQTKIDISKVNAVKFDDKYFAKEVQKK  168



>ref|XP_009395533.1| PREDICTED: 60S ribosomal protein L6-3-like [Musa acuminata subsp. 
malaccensis]
Length=234

 Score =   222 bits (566),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 129/156 (83%), Gaps = 1/156 (1%)
 Frame = +1

Query  64   AKKSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekpp-kFY  240
            A+ + RNP LIRG+GKFSRSK+YHKRG+WAIKAK+ G FPHH+ KP     A   P KFY
Sbjct  7    ARMASRNPSLIRGIGKFSRSKMYHKRGIWAIKAKHCGSFPHHDLKPAPTTPAAVKPPKFY  66

Query  241  PADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFK  420
            PADDVK P+ N  K K TKLR+SITPGTVLI+LAGRF GKRVVFLKQLPSGLLLVTGPFK
Sbjct  67   PADDVKTPIPNHRKAKPTKLRASITPGTVLILLAGRFMGKRVVFLKQLPSGLLLVTGPFK  126

Query  421  INGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYF  528
            INGVPLRRVNQAYVI T+TKVDI  VN +K DDKYF
Sbjct  127  INGVPLRRVNQAYVIGTSTKVDISQVNTDKFDDKYF  162



>ref|XP_010913926.1| PREDICTED: 60S ribosomal protein L6-like [Elaeis guineensis]
Length=231

 Score =   221 bits (564),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +1

Query  64   AKKSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYP  243
            ++ S RNPELIRG+GK+SRSK+YHKRGLWAIKAK+GG FP HE K V    AEKPPK+YP
Sbjct  6    SRASSRNPELIRGIGKYSRSKMYHKRGLWAIKAKHGGVFPRHEPKEVPPKPAEKPPKYYP  65

Query  244  ADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKI  423
            ADDVK P+ N  K K TKLR+SITPGTVLI+LAGRF GKRVVFLKQLPSGLLLVTGPFKI
Sbjct  66   ADDVKHPIPNHRKHKPTKLRASITPGTVLILLAGRFMGKRVVFLKQLPSGLLLVTGPFKI  125

Query  424  NGVPLRRVNQAYVIATATKVDICGVNVEKIDD  519
            NGVPLRRVNQAYVIAT+TKVDI  V+ EK DD
Sbjct  126  NGVPLRRVNQAYVIATSTKVDISAVSAEKFDD  157



>ref|XP_009354339.1| PREDICTED: 60S ribosomal protein L6-3-like [Pyrus x bretschneideri]
Length=232

 Score =   221 bits (564),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 127/157 (81%), Gaps = 0/157 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNP LIR + K SRSK YHKRGLWAIKAKNGG FP H+KK  A   A K PKFYPADDVK
Sbjct  12   RNPNLIREIRKQSRSKTYHKRGLWAIKAKNGGVFPRHDKKAEAEAPAVKRPKFYPADDVK  71

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPLVNK   K TKLR+SITPGTVLIILAGRF GKRVVFLKQL SGLLLVTGPFKINGVPL
Sbjct  72   KPLVNKRNAKPTKLRASITPGTVLIILAGRFMGKRVVFLKQLSSGLLLVTGPFKINGVPL  131

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            RRVNQ+YVI   TK+DI  VN  K DDKYF K+ +KK
Sbjct  132  RRVNQSYVIGAQTKIDISKVNAVKFDDKYFAKEVQKK  168



>emb|CBI30046.3| unnamed protein product [Vitis vinifera]
Length=205

 Score =   216 bits (551),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = +1

Query  127  IYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVKKPLVNKHKPKLTKLRS  306
            +YHKRGLWAIKAKNGG FP HEKKPVA    EK PKFYPADDVKKPL+NKHK K TKLR+
Sbjct  1    MYHKRGLWAIKAKNGGVFPCHEKKPVAPAPLEKLPKFYPADDVKKPLINKHKAKPTKLRA  60

Query  307  SITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPLRRVNQAYVIATATKVD  486
            SITPGTVLIILAGRFKGKRVVFLKQL SGLLL+TGPFKINGVPLRRVNQAYVIAT+TKVD
Sbjct  61   SITPGTVLIILAGRFKGKRVVFLKQLSSGLLLITGPFKINGVPLRRVNQAYVIATSTKVD  120

Query  487  ICGVNVEKIDDKYFGKQAEKK  549
            I  VNVEK DDKYF K+ +KK
Sbjct  121  ISKVNVEKFDDKYFAKEVQKK  141



>ref|XP_006850083.1| hypothetical protein AMTR_s00022p00218700 [Amborella trichopoda]
 gb|ERN11664.1| hypothetical protein AMTR_s00022p00218700 [Amborella trichopoda]
Length=233

 Score =   217 bits (553),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RN +LIRGVG++SRS +YHKRGLWAIKAKNGG FP HEKKP A    EKPPK+YPAD++ 
Sbjct  13   RNKDLIRGVGRYSRSAMYHKRGLWAIKAKNGGVFPSHEKKPAAPKPEEKPPKYYPADNIP  72

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPLVN  K K TKLR+SI PGTVLIILAGRF GKRVVFLKQLPSGLLL+TGPF +NGVPL
Sbjct  73   KPLVNNRKHKPTKLRASIAPGTVLIILAGRFMGKRVVFLKQLPSGLLLITGPFVVNGVPL  132

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            RRVNQAYVIAT+TKVDI G NVEK  D YF K   +K
Sbjct  133  RRVNQAYVIATSTKVDISGTNVEKFTDIYFTKTVVRK  169



>gb|KHN01929.1| 60S ribosomal protein L6, partial [Glycine soja]
Length=209

 Score =   214 bits (546),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = +1

Query  118  RSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVKKPLVNKHKPKLTK  297
            RS++YHKRG+WAIKAKNGG  P H+ KP     A+KPPKFYPADDVKKPLVNKHKPK  K
Sbjct  1    RSQMYHKRGIWAIKAKNGGVLPRHDPKPKPEAPAQKPPKFYPADDVKKPLVNKHKPKPAK  60

Query  298  LRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPLRRVNQAYVIATAT  477
            LR+SITPGTVLI+LAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPLRRVNQ+YVI T+T
Sbjct  61   LRASITPGTVLILLAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPLRRVNQSYVIGTST  120

Query  478  KVDICGVNVEKIDDKYF  528
            KVDI GVNV+K DDKYF
Sbjct  121  KVDISGVNVDKFDDKYF  137



>gb|ABK93247.1| unknown [Populus trichocarpa]
Length=206

 Score =   211 bits (536),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = +1

Query  127  IYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVKKPLVNKHKPKLTKLRS  306
            +YHKRGLWAIKAKNGG FP H  K  A  +AEKPPKFYPADDVKKPL NK KPK TKLR 
Sbjct  1    MYHKRGLWAIKAKNGGVFPKHAPKAKAPTSAEKPPKFYPADDVKKPLPNKRKPKPTKLRD  60

Query  307  SITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPLRRVNQAYVIATATKVD  486
            SITPGTVLIILAGRFKGKRVVFLKQL SGLLLVTGPFKINGVPLRRVNQ+Y+IAT+TKVD
Sbjct  61   SITPGTVLIILAGRFKGKRVVFLKQLTSGLLLVTGPFKINGVPLRRVNQSYLIATSTKVD  120

Query  487  ICGVNVEKIDDKYF  528
            I GVNVEK DDKYF
Sbjct  121  ISGVNVEKFDDKYF  134



>emb|CDY11078.1| BnaC06g23300D [Brassica napus]
Length=206

 Score =   210 bits (535),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = +1

Query  127  IYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVKKPLVNKHKPKLTKLRS  306
            +YHKRGLWAIKAKNGG FP H+ K      AEKPPKFYPA+DVKKPL N+ KPK TKLRS
Sbjct  1    MYHKRGLWAIKAKNGGVFPRHDAKSKVDSPAEKPPKFYPAEDVKKPLANRRKPKPTKLRS  60

Query  307  SITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPLRRVNQAYVIATATKVD  486
            SITPGTVLIILAGRFKGKRVVF+KQL SGLLLV+GPFKINGVPLRRV Q+YVI T+TKVD
Sbjct  61   SITPGTVLIILAGRFKGKRVVFMKQLTSGLLLVSGPFKINGVPLRRVKQSYVIGTSTKVD  120

Query  487  ICGVNVEKIDDKYFGKQAEKK  549
            I GV + K+DDKYFGK AEKK
Sbjct  121  ISGVGIHKLDDKYFGKVAEKK  141



>ref|XP_001763096.1| predicted protein [Physcomitrella patens]
 gb|EDQ71973.1| predicted protein [Physcomitrella patens]
Length=228

 Score =   209 bits (533),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 133/165 (81%), Gaps = 6/165 (4%)
 Frame = +1

Query  64   AKKSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYP  243
            A K+ R+ EL+RG+G+  RSK YHKRGLWAIKAKNGGKFP HEKK VAA  A + PKFYP
Sbjct  2    APKATRSKELVRGIGRNGRSKTYHKRGLWAIKAKNGGKFPSHEKKAVAAAPAVRAPKFYP  61

Query  244  ADDVKKPLVNKHKPKLT---KLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGP  414
            ADDV KPL   HK K+    +LRSSITPGTVLI+LAG FKGKRVVFLKQL SGLLLVTGP
Sbjct  62   ADDVPKPL---HKNKVVNAPRLRSSITPGTVLILLAGHFKGKRVVFLKQLESGLLLVTGP  118

Query  415  FKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            FK+NGVPLRRVNQAYVIAT+TKVDI  V+V K  D YF ++  KK
Sbjct  119  FKVNGVPLRRVNQAYVIATSTKVDISSVDVAKFSDSYFKREVAKK  163



>emb|CDP11071.1| unnamed protein product [Coffea canephora]
Length=207

 Score =   209 bits (531),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 121/138 (88%), Gaps = 1/138 (1%)
 Frame = +1

Query  127  IYHKRGLWAIKAKNGGKFP-HHekkpvaapaaekppkFYPADDVKKPLVNKHKPKLTKLR  303
            +YHKRGLWAIKAKNGG FP H +K    APAA KP KFYPADDVKKPL NK KPK TKLR
Sbjct  1    MYHKRGLWAIKAKNGGTFPCHEKKLEEPAPAAVKPVKFYPADDVKKPLANKRKPKPTKLR  60

Query  304  SSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPLRRVNQAYVIATATKV  483
            +SITPGTVLIILAGRFKGKRVVFLKQL SGLLLVTGP+KINGVPLRRVNQAYVI T+TKV
Sbjct  61   ASITPGTVLIILAGRFKGKRVVFLKQLSSGLLLVTGPYKINGVPLRRVNQAYVIGTSTKV  120

Query  484  DICGVNVEKIDDKYFGKQ  537
            DI GV+V+K DDKYF KQ
Sbjct  121  DISGVSVDKFDDKYFAKQ  138



>ref|XP_007029005.1| Ribosomal protein L6 family protein [Theobroma cacao]
 gb|EOY09507.1| Ribosomal protein L6 family protein [Theobroma cacao]
Length=227

 Score =   209 bits (532),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 131/162 (81%), Gaps = 10/162 (6%)
 Frame = +1

Query  58   MAAK-KSP---RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaek  225
            MAAK K+P   RNP+LIRGVGK+SRSK+YHKRGLWAIKAKNGG  P H+ KP AA A EK
Sbjct  1    MAAKRKTPLKTRNPDLIRGVGKYSRSKMYHKRGLWAIKAKNGGVLPRHDPKPKAAAAPEK  60

Query  226  ppkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLV  405
             PKFYPADDVKKPL+NK KPK TKLR S+        +  RF GKRVVFLKQL SGLLLV
Sbjct  61   LPKFYPADDVKKPLLNKRKPKPTKLRDSVD------FVGWRFMGKRVVFLKQLTSGLLLV  114

Query  406  TGPFKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFG  531
            TGPFKINGVPLRRVNQ+YVIAT+TKVDI GVN EK DDKYF 
Sbjct  115  TGPFKINGVPLRRVNQSYVIATSTKVDISGVNEEKFDDKYFA  156



>ref|XP_005647799.1| ribosomal protein L6 component of cytosolic 80S ribosome and 
60S large subunit [Coccomyxa subellipsoidea C-169]
 gb|EIE23255.1| ribosomal protein L6 component of cytosolic 80S ribosome and 
60S large subunit [Coccomyxa subellipsoidea C-169]
Length=231

 Score =   207 bits (526),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 127/165 (77%), Gaps = 2/165 (1%)
 Frame = +1

Query  61   AAKKSPRNP--ELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppk  234
            A KK PR P  EL  G+    RSK Y +RGLWAIK KNGGKFP HEK+  AA    K P+
Sbjct  4    AKKKEPRAPAKELGPGISAQGRSKTYKRRGLWAIKKKNGGKFPVHEKQAKAAEPEGKAPR  63

Query  235  FYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGP  414
            FYPADDVKKPL  +H  K TKLRSSITPGTVLI+LAGRFKGKRVVFL QLPSGLLLVTGP
Sbjct  64   FYPADDVKKPLKRRHVQKPTKLRSSITPGTVLILLAGRFKGKRVVFLGQLPSGLLLVTGP  123

Query  415  FKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            FK+NGVPL+RVNQAYVIAT+TKVD   V++ KIDD YF    E K
Sbjct  124  FKVNGVPLKRVNQAYVIATSTKVDSKAVDISKIDDAYFKATEEPK  168



>ref|XP_008356794.1| PREDICTED: 60S ribosomal protein L6-3-like [Malus domestica]
Length=232

 Score =   207 bits (526),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNP+LIRG+GK+SRSK+YHKRGLWAIKAKNGG FP H KK  A   A KPPKFYPADDV+
Sbjct  12   RNPDLIRGIGKYSRSKMYHKRGLWAIKAKNGGVFPRHNKKADADAPAVKPPKFYPADDVR  71

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPLVNK K K TKLR+SITPGTVLIILAGRF GKRVVFLK L SGLLLVTGPFKINGVPL
Sbjct  72   KPLVNKRKAKPTKLRASITPGTVLIILAGRFMGKRVVFLKXLSSGLLLVTGPFKINGVPL  131

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFG  531
            RRVNQ+YVI T TK+DI  VN +K DDKYF 
Sbjct  132  RRVNQSYVIGTKTKIDISRVNAKKFDDKYFA  162



>ref|XP_001757885.1| predicted protein [Physcomitrella patens]
 gb|EDQ77127.1| predicted protein [Physcomitrella patens]
Length=231

 Score =   207 bits (526),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 115/163 (71%), Positives = 131/163 (80%), Gaps = 6/163 (4%)
 Frame = +1

Query  70   KSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPAD  249
            ++ R  EL+RG+G+  RSK YHKRGLWAIKAKNGGKFP HEKK VA   A + PKFYPAD
Sbjct  7    RASRKTELVRGIGRNGRSKTYHKRGLWAIKAKNGGKFPIHEKKAVAETPAVRAPKFYPAD  66

Query  250  DVKKPLVNKHKPKLT---KLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFK  420
            DV KPL   HK K+    KLRSSITPGTVLI+LAG+FKGKRVVFLKQL SGLLLVTGPFK
Sbjct  67   DVAKPL---HKNKVINPPKLRSSITPGTVLILLAGQFKGKRVVFLKQLESGLLLVTGPFK  123

Query  421  INGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            +NGVPLRRVNQAYVIAT+TK+D+  V+V K  D YF ++  KK
Sbjct  124  VNGVPLRRVNQAYVIATSTKLDVSSVDVTKFSDAYFKREVTKK  166



>ref|XP_001770541.1| predicted protein [Physcomitrella patens]
 gb|EDQ64710.1| predicted protein [Physcomitrella patens]
Length=230

 Score =   206 bits (524),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 130/163 (80%), Gaps = 6/163 (4%)
 Frame = +1

Query  70   KSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPAD  249
            K+ ++ EL+RG+ +  RSK YHKRGLWAIKAKNGGKFP HEK  VAA  A + PKFYPAD
Sbjct  7    KASKSKELVRGINRSGRSKTYHKRGLWAIKAKNGGKFPTHEKAAVAAAPAVRAPKFYPAD  66

Query  250  DVKKPLVNKHKPKLT---KLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFK  420
            DV KPL   HK K+    KLRSSITPGTVLI+LAG FKGKRVVFLKQL SGLLLVTGPFK
Sbjct  67   DVSKPL---HKNKVINAPKLRSSITPGTVLILLAGNFKGKRVVFLKQLESGLLLVTGPFK  123

Query  421  INGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            +NGVPLRRVNQAYVIAT+TKVDI  V+V K  D YF ++  KK
Sbjct  124  VNGVPLRRVNQAYVIATSTKVDISSVDVAKYSDAYFKREVAKK  166



>ref|XP_001770480.1| predicted protein [Physcomitrella patens]
 gb|EDQ64649.1| predicted protein [Physcomitrella patens]
Length=230

 Score =   206 bits (524),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 130/163 (80%), Gaps = 6/163 (4%)
 Frame = +1

Query  70   KSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPAD  249
            K+ ++ EL+RG+ +  RSK YHKRGLWAIKAKNGGKFP HEK  VAA  A + PKFYPAD
Sbjct  7    KASKSKELVRGINRSGRSKTYHKRGLWAIKAKNGGKFPTHEKAAVAAAPAVRAPKFYPAD  66

Query  250  DVKKPLVNKHKPKLT---KLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFK  420
            DV KPL   HK K+    KLRSSITPGTVLI+LAG FKGKRVVFLKQL SGLLLVTGPFK
Sbjct  67   DVAKPL---HKNKVVNAPKLRSSITPGTVLILLAGNFKGKRVVFLKQLESGLLLVTGPFK  123

Query  421  INGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            +NGVPLRRVNQAYVIAT+TKVDI  V+V K  D YF ++  KK
Sbjct  124  VNGVPLRRVNQAYVIATSTKVDISSVDVAKYSDAYFKREVAKK  166



>ref|XP_008363311.1| PREDICTED: 60S ribosomal protein L6-3-like [Malus domestica]
Length=232

 Score =   202 bits (514),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNP+LIRG+GK+SRSK+YHKRGLWAIKAKNGG FP H+KK  A   A KPPKFYPADD K
Sbjct  12   RNPDLIRGIGKYSRSKMYHKRGLWAIKAKNGGVFPRHDKKADADAPAVKPPKFYPADDFK  71

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPLVNK + K TKLR+SITPGTVLIILAG F GKRVVFLK L SGLLLVTGPFKINGVPL
Sbjct  72   KPLVNKREAKPTKLRASITPGTVLIILAGXFMGKRVVFLKXLSSGLLLVTGPFKINGVPL  131

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFG  531
            RRVNQ+YVI T TK+DI  VN +K DDKYF 
Sbjct  132  RRVNQSYVIGTKTKIDISRVNAKKFDDKYFA  162



>gb|AFW62784.1| hypothetical protein ZEAMMB73_027825 [Zea mays]
Length=171

 Score =   196 bits (498),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 120/154 (78%), Gaps = 5/154 (3%)
 Frame = +1

Query  88   ELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVKKPL  267
            +L  G+ + SRS  YH+RGLWAIKAKNGG FP          AA   PKFYPADDVK  +
Sbjct  6    KLSTGIKRASRSHTYHRRGLWAIKAKNGGAFPK-----ADKAAAAVEPKFYPADDVKPRV  60

Query  268  VNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPLRRV  447
             +  KPK TKLRSSITPGTVLI+LAGRF GKRVVFLKQL SGLLL++GPFKINGVP+RRV
Sbjct  61   PSTRKPKPTKLRSSITPGTVLILLAGRFMGKRVVFLKQLKSGLLLISGPFKINGVPIRRV  120

Query  448  NQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            NQ YVIAT+TKVDI GV+V K DDKYF ++ ++K
Sbjct  121  NQTYVIATSTKVDISGVDVAKFDDKYFAREKKQK  154



>ref|XP_004135912.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosomal protein L6-like 
[Cucumis sativus]
Length=231

 Score =   197 bits (502),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 131/155 (85%), Gaps = 0/155 (0%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVK  258
            RNP+LIRGVGK+SRSK+YHKRGLWAIKAKNGG FP H+ +P AA  AEKPPKFYPADDVK
Sbjct  10   RNPDLIRGVGKYSRSKMYHKRGLWAIKAKNGGVFPRHDAQPKAAAPAEKPPKFYPADDVK  69

Query  259  KPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPL  438
            KPLVNK K KLTKLR   +   +L +L  RF   RVVFLKQLPSGLLLVTGPFKINGVPL
Sbjct  70   KPLVNKRKAKLTKLRYDCSVQNLLNLLLRRFFXLRVVFLKQLPSGLLLVTGPFKINGVPL  129

Query  439  RRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAE  543
            RRVNQ+YVIAT+TKVDI GVN EK DDKYF K+A+
Sbjct  130  RRVNQSYVIATSTKVDISGVNSEKFDDKYFSKEAQ  164



>gb|AFW62778.1| hypothetical protein ZEAMMB73_276988 [Zea mays]
Length=171

 Score =   196 bits (497),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 120/154 (78%), Gaps = 5/154 (3%)
 Frame = +1

Query  88   ELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVKKPL  267
            +L  G+ + SRS  YH+RGLWAIKAKNGG FP          AA   PKFYPADDVK  +
Sbjct  6    KLSTGIKRASRSHAYHRRGLWAIKAKNGGAFPK-----ADKAAAAVEPKFYPADDVKPRV  60

Query  268  VNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPLRRV  447
             +  KPK TKLRSSITPGTVLI+LAGRF GKRVVFLKQL SGLLL++GPFKINGVP+RRV
Sbjct  61   PSTRKPKPTKLRSSITPGTVLILLAGRFMGKRVVFLKQLKSGLLLISGPFKINGVPIRRV  120

Query  448  NQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            NQ YVIAT+TKVDI GV+V K DDKYF ++ ++K
Sbjct  121  NQTYVIATSTKVDISGVDVAKFDDKYFAREKKQK  154



>ref|NP_001288419.1| 60S ribosomal protein L6-3-like [Zea mays]
 gb|ACG24443.1| 60S ribosomal protein L6 [Zea mays]
 gb|ACG24574.1| 60S ribosomal protein L6 [Zea mays]
 gb|ACG24766.1| 60S ribosomal protein L6 [Zea mays]
 gb|ACG25383.1| 60S ribosomal protein L6 [Zea mays]
 gb|ACG30865.1| 60S ribosomal protein L6 [Zea mays]
 gb|AFW62785.1| 60S ribosomal protein L6 [Zea mays]
Length=219

 Score =   196 bits (499),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 120/154 (78%), Gaps = 5/154 (3%)
 Frame = +1

Query  88   ELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVKKPL  267
            +L  G+ + SRS  YH+RGLWAIKAKNGG FP          AA   PKFYPADDVK  +
Sbjct  6    KLSTGIKRASRSHTYHRRGLWAIKAKNGGAFPK-----ADKAAAAVEPKFYPADDVKPRV  60

Query  268  VNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPLRRV  447
             +  KPK TKLRSSITPGTVLI+LAGRF GKRVVFLKQL SGLLL++GPFKINGVP+RRV
Sbjct  61   PSTRKPKPTKLRSSITPGTVLILLAGRFMGKRVVFLKQLKSGLLLISGPFKINGVPIRRV  120

Query  448  NQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            NQ YVIAT+TKVDI GV+V K DDKYF ++ ++K
Sbjct  121  NQTYVIATSTKVDISGVDVAKFDDKYFAREKKQK  154



>ref|NP_001130513.1| uncharacterized protein LOC100191612 [Zea mays]
 gb|ACF78759.1| unknown [Zea mays]
 gb|ACG24863.1| 60S ribosomal protein L6 [Zea mays]
 gb|ACN28238.1| unknown [Zea mays]
 gb|AFW62777.1| 60S ribosomal protein L6 [Zea mays]
Length=219

 Score =   196 bits (499),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 120/154 (78%), Gaps = 5/154 (3%)
 Frame = +1

Query  88   ELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVKKPL  267
            +L  G+ + SRS  YH+RGLWAIKAKNGG FP          AA   PKFYPADDVK  +
Sbjct  6    KLSTGIKRASRSHAYHRRGLWAIKAKNGGAFPK-----ADKAAAAVEPKFYPADDVKPRV  60

Query  268  VNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPLRRV  447
             +  KPK TKLRSSITPGTVLI+LAGRF GKRVVFLKQL SGLLL++GPFKINGVP+RRV
Sbjct  61   PSTRKPKPTKLRSSITPGTVLILLAGRFMGKRVVFLKQLKSGLLLISGPFKINGVPIRRV  120

Query  448  NQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            NQ YVIAT+TKVDI GV+V K DDKYF ++ ++K
Sbjct  121  NQTYVIATSTKVDISGVDVAKFDDKYFAREKKQK  154



>ref|XP_004975938.1| PREDICTED: 60S ribosomal protein L6-3-like [Setaria italica]
Length=219

 Score =   196 bits (497),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 119/154 (77%), Gaps = 5/154 (3%)
 Frame = +1

Query  88   ELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVKKPL  267
            +L  G+ K SRS  YH+RGLWAIKAK+GG FP         PAA   PKFYPADDVK   
Sbjct  6    KLSMGIKKASRSHAYHRRGLWAIKAKHGGAFPK-----AEKPAAVAEPKFYPADDVKPRK  60

Query  268  VNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPLRRV  447
             +  KPK TKLRSSITPGTVLI+LAGRF GKRVVFLKQL SG+LLVTGPFKINGVP+RRV
Sbjct  61   PSTRKPKPTKLRSSITPGTVLILLAGRFMGKRVVFLKQLKSGMLLVTGPFKINGVPIRRV  120

Query  448  NQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            NQ YVIAT+TKVDI GVNVEK DD YF +  ++K
Sbjct  121  NQTYVIATSTKVDISGVNVEKFDDAYFARDKKQK  154



>dbj|BAJ92124.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96314.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=219

 Score =   195 bits (495),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 115/146 (79%), Gaps = 5/146 (3%)
 Frame = +1

Query  100  GVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVKKPLVNKH  279
            G+ + SRS  YH+RGLWAIKAKNGG FP         PAA   PKFYPADDVK    +  
Sbjct  10   GIKRASRSHSYHRRGLWAIKAKNGGAFPK-----AEKPAAVAEPKFYPADDVKPRTASTR  64

Query  280  KPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPLRRVNQAY  459
            KPK TKLRS+ITPGTVLI+LAGR+ GKRVVFLKQL SGLLL+TGPFKINGVP+RRVNQAY
Sbjct  65   KPKPTKLRSTITPGTVLILLAGRYMGKRVVFLKQLKSGLLLITGPFKINGVPVRRVNQAY  124

Query  460  VIATATKVDICGVNVEKIDDKYFGKQ  537
            VIAT+TKVDI GV VEK DDKYF + 
Sbjct  125  VIATSTKVDISGVKVEKFDDKYFARD  150



>ref|XP_002448023.1| hypothetical protein SORBIDRAFT_06g019800 [Sorghum bicolor]
 gb|EES12351.1| hypothetical protein SORBIDRAFT_06g019800 [Sorghum bicolor]
Length=219

 Score =   194 bits (494),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 116/147 (79%), Gaps = 5/147 (3%)
 Frame = +1

Query  88   ELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVKKPL  267
            +L +G+ K SRS  YH+RGLWAIKAK+GG FP         PAA   PKFYPADDVK   
Sbjct  6    KLSQGIKKASRSHAYHRRGLWAIKAKHGGAFPK-----AEKPAAVAEPKFYPADDVKPRK  60

Query  268  VNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPLRRV  447
             +  KPK TKLRSSITPGTVLI+LAGRF GKRVVFLKQL SGLLLVTGPFKINGVP+RRV
Sbjct  61   PSTRKPKPTKLRSSITPGTVLILLAGRFMGKRVVFLKQLKSGLLLVTGPFKINGVPIRRV  120

Query  448  NQAYVIATATKVDICGVNVEKIDDKYF  528
            NQ Y IAT+TKVDI GVNVEK DDKYF
Sbjct  121  NQTYTIATSTKVDISGVNVEKFDDKYF  147



>gb|EMT00299.1| 60S ribosomal protein L6 [Aegilops tauschii]
Length=219

 Score =   192 bits (488),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 115/146 (79%), Gaps = 5/146 (3%)
 Frame = +1

Query  100  GVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVKKPLVNKH  279
            G+ + SRS  YH+RGLWAIKAK+GG FP         PAA   PKFYPADDVK    +  
Sbjct  10   GIKRASRSHTYHRRGLWAIKAKHGGAFPK-----AEKPAAVAEPKFYPADDVKPRTASTR  64

Query  280  KPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPLRRVNQAY  459
            KPK TKLRS+ITPGTVLI+LAGR+ GKRVVFLKQL SGLLL++GPFKINGVP+RRVNQAY
Sbjct  65   KPKPTKLRSTITPGTVLILLAGRYMGKRVVFLKQLKSGLLLISGPFKINGVPVRRVNQAY  124

Query  460  VIATATKVDICGVNVEKIDDKYFGKQ  537
            VIAT+TKVDI GV VEK DDKYF + 
Sbjct  125  VIATSTKVDISGVKVEKFDDKYFARD  150



>emb|CAH67436.1| H0305E08.7 [Oryza sativa Indica Group]
Length=222

 Score =   192 bits (488),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 121/153 (79%), Gaps = 2/153 (1%)
 Frame = +1

Query  91   LIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVKKPLV  270
            L +G+ K SRS  YH+RGLWAIKAK+GG F   + +  AA AA   PKFYPADDVK    
Sbjct  7    LSQGIKKASRSHTYHRRGLWAIKAKHGGAF--PKAEKPAAAAAASAPKFYPADDVKPRQP  64

Query  271  NKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPLRRVN  450
            +  KP  TKLRSSITPGTVLI+LAGRF GKRVVFLKQL SGLLLVTGPFKINGVP+RRVN
Sbjct  65   STRKPNPTKLRSSITPGTVLILLAGRFMGKRVVFLKQLKSGLLLVTGPFKINGVPIRRVN  124

Query  451  QAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            Q YVIAT+TKVDI GVNVEK DDKYF +  ++K
Sbjct  125  QPYVIATSTKVDISGVNVEKFDDKYFSRDKKQK  157



>ref|NP_001053065.2| Os04g0473400 [Oryza sativa Japonica Group]
 emb|CAE02874.2| OSJNBb0022F23.11 [Oryza sativa Japonica Group]
 dbj|BAG90655.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC77460.1| hypothetical protein OsI_16279 [Oryza sativa Indica Group]
 dbj|BAF14979.2| Os04g0473400 [Oryza sativa Japonica Group]
Length=222

 Score =   192 bits (488),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 121/153 (79%), Gaps = 2/153 (1%)
 Frame = +1

Query  91   LIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVKKPLV  270
            L +G+ K SRS  YH+RGLWAIKAK+GG F   + +  AA AA   PKFYPADDVK    
Sbjct  7    LSQGIKKASRSHTYHRRGLWAIKAKHGGAF--PKAEKPAAAAAAAAPKFYPADDVKPRQP  64

Query  271  NKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPLRRVN  450
            +  KP  TKLRSSITPGTVLI+LAGRF GKRVVFLKQL SGLLLVTGPFKINGVP+RRVN
Sbjct  65   STRKPNPTKLRSSITPGTVLILLAGRFMGKRVVFLKQLKSGLLLVTGPFKINGVPIRRVN  124

Query  451  QAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            Q YVIAT+TKVDI GVNVEK DDKYF +  ++K
Sbjct  125  QPYVIATSTKVDISGVNVEKFDDKYFSRDKKQK  157



>ref|XP_002955353.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ43653.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
Length=268

 Score =   192 bits (489),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 119/153 (78%), Gaps = 0/153 (0%)
 Frame = +1

Query  91   LIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVKKPLV  270
            + RG+    RSK Y ++GLWAIK KNGGKFP H KK   A    K P+FYPADDV KPL 
Sbjct  53   IARGITAEGRSKTYKRKGLWAIKKKNGGKFPTHAKKAAPAQPEGKAPRFYPADDVPKPLA  112

Query  271  NKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPLRRVN  450
            +K   K T+LR+SITPGTVLI+LAGRFKGKRV+FL QLPSGLLLVTGPFK+NGVP RRVN
Sbjct  113  HKAVNKPTQLRASITPGTVLILLAGRFKGKRVIFLSQLPSGLLLVTGPFKLNGVPARRVN  172

Query  451  QAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
             AYVIAT+TKV++  +++ + DDKYF  Q EK+
Sbjct  173  AAYVIATSTKVELPKLDLSQFDDKYFQAQEEKR  205



>gb|EMS51678.1| 60S ribosomal protein L6 [Triticum urartu]
Length=219

 Score =   191 bits (484),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 115/146 (79%), Gaps = 5/146 (3%)
 Frame = +1

Query  100  GVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVKKPLVNKH  279
            G+ + SRS  YH+RGLWAIKAK+GG FP         PAA   PKFYPADDVK   V+  
Sbjct  10   GIKRASRSHTYHRRGLWAIKAKHGGAFP-----KAEKPAAVAEPKFYPADDVKPRTVSTR  64

Query  280  KPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPLRRVNQAY  459
            KP  TKLRS+ITPGTVLI+LAGR+ GKRVVFLKQL SGLLL+TGPFKINGVP+RRVNQ Y
Sbjct  65   KPHPTKLRSTITPGTVLILLAGRYMGKRVVFLKQLKSGLLLITGPFKINGVPIRRVNQTY  124

Query  460  VIATATKVDICGVNVEKIDDKYFGKQ  537
            VIAT+TKVDI  VNV+K DDKYF ++
Sbjct  125  VIATSTKVDISKVNVQKFDDKYFARE  150



>pdb|3J61|E Chain E, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 gb|AAW50981.1| ribosomal protein L6 [Triticum aestivum]
Length=219

 Score =   190 bits (482),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 115/146 (79%), Gaps = 5/146 (3%)
 Frame = +1

Query  100  GVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVKKPLVNKH  279
            G+ + SRS  YH+RGLWAIKAK+GG  P         PAA   PKFYPADDVK   V+  
Sbjct  10   GIKRASRSHTYHRRGLWAIKAKHGGALP-----KAEKPAAIAEPKFYPADDVKPRTVSTR  64

Query  280  KPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPLRRVNQAY  459
            KP  TKLRS+ITPGTVLI+LAGR+ GKRVVFLKQL SGLLL+TGPFKINGVP+RRVNQAY
Sbjct  65   KPHPTKLRSTITPGTVLILLAGRYMGKRVVFLKQLQSGLLLITGPFKINGVPIRRVNQAY  124

Query  460  VIATATKVDICGVNVEKIDDKYFGKQ  537
            VIAT+TKVDI  VNV+K DDKYF ++
Sbjct  125  VIATSTKVDISKVNVQKFDDKYFARE  150



>gb|EMT33645.1| 60S ribosomal protein L6 [Aegilops tauschii]
Length=213

 Score =   189 bits (481),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 115/146 (79%), Gaps = 5/146 (3%)
 Frame = +1

Query  100  GVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVKKPLVNKH  279
            G+ + SRS  YH+RGLWAIKAK+GG  P         PAA   PKFYPADDVK   V+  
Sbjct  4    GIKRASRSHTYHRRGLWAIKAKHGGALP-----KAEKPAAVAEPKFYPADDVKPRTVSTR  58

Query  280  KPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPLRRVNQAY  459
            KP  TKLRS+ITPGTVLI+LAGR+ GKRVVFLKQL SGLLL+TGPFKINGVP+RRVNQAY
Sbjct  59   KPHPTKLRSTITPGTVLILLAGRYMGKRVVFLKQLQSGLLLITGPFKINGVPIRRVNQAY  118

Query  460  VIATATKVDICGVNVEKIDDKYFGKQ  537
            VIAT+TKVDI  VNV+K DDKYF ++
Sbjct  119  VIATSTKVDISKVNVQKFDDKYFARE  144



>ref|XP_002454094.1| hypothetical protein SORBIDRAFT_04g024500 [Sorghum bicolor]
 gb|EES07070.1| hypothetical protein SORBIDRAFT_04g024500 [Sorghum bicolor]
Length=219

 Score =   189 bits (481),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 120/154 (78%), Gaps = 5/154 (3%)
 Frame = +1

Query  88   ELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVKKPL  267
            +L  G+ + SRS  YH+RGLWAIKAK+GG F          PAA   PKFYPADDVK  +
Sbjct  6    KLSMGIKRASRSHAYHRRGLWAIKAKHGGAF-----PKAEKPAAAAEPKFYPADDVKPRV  60

Query  268  VNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPLRRV  447
             +  KPK TKLRSSITPGTVLI+LAGRF GKRVVFLKQL SGLLLV+GPFKINGVP+RRV
Sbjct  61   PSTRKPKPTKLRSSITPGTVLILLAGRFMGKRVVFLKQLKSGLLLVSGPFKINGVPIRRV  120

Query  448  NQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            NQ YVIAT+TKVDI GV+V K DDKYF ++ ++K
Sbjct  121  NQTYVIATSTKVDISGVDVAKFDDKYFAREKKQK  154



>ref|XP_009605973.1| PREDICTED: uncharacterized protein LOC104100450 [Nicotiana tomentosiformis]
Length=301

 Score =   192 bits (488),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = +1

Query  58   MAAKKSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkF  237
            MA KK+ RNPELI G+GKFSR K+YHK+GLWAIK KN G FP H KKP A   A KPPKF
Sbjct  1    MAPKKTLRNPELIPGLGKFSRYKMYHKKGLWAIKKKNSGSFPSHNKKPTATAPAIKPPKF  60

Query  238  YPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPF  417
            YPADDV KPLVNK+KPK TK R+SITPGTVLIILAGRFKGKRVVFLKQL S LLLVTGPF
Sbjct  61   YPADDVAKPLVNKNKPKPTKRRASITPGTVLIILAGRFKGKRVVFLKQLGSRLLLVTGPF  120

Query  418  KINGVPLRRVNQAYVIATATKVDICG  495
            K+NG PLRRVNQ YVI      D+ G
Sbjct  121  KLNGGPLRRVNQGYVIVFGRICDLGG  146



>ref|XP_005849340.1| hypothetical protein CHLNCDRAFT_21468 [Chlorella variabilis]
 gb|EFN57238.1| hypothetical protein CHLNCDRAFT_21468 [Chlorella variabilis]
Length=223

 Score =   189 bits (481),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 117/155 (75%), Gaps = 2/155 (1%)
 Frame = +1

Query  88   ELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekp-pkFYPADDVKKP  264
            E+ RGV +  RSK YH+RGLWAIK KNGGKFP H KK  A   A     KFY A+D   P
Sbjct  4    EVARGVVREGRSKSYHRRGLWAIKKKNGGKFPTHAKKAAAPAEASTKPAKFYAAEDAPVP  63

Query  265  LVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPLRR  444
            L  +   +  KLR SITPGTVLI+LAGRFKGKRVVFL QLPSGLLLVTGPFK+NGVPLRR
Sbjct  64   LARRVIRRPAKLRPSITPGTVLILLAGRFKGKRVVFLGQLPSGLLLVTGPFKLNGVPLRR  123

Query  445  VNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            VNQAYVIAT+TKVD+ GV+  K DD YF K AEKK
Sbjct  124  VNQAYVIATSTKVDVSGVDTAKFDDAYF-KSAEKK  157



>gb|ACN34500.1| unknown [Zea mays]
Length=219

 Score =   189 bits (480),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 119/154 (77%), Gaps = 5/154 (3%)
 Frame = +1

Query  88   ELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVKKPL  267
            +L  G+ + SRS  YH+RGLWAIKAKNGG F          PAA   PKFYPADDVK  +
Sbjct  6    KLSMGIKRASRSHAYHRRGLWAIKAKNGGVF-----PKAEKPAAAAEPKFYPADDVKPRV  60

Query  268  VNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPLRRV  447
             +  KP  TKLRSSITPGTVLI+LAGRF GKRVVFLKQL SGLLLV+GPFKINGVP+RRV
Sbjct  61   PSTRKPNPTKLRSSITPGTVLILLAGRFMGKRVVFLKQLNSGLLLVSGPFKINGVPIRRV  120

Query  448  NQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            NQ YVIAT+TKVDI GV+V K DDKYF ++ ++K
Sbjct  121  NQTYVIATSTKVDISGVDVAKFDDKYFAREKKQK  154



>ref|XP_003571841.1| PREDICTED: 60S ribosomal protein L6-like [Brachypodium distachyon]
Length=219

 Score =   189 bits (479),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 114/146 (78%), Gaps = 5/146 (3%)
 Frame = +1

Query  100  GVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVKKPLVNKH  279
            G+ + SRS  YH+RGLWAIKAK+GG FP         PAA   PKFYPADDVK   V+  
Sbjct  10   GIKRASRSHSYHRRGLWAIKAKHGGAFPK-----AEKPAAVAEPKFYPADDVKPRTVSTR  64

Query  280  KPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPLRRVNQAY  459
            KPK TKLRS+ITPGTVLI+LAGR+ GKRVVFLKQL SGLLL+TGPFKINGVP+RRVNQ Y
Sbjct  65   KPKPTKLRSTITPGTVLILLAGRYMGKRVVFLKQLKSGLLLITGPFKINGVPIRRVNQTY  124

Query  460  VIATATKVDICGVNVEKIDDKYFGKQ  537
            VIAT+TKVDI  VNV K DDKYF + 
Sbjct  125  VIATSTKVDISKVNVGKFDDKYFARD  150



>dbj|BAJ88608.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=219

 Score =   187 bits (476),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 116/146 (79%), Gaps = 5/146 (3%)
 Frame = +1

Query  100  GVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVKKPLVNKH  279
            G+ + SRS+ YH+RGLWAIKAK+GG FP         PAA   PKFYPADDVK    +  
Sbjct  10   GIKRTSRSRTYHRRGLWAIKAKHGGAFPK-----AEKPAAVAEPKFYPADDVKPRTFSTR  64

Query  280  KPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPLRRVNQAY  459
            KP  TKLRS+ITPGTVLI+LAGR+ GKRVVFLKQL SGLLL+TGPFKINGVP+RRVNQAY
Sbjct  65   KPHPTKLRSTITPGTVLILLAGRYMGKRVVFLKQLKSGLLLITGPFKINGVPIRRVNQAY  124

Query  460  VIATATKVDICGVNVEKIDDKYFGKQ  537
            VI+T+T++DI  VN++K DDKYF ++
Sbjct  125  VISTSTRLDISKVNMQKFDDKYFARE  150



>ref|XP_003575257.1| PREDICTED: 60S ribosomal protein L6-3-like [Brachypodium distachyon]
Length=219

 Score =   187 bits (475),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 113/146 (77%), Gaps = 5/146 (3%)
 Frame = +1

Query  100  GVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVKKPLVNKH  279
            G+ + SRS  YH+RGLWAIKAK+GG FP         PAA   PKFYPADDVK    +  
Sbjct  10   GIKRASRSHSYHRRGLWAIKAKHGGAFPK-----AEKPAAVAEPKFYPADDVKPRNPSTR  64

Query  280  KPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPLRRVNQAY  459
            KP  TKLRS+ITPGTVLI+LAGR+ GKRVVFLKQL SGLLL+TGPFKINGVP+RRVNQ Y
Sbjct  65   KPNPTKLRSTITPGTVLILLAGRYMGKRVVFLKQLKSGLLLITGPFKINGVPIRRVNQTY  124

Query  460  VIATATKVDICGVNVEKIDDKYFGKQ  537
            VIAT+TKVDI GV VEK DDKYF + 
Sbjct  125  VIATSTKVDISGVKVEKFDDKYFARD  150



>ref|XP_008645881.1| PREDICTED: 60S ribosomal protein L6-like [Zea mays]
 gb|AFW72087.1| 60S ribosomal protein L6 [Zea mays]
Length=279

 Score =   189 bits (480),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 119/154 (77%), Gaps = 5/154 (3%)
 Frame = +1

Query  88   ELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVKKPL  267
            +L  G+ + SRS  YH+RGLWAIKAKNGG F          PAA   PKFYPADDVK  +
Sbjct  66   KLSMGIKRASRSHAYHRRGLWAIKAKNGGVF-----PKAEKPAAAAEPKFYPADDVKPRV  120

Query  268  VNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPLRRV  447
             +  KP  TKLRSSITPGTVLI+LAGRF GKRVVFLKQL SGLLLV+GPFKINGVP+RRV
Sbjct  121  PSTRKPNPTKLRSSITPGTVLILLAGRFMGKRVVFLKQLNSGLLLVSGPFKINGVPIRRV  180

Query  448  NQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            NQ YVIAT+TKVDI GV+V K DDKYF ++ ++K
Sbjct  181  NQTYVIATSTKVDISGVDVAKFDDKYFAREKKQK  214



>ref|XP_011399116.1| 60S ribosomal protein L6 [Auxenochlorella protothecoides]
 gb|KFM26220.1| 60S ribosomal protein L6 [Auxenochlorella protothecoides]
Length=220

 Score =   187 bits (474),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 113/154 (73%), Gaps = 1/154 (1%)
 Frame = +1

Query  88   ELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVKKPL  267
            E ++  G   RS  Y KRGLWAIK KNGG FP H K   A  A  K P+FYPA+D KKPL
Sbjct  4    EAVKPAGGRGRSLSYKKRGLWAIKKKNGGTFPVHAKAEKAEVAVTKAPRFYPAEDAKKPL  63

Query  268  VNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPLRRV  447
                    TKLR+SITPGTVLI+LAGRFKGKRVVFLKQLPSGLLLVTGPF++NGVP RRV
Sbjct  64   NRSFVRNPTKLRASITPGTVLILLAGRFKGKRVVFLKQLPSGLLLVTGPFRVNGVPARRV  123

Query  448  NQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            NQAYVIAT+TKVD+ GV+     D YF K  EKK
Sbjct  124  NQAYVIATSTKVDVSGVDTAAFTDAYF-KSTEKK  156



>ref|XP_006652403.1| PREDICTED: 60S ribosomal protein L6-3-like [Oryza brachyantha]
Length=221

 Score =   186 bits (471),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 117/154 (76%), Gaps = 3/154 (2%)
 Frame = +1

Query  88   ELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVKKPL  267
            +L +G+ K SRS  YH+RGLWAIKAKNGG FP   K   AA AA K      ADDVK   
Sbjct  6    KLSQGIKKASRSHTYHRRGLWAIKAKNGGAFPKAGKPDAAAAAAPKFYP---ADDVKPRQ  62

Query  268  VNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPLRRV  447
             +  KP  TKLRSSITPGTVLI LAGR+ GKRVVFLKQL SGLLLVTGPFKINGVP+RRV
Sbjct  63   PSTRKPHPTKLRSSITPGTVLIFLAGRYMGKRVVFLKQLKSGLLLVTGPFKINGVPIRRV  122

Query  448  NQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            NQAYVIAT+TKVDI GVNVEK DDKYF +  + K
Sbjct  123  NQAYVIATSTKVDISGVNVEKFDDKYFARDKKTK  156



>ref|NP_001047288.1| Os02g0591700 [Oryza sativa Japonica Group]
 dbj|BAD17436.1| putative 60S ribosomal protein L6 (RPL6C) [Oryza sativa Japonica 
Group]
 dbj|BAD34078.1| putative 60S ribosomal protein L6 (RPL6C) [Oryza sativa Japonica 
Group]
 dbj|BAF09202.1| Os02g0591700 [Oryza sativa Japonica Group]
 gb|EAY86491.1| hypothetical protein OsI_07870 [Oryza sativa Indica Group]
 dbj|BAG93142.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57280.1| hypothetical protein OsJ_07332 [Oryza sativa Japonica Group]
Length=219

 Score =   185 bits (470),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 101/150 (67%), Positives = 115/150 (77%), Gaps = 5/150 (3%)
 Frame = +1

Query  88   ELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVKKPL  267
            +L +G+ + SRS  YH+RGLWAIKAKNGG F          PAA   PKFYPADDVK   
Sbjct  6    KLSQGIKRASRSHTYHRRGLWAIKAKNGGTF-----PKAGKPAAAAEPKFYPADDVKPRA  60

Query  268  VNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPLRRV  447
             +  K   TKLRS+ITPGTVLI+LAGR+ GKRVVFLKQL SGLLL+TGPFKINGVP+RRV
Sbjct  61   PSTRKANPTKLRSTITPGTVLILLAGRYMGKRVVFLKQLKSGLLLITGPFKINGVPIRRV  120

Query  448  NQAYVIATATKVDICGVNVEKIDDKYFGKQ  537
            NQAYVIAT+TKVDI GV V+K DDKYF + 
Sbjct  121  NQAYVIATSTKVDISGVKVDKFDDKYFARD  150



>ref|XP_006647437.1| PREDICTED: 60S ribosomal protein L6-3-like [Oryza brachyantha]
Length=219

 Score =   181 bits (459),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 114/150 (76%), Gaps = 5/150 (3%)
 Frame = +1

Query  88   ELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVKKPL  267
            +L +G+ + SRS  YH+RGLWAIKAK+GG F          PAA   PKFYPADD K   
Sbjct  6    KLSQGIKRASRSHTYHRRGLWAIKAKHGGAF-----PKAEKPAAAAEPKFYPADDAKPRT  60

Query  268  VNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPLRRV  447
             +  K   TKLRS+ITPGTVLI+LAGR+ GKRVVFLKQL SGLLL+TGPFK+NGVP+RRV
Sbjct  61   PSTRKANPTKLRSTITPGTVLIMLAGRYMGKRVVFLKQLKSGLLLITGPFKVNGVPIRRV  120

Query  448  NQAYVIATATKVDICGVNVEKIDDKYFGKQ  537
            NQAYVIAT+TKVDI GV V+K DDKYF + 
Sbjct  121  NQAYVIATSTKVDISGVKVDKFDDKYFARD  150



>ref|XP_010943581.1| PREDICTED: 60S ribosomal protein L6-like [Elaeis guineensis]
Length=202

 Score =   180 bits (457),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 106/129 (82%), Gaps = 0/129 (0%)
 Frame = +1

Query  160  AKNGGKFPHHekkpvaapaaekppkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIIL  339
            AK+GG FP HE K      AEK PKFYPADDVK P+ N  KPK TKLR SITPGTVLI+L
Sbjct  8    AKHGGSFPRHEPKAAPPKPAEKAPKFYPADDVKTPIPNHRKPKPTKLRPSITPGTVLILL  67

Query  340  AGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPLRRVNQAYVIATATKVDICGVNVEKIDD  519
            AGRF GKRVVFLKQLPSGLLLVTGPFKINGVPLRRVNQAYVI T+TK+DI GV+VE+ D 
Sbjct  68   AGRFMGKRVVFLKQLPSGLLLVTGPFKINGVPLRRVNQAYVIGTSTKIDISGVDVERFDG  127

Query  520  KYFGKQAEK  546
            KYF K+ +K
Sbjct  128  KYFTKEKKK  136



>ref|XP_008344225.1| PREDICTED: 60S ribosomal protein L6-like [Malus domestica]
Length=124

 Score =   172 bits (436),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 105/122 (86%), Gaps = 4/122 (3%)
 Frame = +1

Query  58   MAAK----KSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaek  225
            MAAK    +  RNP+L+RGVGKFSRSK+YHKRGLWAIKAKNGG FP H+ KP A    EK
Sbjct  1    MAAKARNPRKTRNPDLVRGVGKFSRSKMYHKRGLWAIKAKNGGVFPRHDAKPAAETQPEK  60

Query  226  ppkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLV  405
            PPKFYPADDVKKPLVNK KPK TKLR+SITPGTVLIILAGRFKGKRVVFLKQL SGLLLV
Sbjct  61   PPKFYPADDVKKPLVNKRKPKPTKLRASITPGTVLIILAGRFKGKRVVFLKQLSSGLLLV  120

Query  406  TG  411
            TG
Sbjct  121  TG  122



>ref|XP_001689873.1| ribosomal protein L6, component of cytosolic 80S ribosome and 
60S large subunit [Chlamydomonas reinhardtii]
 gb|EDP09611.1| ribosomal protein L6 [Chlamydomonas reinhardtii]
Length=223

 Score =   175 bits (444),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 112/146 (77%), Gaps = 0/146 (0%)
 Frame = +1

Query  91   LIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVKKPLV  270
            + RG+    R+K Y ++GLWAIK KNGGKFP   KK VA  A  K P+FYPADDV KPL 
Sbjct  8    VARGITAEGRAKTYKRKGLWAIKKKNGGKFPAPAKKAVAKQAEGKAPRFYPADDVPKPLS  67

Query  271  NKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPLRRVN  450
            +    K TKLR+SITPGTVLI+LAGRFKGKRV+FL QLPSGLLLVTGPFK+NGVP+RRVN
Sbjct  68   HNAVHKQTKLRASITPGTVLILLAGRFKGKRVIFLGQLPSGLLLVTGPFKLNGVPVRRVN  127

Query  451  QAYVIATATKVDICGVNVEKIDDKYF  528
             AYVI T+TKV +  +++ K  D YF
Sbjct  128  AAYVIGTSTKVSLPKLDLSKFTDSYF  153



>gb|KIZ07133.1| 60S ribosomal protein L6 [Monoraphidium neglectum]
Length=222

 Score =   175 bits (443),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 113/146 (77%), Gaps = 0/146 (0%)
 Frame = +1

Query  91   LIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVKKPLV  270
            + +G+    RSK Y +RGLWAIK K+GGKFP   K+  A   A K P+FYPADDV KPL 
Sbjct  7    IAKGITAHGRSKTYKRRGLWAIKKKHGGKFPTTPKQQKADAPAAKAPRFYPADDVAKPLS  66

Query  271  NKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPLRRVN  450
             +   K TKLR+SITPGTVLI+LAGRFKGKRVVFLKQL SGLLLVTGPFK+NGVP RRVN
Sbjct  67   VRAVRKPTKLRASITPGTVLILLAGRFKGKRVVFLKQLESGLLLVTGPFKVNGVPARRVN  126

Query  451  QAYVIATATKVDICGVNVEKIDDKYF  528
            QAYVIAT+TKV++  +++ K  D YF
Sbjct  127  QAYVIATSTKVELPQLDLAKFTDGYF  152



>gb|ACU44936.1| 60s ribosomal protein l6 [Pfiesteria piscicida]
Length=233

 Score =   171 bits (432),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 108/143 (76%), Gaps = 1/143 (1%)
 Frame = +1

Query  106  GKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVKKPLVNKHKP  285
             K  RS  YH+ G WA+K KNGGK+P ++K    A A + P  FYPA+DV KP   ++  
Sbjct  24   AKVGRSASYHRSGKWAVKKKNGGKWPVNKKAEKPAAATKAPR-FYPAEDVPKPFARRNVA  82

Query  286  KLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPLRRVNQAYVI  465
            K  KLR SIT GT+LI+L+GRF+GKRVVFLKQL SGLLLVTGP+KINGVPLRR+NQA+ I
Sbjct  83   KAAKLRESITAGTILILLSGRFRGKRVVFLKQLESGLLLVTGPYKINGVPLRRINQAFAI  142

Query  466  ATATKVDICGVNVEKIDDKYFGK  534
            AT+TKVD+ GV+V K +D YF +
Sbjct  143  ATSTKVDVSGVDVSKFNDAYFAR  165



>gb|KJB16392.1| hypothetical protein B456_002G228400 [Gossypium raimondii]
Length=140

 Score =   165 bits (418),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 108/122 (89%), Gaps = 4/122 (3%)
 Frame = +1

Query  58   MAAK-KSP---RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaek  225
            MAAK K+P   RNP+LIRGVGK+SRSK+YHKRGLWAIKAKNGG FP H+ KP A  AAEK
Sbjct  1    MAAKRKTPVKTRNPDLIRGVGKYSRSKMYHKRGLWAIKAKNGGAFPRHDPKPKAPAAAEK  60

Query  226  ppkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLV  405
            PPKFYPA+DVKKPL+NK KPK TKLR+SITPGTVLI+LAGRF GKRVVFLKQL SGLLLV
Sbjct  61   PPKFYPAEDVKKPLLNKRKPKPTKLRASITPGTVLILLAGRFMGKRVVFLKQLTSGLLLV  120

Query  406  TG  411
            TG
Sbjct  121  TG  122



>gb|KIZ06435.1| 60S ribosomal protein L6 [Monoraphidium neglectum]
Length=191

 Score =   166 bits (421),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 107/140 (76%), Gaps = 0/140 (0%)
 Frame = +1

Query  64   AKKSPRNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYP  243
            A  S +   + +G+    RSK Y +RGLWAIK K+GGKFP   K+  A   A K P+FYP
Sbjct  7    AACSAKATVIAKGITAHGRSKTYKRRGLWAIKKKHGGKFPTTPKQQKADAPAAKAPRFYP  66

Query  244  ADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKI  423
            ADDV KPL  +   K TKLR+SITPGTVLI+LAGRFKGKRVVFLKQL SGLLLVTGPFK+
Sbjct  67   ADDVAKPLSVRAVRKPTKLRASITPGTVLILLAGRFKGKRVVFLKQLESGLLLVTGPFKV  126

Query  424  NGVPLRRVNQAYVIATATKV  483
            NGVP RRVNQAYVIAT+TKV
Sbjct  127  NGVPARRVNQAYVIATSTKV  146



>gb|KII95092.1| hypothetical protein PLICRDRAFT_693360 [Plicaturopsis crispa 
FD-325 SS-3]
Length=238

 Score =   168 bits (425),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 120/169 (71%), Gaps = 13/169 (8%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKN----GGKFPHHekkp--------vaapaae  222
            R+ EL  GVG++SRS++  +RGLW    K+      + P H++                 
Sbjct  3    RSKELAPGVGRYSRSQVAARRGLWKGPKKSEKPAAEEVPAHKEVQVGGDKNGGKRLVPTT  62

Query  223  kppkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLL  402
            K P+FYPA+DV++P  ++  PK TKLRSSITPGTVLI+LAGRF+GKRVVFLKQL SGLLL
Sbjct  63   KAPRFYPAEDVRQPKKSRKHPKPTKLRSSITPGTVLILLAGRFRGKRVVFLKQLDSGLLL  122

Query  403  VTGPFKINGVPLRRVNQAYVIATATKVDICGVNV-EKIDDKYFGKQAEK  546
            VTGPFK+NGVPLRRVNQAYVIAT+TK++I  + V +KI+D YF K A K
Sbjct  123  VTGPFKVNGVPLRRVNQAYVIATSTKLEIDDLKVDDKINDSYFAKAATK  171



>gb|KIY49295.1| hypothetical protein FISHEDRAFT_41710 [Fistulina hepatica ATCC 
64428]
Length=238

 Score =   167 bits (424),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 114/173 (66%), Gaps = 31/173 (18%)
 Frame = +1

Query  76   PRNPELIRGVGKFSRSKIYHKRGLW-------AIKA--------------KNGGKFPHHe  192
            PR+ EL+ G+G+ SRS++  KRGLW       A  A              KNGGK     
Sbjct  2    PRSKELVPGIGRLSRSQVAAKRGLWKGPKKSVAPAAEPVPEFVEKSVGGEKNGGK-----  56

Query  193  kkpvaapaaekppkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVF  372
                      K  +FYPA+DV KP  N+   K T+LRSSITPGTVLI+LAGRF+GKRVVF
Sbjct  57   ----RLVPTAKASRFYPAEDVPKPKKNRKSHKPTQLRSSITPGTVLILLAGRFRGKRVVF  112

Query  373  LKQLPSGLLLVTGPFKINGVPLRRVNQAYVIATATKVDICGVNVE-KIDDKYF  528
            LKQL SGLLLVTGPFK+NGVPLRRVNQAY IAT+TKVD+  + V+ KIDD YF
Sbjct  113  LKQLTSGLLLVTGPFKVNGVPLRRVNQAYAIATSTKVDLADIKVDAKIDDAYF  165



>gb|EEE61175.1| hypothetical protein OsJ_15159 [Oryza sativa Japonica Group]
Length=222

 Score =   167 bits (422),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 118/153 (77%), Gaps = 2/153 (1%)
 Frame = +1

Query  91   LIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaekppkFYPADDVKKPLV  270
            L +G+ K SRS  YH+RGLWAIKAK+GG F   + +  AA AA   PKFYPADDVK    
Sbjct  7    LSQGIKKASRSHTYHRRGLWAIKAKHGGAF--PKAEKPAAAAAAAAPKFYPADDVKPRQP  64

Query  271  NKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGPFKINGVPLRRVN  450
            +  KP  TKL SSITPGTVLI+L+ RF GKRVVFL QL SGLLLVTGPFKINGVP+RRVN
Sbjct  65   STRKPNPTKLSSSITPGTVLILLSWRFMGKRVVFLLQLKSGLLLVTGPFKINGVPIRRVN  124

Query  451  QAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            Q YVIAT+TKVDI GVNVEK DDKYF +  ++K
Sbjct  125  QPYVIATSTKVDISGVNVEKFDDKYFSRDKKQK  157



>ref|XP_007315588.1| hypothetical protein SERLADRAFT_461013 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGO01869.1| hypothetical protein SERLA73DRAFT_177423 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGO27497.1| hypothetical protein SERLADRAFT_461013 [Serpula lacrymans var. 
lacrymans S7.9]
Length=238

 Score =   167 bits (422),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 94/169 (56%), Positives = 118/169 (70%), Gaps = 13/169 (8%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWA----IKAKNGGKFPH--------Hekkpvaapaae  222
            R+ +L  GV +FSRS++  +RGL+      K  N  + P          +          
Sbjct  3    RSRQLAPGVSRFSRSQVASRRGLYKGLKKSKDSNAEETPAFKEVTVGGEKNGSTRLVPTS  62

Query  223  kppkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLL  402
            K P+FYPA+DV++P  ++  PK TKLRSSITPG+VLI+LAGRF+GKRVVFLKQL SGLLL
Sbjct  63   KAPRFYPAEDVRQPKKSRKSPKPTKLRSSITPGSVLILLAGRFRGKRVVFLKQLESGLLL  122

Query  403  VTGPFKINGVPLRRVNQAYVIATATKVDICGVNVE-KIDDKYFGKQAEK  546
            VTGP+KINGVPLRRVNQAYVIAT+TKVD+ G+ V+ KI+D YF K A K
Sbjct  123  VTGPYKINGVPLRRVNQAYVIATSTKVDLEGLKVDAKINDAYFAKTATK  171



>ref|XP_002470112.1| 60S ribosomal protein L6 [Postia placenta Mad-698-R]
 gb|EED84715.1| 60S ribosomal protein L6 [Postia placenta Mad-698-R]
Length=238

 Score =   166 bits (421),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 96/178 (54%), Positives = 119/178 (67%), Gaps = 31/178 (17%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLW-AIK--------------------AKNGGKFPHHek  195
            R+ EL+ GVG+ SRS+++ +RGL+  +K                     KNGGK      
Sbjct  3    RSKELVPGVGRLSRSQVFARRGLYKGLKKSEKPAAPEVAETKEKEIGGEKNGGK------  56

Query  196  kpvaapaaekppkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFL  375
                     K P+FYPA+DV++P  ++  PK TKLRSSITPGTVLI+LAGRF+GKRVVFL
Sbjct  57   ---RVIPVAKAPRFYPAEDVRQPKKSRKSPKPTKLRSSITPGTVLILLAGRFRGKRVVFL  113

Query  376  KQLPSGLLLVTGPFKINGVPLRRVNQAYVIATATKVDICGVNV-EKIDDKYFGKQAEK  546
            KQL SGLLLVTGP+K+NGVPLRRVNQAYVIAT+TK+D+      EKI+D YF K A K
Sbjct  114  KQLESGLLLVTGPYKVNGVPLRRVNQAYVIATSTKIDLAEFKADEKINDAYFAKAAAK  171



>gb|KJB76633.1| hypothetical protein B456_012G100600 [Gossypium raimondii]
Length=130

 Score =   162 bits (411),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 106/122 (87%), Gaps = 4/122 (3%)
 Frame = +1

Query  58   MAAK-KSP---RNPELIRGVGKFSRSKIYHKRGLWAIKAKNGGKFPHHekkpvaapaaek  225
            MAAK K+P   RNP+LIRGVGK+SRSK+YHKRGLWAIKAK+GG FP H+ KP A  A EK
Sbjct  1    MAAKRKTPVKTRNPDLIRGVGKYSRSKMYHKRGLWAIKAKHGGVFPRHDPKPKAPVAPEK  60

Query  226  ppkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLV  405
             PKFYPA+DVKKPL+NK KPK TKLR+SITPGTVLI+LAGRF GKRVVFLKQL SGLLLV
Sbjct  61   APKFYPAEDVKKPLLNKRKPKPTKLRASITPGTVLILLAGRFMGKRVVFLKQLTSGLLLV  120

Query  406  TG  411
            TG
Sbjct  121  TG  122



>gb|EIE89517.1| hypothetical protein RO3G_14228 [Rhizopus delemar RA 99-880]
Length=234

 Score =   164 bits (416),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 94/179 (53%), Positives = 119/179 (66%), Gaps = 31/179 (17%)
 Frame = +1

Query  73   SPRNPELIRGVGKFSRSKIYHKRGLWAIK---------------------AKNGGKFPHH  189
            +PRN  L+ GV ++SRS +Y K+ L+  +                     AKNGGK    
Sbjct  4    APRNSVLVPGVSRYSRSAVYSKKALYKRQKTNVAAPAKQTVAEKTVEVKGAKNGGK----  59

Query  190  ekkpvaapaaekppkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVV  369
                     A+K P+FYPA+DV +P VN+   K T LRS+ITPGTVLI+LAGR++GKRVV
Sbjct  60   -----RTVPAQKAPRFYPAEDVPQPKVNRKSAKKTALRSNITPGTVLILLAGRYRGKRVV  114

Query  370  FLKQLPSGLLLVTGPFKINGVPLRRVNQAYVIATATKVDICGVNV-EKIDDKYFGKQAE  543
            FLKQL SGLLLVTGPFK+NGVPLRRVNQAYVIAT++K+D+  V + EK +D YF K A+
Sbjct  115  FLKQLDSGLLLVTGPFKVNGVPLRRVNQAYVIATSSKLDLSSVKIDEKFNDAYFKKSAK  173



>gb|EIE84065.1| hypothetical protein RO3G_08770 [Rhizopus delemar RA 99-880]
Length=234

 Score =   164 bits (416),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 94/179 (53%), Positives = 117/179 (65%), Gaps = 31/179 (17%)
 Frame = +1

Query  73   SPRNPELIRGVGKFSRSKIYHKRGLWAIK---------------------AKNGGKFPHH  189
            +PRN  L+ GV ++SRS +Y K+ L+  +                     AKNGGK    
Sbjct  4    APRNSVLVPGVSRYSRSTVYSKKALYKRQKTNVAAPAKQTVAEKTVEVKGAKNGGK----  59

Query  190  ekkpvaapaaekppkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVV  369
                     A+K P+FYPA+DV +P VN+   K T LRS+ITPGTVLI+LAGR++GKR V
Sbjct  60   -----RTVPAQKAPRFYPAEDVPQPKVNRKSAKKTALRSNITPGTVLILLAGRYRGKRAV  114

Query  370  FLKQLPSGLLLVTGPFKINGVPLRRVNQAYVIATATKVDICGVNV-EKIDDKYFGKQAE  543
            FLKQL SGLLLVTGPFK+NGVPLRRVNQAYVIAT+TK+D+    V EK +D YF K A+
Sbjct  115  FLKQLDSGLLLVTGPFKVNGVPLRRVNQAYVIATSTKIDLSSAKVDEKFNDAYFKKSAK  173



>ref|XP_001837246.1| 60S ribosomal protein L6 [Coprinopsis cinerea okayama7#130]
 gb|EAU84863.1| 60S ribosomal protein L6 [Coprinopsis cinerea okayama7#130]
Length=238

 Score =   164 bits (414),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 120/179 (67%), Gaps = 31/179 (17%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIK---------------------AKNGGKFPHHek  195
            R+ EL+ GVG+ SRS+++ KRGL+  +                      KNGGK      
Sbjct  3    RSKELVPGVGRLSRSQVFAKRGLFKGQKKSEKPAAETPAEYVEKTIGGEKNGGK------  56

Query  196  kpvaapaaekppkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFL  375
                     K P+FYPA+DV++P  ++   K T LRS+ITPGTVLI+LAGRF+GKRVVFL
Sbjct  57   ---RLVPVAKAPRFYPAEDVRQPKKSRKAHKPTGLRSTITPGTVLILLAGRFRGKRVVFL  113

Query  376  KQLPSGLLLVTGPFKINGVPLRRVNQAYVIATATKVDICGVNV-EKIDDKYFGKQAEKK  549
            KQL SGLLLVTGP+K+NGVPLRRVNQAYVIAT+TK+DI GV + +KI+D YF K A K+
Sbjct  114  KQLESGLLLVTGPYKVNGVPLRRVNQAYVIATSTKIDISGVKIDDKINDAYFAKAATKE  172



>emb|CEI86592.1| Putative 60S ribosomal protein L6 [Rhizopus microsporus]
Length=234

 Score =   163 bits (413),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 96/179 (54%), Positives = 118/179 (66%), Gaps = 31/179 (17%)
 Frame = +1

Query  73   SPRNPELIRGVGKFSRSKIYHKRGLWAIK---------------------AKNGGKFPHH  189
            +PRN  L+ GV ++SRS +Y K+ L+  K                     AKNGGK    
Sbjct  4    APRNSVLVPGVSRYSRSAVYSKKALYKRKKTNVAAPAKQTAADKTVEVKGAKNGGK----  59

Query  190  ekkpvaapaaekppkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVV  369
                     A+K P+FYPA+DV +P V +   K T LRSSITPGTVLI+LAGR++GKRVV
Sbjct  60   -----RVVPAQKAPRFYPAEDVPQPKVTRKTSKKTVLRSSITPGTVLILLAGRYRGKRVV  114

Query  370  FLKQLPSGLLLVTGPFKINGVPLRRVNQAYVIATATKVDICGVNV-EKIDDKYFGKQAE  543
            FLKQL SGLLLVTGPFK+NGVPLRRVNQAYVIAT+TK+D+  V + EK +D YF K A+
Sbjct  115  FLKQLDSGLLLVTGPFKVNGVPLRRVNQAYVIATSTKLDLSSVKIDEKFNDAYFKKPAK  173



>gb|EMD40773.1| hypothetical protein CERSUDRAFT_111358 [Ceriporiopsis subvermispora 
B]
Length=237

 Score =   163 bits (412),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 116/169 (69%), Gaps = 13/169 (8%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKN----GGKFPH--------Hekkpvaapaae  222
            R+ EL+ G+G+ SRS++Y +RGL+  + K+      + P          +          
Sbjct  3    RSKELVPGIGRLSRSQVYARRGLFKGQKKSEKAAAAEVPATKEVQVGGEKNGNKRVVPTA  62

Query  223  kppkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLL  402
            K P+FYPA+DV +P  ++  PK  KLRSSITPG+VLI+LAGRF+GKRVVFLKQL SGLLL
Sbjct  63   KAPRFYPAEDVHQPKKSRKAPKPAKLRSSITPGSVLILLAGRFRGKRVVFLKQLESGLLL  122

Query  403  VTGPFKINGVPLRRVNQAYVIATATKVDICGVNV-EKIDDKYFGKQAEK  546
            VTGPFK+NGVPLRRVNQAYVIAT+TKVD+    V EK +D YF K A K
Sbjct  123  VTGPFKVNGVPLRRVNQAYVIATSTKVDLGDFKVDEKFNDAYFAKPATK  171



>ref|XP_007366018.1| 60S ribosomal protein L6 [Dichomitus squalens LYAD-421 SS1]
 gb|EJF61189.1| 60S ribosomal protein L6 [Dichomitus squalens LYAD-421 SS1]
Length=238

 Score =   162 bits (410),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 116/169 (69%), Gaps = 13/169 (8%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAKN----GGKFPH--------Hekkpvaapaae  222
            R+ E+  GVG+ SRS +Y +RGL+  + K       + P          +         +
Sbjct  3    RSKEIAPGVGRLSRSAVYARRGLFKGQKKTEKPAAAETPATKEVSVGGEKNGSTRIVPTK  62

Query  223  kppkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLL  402
            K P+FYPA+DV++P  ++  PK  KLRSSITPGTVLI+LAGRF+GKRVVFLKQL SGLLL
Sbjct  63   KAPRFYPAEDVRQPKKSRKSPKPAKLRSSITPGTVLILLAGRFRGKRVVFLKQLASGLLL  122

Query  403  VTGPFKINGVPLRRVNQAYVIATATKVDICGVNV-EKIDDKYFGKQAEK  546
            VTGP+K+NGVPLRRVNQAYVIAT+TK+D+    V EKI+D YF K A K
Sbjct  123  VTGPYKVNGVPLRRVNQAYVIATSTKLDLGDFKVDEKINDAYFAKPATK  171



>gb|EPT03739.1| hypothetical protein FOMPIDRAFT_1022302 [Fomitopsis pinicola 
FP-58527 SS1]
Length=238

 Score =   162 bits (409),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 120/178 (67%), Gaps = 31/178 (17%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLW---------AIKA------------KNGGKFPHHek  195
            R+ E+  GVG+ SRS+++ +RGL+         A++             KNGGK      
Sbjct  3    RSKEIAPGVGRLSRSQVFARRGLYKGLKKTEKAAVEEPAATKEVTVGGEKNGGK------  56

Query  196  kpvaapaaekppkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFL  375
                     K P+FYPA+DV++P  ++  PK  KLRSSITPG+VLI+LAGRF+GKRVVFL
Sbjct  57   ---RIVPTAKAPRFYPAEDVRQPKKSRKAPKPAKLRSSITPGSVLILLAGRFRGKRVVFL  113

Query  376  KQLPSGLLLVTGPFKINGVPLRRVNQAYVIATATKVDICGVNV-EKIDDKYFGKQAEK  546
            KQL SGLLLVTGP+K+NGVPLRRVNQAYVIAT+T+VD+    V EKIDD YF K ++K
Sbjct  114  KQLASGLLLVTGPYKVNGVPLRRVNQAYVIATSTQVDLGDFKVDEKIDDAYFAKPSKK  171



>gb|EPZ32906.1| Ribosomal protein L2 2 domain-containing protein [Rozella allomycis 
CSF55]
Length=234

 Score =   161 bits (408),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 112/165 (68%), Gaps = 13/165 (8%)
 Frame = +1

Query  94   IRGVGKFSRSKIYHKRGLWA-----IKAKNGGKFPH--------Hekkpvaapaaekppk  234
            + GV  +SRSK+Y  +G +       +AK     P          +       + +K  +
Sbjct  10   VAGVTLYSRSKMYKMKGCFKRTRANAQAKVASAEPTTVTKPIGGEKNGKTRVVSIKKESR  69

Query  235  FYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVTGP  414
            +YPA D+KKPL  +   ++TKLR +I PGTVLI+LAGRF+GKRVVFLKQL SGLLLVTGP
Sbjct  70   YYPAYDIKKPLPVRKTARMTKLRQTIVPGTVLILLAGRFRGKRVVFLKQLSSGLLLVTGP  129

Query  415  FKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYFGKQAEKK  549
            +KINGVPL+RVNQ+YVIAT+TKVDI GVNVE IDD  F + AE+K
Sbjct  130  YKINGVPLKRVNQSYVIATSTKVDIAGVNVENIDDSLFKRSAEEK  174



>emb|CDO71273.1| hypothetical protein BN946_scf184908.g30 [Trametes cinnabarina]
Length=238

 Score =   161 bits (408),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 114/169 (67%), Gaps = 13/169 (8%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLW----------AIKAKNGGKFP--HHekkpvaapaae  222
            RN E+   VG+ SRS +Y +RGLW          A +     + P    +         +
Sbjct  3    RNKEISPAVGRLSRSAVYARRGLWKGLKKSEKPAAAEVAPTKEVPVGGEKNGQKRLVPTQ  62

Query  223  kppkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFLKQLPSGLLL  402
            K P+FYPA+DV++P  ++  PK  KLRSSITPGTVLI+LAGRF+ KRVVFLKQL SGLLL
Sbjct  63   KAPRFYPAEDVRQPKKSRKSPKPAKLRSSITPGTVLILLAGRFRSKRVVFLKQLESGLLL  122

Query  403  VTGPFKINGVPLRRVNQAYVIATATKVDICGVNV-EKIDDKYFGKQAEK  546
            VTGP+K+NGVPLRRVNQAYVIAT+TKVD+    V EKI+D YF K A K
Sbjct  123  VTGPYKVNGVPLRRVNQAYVIATSTKVDLGDFKVDEKINDAYFVKPAAK  171



>emb|CEG65908.1| Putative 60S ribosomal protein L6 [Rhizopus microsporus]
 emb|CEJ03198.1| Putative 60S ribosomal protein L6 [Rhizopus microsporus]
Length=234

 Score =   161 bits (407),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 117/179 (65%), Gaps = 31/179 (17%)
 Frame = +1

Query  73   SPRNPELIRGVGKFSRSKIYHKRGLWAIK---------------------AKNGGKFPHH  189
            +PRN  L  GV ++SRS +Y K+ L+  K                     AKNGGK    
Sbjct  4    APRNSVLAPGVSRYSRSAVYSKKALYKRKKTNVAAPAKQTAADKTVEVKGAKNGGK----  59

Query  190  ekkpvaapaaekppkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVV  369
                     A+K P+FYPA+DV +P V +   K T LRS+ITPGTVLI+LAGR++GKRVV
Sbjct  60   -----RVVPAQKAPRFYPAEDVPQPKVTRKTSKKTVLRSNITPGTVLILLAGRYRGKRVV  114

Query  370  FLKQLPSGLLLVTGPFKINGVPLRRVNQAYVIATATKVDICGVNV-EKIDDKYFGKQAE  543
            FLKQL SGLLLVTGPFK+NGVPLRRVNQAYVIAT+TK+D+  V + EK +D YF K A+
Sbjct  115  FLKQLDSGLLLVTGPFKVNGVPLRRVNQAYVIATSTKLDLSSVKIDEKFNDAYFKKSAK  173



>emb|CDS08209.1| hypothetical protein LRAMOSA02157 [Absidia idahoensis var. thermophila]
Length=236

 Score =   161 bits (407),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 118/181 (65%), Gaps = 31/181 (17%)
 Frame = +1

Query  73   SPRNPELIRGVGKFSRSKIY-----HKRGLWAIKA----------------KNGGKFPHH  189
            +PRN  L+ GV ++SRS +Y     HKR    + A                KNGGK    
Sbjct  4    APRNSFLVPGVARYSRSAMYAKKALHKRSKKGVTAPVKQTAADKTVEVKGAKNGGK----  59

Query  190  ekkpvaapaaekppkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVV  369
                     AEK P+FYPA+DV KP V++  PK   LR SITPGTV+I+LAGR +GKRVV
Sbjct  60   -----RVIPAEKAPRFYPAEDVPKPKVSRKSPKAAALRKSITPGTVVILLAGRHQGKRVV  114

Query  370  FLKQLPSGLLLVTGPFKINGVPLRRVNQAYVIATATKVDICGVNV-EKIDDKYFGKQAEK  546
             LKQL SGLLLVTGPFK+NGVPLRRVNQAYVIAT+TKVDI GV V +KI+D YF K+  K
Sbjct  115  VLKQLASGLLLVTGPFKVNGVPLRRVNQAYVIATSTKVDISGVKVDDKINDAYFAKKGGK  174

Query  547  K  549
            +
Sbjct  175  E  175



>emb|CDS03075.1| hypothetical protein LRAMOSA00477 [Absidia idahoensis var. thermophila]
Length=236

 Score =   160 bits (406),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 119/181 (66%), Gaps = 31/181 (17%)
 Frame = +1

Query  73   SPRNPELIRGVGKFSRSKIYHKRGLW--------------------AIK-AKNGGKFPHH  189
            +PRN  L+ GV ++SRS +Y K+ L                      +K AKNGGK    
Sbjct  4    APRNSFLVPGVARYSRSNMYAKKALHKRSKKGVAAPAKQTAADKTVEVKGAKNGGK----  59

Query  190  ekkpvaapaaekppkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVV  369
                     AEK P+FYPA+DV KP V++  PK   LR SITPGTV+I+LAGR +GKRV+
Sbjct  60   -----RVIPAEKAPRFYPAEDVPKPKVSRKSPKTAALRKSITPGTVVILLAGRHQGKRVI  114

Query  370  FLKQLPSGLLLVTGPFKINGVPLRRVNQAYVIATATKVDICGVNV-EKIDDKYFGKQAEK  546
             LKQL SGLLLVTGPFK+NGVPLRRVNQAYVIAT+TKVDI GV + +KI+D YF K+  K
Sbjct  115  ALKQLDSGLLLVTGPFKVNGVPLRRVNQAYVIATSTKVDISGVKIDDKINDAYFAKKGSK  174

Query  547  K  549
            +
Sbjct  175  E  175



>emb|CDS03973.1| hypothetical protein LRAMOSA06928 [Absidia idahoensis var. thermophila]
Length=234

 Score =   160 bits (406),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 115/173 (66%), Gaps = 30/173 (17%)
 Frame = +1

Query  73   SPRNPELIRGVGKFSRSKIY-----HKRGLWAIKA----------------KNGGKFPHH  189
            +PRN  L+ GV ++SRS +Y     HKR    ++A                KNGGK    
Sbjct  4    APRNSFLVPGVARYSRSNMYAKKALHKRSKKGVQAPAKQTAADKTVEVKGAKNGGK----  59

Query  190  ekkpvaapaaekppkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVV  369
                     A+K P+FYPA+DV +P +++  PK   LR SITPGTVLI+LAGR++GKRVV
Sbjct  60   -----RVIPAQKAPRFYPAEDVPQPKISRKSPKAAPLRKSITPGTVLILLAGRYRGKRVV  114

Query  370  FLKQLPSGLLLVTGPFKINGVPLRRVNQAYVIATATKVDICGVNVEKIDDKYF  528
            FLKQL SGLLLVTGPFK+NGVPLRRVNQAYVIAT+TK+D+  V V++ +D YF
Sbjct  115  FLKQLESGLLLVTGPFKVNGVPLRRVNQAYVIATSTKIDVSKVKVDQFNDAYF  167



>ref|XP_007844668.1| 60s ribosomal protein l6 [Moniliophthora roreri MCA 2997]
 gb|ESK96069.1| 60s ribosomal protein l6 [Moniliophthora roreri MCA 2997]
Length=237

 Score =   160 bits (405),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 117/178 (66%), Gaps = 31/178 (17%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLW-AIKA--------------------KNGGKFPHHek  195
            R+ E+  GVG+ SRS+++ KRGL+  +K                     KNGGK      
Sbjct  3    RSKEIAPGVGRLSRSQVFAKRGLYKGVKKSEKKVVEPTPETVEKTVGGDKNGGK------  56

Query  196  kpvaapaaekppkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFL  375
                     K P+FYPA+DV++P  ++  PK T+LR SITPG VLI+LAGRF+GKRVVFL
Sbjct  57   ---RLVPTSKAPRFYPAEDVRQPKKSRKSPKPTQLRPSITPGAVLILLAGRFRGKRVVFL  113

Query  376  KQLPSGLLLVTGPFKINGVPLRRVNQAYVIATATKVDICGVNV-EKIDDKYFGKQAEK  546
            KQL SGLLLVTGPFKINGVPLRRVNQAYVIAT+TKVD+ G  V EKI+D YF K   K
Sbjct  114  KQLESGLLLVTGPFKINGVPLRRVNQAYVIATSTKVDLEGFKVDEKINDAYFVKPVTK  171



>gb|KDR83654.1| hypothetical protein GALMADRAFT_235972 [Galerina marginata CBS 
339.88]
Length=238

 Score =   160 bits (405),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 114/178 (64%), Gaps = 31/178 (17%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLWAIKAK---------------------NGGKFPHHek  195
            R+ EL+ GVG+ SRS+++ KR L+  + K                     NGGK      
Sbjct  3    RSKELVPGVGRLSRSQVFAKRALFKGQKKSTKPAAETPAEHVEKTIGGDKNGGK------  56

Query  196  kpvaapaaekppkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFL  375
                     K P+FYPA+DV+ P  ++  P    LRS+ITPG VLI+LAGR++GKRVVFL
Sbjct  57   ---RLVPTTKAPRFYPAEDVRHPKKSRKSPNPPSLRSTITPGAVLILLAGRYRGKRVVFL  113

Query  376  KQLPSGLLLVTGPFKINGVPLRRVNQAYVIATATKVDICGVNV-EKIDDKYFGKQAEK  546
            KQLPSGLLLVTGP+KINGVPLRRVNQAYVIAT+TKVD+ G+ + EK DD YF K   K
Sbjct  114  KQLPSGLLLVTGPYKINGVPLRRVNQAYVIATSTKVDVSGLKIDEKFDDAYFAKPTAK  171



>emb|CDH51903.1| 60s ribosomal protein l6 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=235

 Score =   160 bits (405),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 118/181 (65%), Gaps = 31/181 (17%)
 Frame = +1

Query  73   SPRNPELIRGVGKFSRSKIYHKRGLWAIK---------------------AKNGGKFPHH  189
            +PRN  L+ GV ++SRS +Y K+ L   +                     AKNGGK    
Sbjct  4    APRNSFLVPGVARYSRSNMYAKKALHKRQKKGVTAPAKQAAADKTVEVKGAKNGGK----  59

Query  190  ekkpvaapaaekppkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVV  369
                     AEK P+FYPA+DV KP  ++  PK   LR SITPGTV+I+LAGR +GKRV+
Sbjct  60   -----RVIPAEKAPRFYPAEDVPKPKASRKSPKTAALRKSITPGTVVILLAGRHQGKRVI  114

Query  370  FLKQLPSGLLLVTGPFKINGVPLRRVNQAYVIATATKVDICGVNV-EKIDDKYFGKQAEK  546
             LKQL SGLLLVTGPFK+NGVPLRRVNQAYVIAT+TKVDI GV + +KI+D YF K+ +K
Sbjct  115  ALKQLDSGLLLVTGPFKVNGVPLRRVNQAYVIATSTKVDISGVKIDDKINDAYFSKKGDK  174

Query  547  K  549
            +
Sbjct  175  Q  175



>emb|CDH51902.1| 60s ribosomal protein l6 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=234

 Score =   160 bits (404),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 118/181 (65%), Gaps = 31/181 (17%)
 Frame = +1

Query  73   SPRNPELIRGVGKFSRSKIYHKRGLWAIK---------------------AKNGGKFPHH  189
            +PRN  L+ GV ++SRS +Y K+ L   +                     AKNGGK    
Sbjct  4    APRNSFLVPGVARYSRSNMYAKKALHKRQKKGVTAPAKQAAADKTVEVKGAKNGGK----  59

Query  190  ekkpvaapaaekppkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVV  369
                     AEK P+FYPA+DV KP  ++  PK   LR SITPGTV+I+LAGR +GKRV+
Sbjct  60   -----RVIPAEKAPRFYPAEDVPKPKASRKSPKTAALRKSITPGTVVILLAGRHQGKRVI  114

Query  370  FLKQLPSGLLLVTGPFKINGVPLRRVNQAYVIATATKVDICGVNV-EKIDDKYFGKQAEK  546
             LKQL SGLLLVTGPFK+NGVPLRRVNQAYVIAT+TKVDI GV + +KI+D YF K+ +K
Sbjct  115  ALKQLDSGLLLVTGPFKVNGVPLRRVNQAYVIATSTKVDISGVKIDDKINDAYFSKKGDK  174

Query  547  K  549
            +
Sbjct  175  Q  175



>ref|XP_003037903.1| 60S ribosomal protein L6 [Schizophyllum commune H4-8]
 gb|EFJ03001.1| hypothetical protein SCHCODRAFT_63127 [Schizophyllum commune 
H4-8]
Length=238

 Score =   160 bits (405),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 118/178 (66%), Gaps = 31/178 (17%)
 Frame = +1

Query  79   RNPELIRGVGKFSRSKIYHKRGLW---------------------AIKAKNGGKFPHHek  195
            R+ EL+ GVG+ SRS+++ KRGL+                         KNGGK      
Sbjct  3    RSKELVPGVGRLSRSQVFAKRGLFKGPKKSEKPAAEPTPEYVEKTVNGEKNGGK------  56

Query  196  kpvaapaaekppkFYPADDVKKPLVNKHKPKLTKLRSSITPGTVLIILAGRFKGKRVVFL  375
                    +K P+FYPA+DV++P  ++  PK T LRS+ITPGTVLI+LAGR++GKRVVFL
Sbjct  57   ---RLVPTQKAPRFYPAEDVRQPKKSRKSPKPTALRSTITPGTVLILLAGRYRGKRVVFL  113

Query  376  KQLPSGLLLVTGPFKINGVPLRRVNQAYVIATATKVDICGVNV-EKIDDKYFGKQAEK  546
            KQL SGLLLVTGP+K+NGVPLRRVNQAYVIAT+TK+++    V EKI+D YF K+  K
Sbjct  114  KQLESGLLLVTGPYKVNGVPLRRVNQAYVIATSTKLELGDYKVDEKINDAYFAKEKTK  171



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 590079713720