BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001F04

Length=547
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ABK94904.1|  unknown                                                 342   2e-115   Populus trichocarpa [western balsam poplar]
gb|AFW70477.1|  hypothetical protein ZEAMMB73_398917                    347   3e-115   
ref|NP_001046107.2|  Os02g0184200                                       343   3e-115   
gb|AFQ00710.1|  pyrophosphate-energized vacuolar membrane proteon...    356   5e-115   Ipomoea batatas [batate]
emb|CBI36400.3|  unnamed protein product                                344   5e-115   Vitis vinifera
ref|XP_003632767.2|  PREDICTED: LOW QUALITY PROTEIN: pyrophosphat...    344   2e-114   
ref|XP_010654839.1|  PREDICTED: pyrophosphate-energized vacuolar ...    337   1e-113   Vitis vinifera
gb|EAY84758.1|  hypothetical protein OsI_06126                          335   5e-113   Oryza sativa Indica Group [Indian rice]
emb|CBI36397.3|  unnamed protein product                                336   1e-112   Vitis vinifera
gb|KJB64656.1|  hypothetical protein B456_010G059800                    348   1e-112   Gossypium raimondii
emb|CAC39165.1|  vacuolar-type H+-pyrophosphatase                       337   1e-112   Solanum lycopersicum
gb|KDO47416.1|  hypothetical protein CISIN_1g0042302mg                  344   2e-112   Citrus sinensis [apfelsine]
ref|XP_008658530.1|  PREDICTED: uncharacterized protein LOC100280...    346   2e-112   Zea mays [maize]
ref|XP_006474386.1|  PREDICTED: pyrophosphate-energized vacuolar ...    347   3e-112   
gb|KJB23660.1|  hypothetical protein B456_004G108700                    346   3e-112   Gossypium raimondii
gb|KDO73437.1|  hypothetical protein CISIN_1g004159mg                   347   3e-112   Citrus sinensis [apfelsine]
gb|ABS01290.1|  tonoplast proton pump                                   348   3e-112   Lotus corniculatus
emb|CAA58699.1|  inorganic pyrophosphatase                              342   3e-112   Nicotiana tabacum [American tobacco]
gb|KHN01313.1|  Pyrophosphate-energized vacuolar membrane proton ...    345   9e-112   Glycine soja [wild soybean]
ref|XP_010097004.1|  Pyrophosphate-energized vacuolar membrane pr...    347   1e-111   Morus notabilis
ref|XP_011020230.1|  PREDICTED: pyrophosphate-energized vacuolar ...    347   1e-111   Populus euphratica
ref|XP_008795832.1|  PREDICTED: pyrophosphate-energized vacuolar ...    347   1e-111   Phoenix dactylifera
gb|AAA61609.1|  pyrophosphatase                                         347   1e-111   Beta vulgaris [beet]
gb|KJB64655.1|  hypothetical protein B456_010G059800                    347   1e-111   Gossypium raimondii
ref|XP_010691127.1|  PREDICTED: pyrophosphate-energized vacuolar ...    347   1e-111   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006381091.1|  Pyrophosphate-energized vacuolar membrane pr...    347   1e-111   Populus trichocarpa [western balsam poplar]
emb|CDP10479.1|  unnamed protein product                                347   2e-111   Coffea canephora [robusta coffee]
gb|KHG04918.1|  Pyrophosphate-energized vacuolar membrane proton ...    346   2e-111   Gossypium arboreum [tree cotton]
ref|XP_006453118.1|  hypothetical protein CICLE_v10007524mg             346   2e-111   Citrus clementina [clementine]
gb|KJB53981.1|  hypothetical protein B456_009G014500                    346   2e-111   Gossypium raimondii
gb|KDO73436.1|  hypothetical protein CISIN_1g004159mg                   346   2e-111   Citrus sinensis [apfelsine]
gb|KDO47417.1|  hypothetical protein CISIN_1g0042302mg                  344   3e-111   Citrus sinensis [apfelsine]
emb|CAG29370.1|  vacuolar H+-translocating inorganic pyrophosphatase    346   3e-111   Zea mays [maize]
ref|NP_001146732.1|  uncharacterized protein LOC100280334               346   3e-111   Zea mays [maize]
gb|AFW70478.1|  vacuolar H+-translocating inorganic pyrophosphatase     346   3e-111   
ref|XP_010323159.1|  PREDICTED: vacuolar-type H+-pyrophosphatase ...    345   4e-111   
gb|KJB83229.1|  hypothetical protein B456_013G236400                    345   4e-111   Gossypium raimondii
gb|KHG19866.1|  Pyrophosphate-energized vacuolar membrane proton ...    345   4e-111   Gossypium arboreum [tree cotton]
ref|XP_009410369.1|  PREDICTED: pyrophosphate-energized vacuolar ...    345   4e-111   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001265905.1|  vacuolar-type H+-pyrophosphatase                   345   4e-111   
ref|XP_010050115.1|  PREDICTED: pyrophosphate-energized vacuolar ...    345   5e-111   Eucalyptus grandis [rose gum]
ref|XP_009796113.1|  PREDICTED: pyrophosphate-energized vacuolar ...    345   5e-111   Nicotiana sylvestris
ref|XP_009628297.1|  PREDICTED: pyrophosphate-energized vacuolar ...    345   5e-111   Nicotiana tomentosiformis
gb|KJB23657.1|  hypothetical protein B456_004G108700                    345   6e-111   Gossypium raimondii
ref|XP_006359496.1|  PREDICTED: pyrophosphate-energized vacuolar ...    345   6e-111   Solanum tuberosum [potatoes]
emb|CAA58701.1|  inorganic pyrophosphatase                              345   6e-111   Nicotiana tabacum [American tobacco]
ref|XP_009791988.1|  PREDICTED: pyrophosphate-energized vacuolar ...    345   6e-111   Nicotiana sylvestris
ref|XP_004235902.1|  PREDICTED: pyrophosphate-energized vacuolar ...    345   6e-111   
ref|XP_006341399.1|  PREDICTED: pyrophosphate-energized vacuolar ...    345   6e-111   Solanum tuberosum [potatoes]
gb|AAA80347.1|  H+-pyrophosphatase                                      338   7e-111   Zea mays [maize]
ref|XP_004287260.1|  PREDICTED: LOW QUALITY PROTEIN: pyrophosphat...    345   7e-111   Fragaria vesca subsp. vesca
ref|XP_002530755.1|  Pyrophosphate-energized vacuolar membrane pr...    345   7e-111   Ricinus communis
gb|EMS53286.1|  Pyrophosphate-energized vacuolar membrane proton ...    343   8e-111   Triticum urartu
ref|XP_009595111.1|  PREDICTED: pyrophosphate-energized vacuolar ...    345   8e-111   Nicotiana tomentosiformis
ref|XP_009401376.1|  PREDICTED: pyrophosphate-energized vacuolar ...    345   8e-111   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011081989.1|  PREDICTED: pyrophosphate-energized vacuolar ...    345   8e-111   Sesamum indicum [beniseed]
gb|AHA38114.1|  vacuolar H+-pyrophosphatase                             345   9e-111   Sesuvium portulacastrum [sea-purslane]
ref|XP_011078537.1|  PREDICTED: pyrophosphate-energized vacuolar ...    345   1e-110   Sesamum indicum [beniseed]
ref|XP_007013600.1|  Inorganic H pyrophosphatase family protein i...    345   1e-110   
ref|XP_003528302.1|  PREDICTED: pyrophosphate-energized vacuolar ...    344   1e-110   Glycine max [soybeans]
ref|XP_006656294.1|  PREDICTED: pyrophosphate-energized vacuolar ...    345   1e-110   Oryza brachyantha
ref|XP_004965753.1|  PREDICTED: pyrophosphate-energized vacuolar ...    344   1e-110   Setaria italica
ref|XP_010557616.1|  PREDICTED: pyrophosphate-energized vacuolar ...    344   1e-110   Tarenaya hassleriana [spider flower]
ref|XP_010913343.1|  PREDICTED: pyrophosphate-energized vacuolar ...    344   1e-110   Elaeis guineensis
gb|AJR29310.1|  H+-pyrophosphatase                                      344   1e-110   Secale cereale
ref|XP_008389636.1|  PREDICTED: LOW QUALITY PROTEIN: pyrophosphat...    342   2e-110   
ref|XP_006427441.1|  hypothetical protein CICLE_v10024946mg             344   2e-110   Citrus clementina [clementine]
ref|XP_004241690.1|  PREDICTED: pyrophosphate-energized vacuolar ...    344   2e-110   Solanum lycopersicum
gb|KDP37047.1|  hypothetical protein JCGZ_06103                         344   2e-110   Jatropha curcas
ref|XP_008801902.1|  PREDICTED: pyrophosphate-energized vacuolar ...    344   2e-110   Phoenix dactylifera
ref|XP_002273207.1|  PREDICTED: pyrophosphate-energized vacuolar ...    344   2e-110   Vitis vinifera
gb|AEI17666.1|  vacuolar H+-pyrophosphatase                             343   2e-110   Salicornia europaea [chicken-claws]
ref|XP_010928300.1|  PREDICTED: pyrophosphate-energized vacuolar ...    343   2e-110   Elaeis guineensis
ref|XP_006492091.1|  PREDICTED: pyrophosphate-energized vacuolar ...    343   2e-110   Citrus sinensis [apfelsine]
ref|XP_008788803.1|  PREDICTED: pyrophosphate-energized vacuolar ...    343   2e-110   Phoenix dactylifera
ref|NP_001058184.1|  Os06g0644200                                       344   2e-110   
ref|XP_009765177.1|  PREDICTED: pyrophosphate-energized vacuolar ...    343   2e-110   Nicotiana sylvestris
ref|XP_006350116.1|  PREDICTED: pyrophosphate-energized vacuolar ...    343   2e-110   Solanum tuberosum [potatoes]
dbj|BAA08232.1|  vacuolar H+-pyrophosphatase                            343   2e-110   Oryza sativa Japonica Group [Japonica rice]
emb|CAA54869.1|  inorganic pyrophosphatase                              343   2e-110   Nicotiana tabacum [American tobacco]
ref|XP_010033979.1|  PREDICTED: pyrophosphate-energized vacuolar ...    343   3e-110   Eucalyptus grandis [rose gum]
gb|EEE66103.1|  hypothetical protein OsJ_22136                          343   3e-110   Oryza sativa Japonica Group [Japonica rice]
dbj|BAA23649.1|  proton pyrophosphatase                                 343   3e-110   Vigna radiata [mung bean]
gb|AAS66771.1|  PPase                                                   343   3e-110   Hevea brasiliensis [jebe]
dbj|BAD02277.1|  vacuolar proton pyrophosphatase                        343   3e-110   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008793954.1|  PREDICTED: pyrophosphate-energized vacuolar ...    343   3e-110   Phoenix dactylifera
ref|XP_009334631.1|  PREDICTED: pyrophosphate-energized vacuolar ...    343   3e-110   Pyrus x bretschneideri [bai li]
dbj|BAA31523.1|  ovp1                                                   343   3e-110   Oryza sativa [red rice]
gb|AAC49175.1|  pyrophosphatase                                         343   3e-110   Vigna radiata [mung bean]
ref|XP_007155080.1|  hypothetical protein PHAVU_003G171500g             343   3e-110   Phaseolus vulgaris [French bean]
sp|P21616.4|AVP_VIGRR  RecName: Full=Pyrophosphate-energized vacu...    343   3e-110   Vigna radiata var. radiata [golden gram]
dbj|BAD25066.1|  putative inorganic diphosphatase                       343   3e-110   Oryza sativa Japonica Group [Japonica rice]
gb|KDP30223.1|  hypothetical protein JCGZ_17005                         343   3e-110   Jatropha curcas
ref|XP_006646987.1|  PREDICTED: pyrophosphate-energized vacuolar ...    343   3e-110   Oryza brachyantha
ref|XP_004951660.1|  PREDICTED: pyrophosphate-energized vacuolar ...    342   3e-110   
ref|XP_003563306.1|  PREDICTED: pyrophosphate-energized vacuolar ...    343   3e-110   
gb|KHN15033.1|  Pyrophosphate-energized vacuolar membrane proton ...    342   4e-110   Glycine soja [wild soybean]
ref|XP_010927355.1|  PREDICTED: pyrophosphate-energized vacuolar ...    343   4e-110   Elaeis guineensis
gb|ABF85694.1|  inorganic pyrophosphatase                               343   4e-110   Nicotiana rustica [wild tobacco]
ref|XP_011084078.1|  PREDICTED: pyrophosphate-energized vacuolar ...    344   4e-110   
ref|XP_004251737.1|  PREDICTED: pyrophosphate-energized vacuolar ...    343   4e-110   Solanum lycopersicum
ref|XP_010687850.1|  PREDICTED: pyrophosphate-energized vacuolar ...    343   5e-110   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009418179.1|  PREDICTED: pyrophosphate-energized vacuolar ...    343   5e-110   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAZ01854.1|  hypothetical protein OsI_23875                          343   5e-110   Oryza sativa Indica Group [Indian rice]
ref|XP_009336318.1|  PREDICTED: pyrophosphate-energized vacuolar ...    343   5e-110   Pyrus x bretschneideri [bai li]
ref|XP_004508424.1|  PREDICTED: pyrophosphate-energized vacuolar ...    343   5e-110   Cicer arietinum [garbanzo]
gb|KJB35139.1|  hypothetical protein B456_006G102100                    343   5e-110   Gossypium raimondii
gb|KHG25943.1|  Pyrophosphate-energized vacuolar membrane proton ...    343   6e-110   Gossypium arboreum [tree cotton]
gb|ADN96173.1|  pyrophosphate-energized vacuolar membrane proton ...    342   6e-110   Gossypium hirsutum [American cotton]
ref|XP_010537929.1|  PREDICTED: pyrophosphate-energized vacuolar ...    343   6e-110   Tarenaya hassleriana [spider flower]
ref|XP_007204643.1|  hypothetical protein PRUPE_ppa001782mg             342   7e-110   Prunus persica
ref|XP_009779977.1|  PREDICTED: pyrophosphate-energized vacuolar ...    342   7e-110   Nicotiana sylvestris
emb|CAA58700.1|  inorganic pyrophosphatase                              342   7e-110   Nicotiana tabacum [American tobacco]
ref|XP_009598387.1|  PREDICTED: pyrophosphate-energized vacuolar ...    342   7e-110   Nicotiana tomentosiformis
ref|XP_004951662.1|  PREDICTED: pyrophosphate-energized vacuolar ...    342   8e-110   Setaria italica
ref|XP_003542656.1|  PREDICTED: pyrophosphate-energized vacuolar ...    342   8e-110   Glycine max [soybeans]
ref|XP_002453419.1|  hypothetical protein SORBIDRAFT_04g005710          342   8e-110   Sorghum bicolor [broomcorn]
ref|XP_003609463.1|  Vacuolar proton-inorganic pyrophosphatase          342   1e-109   Medicago truncatula
ref|XP_003531725.1|  PREDICTED: pyrophosphate-energized vacuolar ...    342   1e-109   Glycine max [soybeans]
gb|AFW66266.1|  hypothetical protein ZEAMMB73_353171                    342   1e-109   
gb|AIS71988.1|  vacuolar pyrophosphatase 1                              342   1e-109   Haloxylon ammodendron
gb|AGT16227.1|  vacuolar proton pyrophosphatase                         342   1e-109   Saccharum hybrid cultivar R570
gb|AGT15917.1|  vacuolar H+-pyrophosphatase                             342   1e-109   Saccharum hybrid cultivar R570
gb|KHF98453.1|  Pyrophosphate-energized vacuolar membrane proton ...    342   1e-109   Gossypium arboreum [tree cotton]
ref|XP_010541940.1|  PREDICTED: pyrophosphate-energized vacuolar ...    342   1e-109   Tarenaya hassleriana [spider flower]
gb|AAM97920.1|  vacuolar proton-pumping PPase                           342   1e-109   Oxybasis rubra [pigweed]
ref|XP_009363953.1|  PREDICTED: pyrophosphate-energized vacuolar ...    342   1e-109   Pyrus x bretschneideri [bai li]
ref|XP_002437341.1|  hypothetical protein SORBIDRAFT_10g025280          342   1e-109   
ref|XP_008343930.1|  PREDICTED: pyrophosphate-energized vacuolar ...    342   1e-109   
ref|XP_010250265.1|  PREDICTED: pyrophosphate-energized vacuolar ...    342   1e-109   Nelumbo nucifera [Indian lotus]
gb|KHG11819.1|  Pyrophosphate-energized vacuolar membrane proton ...    339   1e-109   Gossypium arboreum [tree cotton]
gb|KDO47419.1|  hypothetical protein CISIN_1g0042302mg                  337   1e-109   Citrus sinensis [apfelsine]
ref|XP_009338516.1|  PREDICTED: pyrophosphate-energized vacuolar ...    342   2e-109   Pyrus x bretschneideri [bai li]
ref|XP_009593516.1|  PREDICTED: pyrophosphate-energized vacuolar ...    342   2e-109   Nicotiana tomentosiformis
ref|XP_007023297.1|  Inorganic H pyrophosphatase family protein i...    342   2e-109   
gb|EMT15308.1|  Pyrophosphate-energized vacuolar membrane proton ...    342   2e-109   
ref|XP_004951661.1|  PREDICTED: pyrophosphate-energized vacuolar ...    342   2e-109   
gb|KJB64657.1|  hypothetical protein B456_010G059800                    340   2e-109   Gossypium raimondii
ref|XP_009358552.1|  PREDICTED: pyrophosphate-energized vacuolar ...    341   2e-109   Pyrus x bretschneideri [bai li]
ref|XP_008242846.1|  PREDICTED: pyrophosphate-energized vacuolar ...    341   2e-109   
gb|AAP06752.1|  vacuolar proton-inorganic pyrophosphatase               341   2e-109   Hordeum brevisubulatum
gb|ABX10014.1|  vacuolar H+-pyrophosphatase                             342   2e-109   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008352108.1|  PREDICTED: pyrophosphate-energized vacuolar ...    341   2e-109   
dbj|BAJ91598.1|  predicted protein                                      341   2e-109   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ADQ00196.1|  vacuolar H+-PPase protein                               341   2e-109   Suaeda corniculata
dbj|BAB18681.1|  vacuolar proton-inorganic pyrophosphatase              341   2e-109   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHN38003.1|  Pyrophosphate-energized vacuolar membrane proton ...    341   2e-109   Glycine soja [wild soybean]
ref|XP_010097186.1|  Pyrophosphate-energized vacuolar membrane pr...    341   3e-109   Morus notabilis
ref|NP_001105380.1|  vacuolar proton pump homolog1                      340   3e-109   
emb|CDO98179.1|  unnamed protein product                                340   3e-109   Coffea canephora [robusta coffee]
gb|KDO47418.1|  hypothetical protein CISIN_1g0042302mg                  336   4e-109   Citrus sinensis [apfelsine]
ref|XP_010539519.1|  PREDICTED: pyrophosphate-energized vacuolar ...    340   4e-109   Tarenaya hassleriana [spider flower]
ref|XP_010497310.1|  PREDICTED: pyrophosphate-energized vacuolar ...    340   4e-109   Camelina sativa [gold-of-pleasure]
ref|XP_010476656.1|  PREDICTED: pyrophosphate-energized vacuolar ...    340   4e-109   Camelina sativa [gold-of-pleasure]
ref|XP_010905999.1|  PREDICTED: pyrophosphate-energized vacuolar ...    340   5e-109   Elaeis guineensis
ref|XP_010459106.1|  PREDICTED: pyrophosphate-energized vacuolar ...    340   5e-109   Camelina sativa [gold-of-pleasure]
ref|XP_011073387.1|  PREDICTED: pyrophosphate-energized vacuolar ...    340   5e-109   Sesamum indicum [beniseed]
gb|EYU21676.1|  hypothetical protein MIMGU_mgv1a001720mg                340   5e-109   Erythranthe guttata [common monkey flower]
gb|AHZ97880.1|  vacuolar H+-pyrophosphatase                             340   5e-109   Olimarabidopsis pumila
gb|KJB23659.1|  hypothetical protein B456_004G108700                    338   5e-109   Gossypium raimondii
dbj|BAA33149.1|  proton-translocating inorganic pyrophosphatase         340   5e-109   Cucurbita moschata [ayote]
ref|XP_008228676.1|  PREDICTED: pyrophosphate-energized vacuolar ...    340   6e-109   Prunus mume [ume]
gb|KFK43817.1|  hypothetical protein AALP_AA1G177100                    340   6e-109   Arabis alpina [alpine rockcress]
dbj|BAA32210.1|  Vacuolar proton pyrophosphatase                        340   7e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006306837.1|  hypothetical protein CARUB_v10008378mg             340   7e-109   Capsella rubella
ref|NP_173021.1|  Pyrophosphate-energized vacuolar membrane proto...    340   7e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009385121.1|  PREDICTED: pyrophosphate-energized vacuolar ...    340   7e-109   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB56580.1|  hypothetical protein B456_009G126900                    340   7e-109   Gossypium raimondii
gb|AGT16998.1|  diphosphatase                                           340   7e-109   Saccharum hybrid cultivar R570
ref|XP_002890120.1|  vacuolar-type H+-pumping pyrophosphatase 1         340   7e-109   Arabidopsis lyrata subsp. lyrata
ref|XP_006416887.1|  hypothetical protein EUTSA_v10006869mg             340   8e-109   Eutrema salsugineum [saltwater cress]
ref|XP_007217159.1|  hypothetical protein PRUPE_ppa001776mg             340   8e-109   Prunus persica
ref|NP_001268155.1|  vacuolar pyrophosphatase                           340   8e-109   Vitis vinifera
emb|CAN65456.1|  hypothetical protein VITISV_035221                     340   8e-109   Vitis vinifera
gb|AAR08913.2|  pyrophosphate-energized vacuolar membrane proton ...    340   8e-109   Eutrema salsugineum [saltwater cress]
ref|XP_009117814.1|  PREDICTED: pyrophosphate-energized vacuolar ...    340   8e-109   Brassica rapa
gb|AGJ81362.1|  vacuolar H+ pyrophosphatase 1                           340   8e-109   Brassica napus [oilseed rape]
ref|XP_008679906.1|  PREDICTED: pyrophosphate-energized vacuolar ...    342   9e-109   
gb|AES91661.2|  vacuolar H+-translocating inorganic pyrophosphatase     335   9e-109   Medicago truncatula
emb|CBI25554.3|  unnamed protein product                                339   9e-109   Vitis vinifera
emb|CDX83972.1|  BnaC08g16730D                                          339   1e-108   
gb|KFK42469.1|  hypothetical protein AALP_AA2G261100                    339   1e-108   Arabis alpina [alpine rockcress]
dbj|BAE98517.1|  hypothetical protein                                   339   1e-108   Arabidopsis thaliana [mouse-ear cress]
emb|CDX96835.1|  BnaA08g23780D                                          339   1e-108   
ref|XP_006389422.1|  Pyrophosphate-energized vacuolar membrane pr...    339   1e-108   Populus trichocarpa [western balsam poplar]
ref|XP_003564217.1|  PREDICTED: pyrophosphate-energized vacuolar ...    339   1e-108   Brachypodium distachyon [annual false brome]
ref|NP_001288904.1|  uncharacterized protein LOC103836019               339   1e-108   Brassica rapa
gb|EYU24628.1|  hypothetical protein MIMGU_mgv1a001756mg                339   1e-108   Erythranthe guttata [common monkey flower]
gb|AEI17665.1|  vacuolar H+-pyrophosphatase                             339   1e-108   Salicornia europaea [chicken-claws]
emb|CAN69652.1|  hypothetical protein VITISV_010537                     330   1e-108   Vitis vinifera
ref|NP_001288927.1|  uncharacterized protein LOC103832483               339   1e-108   Brassica rapa
emb|CDX87313.1|  BnaA07g35600D                                          339   1e-108   
ref|XP_006427442.1|  hypothetical protein CICLE_v10024946mg             337   1e-108   
emb|CDY36581.1|  BnaA06g10340D                                          339   1e-108   Brassica napus [oilseed rape]
gb|EPS59584.1|  pyrophosphate-energized vacuolar membrane proton ...    334   2e-108   Genlisea aurea
emb|CDY53310.1|  BnaA09g56670D                                          340   2e-108   Brassica napus [oilseed rape]
dbj|BAF63470.1|  vacuolar proton-pyrophosphatase                        338   2e-108   Potamogeton distinctus
gb|AET95912.1|  PHP1                                                    338   2e-108   Lagenaria siceraria [bottle gourd]
ref|XP_009392139.1|  PREDICTED: pyrophosphate-energized vacuolar ...    338   2e-108   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009407207.1|  PREDICTED: pyrophosphate-energized vacuolar ...    338   2e-108   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010429951.1|  PREDICTED: pyrophosphate-energized vacuolar ...    338   2e-108   Camelina sativa [gold-of-pleasure]
ref|XP_010244912.1|  PREDICTED: pyrophosphate-energized vacuolar ...    338   3e-108   Nelumbo nucifera [Indian lotus]
ref|XP_009403196.1|  PREDICTED: pyrophosphate-energized vacuolar ...    338   3e-108   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAL57660.1|  At1g15690/F7H2_3                                        338   4e-108   Arabidopsis thaliana [mouse-ear cress]
gb|ABD98735.1|  vacuolar H+-pyrophosphatase                             338   4e-108   Oxybasis glauca [oakleaf goosefoot]
gb|AAA61610.1|  pyrophosphatase                                         338   4e-108   Beta vulgaris [beet]
gb|AAL84953.1|  At1g15690/F7H2_3                                        338   4e-108   Arabidopsis thaliana [mouse-ear cress]
gb|AGQ50316.1|  vaculoar H+ pyrophosphatase                             338   4e-108   Prosopis juliflora [algorrobo]
emb|CDY39975.1|  BnaC06g40530D                                          338   4e-108   Brassica napus [oilseed rape]
ref|NP_001266772.1|  uncharacterized protein LOC101027208               337   5e-108   Zea mays [maize]
ref|XP_004303283.1|  PREDICTED: pyrophosphate-energized vacuolar ...    338   5e-108   Fragaria vesca subsp. vesca
ref|XP_004150506.1|  PREDICTED: pyrophosphate-energized vacuolar ...    338   5e-108   
ref|XP_008443926.1|  PREDICTED: pyrophosphate-energized vacuolar ...    337   5e-108   Cucumis melo [Oriental melon]
gb|ABO45933.1|  vacuolar H+-pyrophosphatase                             337   5e-108   Halostachys caspica
emb|CDY33390.1|  BnaC05g11930D                                          338   5e-108   Brassica napus [oilseed rape]
gb|AFW85592.1|  vacuolar proton pump-like protein                       337   6e-108   
gb|EMT29715.1|  Pyrophosphate-energized vacuolar membrane proton ...    337   7e-108   
gb|ACA63883.1|  vacuolar proton-inorganic pyrophosphatase               337   7e-108   Hordeum vulgare [barley]
ref|XP_007013601.1|  Inorganic H pyrophosphatase family protein i...    336   8e-108   
ref|XP_006852851.1|  hypothetical protein AMTR_s00033p00195690          337   8e-108   Amborella trichopoda
sp|Q06572.2|AVP_HORVU  RecName: Full=Pyrophosphate-energized vacu...    337   8e-108   Hordeum vulgare [barley]
dbj|BAJ88084.1|  predicted protein                                      337   8e-108   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010472923.1|  PREDICTED: pyrophosphate-energized vacuolar ...    337   1e-107   Camelina sativa [gold-of-pleasure]
ref|XP_007023298.1|  Inorganic H pyrophosphatase family protein i...    337   1e-107   
gb|EPS68114.1|  inorganic pyrophosphatase                               337   1e-107   Genlisea aurea
ref|XP_010417704.1|  PREDICTED: pyrophosphate-energized vacuolar ...    337   1e-107   Camelina sativa [gold-of-pleasure]
ref|XP_003609464.1|  Vacuolar proton-inorganic pyrophosphatase          335   1e-107   
gb|EMS65629.1|  Pyrophosphate-energized vacuolar membrane proton ...    336   1e-107   Triticum urartu
ref|XP_008245918.1|  PREDICTED: pyrophosphate-energized vacuolar ...    336   1e-107   Prunus mume [ume]
ref|XP_006300952.1|  hypothetical protein CARUB_v10021340mg             337   1e-107   
gb|ADD51840.1|  pyrophosphatase                                         336   1e-107   Cucumis sativus [cucumbers]
ref|XP_008359855.1|  PREDICTED: pyrophosphate-energized vacuolar ...    336   1e-107   Malus domestica [apple tree]
ref|XP_007208066.1|  hypothetical protein PRUPE_ppa001833mg             336   1e-107   Prunus persica
gb|AAL11507.1|AF367447_1  vacuolar H+-pyrophosphatase                   336   1e-107   Prunus persica
ref|XP_006389797.1|  hypothetical protein EUTSA_v10018163mg             336   2e-107   Eutrema salsugineum [saltwater cress]
ref|XP_002517682.1|  Pyrophosphate-energized vacuolar membrane pr...    342   2e-107   
ref|XP_009373278.1|  PREDICTED: pyrophosphate-energized vacuolar ...    336   2e-107   Pyrus x bretschneideri [bai li]
ref|XP_009630145.1|  PREDICTED: pyrophosphate-energized vacuolar ...    334   2e-107   Nicotiana tomentosiformis
gb|ACT98610.2|  vacuolar proton-inorganic pyrophosphatase               335   3e-107   Diplachne fusca
ref|XP_004964695.1|  PREDICTED: pyrophosphate-energized vacuolar ...    335   3e-107   Setaria italica
ref|XP_006427443.1|  hypothetical protein CICLE_v10024946mg             335   3e-107   
gb|AFW77130.1|  hypothetical protein ZEAMMB73_840165                    337   3e-107   
ref|NP_001056966.1|  Os06g0178900                                       335   3e-107   
ref|XP_009763189.1|  PREDICTED: pyrophosphate-energized vacuolar ...    333   4e-107   Nicotiana sylvestris
gb|ADJ67258.1|  vaculor H+-pyrophosphatase                              335   4e-107   Sorghum bicolor [broomcorn]
gb|ABK91685.1|  vacuolar H+-pyrophosphatase                             335   6e-107   Kalidium foliatum
ref|XP_006344755.1|  PREDICTED: pyrophosphate-energized vacuolar ...    335   6e-107   Solanum tuberosum [potatoes]
ref|XP_006656699.1|  PREDICTED: pyrophosphate-energized vacuolar ...    335   7e-107   
gb|ABR16052.1|  unknown                                                 334   8e-107   Picea sitchensis
ref|XP_008372806.1|  PREDICTED: pyrophosphate-energized vacuolar ...    342   9e-107   
ref|XP_008370385.1|  PREDICTED: pyrophosphate-energized vacuolar ...    334   1e-106   
ref|XP_004302243.1|  PREDICTED: pyrophosphate-energized vacuolar ...    334   1e-106   Fragaria vesca subsp. vesca
ref|XP_002512502.1|  Pyrophosphate-energized vacuolar membrane pr...    334   1e-106   Ricinus communis
gb|ACN40474.1|  unknown                                                 334   1e-106   Picea sitchensis
gb|EYU34952.1|  hypothetical protein MIMGU_mgv1a001747mg                334   1e-106   Erythranthe guttata [common monkey flower]
gb|KJB56582.1|  hypothetical protein B456_009G126900                    333   1e-106   Gossypium raimondii
ref|XP_004230300.1|  PREDICTED: pyrophosphate-energized vacuolar ...    333   1e-106   Solanum lycopersicum
ref|XP_009630144.1|  PREDICTED: pyrophosphate-energized vacuolar ...    333   2e-106   Nicotiana tomentosiformis
gb|ABR18024.1|  unknown                                                 333   2e-106   Picea sitchensis
ref|XP_011017877.1|  PREDICTED: pyrophosphate-energized vacuolar ...    333   2e-106   Populus euphratica
ref|XP_009763192.1|  PREDICTED: pyrophosphate-energized vacuolar ...    332   4e-106   Nicotiana sylvestris
gb|KDP23377.1|  hypothetical protein JCGZ_23210                         332   5e-106   Jatropha curcas
ref|XP_006841407.1|  hypothetical protein AMTR_s00003p00014700          331   1e-105   Amborella trichopoda
emb|CDX81728.1|  BnaC08g38730D                                          339   1e-105   
ref|XP_010259323.1|  PREDICTED: pyrophosphate-energized vacuolar ...    330   3e-105   Nelumbo nucifera [Indian lotus]
gb|KJB83230.1|  hypothetical protein B456_013G236400                    331   4e-105   Gossypium raimondii
gb|KJB26321.1|  hypothetical protein B456_004G237000                    328   4e-105   Gossypium raimondii
ref|XP_011023767.1|  PREDICTED: pyrophosphate-energized vacuolar ...    330   4e-105   Populus euphratica
ref|XP_004954254.1|  PREDICTED: pyrophosphate-energized vacuolar ...    330   5e-105   Setaria italica
emb|CBI39586.3|  unnamed protein product                                329   5e-105   Vitis vinifera
ref|NP_001268072.1|  H+-pyrophosphatase                                 329   6e-105   Vitis vinifera
ref|XP_010039554.1|  PREDICTED: pyrophosphate-energized vacuolar ...    329   8e-105   Eucalyptus grandis [rose gum]
ref|XP_009148959.1|  PREDICTED: pyrophosphate-energized vacuolar ...    329   8e-105   Brassica rapa
ref|XP_010024124.1|  PREDICTED: pyrophosphate-energized vacuolar ...    329   8e-105   Eucalyptus grandis [rose gum]
ref|XP_002318956.1|  inorganic pyrophosphatase family protein           328   1e-104   Populus trichocarpa [western balsam poplar]
ref|XP_007031138.1|  Inorganic H pyrophosphatase family protein i...    328   2e-104   
gb|KCW45902.1|  hypothetical protein EUGRSUZ_L00271                     328   2e-104   Eucalyptus grandis [rose gum]
ref|NP_001048422.1|  Os02g0802500                                       328   2e-104   
emb|CAF18416.1|  proton translocating pyrophosphatase                   328   3e-104   Oryza sativa [red rice]
ref|XP_006382405.1|  inorganic pyrophosphatase family protein           327   3e-104   
gb|KJB26320.1|  hypothetical protein B456_004G237000                    327   4e-104   
ref|XP_011036944.1|  PREDICTED: pyrophosphate-energized vacuolar ...    327   4e-104   
gb|EYU40132.1|  hypothetical protein MIMGU_mgv1a001763mg                327   4e-104   
gb|KHG22725.1|  Pyrophosphate-energized vacuolar membrane proton ...    327   4e-104   
gb|AAL11506.1|AF367446_1  vacuolar H+-pyrophosphatase                   327   5e-104   
gb|ABK62847.1|  vacuolar H+-PPase                                       327   6e-104   
ref|XP_001782956.1|  predicted protein                                  318   1e-103   
ref|XP_002438225.1|  hypothetical protein SORBIDRAFT_10g009880          325   2e-103   
ref|XP_006648065.1|  PREDICTED: pyrophosphate-energized vacuolar ...    325   3e-103   
gb|KCW60550.1|  hypothetical protein EUGRSUZ_H03285                     322   1e-102   
ref|XP_006605822.1|  PREDICTED: pyrophosphate-energized vacuolar ...    323   2e-102   
ref|XP_003555808.1|  PREDICTED: pyrophosphate-energized vacuolar ...    323   2e-102   
gb|KJB26322.1|  hypothetical protein B456_004G237000                    321   2e-102   
ref|XP_008453661.1|  PREDICTED: pyrophosphate-energized vacuolar ...    322   4e-102   
gb|AAP55210.1|  vacuolar proton-inorganic pyrophosphatase               322   5e-102   
ref|XP_004144756.1|  PREDICTED: pyrophosphate-energized vacuolar ...    322   6e-102   
ref|XP_009412123.1|  PREDICTED: pyrophosphate-energized vacuolar ...    321   8e-102   
ref|XP_010931754.1|  PREDICTED: pyrophosphate-energized vacuolar ...    321   8e-102   
ref|XP_008797457.1|  PREDICTED: pyrophosphate-energized vacuolar ...    321   8e-102   
gb|ABJ53282.1|  vacuolar proton-pumping PPase                           304   2e-101   
ref|XP_010096802.1|  Pyrophosphate-energized vacuolar membrane pr...    316   1e-100   
gb|ABU92563.1|  vacuolar H+-pyrophosphatase                             318   1e-100   
ref|XP_002454723.1|  hypothetical protein SORBIDRAFT_04g036230          315   2e-99    
emb|CDP18241.1|  unnamed protein product                                315   4e-99    
gb|AAF07174.1|  H+-pyrophosphatase                                      294   1e-98    
gb|ACN35181.1|  unknown                                                 304   3e-98    
ref|XP_002960455.1|  hypothetical protein SELMODRAFT_270204             312   3e-98    
gb|AEI83219.1|  H+-pyrophosphatase                                      293   3e-98    
gb|EAY73863.1|  hypothetical protein OsI_01741                          310   3e-98    
ref|XP_002967265.1|  hypothetical protein SELMODRAFT_270614             311   4e-98    
gb|EMT27630.1|  Pyrophosphate-energized vacuolar membrane proton ...    306   7e-98    
emb|CAC42129.1|  vacuolar pyrophosphatase                               292   1e-97    
ref|NP_001042938.1|  Os01g0337500                                       310   1e-97    
gb|EAZ11737.1|  hypothetical protein OsJ_01602                          310   4e-97    
ref|XP_002455587.1|  hypothetical protein SORBIDRAFT_03g013530          309   4e-97    
gb|AAQ19328.1|  H+-pyrophosphatase                                      309   5e-97    
ref|XP_010093840.1|  Pyrophosphate-energized vacuolar membrane pr...    306   1e-96    
ref|XP_008655899.1|  PREDICTED: pyrophosphate-energized vacuolar ...    308   1e-96    
ref|XP_004968691.1|  PREDICTED: pyrophosphate-energized vacuolar ...    307   2e-96    
dbj|BAK06237.1|  predicted protein                                      306   4e-96    
dbj|BAK04633.1|  predicted protein                                      303   3e-95    
ref|NP_001152459.1|  pyrophosphate-energized vacuolar membrane pr...    304   4e-95    
gb|AFW77254.1|  pyrophosphate-energized vacuolar membrane proton ...    303   5e-95    
ref|XP_004978280.1|  PREDICTED: pyrophosphate-energized vacuolar ...    303   1e-94    
gb|EAZ24976.1|  hypothetical protein OsJ_08754                          302   1e-94    
ref|XP_001785132.1|  predicted protein                                  301   2e-94    
gb|AFW80727.1|  hypothetical protein ZEAMMB73_205029                    301   8e-94    
gb|AAC04387.1|  H+-pyrophosphatase                                      281   2e-93    
ref|XP_002440641.1|  hypothetical protein SORBIDRAFT_09g004450          297   2e-92    
emb|CAC80971.1|  putative proton-translocating inorganic pyrophos...    278   9e-92    
ref|XP_008655898.1|  PREDICTED: pyrophosphate-energized vacuolar ...    295   2e-91    
dbj|BAA36841.1|  vacuolar H+-pyrophosphatase                            291   3e-90    
gb|KDD76475.1|  Inorganic H+ pyrophosphatase                            290   8e-90    
ref|NP_001140455.1|  uncharacterized protein LOC100272514 precursor     272   1e-89    
ref|XP_005845116.1|  hypothetical protein CHLNCDRAFT_32356              289   2e-89    
ref|XP_005647206.1|  vacuolar-type H-pyrophosphatase                    288   5e-89    
dbj|BAJ93792.1|  predicted protein                                      288   5e-89    
ref|XP_003567657.1|  PREDICTED: pyrophosphate-energized vacuolar ...    287   1e-88    
gb|ABN48304.1|  vacuolar pyrophosphatase                                269   1e-88    
ref|XP_006645853.1|  PREDICTED: pyrophosphate-energized vacuolar ...    285   2e-88    
gb|AHL67376.1|  Chalk5                                                  281   3e-86    
ref|NP_001054701.1|  Os05g0156900                                       281   3e-86    
gb|EEE62395.1|  hypothetical protein OsJ_17186                          280   4e-86    
tpg|DAA54709.1|  TPA: hypothetical protein ZEAMMB73_571741              279   5e-86    
ref|XP_011398805.1|  Pyrophosphate-energized vacuolar membrane pr...    287   7e-86    
ref|XP_003568884.1|  PREDICTED: pyrophosphate-energized vacuolar ...    278   2e-85    
gb|EAY96623.1|  hypothetical protein OsI_18536                          277   5e-85    
ref|XP_002954858.1|  hypothetical protein VOLCADRAFT_76494              276   1e-84    
emb|CAC44451.1|  proton-translocating inorganic pyrophosphatase         276   2e-84    
ref|XP_001694682.1|  inorganic pyrophosphatase                          276   2e-84    
ref|XP_004169835.1|  PREDICTED: pyrophosphate-energized vacuolar ...    259   4e-84    
gb|ADK36629.1|  vacuolar H+-pyrophosphatase                             269   7e-82    
tpg|DAA63101.1|  TPA: hypothetical protein ZEAMMB73_533095              273   6e-81    
emb|CAC39167.1|  putative vacuolar-type H+-pyrophosphatase              248   7e-81    
gb|ETO16925.1|  hypothetical protein RFI_20413                          263   1e-80    
ref|WP_000322071.1|  hypothetical protein                               251   1e-79    
gb|ETO10415.1|  inorganic pyrophosphatase                               262   4e-79    
emb|CAH10836.1|  inorganic pyrophosphatase                              245   5e-79    
emb|CBK21196.2|  unnamed protein product                                258   7e-78    
emb|CBK23132.2|  unnamed protein product                                258   8e-78    
ref|WP_000585754.1|  K(+)-stimulated pyrophosphate-energized sodi...    253   2e-77    
gb|KHN23153.1|  Pyrophosphate-energized vacuolar membrane proton ...    255   3e-77    
ref|WP_001089697.1|  K(+)-stimulated pyrophosphate-energized sodi...    256   3e-77    
emb|CCC92569.1|  unnamed protein product                                246   4e-77    
gb|EMN79697.1|  V-type H(+)-translocating pyrophosphatase               255   4e-77    
ref|WP_017858711.1|  potassium transporter                              254   8e-77    
ref|WP_025178077.1|  potassium transporter                              254   1e-76    
ref|WP_025183110.1|  potassium transporter                              254   1e-76    
ref|WP_001089696.1|  K(+)-stimulated pyrophosphate-energized sodi...    254   1e-76    
gb|EKR54608.1|  V-type H(+)-translocating pyrophosphatase               254   1e-76    
gb|EMJ47695.1|  V-type H(+)-translocating pyrophosphatase               254   1e-76    
ref|WP_002070913.1|  potassium transporter                              254   1e-76    
ref|WP_001089687.1|  K(+)-stimulated pyrophosphate-energized sodi...    254   1e-76    
ref|XP_002500955.1|  H+-translocating pyrophosphatase family            250   1e-76    
gb|EKO85217.1|  V-type H(+)-translocating pyrophosphatase               254   1e-76    
ref|XP_001415754.1|  H+-PPase family transporter: proton                253   3e-76    
ref|WP_001089685.1|  K(+)-stimulated pyrophosphate-energized sodi...    251   3e-76    
ref|WP_039937109.1|  potassium transporter                              253   4e-76    
gb|EMY63018.1|  V-type H(+)-translocating pyrophosphatase               252   4e-76    
ref|WP_012390364.1|  potassium transporter                              253   5e-76    
ref|WP_015681155.1|  V-type H(+)-translocating pyrophosphatase          252   6e-76    
ref|WP_002980370.1|  V-type H(+)-translocating pyrophosphatase          252   6e-76    
ref|XP_002999240.1|  pyrophosphate-energized vacuolar membrane pr...    253   7e-76    
ref|WP_001089699.1|  K(+)-stimulated pyrophosphate-energized sodi...    252   7e-76    
gb|EMM96114.1|  V-type H(+)-translocating pyrophosphatase               251   8e-76    
ref|WP_003006999.1|  V-type H(+)-translocating pyrophosphatase          251   1e-75    
ref|WP_025177737.1|  potassium transporter                              251   1e-75    
ref|WP_001089688.1|  K(+)-stimulated pyrophosphate-energized sodi...    251   1e-75    
ref|WP_001089693.1|  K(+)-stimulated pyrophosphate-energized sodi...    251   1e-75    
ref|WP_001089694.1|  potassium transporter                              251   1e-75    
ref|WP_001089698.1|  K(+)-stimulated pyrophosphate-energized sodi...    251   1e-75    
ref|WP_001089695.1|  K(+)-stimulated pyrophosphate-energized sodi...    251   1e-75    
ref|WP_002142595.1|  V-type H(+)-translocating pyrophosphatase          251   1e-75    
ref|WP_025180399.1|  potassium transporter                              251   1e-75    
ref|WP_002068200.1|  potassium transporter                              251   1e-75    
ref|WP_016748609.1|  potassium transporter                              251   1e-75    
ref|WP_025177999.1|  potassium transporter                              251   1e-75    
ref|WP_001089689.1|  K(+)-stimulated pyrophosphate-energized sodi...    251   1e-75    
gb|AER01981.1|  membrane-bound proton-translocating pyrophosphatase     251   1e-75    
ref|WP_016749795.1|  potassium transporter                              251   1e-75    
ref|WP_002077918.1|  potassium transporter                              251   1e-75    
gb|EMN49303.1|  V-type H(+)-translocating pyrophosphatase               251   1e-75    
ref|WP_001968143.1|  V-type H(+)-translocating pyrophosphatase          251   1e-75    
gb|EMY54808.1|  V-type H(+)-translocating pyrophosphatase               251   1e-75    
ref|WP_025175902.1|  potassium transporter                              251   1e-75    
gb|EKO95603.1|  V-type H(+)-translocating pyrophosphatase               251   1e-75    
ref|WP_001089686.1|  K(+)-stimulated pyrophosphate-energized sodi...    251   1e-75    
ref|WP_017855597.1|  potassium transporter                              251   1e-75    
ref|WP_001089690.1|  K(+)-stimulated pyrophosphate-energized sodi...    251   1e-75    
gb|EMF70684.1|  V-type H(+)-translocating pyrophosphatase               251   1e-75    
gb|EMN93735.1|  V-type H(+)-translocating pyrophosphatase               251   1e-75    
gb|EPG51431.1|  V-type H(+)-translocating pyrophosphatase               251   1e-75    
ref|WP_025182274.1|  potassium transporter                              251   2e-75    
ref|XP_008892299.1|  V-type H(+)-translocating pyrophosphatase          252   2e-75    
ref|WP_025184333.1|  potassium transporter                              251   2e-75    
gb|EMJ92281.1|  V-type H(+)-translocating pyrophosphatase               251   2e-75    
gb|EKP03943.1|  V-type H(+)-translocating pyrophosphatase               251   2e-75    
gb|EJO69368.1|  V-type H(+)-translocating pyrophosphatase               251   2e-75    
ref|WP_004758301.1|  V-type H(+)-translocating pyrophosphatase          251   2e-75    
ref|WP_016752051.1|  potassium transporter                              251   2e-75    
emb|CAB99324.1|  putative proton-translocating inorganic pyrophos...    236   2e-75    
gb|EPY41775.1|  inorganic pyrophosphatase                               244   2e-75    
gb|EKQ82831.1|  V-type H(+)-translocating pyrophosphatase               251   2e-75    
ref|WP_036078489.1|  potassium transporter                              251   2e-75    
ref|WP_004766843.1|  V-type H(+)-translocating pyrophosphatase          250   2e-75    
ref|XP_009518929.1|  pyrophosphatase                                    251   2e-75    
ref|WP_020770960.1|  V-type H(+)-translocating pyrophosphatase          251   2e-75    
ref|WP_002151978.1|  V-type H(+)-translocating pyrophosphatase          249   2e-75    
ref|WP_025183590.1|  potassium transporter                              250   2e-75    
gb|EMS84153.1|  V-type H(+)-translocating pyrophosphatase               250   2e-75    
ref|WP_016762025.1|  potassium transporter                              250   2e-75    
ref|WP_008589377.1|  potassium transporter                              250   2e-75    
gb|EMK22814.1|  V-type H(+)-translocating pyrophosphatase               250   2e-75    
ref|WP_017809980.1|  potassium transporter                              250   2e-75    
emb|CCI48961.1|  unnamed protein product                                251   3e-75    
ref|WP_025182806.1|  potassium transporter                              250   3e-75    
gb|EMK03279.1|  V-type H(+)-translocating pyrophosphatase               250   3e-75    
emb|CAC67690.1|  putative proton-translocating inorganic pyrophos...    235   3e-75    
ref|WP_017214623.1|  potassium transporter                              250   3e-75    
ref|WP_036069051.1|  potassium transporter                              250   3e-75    
ref|WP_036032260.1|  potassium transporter                              250   3e-75    
gb|KDO29615.1|  V-type H(+)-translocating pyrophosphatase               251   3e-75    
ref|XP_008607654.1|  V-type H(+)-translocating pyrophosphatase          251   3e-75    
gb|EQA52304.1|  V-type H(+)-translocating pyrophosphatase               250   3e-75    
gb|EMO53491.1|  V-type H(+)-translocating pyrophosphatase               250   3e-75    
gb|EMM98893.1|  V-type H(+)-translocating pyrophosphatase               250   3e-75    
ref|WP_036026455.1|  potassium transporter                              250   3e-75    
ref|WP_010574321.1|  potassium transporter                              250   3e-75    
gb|EMO43104.1|  V-type H(+)-translocating pyrophosphatase               250   3e-75    
ref|WP_020776171.1|  V-type H(+)-translocating pyrophosphatase          250   4e-75    
ref|WP_004786870.1|  potassium transporter                              250   4e-75    
ref|WP_015677209.1|  V-type H(+)-translocating pyrophosphatase          250   4e-75    
gb|EQA70089.1|  V-type H(+)-translocating pyrophosphatase               249   4e-75    
ref|WP_025182872.1|  potassium transporter                              249   4e-75    
gb|EMK06207.1|  V-type H(+)-translocating pyrophosphatase               249   5e-75    
ref|WP_036064229.1|  potassium transporter                              249   7e-75    
gb|EKR73234.1|  V-type H(+)-translocating pyrophosphatase               249   7e-75    
ref|WP_016756764.1|  potassium transporter                              249   7e-75    
ref|WP_032914011.1|  potassium transporter                              249   7e-75    
ref|WP_032922181.1|  potassium transporter                              249   7e-75    
ref|WP_004470249.1|  V-type H(+)-translocating pyrophosphatase          249   9e-75    
ref|WP_043991582.1|  potassium transporter                              249   9e-75    
gb|EKO34787.1|  V-type H(+)-translocating pyrophosphatase               249   9e-75    
ref|WP_004458247.1|  MULTISPECIES: membrane-bound proton-transloc...    249   9e-75    
ref|WP_036098048.1|  potassium transporter                              249   9e-75    
gb|EMP80355.1|  V-type H(+)-translocating pyrophosphatase               249   9e-75    
ref|WP_004466135.1|  V-type H(+)-translocating pyrophosphatase          249   9e-75    
ref|XP_008666607.1|  PREDICTED: pyrophosphate-energized vacuolar ...    239   9e-75    
gb|EMS86910.1|  V-type H(+)-translocating pyrophosphatase               249   1e-74    
gb|ETL95939.1|  V-type H(+)-translocating pyrophosphatase               250   1e-74    
emb|CCA14759.1|  unknown putative                                       249   1e-74    
gb|EKO77826.1|  V-type H(+)-translocating pyrophosphatase               248   1e-74    
ref|WP_010570365.1|  potassium transporter                              248   1e-74    
ref|WP_020983541.1|  V-type H(+)-translocating pyrophosphatase          248   2e-74    
emb|CEF96532.1|  Pyrophosphate-energised proton pump                    250   2e-74    
emb|CAC67791.1|  putative proton-translocating inorganic pyrophos...    233   2e-74    
emb|CAC48004.1|  putative proton-translocating inorganic pyrophos...    233   3e-74    
ref|WP_010411520.1|  potassium transporter                              248   3e-74    
ref|XP_008671333.1|  PREDICTED: pyrophosphate-energized vacuolar ...    237   3e-74    
ref|WP_016549231.1|  V-type H(+)-translocating pyrophosphatase          247   3e-74    
ref|WP_002760848.1|  V-type H(+)-translocating pyrophosphatase          247   4e-74    
ref|XP_003863215.1|  vacuolar-type proton translocating pyrophosp...    248   5e-74    
emb|CAC80899.1|  putative proton-translocating inorganic pyrophos...    232   5e-74    
ref|XP_001467417.1|  putative vacuolar-type proton translocating ...    248   6e-74    
ref|WP_004499021.1|  V-type H(+)-translocating pyrophosphatase          246   6e-74    
gb|EPY37996.1|  inorganic pyrophosphatase                               244   7e-74    
ref|NP_001077542.1|  Pyrophosphate-energized vacuolar membrane pr...    245   8e-74    
ref|XP_003055966.1|  H+-translocating pyrophosphatase family            247   9e-74    
emb|CAH55610.1|  proton-translocating inorganic pyrophosphatase Ib      232   1e-73    
emb|CAC67691.1|  putative proton-translocating inorganic pyrophos...    231   2e-73    
ref|WP_004497654.1|  V-type H(+)-translocating pyrophosphatase          245   2e-73    
ref|XP_009834264.1|  V-type H(+)-translocating pyrophosphatase          246   2e-73    
ref|XP_001685107.1|  putative vacuolar-type proton translocating ...    247   2e-73    
ref|WP_002624429.1|  V-type H(+)-translocating pyrophosphatase          245   3e-73    
ref|WP_016543771.1|  V-type H(+)-translocating pyrophosphatase          245   3e-73    
ref|WP_020782374.1|  V-type H(+)-translocating pyrophosphatase          245   3e-73    
ref|XP_008876002.1|  V-type H(+)-translocating pyrophosphatase          246   3e-73    
ref|XP_847623.1|  vacuolar-type proton translocating pyrophosphat...    246   5e-73    
emb|CBH13886.1|  vacuolar-type proton translocating pyrophosphata...    246   5e-73    
ref|XP_844588.1|  vacuolar-type proton translocating pyrophosphat...    246   5e-73    



>gb|ABK94904.1| unknown [Populus trichocarpa]
Length=288

 Score =   342 bits (876),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  26   PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  85

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPY FSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  86   SISTVDVLTPKVFIGLIVGAMLPYRFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  145

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAG+LVSGVQIAISA
Sbjct  146  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQIAISA  205

Query  543  S  545
            S
Sbjct  206  S  206



>gb|AFW70477.1| hypothetical protein ZEAMMB73_398917 [Zea mays]
Length=443

 Score =   347 bits (889),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 175/181 (97%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  181  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  240

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFNNIPGLMEGT 
Sbjct  241  AISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNNIPGLMEGTT  300

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGI FGVETLSGVLAGALVSGVQIAISA
Sbjct  301  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGILFGVETLSGVLAGALVSGVQIAISA  360

Query  543  S  545
            S
Sbjct  361  S  361



>ref|NP_001046107.2| Os02g0184200 [Oryza sativa Japonica Group]
 dbj|BAF08021.2| Os02g0184200, partial [Oryza sativa Japonica Group]
Length=360

 Score =   343 bits (881),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  98   PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  157

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGT 
Sbjct  158  AISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTT  217

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGI FGVETLSGVLAGALVSGVQIAISA
Sbjct  218  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGILFGVETLSGVLAGALVSGVQIAISA  277

Query  543  S  545
            S
Sbjct  278  S  278



>gb|AFQ00710.1| pyrophosphate-energized vacuolar membrane proteon pump 1 [Ipomoea 
batatas]
Length=767

 Score =   356 bits (913),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 180/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  505  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  564

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
            EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA
Sbjct  565  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  624

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA
Sbjct  625  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  684

Query  543  S  545
            S
Sbjct  685  S  685



>emb|CBI36400.3| unnamed protein product [Vitis vinifera]
Length=395

 Score =   344 bits (883),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  133  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  192

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG+AALKMVEEVRRQFN IPGLMEG A
Sbjct  193  SISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGRAALKMVEEVRRQFNTIPGLMEGLA  252

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG FFGVETLSGVLAG+LVSGVQIAISA
Sbjct  253  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTFFGVETLSGVLAGSLVSGVQIAISA  312

Query  543  S  545
            S
Sbjct  313  S  313



>ref|XP_003632767.2| PREDICTED: LOW QUALITY PROTEIN: pyrophosphate-energized vacuolar 
membrane proton pump [Vitis vinifera]
Length=444

 Score =   344 bits (883),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  182  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  241

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG+AALKMVEEVRRQFN IPGLMEG A
Sbjct  242  SISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGRAALKMVEEVRRQFNTIPGLMEGLA  301

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG FFGVETLSGVLAG+LVSGVQIAISA
Sbjct  302  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTFFGVETLSGVLAGSLVSGVQIAISA  361

Query  543  S  545
            S
Sbjct  362  S  362



>ref|XP_010654839.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like [Vitis vinifera]
Length=310

 Score =   337 bits (865),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 168/176 (95%), Positives = 170/176 (97%), Gaps = 0/176 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  133  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  192

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEG A
Sbjct  193  SISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGLA  252

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQI  530
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG FFGVETLSGVLAG+LVSGVQ+
Sbjct  253  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTFFGVETLSGVLAGSLVSGVQV  308



>gb|EAY84758.1| hypothetical protein OsI_06126 [Oryza sativa Indica Group]
Length=268

 Score =   335 bits (858),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 168/175 (96%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  26   PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  85

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGT 
Sbjct  86   AISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTT  145

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQ  527
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGI FGVETLSGVLAGALVSGVQ
Sbjct  146  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGILFGVETLSGVLAGALVSGVQ  200



>emb|CBI36397.3| unnamed protein product [Vitis vinifera]
Length=347

 Score =   336 bits (862),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 168/175 (96%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  133  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  192

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEG A
Sbjct  193  SISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGLA  252

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQ  527
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG FFGVETLSGVLAG+LVSGVQ
Sbjct  253  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTFFGVETLSGVLAGSLVSGVQ  307



>gb|KJB64656.1| hypothetical protein B456_010G059800 [Gossypium raimondii]
Length=702

 Score =   348 bits (892),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 176/181 (97%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  504  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  563

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  564  AISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  623

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAG+LVSGVQIAISA
Sbjct  624  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQIAISA  683

Query  543  S  545
            S
Sbjct  684  S  684



>emb|CAC39165.1| vacuolar-type H+-pyrophosphatase [Solanum lycopersicum]
Length=356

 Score =   337 bits (863),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 172/181 (95%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  94   PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  153

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVR QFN IPGLME TA
Sbjct  154  AISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRXQFNTIPGLMERTA  213

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKI TDASIKEMIP GALVMLTPLIVGI FGVETLSGVLAG+LVSGVQIAISA
Sbjct  214  KPDYATCVKIFTDASIKEMIPPGALVMLTPLIVGILFGVETLSGVLAGSLVSGVQIAISA  273

Query  543  S  545
            S
Sbjct  274  S  274



>gb|KDO47416.1| hypothetical protein CISIN_1g0042302mg, partial [Citrus sinensis]
Length=602

 Score =   344 bits (883),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  340  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  399

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I+TVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGT 
Sbjct  400  GITTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTT  459

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAG+LVSGVQIAISA
Sbjct  460  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQIAISA  519

Query  543  S  545
            S
Sbjct  520  S  520



>ref|XP_008658530.1| PREDICTED: uncharacterized protein LOC100280334 isoform X1 [Zea 
mays]
Length=667

 Score =   346 bits (888),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 175/181 (97%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  405  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  464

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
            EISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEG  
Sbjct  465  EISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGIT  524

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA
Sbjct  525  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  584

Query  543  S  545
            S
Sbjct  585  S  585



>ref|XP_006474386.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
isoform X2 [Citrus sinensis]
Length=705

 Score =   347 bits (890),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 175/181 (97%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  508  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  567

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  568  AISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  627

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAG+LVSGVQIAISA
Sbjct  628  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQIAISA  687

Query  543  S  545
            S
Sbjct  688  S  688



>gb|KJB23660.1| hypothetical protein B456_004G108700 [Gossypium raimondii]
Length=667

 Score =   346 bits (887),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 175/181 (97%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  405  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  464

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGT+
Sbjct  465  AISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTS  524

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAG+LVSGVQIAISA
Sbjct  525  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQIAISA  584

Query  543  S  545
            S
Sbjct  585  S  585



>gb|KDO73437.1| hypothetical protein CISIN_1g004159mg [Citrus sinensis]
Length=705

 Score =   347 bits (890),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 175/181 (97%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  508  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  567

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  568  AISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  627

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAG+LVSGVQIAISA
Sbjct  628  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQIAISA  687

Query  543  S  545
            S
Sbjct  688  S  688



>gb|ABS01290.1| tonoplast proton pump [Lotus corniculatus]
Length=767

 Score =   348 bits (894),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 175/181 (97%), Positives = 178/181 (98%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  506  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  565

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I+TVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFN IPGLMEGTA
Sbjct  566  NITTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNTIPGLMEGTA  625

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAG+LVSGVQIAISA
Sbjct  626  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQIAISA  685

Query  543  S  545
            S
Sbjct  686  S  686



>emb|CAA58699.1| inorganic pyrophosphatase [Nicotiana tabacum]
Length=541

 Score =   342 bits (877),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  279  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  338

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  339  AISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  398

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMI  GALVMLTPLIVGI FGVETLSGVLAG+LVSGVQIAISA
Sbjct  399  KPDYATCVKISTDASIKEMIAPGALVMLTPLIVGILFGVETLSGVLAGSLVSGVQIAISA  458

Query  543  S  545
            S
Sbjct  459  S  459



>gb|KHN01313.1| Pyrophosphate-energized vacuolar membrane proton pump [Glycine 
soja]
Length=667

 Score =   345 bits (884),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 175/181 (97%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  405  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  464

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEG A
Sbjct  465  GISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGHA  524

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA
Sbjct  525  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  584

Query  543  S  545
            S
Sbjct  585  S  585



>ref|XP_010097004.1| Pyrophosphate-energized vacuolar membrane proton pump [Morus 
notabilis]
 gb|EXB66631.1| Pyrophosphate-energized vacuolar membrane proton pump [Morus 
notabilis]
Length=764

 Score =   347 bits (890),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 175/181 (97%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  502  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  561

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  562  NISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  621

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAG+LVSGVQIAISA
Sbjct  622  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQIAISA  681

Query  543  S  545
            S
Sbjct  682  S  682



>ref|XP_011020230.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Populus euphratica]
Length=768

 Score =   347 bits (890),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 175/181 (97%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  506  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  565

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  566  SISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  625

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAG+LVSGVQIAISA
Sbjct  626  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQIAISA  685

Query  543  S  545
            S
Sbjct  686  S  686



>ref|XP_008795832.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Phoenix dactylifera]
Length=765

 Score =   347 bits (890),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 175/181 (97%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  503  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  562

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
            EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEG+A
Sbjct  563  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGSA  622

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG FFGVETLSGVLAG+LVSGVQIAISA
Sbjct  623  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTFFGVETLSGVLAGSLVSGVQIAISA  682

Query  543  S  545
            S
Sbjct  683  S  683



>gb|AAA61609.1| pyrophosphatase [Beta vulgaris]
Length=761

 Score =   347 bits (890),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 175/181 (97%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  499  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  558

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  559  AISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  618

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAG+LVSGVQIAISA
Sbjct  619  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQIAISA  678

Query  543  S  545
            S
Sbjct  679  S  679



>gb|KJB64655.1| hypothetical protein B456_010G059800 [Gossypium raimondii]
Length=766

 Score =   347 bits (890),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 176/181 (97%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  504  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  563

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  564  AISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  623

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAG+LVSGVQIAISA
Sbjct  624  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQIAISA  683

Query  543  S  545
            S
Sbjct  684  S  684



>ref|XP_010691127.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1 [Beta vulgaris subsp. vulgaris]
Length=762

 Score =   347 bits (890),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 175/181 (97%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  500  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  559

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  560  AISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  619

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAG+LVSGVQIAISA
Sbjct  620  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQIAISA  679

Query  543  S  545
            S
Sbjct  680  S  680



>ref|XP_006381091.1| Pyrophosphate-energized vacuolar membrane proton pump family 
protein [Populus trichocarpa]
 gb|ERP58888.1| Pyrophosphate-energized vacuolar membrane proton pump family 
protein [Populus trichocarpa]
Length=768

 Score =   347 bits (890),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 175/181 (97%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  506  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  565

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  566  SISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  625

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAG+LVSGVQIAISA
Sbjct  626  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQIAISA  685

Query  543  S  545
            S
Sbjct  686  S  686



>emb|CDP10479.1| unnamed protein product [Coffea canephora]
Length=765

 Score =   347 bits (889),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 175/181 (97%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  503  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  562

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGT 
Sbjct  563  AISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTT  622

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA
Sbjct  623  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  682

Query  543  S  545
            S
Sbjct  683  S  683



>gb|KHG04918.1| Pyrophosphate-energized vacuolar membrane proton pump [Gossypium 
arboreum]
Length=770

 Score =   346 bits (888),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 175/181 (97%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  508  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  567

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  568  AISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  627

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPL+VGIFFGVETLSGVLAG+LVSGVQIAISA
Sbjct  628  KPDYATCVKISTDASIKEMIPPGALVMLTPLVVGIFFGVETLSGVLAGSLVSGVQIAISA  687

Query  543  S  545
            S
Sbjct  688  S  688



>ref|XP_006453118.1| hypothetical protein CICLE_v10007524mg [Citrus clementina]
 ref|XP_006474385.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
isoform X1 [Citrus sinensis]
 gb|ESR66358.1| hypothetical protein CICLE_v10007524mg [Citrus clementina]
Length=771

 Score =   346 bits (888),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 175/181 (97%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  508  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  567

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  568  AISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  627

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAG+LVSGVQIAISA
Sbjct  628  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQIAISA  687

Query  543  S  545
            S
Sbjct  688  S  688



>gb|KJB53981.1| hypothetical protein B456_009G014500 [Gossypium raimondii]
Length=770

 Score =   346 bits (888),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 175/181 (97%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  508  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  567

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  568  AISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  627

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPL+VGIFFGVETLSGVLAG+LVSGVQIAISA
Sbjct  628  KPDYATCVKISTDASIKEMIPPGALVMLTPLVVGIFFGVETLSGVLAGSLVSGVQIAISA  687

Query  543  S  545
            S
Sbjct  688  S  688



>gb|KDO73436.1| hypothetical protein CISIN_1g004159mg [Citrus sinensis]
Length=771

 Score =   346 bits (888),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 175/181 (97%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  508  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  567

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  568  AISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  627

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAG+LVSGVQIAISA
Sbjct  628  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQIAISA  687

Query  543  S  545
            S
Sbjct  688  S  688



>gb|KDO47417.1| hypothetical protein CISIN_1g0042302mg, partial [Citrus sinensis]
Length=682

 Score =   344 bits (882),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  420  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  479

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I+TVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGT 
Sbjct  480  GITTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTT  539

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAG+LVSGVQIAISA
Sbjct  540  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQIAISA  599

Query  543  S  545
            S
Sbjct  600  S  600



>emb|CAG29370.1| vacuolar H+-translocating inorganic pyrophosphatase [Zea mays]
Length=766

 Score =   346 bits (888),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 175/181 (97%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  504  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  563

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFNNIPGLMEGT 
Sbjct  564  AISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNNIPGLMEGTT  623

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGI FGVETLSGVLAGALVSGVQIAISA
Sbjct  624  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGILFGVETLSGVLAGALVSGVQIAISA  683

Query  543  S  545
            S
Sbjct  684  S  684



>ref|NP_001146732.1| uncharacterized protein LOC100280334 [Zea mays]
 gb|ACL54639.1| unknown [Zea mays]
 gb|AFW87296.1| hypothetical protein ZEAMMB73_037805 [Zea mays]
Length=771

 Score =   346 bits (888),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 175/181 (97%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  509  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  568

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
            EISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEG  
Sbjct  569  EISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGIT  628

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA
Sbjct  629  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  688

Query  543  S  545
            S
Sbjct  689  S  689



>gb|AFW70478.1| vacuolar H+-translocating inorganic pyrophosphatase [Zea mays]
Length=766

 Score =   346 bits (887),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 175/181 (97%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  504  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  563

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFNNIPGLMEGT 
Sbjct  564  AISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNNIPGLMEGTT  623

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGI FGVETLSGVLAGALVSGVQIAISA
Sbjct  624  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGILFGVETLSGVLAGALVSGVQIAISA  683

Query  543  S  545
            S
Sbjct  684  S  684



>ref|XP_010323159.1| PREDICTED: vacuolar-type H+-pyrophosphatase isoform X1 [Solanum 
lycopersicum]
Length=765

 Score =   345 bits (886),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 175/181 (97%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  503  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  562

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  563  AISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  622

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGI FGVETLSGVLAG+LVSGVQIAISA
Sbjct  623  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGILFGVETLSGVLAGSLVSGVQIAISA  682

Query  543  S  545
            S
Sbjct  683  S  683



>gb|KJB83229.1| hypothetical protein B456_013G236400 [Gossypium raimondii]
Length=767

 Score =   345 bits (886),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  505  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  564

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGT 
Sbjct  565  AISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTT  624

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPL+VGIFFGVETLSGVLAG+LVSGVQIAISA
Sbjct  625  KPDYATCVKISTDASIKEMIPPGALVMLTPLVVGIFFGVETLSGVLAGSLVSGVQIAISA  684

Query  543  S  545
            S
Sbjct  685  S  685



>gb|KHG19866.1| Pyrophosphate-energized vacuolar membrane proton pump [Gossypium 
arboreum]
Length=771

 Score =   345 bits (886),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 175/181 (97%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  509  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  568

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGT+
Sbjct  569  AISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTS  628

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAG+LVSGVQIAISA
Sbjct  629  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQIAISA  688

Query  543  S  545
            S
Sbjct  689  S  689



>ref|XP_009410369.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Musa acuminata subsp. malaccensis]
Length=767

 Score =   345 bits (886),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 178/181 (98%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  505  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  564

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG+AAL+MVEEVRRQFN+IPGLMEGTA
Sbjct  565  AISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGRAALEMVEEVRRQFNSIPGLMEGTA  624

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG FFGVETLSGVLAGALVSGVQIAISA
Sbjct  625  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTFFGVETLSGVLAGALVSGVQIAISA  684

Query  543  S  545
            S
Sbjct  685  S  685



>ref|NP_001265905.1| vacuolar-type H+-pyrophosphatase [Solanum lycopersicum]
 dbj|BAM65603.1| vacuolar H+-pyrophosphatase [Solanum lycopersicum]
Length=765

 Score =   345 bits (886),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 175/181 (97%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  503  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  562

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  563  AISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  622

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGI FGVETLSGVLAG+LVSGVQIAISA
Sbjct  623  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGILFGVETLSGVLAGSLVSGVQIAISA  682

Query  543  S  545
            S
Sbjct  683  S  683



>ref|XP_010050115.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Eucalyptus grandis]
 gb|KCW82997.1| hypothetical protein EUGRSUZ_C04383 [Eucalyptus grandis]
Length=768

 Score =   345 bits (886),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  506  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  565

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I TVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  566  HIVTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  625

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAG+LVSGVQIAISA
Sbjct  626  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQIAISA  685

Query  543  S  545
            S
Sbjct  686  S  686



>ref|XP_009796113.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Nicotiana sylvestris]
Length=765

 Score =   345 bits (886),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  503  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  562

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I+TVDVLTP+VFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  563  AITTVDVLTPQVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  622

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA
Sbjct  623  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  682

Query  543  S  545
            S
Sbjct  683  S  683



>ref|XP_009628297.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Nicotiana tomentosiformis]
Length=765

 Score =   345 bits (885),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  503  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  562

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I+TVDVLTP+VFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  563  AITTVDVLTPQVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  622

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA
Sbjct  623  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  682

Query  543  S  545
            S
Sbjct  683  S  683



>gb|KJB23657.1| hypothetical protein B456_004G108700 [Gossypium raimondii]
 gb|KJB23658.1| hypothetical protein B456_004G108700 [Gossypium raimondii]
Length=771

 Score =   345 bits (886),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 175/181 (97%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  509  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  568

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGT+
Sbjct  569  AISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTS  628

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAG+LVSGVQIAISA
Sbjct  629  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQIAISA  688

Query  543  S  545
            S
Sbjct  689  S  689



>ref|XP_006359496.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Solanum tuberosum]
Length=765

 Score =   345 bits (885),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 175/181 (97%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  503  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  562

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  563  AISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  622

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGI FGVETLSGVLAG+LVSGVQIAISA
Sbjct  623  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGILFGVETLSGVLAGSLVSGVQIAISA  682

Query  543  S  545
            S
Sbjct  683  S  683



>emb|CAA58701.1| inorganic pyrophosphatase [Nicotiana tabacum]
Length=765

 Score =   345 bits (885),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  503  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  562

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I+TVDVLTP+VFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  563  AITTVDVLTPQVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  622

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA
Sbjct  623  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  682

Query  543  S  545
            S
Sbjct  683  S  683



>ref|XP_009791988.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Nicotiana sylvestris]
Length=767

 Score =   345 bits (885),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 175/181 (97%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  505  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  564

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  565  GISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  624

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGI FGVETLSGVLAG+LVSGVQIAISA
Sbjct  625  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGILFGVETLSGVLAGSLVSGVQIAISA  684

Query  543  S  545
            S
Sbjct  685  S  685



>ref|XP_004235902.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Solanum lycopersicum]
Length=767

 Score =   345 bits (885),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 175/181 (97%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  505  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  564

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEG A
Sbjct  565  AISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGHA  624

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA
Sbjct  625  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  684

Query  543  S  545
            S
Sbjct  685  S  685



>ref|XP_006341399.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like [Solanum tuberosum]
Length=767

 Score =   345 bits (885),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 175/181 (97%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  505  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  564

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEG A
Sbjct  565  AISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGLA  624

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA
Sbjct  625  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  684

Query  543  S  545
            S
Sbjct  685  S  685



>gb|AAA80347.1| H+-pyrophosphatase, partial [Zea mays]
Length=509

 Score =   338 bits (866),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 171/181 (94%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSL LFGAFVSRA
Sbjct  284  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLRLFGAFVSRA  343

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTP+VFIGL+VGAMLPYWFSAMTMKS+G AALKMVEEVRRQFN IPGLMEGT 
Sbjct  344  AISTVDVLTPEVFIGLIVGAMLPYWFSAMTMKSMGSAALKMVEEVRRQFNTIPGLMEGTT  403

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGI FGVETLSGVLAGALVSGVQIAISA
Sbjct  404  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGILFGVETLSGVLAGALVSGVQIAISA  463

Query  543  S  545
            S
Sbjct  464  S  464



>ref|XP_004287260.1| PREDICTED: LOW QUALITY PROTEIN: pyrophosphate-energized vacuolar 
membrane proton pump-like [Fragaria vesca subsp. vesca]
Length=765

 Score =   345 bits (885),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  504  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  563

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I+TVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  564  GIATVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  623

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAG+LVSGVQIAISA
Sbjct  624  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQIAISA  683

Query  543  S  545
            S
Sbjct  684  S  684



>ref|XP_002530755.1| Pyrophosphate-energized vacuolar membrane proton pump, putative 
[Ricinus communis]
 gb|EEF31615.1| Pyrophosphate-energized vacuolar membrane proton pump, putative 
[Ricinus communis]
Length=767

 Score =   345 bits (885),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  505  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  564

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGT 
Sbjct  565  SISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTT  624

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAG+LVSGVQIAISA
Sbjct  625  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQIAISA  684

Query  543  S  545
            S
Sbjct  685  S  685



>gb|EMS53286.1| Pyrophosphate-energized vacuolar membrane proton pump 1 [Triticum 
urartu]
Length=700

 Score =   343 bits (880),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  438  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  497

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I+TVDVLTP VFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  498  GITTVDVLTPNVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  557

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG FFGVETLSGVLAGALVSGVQIAISA
Sbjct  558  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTFFGVETLSGVLAGALVSGVQIAISA  617

Query  543  S  545
            S
Sbjct  618  S  618



>ref|XP_009595111.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Nicotiana tomentosiformis]
Length=767

 Score =   345 bits (885),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 175/181 (97%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  505  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  564

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  565  GISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  624

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGI FGVETLSGVLAG+LVSGVQIAISA
Sbjct  625  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGILFGVETLSGVLAGSLVSGVQIAISA  684

Query  543  S  545
            S
Sbjct  685  S  685



>ref|XP_009401376.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Musa acuminata subsp. malaccensis]
Length=762

 Score =   345 bits (884),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  500  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  559

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  560  AISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  619

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG FFGVETLSGVLAG+LVSGVQIAISA
Sbjct  620  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTFFGVETLSGVLAGSLVSGVQIAISA  679

Query  543  S  545
            S
Sbjct  680  S  680



>ref|XP_011081989.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Sesamum indicum]
Length=764

 Score =   345 bits (884),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  503  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  562

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEG A
Sbjct  563  SISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGHA  622

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAG+LVSGVQIAISA
Sbjct  623  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQIAISA  682

Query  543  S  545
            S
Sbjct  683  S  683



>gb|AHA38114.1| vacuolar H+-pyrophosphatase [Sesuvium portulacastrum]
Length=765

 Score =   345 bits (884),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  503  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  562

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEG A
Sbjct  563  SISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGHA  622

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG FFGVETLSGVLAG+LVSGVQIAISA
Sbjct  623  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTFFGVETLSGVLAGSLVSGVQIAISA  682

Query  543  S  545
            S
Sbjct  683  S  683



>ref|XP_011078537.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Sesamum indicum]
Length=764

 Score =   345 bits (884),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSH IRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  502  PISDNAGGIAEMAGMSHSIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  561

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
            +ISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  562  DISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  621

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDY  CVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA
Sbjct  622  KPDYTNCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  681

Query  543  S  545
            S
Sbjct  682  S  682



>ref|XP_007013600.1| Inorganic H pyrophosphatase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY31219.1| Inorganic H pyrophosphatase family protein isoform 1 [Theobroma 
cacao]
Length=770

 Score =   345 bits (884),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  508  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  567

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEG+A
Sbjct  568  AISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGSA  627

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPL+VGIFFGVETLSGVLAG+LVSGVQIAISA
Sbjct  628  KPDYATCVKISTDASIKEMIPPGALVMLTPLLVGIFFGVETLSGVLAGSLVSGVQIAISA  687

Query  543  S  545
            S
Sbjct  688  S  688



>ref|XP_003528302.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Glycine max]
Length=768

 Score =   344 bits (883),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 175/181 (97%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  506  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  565

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEG A
Sbjct  566  GISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGHA  625

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA
Sbjct  626  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  685

Query  543  S  545
            S
Sbjct  686  S  686



>ref|XP_006656294.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Oryza brachyantha]
Length=772

 Score =   345 bits (884),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  510  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  569

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGT 
Sbjct  570  AISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTT  629

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSG+LAGALVSGVQIAISA
Sbjct  630  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGLLAGALVSGVQIAISA  689

Query  543  S  545
            S
Sbjct  690  S  690



>ref|XP_004965753.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Setaria italica]
Length=769

 Score =   344 bits (883),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  507  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  566

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
            EISTVDVL+PKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGT 
Sbjct  567  EISTVDVLSPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTT  626

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGI FGVETLSGVLAGALVSGVQIAISA
Sbjct  627  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGILFGVETLSGVLAGALVSGVQIAISA  686

Query  543  S  545
            S
Sbjct  687  S  687



>ref|XP_010557616.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Tarenaya hassleriana]
Length=768

 Score =   344 bits (883),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  506  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  565

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN+IPGLMEGT 
Sbjct  566  GISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNSIPGLMEGTT  625

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG FFGVETLSGVLAG+LVSGVQIAISA
Sbjct  626  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGFFFGVETLSGVLAGSLVSGVQIAISA  685

Query  543  S  545
            S
Sbjct  686  S  686



>ref|XP_010913343.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Elaeis guineensis]
Length=765

 Score =   344 bits (882),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  503  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  562

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
            +ISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEG+ 
Sbjct  563  DISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGST  622

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG FFGVETLSGVLAG+LVSGVQIAISA
Sbjct  623  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTFFGVETLSGVLAGSLVSGVQIAISA  682

Query  543  S  545
            S
Sbjct  683  S  683



>gb|AJR29310.1| H+-pyrophosphatase [Secale cereale]
Length=762

 Score =   344 bits (882),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  500  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  559

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I+TVDVLTP VFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  560  GITTVDVLTPNVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  619

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG FFGVETLSGVLAGALVSGVQIAISA
Sbjct  620  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTFFGVETLSGVLAGALVSGVQIAISA  679

Query  543  S  545
            S
Sbjct  680  S  680



>ref|XP_008389636.1| PREDICTED: LOW QUALITY PROTEIN: pyrophosphate-energized vacuolar 
membrane proton pump-like, partial [Malus domestica]
Length=685

 Score =   342 bits (877),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  424  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  483

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I TVDVLTPKV IGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  484  GIKTVDVLTPKVIIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  543

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETL+GVLAG+LVSGVQIAISA
Sbjct  544  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLAGVLAGSLVSGVQIAISA  603

Query  543  S  545
            S
Sbjct  604  S  604



>ref|XP_006427441.1| hypothetical protein CICLE_v10024946mg [Citrus clementina]
 gb|ESR40681.1| hypothetical protein CICLE_v10024946mg [Citrus clementina]
Length=766

 Score =   344 bits (882),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  504  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  563

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I+TVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGT 
Sbjct  564  GITTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTT  623

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAG+LVSGVQIAISA
Sbjct  624  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQIAISA  683

Query  543  S  545
            S
Sbjct  684  S  684



>ref|XP_004241690.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Solanum lycopersicum]
Length=767

 Score =   344 bits (882),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  505  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  564

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTP+VFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEG A
Sbjct  565  SISTVDVLTPEVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGLA  624

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA
Sbjct  625  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  684

Query  543  S  545
            S
Sbjct  685  S  685



>gb|KDP37047.1| hypothetical protein JCGZ_06103 [Jatropha curcas]
Length=765

 Score =   344 bits (882),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  503  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  562

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGT 
Sbjct  563  SISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTT  622

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG FFGVETLSGVLAG+LVSGVQIAISA
Sbjct  623  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTFFGVETLSGVLAGSLVSGVQIAISA  682

Query  543  S  545
            S
Sbjct  683  S  683



>ref|XP_008801902.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Phoenix dactylifera]
Length=767

 Score =   344 bits (882),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  505  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  564

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGT 
Sbjct  565  AISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTV  624

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG FFGVETLSGVLAGALVSGVQIAISA
Sbjct  625  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTFFGVETLSGVLAGALVSGVQIAISA  684

Query  543  S  545
            S
Sbjct  685  S  685



>ref|XP_002273207.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Vitis vinifera]
 emb|CBI36393.3| unnamed protein product [Vitis vinifera]
Length=767

 Score =   344 bits (882),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  505  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  564

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEG A
Sbjct  565  SISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGLA  624

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG FFGVETLSGVLAG+LVSGVQIAISA
Sbjct  625  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTFFGVETLSGVLAGSLVSGVQIAISA  684

Query  543  S  545
            S
Sbjct  685  S  685



>gb|AEI17666.1| vacuolar H+-pyrophosphatase [Salicornia europaea]
Length=763

 Score =   343 bits (881),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSH IRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  500  PISDNAGGIAEMAGMSHHIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  559

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  560  SISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  619

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG FFGVETLSGVLAG+LVSGVQ+AISA
Sbjct  620  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTFFGVETLSGVLAGSLVSGVQVAISA  679

Query  543  S  545
            S
Sbjct  680  S  680



>ref|XP_010928300.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Elaeis guineensis]
Length=765

 Score =   343 bits (881),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  503  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  562

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGT 
Sbjct  563  SISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTT  622

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG FFGVETLSGVLAG+LVSGVQIAISA
Sbjct  623  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTFFGVETLSGVLAGSLVSGVQIAISA  682

Query  543  S  545
            S
Sbjct  683  S  683



>ref|XP_006492091.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1 [Citrus sinensis]
Length=766

 Score =   343 bits (881),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  504  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  563

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I+TVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGT 
Sbjct  564  GITTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTT  623

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAG+LVSGVQIAISA
Sbjct  624  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQIAISA  683

Query  543  S  545
            S
Sbjct  684  S  684



>ref|XP_008788803.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Phoenix dactylifera]
Length=765

 Score =   343 bits (881),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  503  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  562

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGT 
Sbjct  563  SISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTT  622

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG FFGVETLSGVLAG+LVSGVQIAISA
Sbjct  623  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTFFGVETLSGVLAGSLVSGVQIAISA  682

Query  543  S  545
            S
Sbjct  683  S  683



>ref|NP_001058184.1| Os06g0644200 [Oryza sativa Japonica Group]
 dbj|BAD37431.1| inorganic diphosphatase, H+-translocating, vacuolar membrane 
[Oryza sativa Japonica Group]
 dbj|BAF20098.1| Os06g0644200 [Oryza sativa Japonica Group]
 dbj|BAG94303.1| unnamed protein product [Oryza sativa Japonica Group]
Length=782

 Score =   344 bits (882),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  520  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  579

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN+IPGLMEGT 
Sbjct  580  AISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNSIPGLMEGTT  639

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVML+PLIVGIFFGVETLSG+LAGALVSGVQIAISA
Sbjct  640  KPDYATCVKISTDASIKEMIPPGALVMLSPLIVGIFFGVETLSGLLAGALVSGVQIAISA  699

Query  543  S  545
            S
Sbjct  700  S  700



>ref|XP_009765177.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Nicotiana sylvestris]
Length=769

 Score =   343 bits (881),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  507  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  566

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTP+VFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEG A
Sbjct  567  GISTVDVLTPQVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGLA  626

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA
Sbjct  627  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  686

Query  543  S  545
            S
Sbjct  687  S  687



>ref|XP_006350116.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Solanum tuberosum]
Length=769

 Score =   343 bits (881),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  507  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  566

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  567  GISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  626

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYA CVKISTDASIKEMIP GALVMLTPLIVGI FGVETLSGVLAG+LVSGVQIAISA
Sbjct  627  KPDYANCVKISTDASIKEMIPPGALVMLTPLIVGILFGVETLSGVLAGSLVSGVQIAISA  686

Query  543  S  545
            S
Sbjct  687  S  687



>dbj|BAA08232.1| vacuolar H+-pyrophosphatase [Oryza sativa (japonica cultivar-group)]
Length=771

 Score =   343 bits (881),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  509  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  568

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN+IPGLMEGT 
Sbjct  569  AISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNSIPGLMEGTT  628

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVML+PLIVGIFFGVETLSG+LAGALVSGVQIAISA
Sbjct  629  KPDYATCVKISTDASIKEMIPPGALVMLSPLIVGIFFGVETLSGLLAGALVSGVQIAISA  688

Query  543  S  545
            S
Sbjct  689  S  689



>emb|CAA54869.1| inorganic pyrophosphatase [Nicotiana tabacum]
Length=764

 Score =   343 bits (881),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  502  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  561

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTP+VFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEG A
Sbjct  562  GISTVDVLTPQVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGLA  621

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA
Sbjct  622  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  681

Query  543  S  545
            S
Sbjct  682  S  682



>ref|XP_010033979.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1 [Eucalyptus grandis]
 gb|KCW53849.1| hypothetical protein EUGRSUZ_J03081 [Eucalyptus grandis]
Length=769

 Score =   343 bits (881),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  507  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  566

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEG A
Sbjct  567  AISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGLA  626

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDAS+KEMIP GALVMLTPLIVGIFFGVETLSGVLAG+LVSGVQIAISA
Sbjct  627  KPDYATCVKISTDASLKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQIAISA  686

Query  543  S  545
            S
Sbjct  687  S  687



>gb|EEE66103.1| hypothetical protein OsJ_22136 [Oryza sativa Japonica Group]
Length=771

 Score =   343 bits (881),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  509  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  568

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN+IPGLMEGT 
Sbjct  569  AISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNSIPGLMEGTT  628

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVML+PLIVGIFFGVETLSG+LAGALVSGVQIAISA
Sbjct  629  KPDYATCVKISTDASIKEMIPPGALVMLSPLIVGIFFGVETLSGLLAGALVSGVQIAISA  688

Query  543  S  545
            S
Sbjct  689  S  689



>dbj|BAA23649.1| proton pyrophosphatase [Vigna radiata]
Length=766

 Score =   343 bits (881),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 172/181 (95%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  504  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  563

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I+TVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  564  SITTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  623

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPL+VGI FGVETLSGVLAG+LVSGVQIAISA
Sbjct  624  KPDYATCVKISTDASIKEMIPPGALVMLTPLVVGILFGVETLSGVLAGSLVSGVQIAISA  683

Query  543  S  545
            S
Sbjct  684  S  684



>gb|AAS66771.1| PPase [Hevea brasiliensis]
Length=769

 Score =   343 bits (881),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  507  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  566

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEG A
Sbjct  567  SISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGHA  626

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG FFGVETLSGVLAGALVSGVQIAISA
Sbjct  627  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTFFGVETLSGVLAGALVSGVQIAISA  686

Query  543  S  545
            S
Sbjct  687  S  687



>dbj|BAD02277.1| vacuolar proton pyrophosphatase [Oryza sativa Japonica Group]
Length=770

 Score =   343 bits (881),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  508  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  567

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGT 
Sbjct  568  AISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTT  627

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGI FGVETLSGVLAGALVSGVQIAISA
Sbjct  628  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGILFGVETLSGVLAGALVSGVQIAISA  687

Query  543  S  545
            S
Sbjct  688  S  688



>ref|XP_008793954.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Phoenix dactylifera]
Length=767

 Score =   343 bits (881),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 172/181 (95%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  505  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  564

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             +STVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  565  ALSTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  624

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASI+EMIP GALVMLTPLIVG FFGVETLSGVLAGALVSGVQ+AISA
Sbjct  625  KPDYATCVKISTDASIREMIPPGALVMLTPLIVGTFFGVETLSGVLAGALVSGVQVAISA  684

Query  543  S  545
            S
Sbjct  685  S  685



>ref|XP_009334631.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Pyrus x bretschneideri]
Length=767

 Score =   343 bits (881),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  505  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  564

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  565  AISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  624

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALV+LTPLIVG FFGVETLSGVLAG+LVSGVQIAISA
Sbjct  625  KPDYATCVKISTDASIKEMIPPGALVILTPLIVGTFFGVETLSGVLAGSLVSGVQIAISA  684

Query  543  S  545
            S
Sbjct  685  S  685



>dbj|BAA31523.1| ovp1 [Oryza sativa]
Length=771

 Score =   343 bits (881),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  509  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  568

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN+IPGLMEGT 
Sbjct  569  AISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNSIPGLMEGTT  628

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVML+PLIVGIFFGVETLSG+LAGALVSGVQIAISA
Sbjct  629  KPDYATCVKISTDASIKEMIPPGALVMLSPLIVGIFFGVETLSGLLAGALVSGVQIAISA  688

Query  543  S  545
            S
Sbjct  689  S  689



>gb|AAC49175.1| pyrophosphatase [Vigna radiata]
Length=765

 Score =   343 bits (880),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 172/181 (95%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  504  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  563

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I+TVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  564  SITTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  623

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPL+VGI FGVETLSGVLAG+LVSGVQIAISA
Sbjct  624  KPDYATCVKISTDASIKEMIPPGALVMLTPLVVGILFGVETLSGVLAGSLVSGVQIAISA  683

Query  543  S  545
            S
Sbjct  684  S  684



>ref|XP_007155080.1| hypothetical protein PHAVU_003G171500g [Phaseolus vulgaris]
 gb|ESW27074.1| hypothetical protein PHAVU_003G171500g [Phaseolus vulgaris]
Length=766

 Score =   343 bits (880),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  504  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  563

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I+TVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  564  SITTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  623

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGI FGVETLSGVLAG+LVSGVQIAISA
Sbjct  624  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGILFGVETLSGVLAGSLVSGVQIAISA  683

Query  543  S  545
            S
Sbjct  684  S  684



>sp|P21616.4|AVP_VIGRR RecName: Full=Pyrophosphate-energized vacuolar membrane proton 
pump; AltName: Full=Pyrophosphate-energized inorganic pyrophosphatase; 
Short=H(+)-PPase; AltName: Full=Vacuolar H(+)-pyrophosphatase 
[Vigna radiata var. radiata]
 pdb|4A01|A Chain A, Crystal Structure Of The H-Translocating Pyrophosphatase
 pdb|4A01|B Chain B, Crystal Structure Of The H-Translocating Pyrophosphatase
Length=766

 Score =   343 bits (880),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 172/181 (95%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  504  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  563

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I+TVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  564  SITTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  623

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPL+VGI FGVETLSGVLAG+LVSGVQIAISA
Sbjct  624  KPDYATCVKISTDASIKEMIPPGALVMLTPLVVGILFGVETLSGVLAGSLVSGVQIAISA  683

Query  543  S  545
            S
Sbjct  684  S  684



>dbj|BAD25066.1| putative inorganic diphosphatase [Oryza sativa Japonica Group]
 gb|EEE56454.1| hypothetical protein OsJ_05651 [Oryza sativa Japonica Group]
Length=770

 Score =   343 bits (881),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  508  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  567

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGT 
Sbjct  568  AISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTT  627

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGI FGVETLSGVLAGALVSGVQIAISA
Sbjct  628  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGILFGVETLSGVLAGALVSGVQIAISA  687

Query  543  S  545
            S
Sbjct  688  S  688



>gb|KDP30223.1| hypothetical protein JCGZ_17005 [Jatropha curcas]
Length=770

 Score =   343 bits (881),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  508  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  567

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  568  AISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  627

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGI FGVETLSGVLAG+LVSGVQIAISA
Sbjct  628  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGILFGVETLSGVLAGSLVSGVQIAISA  687

Query  543  S  545
            S
Sbjct  688  S  688



>ref|XP_006646987.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Oryza brachyantha]
Length=764

 Score =   343 bits (880),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  502  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  561

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGT 
Sbjct  562  AISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTT  621

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGI FGVETLSGVLAGALVSGVQIAISA
Sbjct  622  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGILFGVETLSGVLAGALVSGVQIAISA  681

Query  543  S  545
            S
Sbjct  682  S  682



>ref|XP_004951660.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
isoform X1 [Setaria italica]
Length=714

 Score =   342 bits (877),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  452  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  511

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVL+PKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGT 
Sbjct  512  AISTVDVLSPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTT  571

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGI FGVETLSGVLAGALVSGVQIAISA
Sbjct  572  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGILFGVETLSGVLAGALVSGVQIAISA  631

Query  543  S  545
            S
Sbjct  632  S  632



>ref|XP_003563306.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Brachypodium distachyon]
Length=773

 Score =   343 bits (881),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  511  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  570

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I+TVDVLTP VFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  571  GITTVDVLTPNVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  630

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG FFGVETLSGVLAGALVSGVQIAISA
Sbjct  631  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTFFGVETLSGVLAGALVSGVQIAISA  690

Query  543  S  545
            S
Sbjct  691  S  691



>gb|KHN15033.1| Pyrophosphate-energized vacuolar membrane proton pump [Glycine 
soja]
Length=732

 Score =   342 bits (878),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 172/181 (95%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  471  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  530

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I+TVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  531  AITTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  590

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPL+VGI FGVETLSGVLAG+LVSGVQIAISA
Sbjct  591  KPDYATCVKISTDASIKEMIPPGALVMLTPLVVGILFGVETLSGVLAGSLVSGVQIAISA  650

Query  543  S  545
            S
Sbjct  651  S  651



>ref|XP_010927355.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Elaeis guineensis]
Length=767

 Score =   343 bits (880),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 172/181 (95%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  505  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  564

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             +STVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN+IPGLMEG+A
Sbjct  565  ALSTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNSIPGLMEGSA  624

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG FFGVETLSGVLAGALVSGVQ+AISA
Sbjct  625  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTFFGVETLSGVLAGALVSGVQVAISA  684

Query  543  S  545
            S
Sbjct  685  S  685



>gb|ABF85694.1| inorganic pyrophosphatase [Nicotiana rustica]
Length=765

 Score =   343 bits (880),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  503  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  562

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I+TVDVLTP+VFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  563  AITTVDVLTPQVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  622

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPD+ATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA
Sbjct  623  KPDHATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  682

Query  543  S  545
            S
Sbjct  683  S  683



>ref|XP_011084078.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Sesamum indicum]
 ref|XP_011084079.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Sesamum indicum]
Length=823

 Score =   344 bits (883),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  561  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  620

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             IS+VDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGT 
Sbjct  621  AISSVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTT  680

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAG+LVSGVQIAISA
Sbjct  681  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQIAISA  740

Query  543  S  545
            S
Sbjct  741  S  741



>ref|XP_004251737.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Solanum lycopersicum]
Length=769

 Score =   343 bits (880),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  507  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  566

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  567  GISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  626

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYA CVKISTDASIKEMIP GALVMLTPLIVGI FGVETLSGVLAG+LVSGVQIAISA
Sbjct  627  KPDYANCVKISTDASIKEMIPPGALVMLTPLIVGILFGVETLSGVLAGSLVSGVQIAISA  686

Query  543  S  545
            S
Sbjct  687  S  687



>ref|XP_010687850.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Beta vulgaris subsp. vulgaris]
Length=764

 Score =   343 bits (879),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 172/181 (95%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  502  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  561

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I TVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGL+EGTA
Sbjct  562  SIQTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLLEGTA  621

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG FFGVETLSGVLAG+LVSGVQIAISA
Sbjct  622  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTFFGVETLSGVLAGSLVSGVQIAISA  681

Query  543  S  545
            S
Sbjct  682  S  682



>ref|XP_009418179.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Musa acuminata subsp. malaccensis]
Length=766

 Score =   343 bits (879),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 171/181 (94%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  504  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  563

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGLL+GAMLPYWFSAMTMKSVG AALKMVEEVRRQFNNIPG+MEG+A
Sbjct  564  TISTVDVLTPKVFIGLLIGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNNIPGIMEGSA  623

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPL+VG  FGVETLSGVLAG+LVSGVQIAISA
Sbjct  624  KPDYATCVKISTDASIKEMIPPGALVMLTPLVVGTLFGVETLSGVLAGSLVSGVQIAISA  683

Query  543  S  545
            S
Sbjct  684  S  684



>gb|EAZ01854.1| hypothetical protein OsI_23875 [Oryza sativa Indica Group]
Length=784

 Score =   343 bits (880),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  522  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  581

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN+IPGLMEGT 
Sbjct  582  AISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNSIPGLMEGTT  641

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVML+PLIVGIFFGVETLSG+LAGALVSGVQIAISA
Sbjct  642  KPDYATCVKISTDASIKEMIPPGALVMLSPLIVGIFFGVETLSGLLAGALVSGVQIAISA  701

Query  543  S  545
            S
Sbjct  702  S  702



>ref|XP_009336318.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Pyrus x bretschneideri]
 dbj|BAC41250.1| vacuolar proton-inorganic pyrophosphatase [Pyrus communis]
Length=767

 Score =   343 bits (879),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  505  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  564

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  565  AISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  624

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALV+LTPLIVG FFGVETLSGVLAG+LVSGVQIAISA
Sbjct  625  KPDYATCVKISTDASIKEMIPPGALVILTPLIVGTFFGVETLSGVLAGSLVSGVQIAISA  684

Query  543  S  545
            S
Sbjct  685  S  685



>ref|XP_004508424.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Cicer arietinum]
Length=765

 Score =   343 bits (879),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  504  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  563

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I+TVDVLTP+VFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  564  GIATVDVLTPRVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  623

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDY TCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAG+LVSGVQIAISA
Sbjct  624  KPDYHTCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQIAISA  683

Query  543  S  545
            S
Sbjct  684  S  684



>gb|KJB35139.1| hypothetical protein B456_006G102100 [Gossypium raimondii]
Length=766

 Score =   343 bits (879),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  504  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  563

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I+TVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEG A
Sbjct  564  AITTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGHA  623

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG FFGVETLSGVLAGALVSGVQIAISA
Sbjct  624  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTFFGVETLSGVLAGALVSGVQIAISA  683

Query  543  S  545
            S
Sbjct  684  S  684



>gb|KHG25943.1| Pyrophosphate-energized vacuolar membrane proton pump 1 -like 
protein [Gossypium arboreum]
Length=766

 Score =   343 bits (879),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  504  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  563

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I+TVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEG A
Sbjct  564  AITTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGHA  623

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG FFGVETLSGVLAGALVSGVQIAISA
Sbjct  624  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTFFGVETLSGVLAGALVSGVQIAISA  683

Query  543  S  545
            S
Sbjct  684  S  684



>gb|ADN96173.1| pyrophosphate-energized vacuolar membrane proton pump [Gossypium 
hirsutum]
Length=766

 Score =   342 bits (878),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  504  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  563

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I+TVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEG A
Sbjct  564  AITTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGHA  623

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG FFGVETLSGVLAGALVSGVQIAISA
Sbjct  624  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTFFGVETLSGVLAGALVSGVQIAISA  683

Query  543  S  545
            S
Sbjct  684  S  684



>ref|XP_010537929.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1 [Tarenaya hassleriana]
Length=769

 Score =   343 bits (879),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  507  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  566

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I TVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  567  AIQTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  626

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEM+P GALVMLTPLIVGI FGVETLSGVLAG+LVSGVQIAISA
Sbjct  627  KPDYATCVKISTDASIKEMLPPGALVMLTPLIVGILFGVETLSGVLAGSLVSGVQIAISA  686

Query  543  S  545
            S
Sbjct  687  S  687



>ref|XP_007204643.1| hypothetical protein PRUPE_ppa001782mg [Prunus persica]
 gb|EMJ05842.1| hypothetical protein PRUPE_ppa001782mg [Prunus persica]
Length=765

 Score =   342 bits (878),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  504  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  563

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVL+PKV IGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  564  GISTVDVLSPKVVIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  623

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAG+LVSGVQIAISA
Sbjct  624  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQIAISA  683

Query  543  S  545
            S
Sbjct  684  S  684



>ref|XP_009779977.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Nicotiana sylvestris]
Length=766

 Score =   342 bits (878),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  504  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  563

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  564  AISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  623

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMI  GALVMLTPLIVGI FGVETLSGVLAG+LVSGVQIAISA
Sbjct  624  KPDYATCVKISTDASIKEMIAPGALVMLTPLIVGILFGVETLSGVLAGSLVSGVQIAISA  683

Query  543  S  545
            S
Sbjct  684  S  684



>emb|CAA58700.1| inorganic pyrophosphatase [Nicotiana tabacum]
Length=766

 Score =   342 bits (878),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  504  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  563

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  564  AISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  623

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMI  GALVMLTPLIVGI FGVETLSGVLAG+LVSGVQIAISA
Sbjct  624  KPDYATCVKISTDASIKEMIAPGALVMLTPLIVGILFGVETLSGVLAGSLVSGVQIAISA  683

Query  543  S  545
            S
Sbjct  684  S  684



>ref|XP_009598387.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Nicotiana tomentosiformis]
Length=766

 Score =   342 bits (878),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  504  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  563

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  564  AISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  623

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMI  GALVMLTPLIVGI FGVETLSGVLAG+LVSGVQIAISA
Sbjct  624  KPDYATCVKISTDASIKEMIAPGALVMLTPLIVGILFGVETLSGVLAGSLVSGVQIAISA  683

Query  543  S  545
            S
Sbjct  684  S  684



>ref|XP_004951662.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
isoform X3 [Setaria italica]
Length=765

 Score =   342 bits (878),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  503  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  562

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVL+PKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGT 
Sbjct  563  AISTVDVLSPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTT  622

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGI FGVETLSGVLAGALVSGVQIAISA
Sbjct  623  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGILFGVETLSGVLAGALVSGVQIAISA  682

Query  543  S  545
            S
Sbjct  683  S  683



>ref|XP_003542656.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Glycine max]
 gb|KHN47114.1| Pyrophosphate-energized vacuolar membrane proton pump [Glycine 
soja]
Length=765

 Score =   342 bits (877),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 172/181 (95%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  504  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  563

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I+TVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  564  AITTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  623

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPL+VGI FGVETLSGVLAG+LVSGVQIAISA
Sbjct  624  KPDYATCVKISTDASIKEMIPPGALVMLTPLVVGILFGVETLSGVLAGSLVSGVQIAISA  683

Query  543  S  545
            S
Sbjct  684  S  684



>ref|XP_002453419.1| hypothetical protein SORBIDRAFT_04g005710 [Sorghum bicolor]
 gb|EES06395.1| hypothetical protein SORBIDRAFT_04g005710 [Sorghum bicolor]
Length=766

 Score =   342 bits (877),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALD+AGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  504  PISDNAGGIAEMAGMSHRIRERTDALDSAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  563

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGT 
Sbjct  564  AISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTT  623

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGI FGVETLSGVLAGALVSGVQIAISA
Sbjct  624  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGILFGVETLSGVLAGALVSGVQIAISA  683

Query  543  S  545
            S
Sbjct  684  S  684



>ref|XP_003609463.1| Vacuolar proton-inorganic pyrophosphatase [Medicago truncatula]
 gb|ACI22377.1| vacuolar-type H-pyrophosphatase [Medicago truncatula]
 gb|AES91660.1| vacuolar H+-translocating inorganic pyrophosphatase [Medicago 
truncatula]
Length=765

 Score =   342 bits (877),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  504  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  563

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I+TVDVLTPKVFIGLLVG+MLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  564  GITTVDVLTPKVFIGLLVGSMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  623

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCV ISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAG+LVSGVQIAISA
Sbjct  624  KPDYATCVTISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQIAISA  683

Query  543  S  545
            S
Sbjct  684  S  684



>ref|XP_003531725.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Glycine max]
Length=768

 Score =   342 bits (877),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  506  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  565

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I TVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEG A
Sbjct  566  GILTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGHA  625

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA
Sbjct  626  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  685

Query  543  S  545
            S
Sbjct  686  S  686



>gb|AFW66266.1| hypothetical protein ZEAMMB73_353171 [Zea mays]
Length=767

 Score =   342 bits (877),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  505  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  564

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGT 
Sbjct  565  AISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTT  624

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGI FGVETL+GVLAGALVSGVQIAISA
Sbjct  625  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGILFGVETLAGVLAGALVSGVQIAISA  684

Query  543  S  545
            S
Sbjct  685  S  685



>gb|AIS71988.1| vacuolar pyrophosphatase 1 [Haloxylon ammodendron]
Length=767

 Score =   342 bits (877),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 172/181 (95%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  505  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  564

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I+TVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  565  SITTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNEIPGLMEGTA  624

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEM+P GALVMLTPLIVG  FGVETLSGVLAG+LVSGVQIAISA
Sbjct  625  KPDYATCVKISTDASIKEMVPPGALVMLTPLIVGTLFGVETLSGVLAGSLVSGVQIAISA  684

Query  543  S  545
            S
Sbjct  685  S  685



>gb|AGT16227.1| vacuolar proton pyrophosphatase [Saccharum hybrid cultivar R570]
Length=771

 Score =   342 bits (877),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  509  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  568

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVL+PKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGT 
Sbjct  569  AISTVDVLSPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTT  628

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGI FGVETLSGVLAGALVSGVQIAISA
Sbjct  629  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGILFGVETLSGVLAGALVSGVQIAISA  688

Query  543  S  545
            S
Sbjct  689  S  689



>gb|AGT15917.1| vacuolar H+-pyrophosphatase [Saccharum hybrid cultivar R570]
 gb|AGT16391.1| vacuolar H+-pyrophosphatase [Saccharum hybrid cultivar R570]
Length=771

 Score =   342 bits (877),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  509  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  568

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVL+PKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGT 
Sbjct  569  AISTVDVLSPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTT  628

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGI FGVETLSGVLAGALVSGVQIAISA
Sbjct  629  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGILFGVETLSGVLAGALVSGVQIAISA  688

Query  543  S  545
            S
Sbjct  689  S  689



>gb|KHF98453.1| Pyrophosphate-energized vacuolar membrane proton pump [Gossypium 
arboreum]
Length=767

 Score =   342 bits (876),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  505  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  564

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGT 
Sbjct  565  AISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTT  624

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPL+VGI FGVETLSGVLAG+LVSGVQIAISA
Sbjct  625  KPDYATCVKISTDASIKEMIPPGALVMLTPLVVGISFGVETLSGVLAGSLVSGVQIAISA  684

Query  543  S  545
            S
Sbjct  685  S  685



>ref|XP_010541940.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Tarenaya hassleriana]
Length=765

 Score =   342 bits (876),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  503  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  562

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGT 
Sbjct  563  GISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTT  622

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG  FGVETLSGVLAG+LVSGVQIAISA
Sbjct  623  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGFLFGVETLSGVLAGSLVSGVQIAISA  682

Query  543  S  545
            S
Sbjct  683  S  683



>gb|AAM97920.1| vacuolar proton-pumping PPase [Oxybasis rubra]
 gb|AAM97921.1| vacuolar proton-pumping PPase [Oxybasis rubra]
Length=764

 Score =   342 bits (876),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  502  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  561

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  562  AISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNEIPGLMEGTA  621

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYA CVKISTDASIKEMIP GALVMLTPLIVG  FGVETLSGVLAG+LVSGVQIAISA
Sbjct  622  KPDYANCVKISTDASIKEMIPPGALVMLTPLIVGTLFGVETLSGVLAGSLVSGVQIAISA  681

Query  543  S  545
            S
Sbjct  682  S  682



>ref|XP_009363953.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Pyrus x bretschneideri]
Length=764

 Score =   342 bits (876),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  503  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  562

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I TVDVLTPKV IGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  563  GIKTVDVLTPKVIIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  622

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETL+GVLAG+LVSGVQIAISA
Sbjct  623  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLAGVLAGSLVSGVQIAISA  682

Query  543  S  545
            S
Sbjct  683  S  683



>ref|XP_002437341.1| hypothetical protein SORBIDRAFT_10g025280 [Sorghum bicolor]
 gb|EER88708.1| hypothetical protein SORBIDRAFT_10g025280 [Sorghum bicolor]
Length=772

 Score =   342 bits (876),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  510  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  569

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVL+PKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGT 
Sbjct  570  AISTVDVLSPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTT  629

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGI FGVETLSGVLAGALVSGVQIAISA
Sbjct  630  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGILFGVETLSGVLAGALVSGVQIAISA  689

Query  543  S  545
            S
Sbjct  690  S  690



>ref|XP_008343930.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Malus domestica]
Length=764

 Score =   342 bits (876),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  503  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  562

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I TVDVLTPKV IGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  563  GIKTVDVLTPKVIIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  622

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETL+GVLAG+LVSGVQIAISA
Sbjct  623  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLAGVLAGSLVSGVQIAISA  682

Query  543  S  545
            S
Sbjct  683  S  683



>ref|XP_010250265.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Nelumbo nucifera]
Length=765

 Score =   342 bits (876),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 172/181 (95%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  503  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  562

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEG A
Sbjct  563  SISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGHA  622

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG+ FGVETLSGVLAG+LVSGVQIAISA
Sbjct  623  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGVIFGVETLSGVLAGSLVSGVQIAISA  682

Query  543  S  545
            S
Sbjct  683  S  683



>gb|KHG11819.1| Pyrophosphate-energized vacuolar membrane proton pump 1 -like 
protein [Gossypium arboreum]
Length=666

 Score =   339 bits (869),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 172/181 (95%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSH IRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  404  PISDNAGGIAEMAGMSHHIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  463

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEG A
Sbjct  464  AISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGRA  523

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG FFGVETL+GVLAGALVSGVQIAISA
Sbjct  524  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTFFGVETLAGVLAGALVSGVQIAISA  583

Query  543  S  545
            S
Sbjct  584  S  584



>gb|KDO47419.1| hypothetical protein CISIN_1g0042302mg, partial [Citrus sinensis]
Length=599

 Score =   337 bits (864),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 167/176 (95%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  420  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  479

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I+TVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGT 
Sbjct  480  GITTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTT  539

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQI  530
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAG+LVSGVQ+
Sbjct  540  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQV  595



>ref|XP_009338516.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Pyrus x bretschneideri]
Length=767

 Score =   342 bits (876),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 172/181 (95%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  505  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  564

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGT 
Sbjct  565  AISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTT  624

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALV+LTPLIVG FFGVETLSGVLAG+LVSGVQIAISA
Sbjct  625  KPDYATCVKISTDASIKEMIPPGALVILTPLIVGTFFGVETLSGVLAGSLVSGVQIAISA  684

Query  543  S  545
            S
Sbjct  685  S  685



>ref|XP_009593516.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Nicotiana tomentosiformis]
Length=769

 Score =   342 bits (876),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  507  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  566

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTP+VFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEG  
Sbjct  567  GISTVDVLTPQVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGLV  626

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA
Sbjct  627  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  686

Query  543  S  545
            S
Sbjct  687  S  687



>ref|XP_007023297.1| Inorganic H pyrophosphatase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY25919.1| Inorganic H pyrophosphatase family protein isoform 1 [Theobroma 
cacao]
Length=768

 Score =   342 bits (876),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 172/181 (95%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  506  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  565

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEG A
Sbjct  566  AISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGHA  625

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            +PDY+TCVKISTDASIKEMIP GALVMLTPLIVG FFGVETLSGVLAGALVSGVQIAISA
Sbjct  626  RPDYSTCVKISTDASIKEMIPPGALVMLTPLIVGTFFGVETLSGVLAGALVSGVQIAISA  685

Query  543  S  545
            S
Sbjct  686  S  686



>gb|EMT15308.1| Pyrophosphate-energized vacuolar membrane proton pump 1 [Aegilops 
tauschii]
Length=812

 Score =   342 bits (878),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  550  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  609

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I+TVDVLTP VFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  610  GITTVDVLTPNVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  669

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG FFGVETLSGVLAGALVSGVQIAISA
Sbjct  670  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTFFGVETLSGVLAGALVSGVQIAISA  729

Query  543  S  545
            S
Sbjct  730  S  730



>ref|XP_004951661.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
isoform X2 [Setaria italica]
Length=795

 Score =   342 bits (877),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  533  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  592

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVL+PKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGT 
Sbjct  593  AISTVDVLSPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTT  652

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGI FGVETLSGVLAGALVSGVQIAISA
Sbjct  653  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGILFGVETLSGVLAGALVSGVQIAISA  712

Query  543  S  545
            S
Sbjct  713  S  713



>gb|KJB64657.1| hypothetical protein B456_010G059800 [Gossypium raimondii]
Length=733

 Score =   340 bits (873),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 170/180 (94%), Positives = 175/180 (97%), Gaps = 0/180 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  504  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  563

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  564  AISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  623

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAG+LVSGVQ+ +++
Sbjct  624  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQVMLTS  683



>ref|XP_009358552.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Pyrus x bretschneideri]
Length=767

 Score =   341 bits (875),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  506  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  565

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I TVDVLTPKV IGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  566  GIETVDVLTPKVIIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  625

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETL+GVLAG+LVSGVQIAISA
Sbjct  626  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLAGVLAGSLVSGVQIAISA  685

Query  543  S  545
            S
Sbjct  686  S  686



>ref|XP_008242846.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Prunus mume]
Length=765

 Score =   341 bits (875),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  504  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  563

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVL+PKV IGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGL+EGTA
Sbjct  564  GISTVDVLSPKVVIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLLEGTA  623

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAG+LVSGVQIAISA
Sbjct  624  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQIAISA  683

Query  543  S  545
            S
Sbjct  684  S  684



>gb|AAP06752.1| vacuolar proton-inorganic pyrophosphatase [Hordeum brevisubulatum]
Length=773

 Score =   341 bits (875),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  511  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  570

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I+TVDVLTP VFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  571  GITTVDVLTPNVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  630

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDAS KEMIP GALVMLTPLIVG FFGVETLSGVLAGALVSGVQIAISA
Sbjct  631  KPDYATCVKISTDASTKEMIPPGALVMLTPLIVGTFFGVETLSGVLAGALVSGVQIAISA  690

Query  543  S  545
            S
Sbjct  691  S  691



>gb|ABX10014.1| vacuolar H+-pyrophosphatase [Triticum aestivum]
Length=775

 Score =   342 bits (876),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  513  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  572

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I+TVDVLTP VFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  573  GITTVDVLTPNVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  632

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTD SIKEMIP GALVMLTPLIVG FFGVETLSGVLAGALVSGVQIAISA
Sbjct  633  KPDYATCVKISTDTSIKEMIPPGALVMLTPLIVGTFFGVETLSGVLAGALVSGVQIAISA  692

Query  543  S  545
            S
Sbjct  693  S  693



>ref|XP_008352108.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Malus domestica]
Length=767

 Score =   341 bits (875),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  506  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  565

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I TVDVLTPKV IGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  566  GIETVDVLTPKVIIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  625

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETL+GVLAG+LVSGVQIAISA
Sbjct  626  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLAGVLAGSLVSGVQIAISA  685

Query  543  S  545
            S
Sbjct  686  S  686



>dbj|BAJ91598.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=771

 Score =   341 bits (875),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  509  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  568

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I+TVDVLTP VFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  569  GITTVDVLTPNVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  628

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG  FGVETLSGVLAGALVSGVQIAISA
Sbjct  629  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTLFGVETLSGVLAGALVSGVQIAISA  688

Query  543  S  545
            S
Sbjct  689  S  689



>gb|ADQ00196.1| vacuolar H+-PPase protein [Suaeda corniculata]
Length=764

 Score =   341 bits (875),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 172/181 (95%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  502  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  561

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I+TVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  562  SITTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  621

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYA CVKISTDASIKEMIP GALVMLTPLIVG  FGVETLSGVLAG+LVSGVQIAISA
Sbjct  622  KPDYANCVKISTDASIKEMIPPGALVMLTPLIVGTLFGVETLSGVLAGSLVSGVQIAISA  681

Query  543  S  545
            S
Sbjct  682  S  682



>dbj|BAB18681.1| vacuolar proton-inorganic pyrophosphatase [Hordeum vulgare subsp. 
vulgare]
Length=771

 Score =   341 bits (875),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  509  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  568

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I+TVDVLTP VFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  569  GITTVDVLTPNVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  628

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG  FGVETLSGVLAGALVSGVQIAISA
Sbjct  629  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTLFGVETLSGVLAGALVSGVQIAISA  688

Query  543  S  545
            S
Sbjct  689  S  689



>gb|KHN38003.1| Pyrophosphate-energized vacuolar membrane proton pump [Glycine 
soja]
Length=764

 Score =   341 bits (874),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  502  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  561

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I TVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEG A
Sbjct  562  GILTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGHA  621

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAG+LVSGVQIAISA
Sbjct  622  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQIAISA  681

Query  543  S  545
            S
Sbjct  682  S  682



>ref|XP_010097186.1| Pyrophosphate-energized vacuolar membrane proton pump [Morus 
notabilis]
 gb|EXB67253.1| Pyrophosphate-energized vacuolar membrane proton pump [Morus 
notabilis]
Length=765

 Score =   341 bits (874),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 172/181 (95%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  503  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  562

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEG A
Sbjct  563  AISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGHA  622

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDAS+KEMIP GALVMLTPLIVG FFGVETLSGVLAG+LVSGVQIAISA
Sbjct  623  KPDYATCVKISTDASLKEMIPPGALVMLTPLIVGTFFGVETLSGVLAGSLVSGVQIAISA  682

Query  543  S  545
            S
Sbjct  683  S  683



>ref|NP_001105380.1| vacuolar proton pump homolog1 [Zea mays]
 emb|CAG29369.1| vacuolar H+-translocating inorganic pyrophosphatase [Zea mays]
Length=766

 Score =   340 bits (873),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 172/181 (95%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSL LFGAFVSRA
Sbjct  504  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLRLFGAFVSRA  563

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTP+VFIGL+VGAMLPYWFSAMTMKS+G AALKMVEEVRRQFNNIPGLMEGT 
Sbjct  564  AISTVDVLTPEVFIGLIVGAMLPYWFSAMTMKSMGSAALKMVEEVRRQFNNIPGLMEGTT  623

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGI FGVETLSGVLAGALVSGVQIAISA
Sbjct  624  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGILFGVETLSGVLAGALVSGVQIAISA  683

Query  543  S  545
            S
Sbjct  684  S  684



>emb|CDO98179.1| unnamed protein product [Coffea canephora]
Length=762

 Score =   340 bits (873),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 172/181 (95%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  501  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  560

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             +STVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEG A
Sbjct  561  GVSTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGRA  620

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG FFGVETLSGVLAG+LVSGVQIAISA
Sbjct  621  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTFFGVETLSGVLAGSLVSGVQIAISA  680

Query  543  S  545
            S
Sbjct  681  S  681



>gb|KDO47418.1| hypothetical protein CISIN_1g0042302mg, partial [Citrus sinensis]
Length=597

 Score =   336 bits (861),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 167/175 (95%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  420  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  479

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I+TVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGT 
Sbjct  480  GITTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTT  539

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQ  527
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAG+LVSGVQ
Sbjct  540  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQ  594



>ref|XP_010539519.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like [Tarenaya hassleriana]
Length=769

 Score =   340 bits (873),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 172/181 (95%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  507  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  566

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I TVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  567  AIQTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  626

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEM+P GALVMLTPLIVG  FGVETLSGVLAG+LVSGVQIAISA
Sbjct  627  KPDYATCVKISTDASIKEMLPPGALVMLTPLIVGTLFGVETLSGVLAGSLVSGVQIAISA  686

Query  543  S  545
            S
Sbjct  687  S  687



>ref|XP_010497310.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like [Camelina sativa]
Length=766

 Score =   340 bits (873),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 172/181 (95%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  504  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  563

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I TVDVLTPKV IGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  564  GIHTVDVLTPKVIIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  623

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP G LVMLTPLIVG FFGVETLSGVLAG+LVSGVQIAISA
Sbjct  624  KPDYATCVKISTDASIKEMIPPGCLVMLTPLIVGFFFGVETLSGVLAGSLVSGVQIAISA  683

Query  543  S  545
            S
Sbjct  684  S  684



>ref|XP_010476656.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1 [Camelina sativa]
Length=766

 Score =   340 bits (873),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 172/181 (95%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  504  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  563

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I TVDVLTPKV IGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  564  GIHTVDVLTPKVIIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  623

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP G LVMLTPLIVG FFGVETLSGVLAG+LVSGVQIAISA
Sbjct  624  KPDYATCVKISTDASIKEMIPPGCLVMLTPLIVGFFFGVETLSGVLAGSLVSGVQIAISA  683

Query  543  S  545
            S
Sbjct  684  S  684



>ref|XP_010905999.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Elaeis guineensis]
Length=767

 Score =   340 bits (872),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 171/181 (94%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  505  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  564

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN+IPGL+EGT 
Sbjct  565  AISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNSIPGLLEGTV  624

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            +PDYATCVKISTDASI+EMIP GALVMLTPLIVG FFGVETLSGVLAGALVSGVQIAISA
Sbjct  625  RPDYATCVKISTDASIREMIPPGALVMLTPLIVGTFFGVETLSGVLAGALVSGVQIAISA  684

Query  543  S  545
            S
Sbjct  685  S  685



>ref|XP_010459106.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like [Camelina sativa]
Length=766

 Score =   340 bits (872),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 172/181 (95%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  504  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  563

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I TVDVLTPKV IGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  564  GIHTVDVLTPKVIIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  623

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP G LVMLTPLIVG FFGVETLSGVLAG+LVSGVQIAISA
Sbjct  624  KPDYATCVKISTDASIKEMIPPGCLVMLTPLIVGFFFGVETLSGVLAGSLVSGVQIAISA  683

Query  543  S  545
            S
Sbjct  684  S  684



>ref|XP_011073387.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Sesamum indicum]
Length=765

 Score =   340 bits (872),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 172/181 (95%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  503  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  562

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             IS VDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEG A
Sbjct  563  AISKVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGHA  622

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG FFGVETLSGVLAG+LVSGVQIAISA
Sbjct  623  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTFFGVETLSGVLAGSLVSGVQIAISA  682

Query  543  S  545
            S
Sbjct  683  S  683



>gb|EYU21676.1| hypothetical protein MIMGU_mgv1a001720mg [Erythranthe guttata]
Length=769

 Score =   340 bits (872),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 170/181 (94%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  507  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  566

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
            EI TVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPG+MEGTA
Sbjct  567  EIKTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGIMEGTA  626

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYA CVKISTDASIKEMIP G LVMLTPLIVG FFGVETL+GVLAGALVSGVQ+AISA
Sbjct  627  KPDYARCVKISTDASIKEMIPPGCLVMLTPLIVGTFFGVETLAGVLAGALVSGVQVAISA  686

Query  543  S  545
            S
Sbjct  687  S  687



>gb|AHZ97880.1| vacuolar H+-pyrophosphatase [Olimarabidopsis pumila]
Length=770

 Score =   340 bits (872),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 172/181 (95%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  508  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  567

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I TVDVLTPKV IGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  568  GIHTVDVLTPKVIIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  627

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP G LVMLTPLIVG FFGVETLSGVLAG+LVSGVQIAISA
Sbjct  628  KPDYATCVKISTDASIKEMIPPGCLVMLTPLIVGFFFGVETLSGVLAGSLVSGVQIAISA  687

Query  543  S  545
            S
Sbjct  688  S  688



>gb|KJB23659.1| hypothetical protein B456_004G108700 [Gossypium raimondii]
Length=707

 Score =   338 bits (868),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 169/180 (94%), Positives = 175/180 (97%), Gaps = 0/180 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  509  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  568

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGT+
Sbjct  569  AISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTS  628

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAG+LVSGVQ+ +++
Sbjct  629  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQVMLAS  688



>dbj|BAA33149.1| proton-translocating inorganic pyrophosphatase [Cucurbita moschata]
Length=768

 Score =   340 bits (872),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 171/181 (94%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  506  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  565

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ++ VDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  566  GVTAVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  625

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGI FGVETLSGVLAG+LVSGVQIAISA
Sbjct  626  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGILFGVETLSGVLAGSLVSGVQIAISA  685

Query  543  S  545
            S
Sbjct  686  S  686



>ref|XP_008228676.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Prunus mume]
Length=767

 Score =   340 bits (872),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 171/181 (94%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  505  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  564

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  565  AISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  624

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALV+LTPLIVG  FGVETLSGVLAG+LVSGVQ+AISA
Sbjct  625  KPDYATCVKISTDASIKEMIPPGALVILTPLIVGTLFGVETLSGVLAGSLVSGVQVAISA  684

Query  543  S  545
            S
Sbjct  685  S  685



>gb|KFK43817.1| hypothetical protein AALP_AA1G177100 [Arabis alpina]
Length=771

 Score =   340 bits (872),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 172/181 (95%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  508  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  567

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I TVDVLTPKV IGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  568  GIHTVDVLTPKVIIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  627

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP G LVMLTPLIVG FFGVETLSGVLAG+LVSGVQIAISA
Sbjct  628  KPDYATCVKISTDASIKEMIPPGCLVMLTPLIVGFFFGVETLSGVLAGSLVSGVQIAISA  687

Query  543  S  545
            S
Sbjct  688  S  688



>dbj|BAA32210.1| Vacuolar proton pyrophosphatase [Arabidopsis thaliana]
Length=770

 Score =   340 bits (872),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 172/181 (95%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  508  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  567

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I TVDVLTPKV IGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  568  GIHTVDVLTPKVIIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  627

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP G LVMLTPLIVG FFGVETLSGVLAG+LVSGVQIAISA
Sbjct  628  KPDYATCVKISTDASIKEMIPPGCLVMLTPLIVGFFFGVETLSGVLAGSLVSGVQIAISA  687

Query  543  S  545
            S
Sbjct  688  S  688



>ref|XP_006306837.1| hypothetical protein CARUB_v10008378mg [Capsella rubella]
 gb|EOA39735.1| hypothetical protein CARUB_v10008378mg [Capsella rubella]
Length=766

 Score =   340 bits (871),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 172/181 (95%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  504  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  563

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I TVDVLTPKV IGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  564  GIHTVDVLTPKVIIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  623

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP G LVMLTPLIVG FFGVETLSGVLAG+LVSGVQIAISA
Sbjct  624  KPDYATCVKISTDASIKEMIPPGCLVMLTPLIVGFFFGVETLSGVLAGSLVSGVQIAISA  683

Query  543  S  545
            S
Sbjct  684  S  684



>ref|NP_173021.1| Pyrophosphate-energized vacuolar membrane proton pump 1 [Arabidopsis 
thaliana]
 sp|P31414.1|AVP1_ARATH RecName: Full=Pyrophosphate-energized vacuolar membrane proton 
pump 1; AltName: Full=Pyrophosphate-energized inorganic pyrophosphatase 
1; Short=H(+)-PPase 1; AltName: Full=Vacuolar 
proton pyrophosphatase 1; AltName: Full=Vacuolar proton pyrophosphatase 
3 [Arabidopsis thaliana]
 gb|AAF82139.1|AC034256_3 Identical to Vacuolar proton pyrophosphatase (AVP3) from Arabidopsis 
thaliana gb|AB015138 and gb|M81892. ESTs gb|AA006922, 
gb|AA586042, gb|AA651053, gb|AA712863, gb|AA394384, gb|AA605347, 
gb|AA006474, gb|AA006772, gb|AA650817, gb|AA042538, gb|AA006217, 
gb|AW004149, gb|H36252, gb|H36659, gb|R30444, gb|W43600, 
gb|W43886, gb|W43517, gb|W43127, gb|N96656, gb|T14167, 
gb|T76140, gb|T21188, gb|Z17694, gb|Z17695 come from this 
gene [Arabidopsis thaliana]
 gb|AAA32754.1| vacuolar H+-phosphatase [Arabidopsis thaliana]
 gb|AAO00841.1| Unknown protein [Arabidopsis thaliana]
 gb|AEE29349.1| Pyrophosphate-energized vacuolar membrane proton pump 1 [Arabidopsis 
thaliana]
Length=770

 Score =   340 bits (872),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 172/181 (95%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  508  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  567

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I TVDVLTPKV IGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  568  GIHTVDVLTPKVIIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  627

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP G LVMLTPLIVG FFGVETLSGVLAG+LVSGVQIAISA
Sbjct  628  KPDYATCVKISTDASIKEMIPPGCLVMLTPLIVGFFFGVETLSGVLAGSLVSGVQIAISA  687

Query  543  S  545
            S
Sbjct  688  S  688



>ref|XP_009385121.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Musa acuminata subsp. malaccensis]
Length=771

 Score =   340 bits (872),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 169/181 (93%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSH+IRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  505  PISDNAGGIAEMAGMSHKIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  564

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL++GAMLPYWFSAMTMKSVG AALKMV+EVRRQFN+IPGLMEG+A
Sbjct  565  AISTVDVLTPKVFIGLIIGAMLPYWFSAMTMKSVGSAALKMVQEVRRQFNSIPGLMEGSA  624

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPL+VG FFGVETLSGVLAG+LVSGVQIAISA
Sbjct  625  KPDYATCVKISTDASIKEMIPPGALVMLTPLVVGTFFGVETLSGVLAGSLVSGVQIAISA  684

Query  543  S  545
            S
Sbjct  685  S  685



>gb|KJB56580.1| hypothetical protein B456_009G126900 [Gossypium raimondii]
 gb|KJB56581.1| hypothetical protein B456_009G126900 [Gossypium raimondii]
Length=766

 Score =   340 bits (871),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 172/181 (95%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSH IRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  504  PISDNAGGIAEMAGMSHHIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  563

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEG A
Sbjct  564  AISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGRA  623

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG FFGVETL+GVLAGALVSGVQIAISA
Sbjct  624  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTFFGVETLAGVLAGALVSGVQIAISA  683

Query  543  S  545
            S
Sbjct  684  S  684



>gb|AGT16998.1| diphosphatase [Saccharum hybrid cultivar R570]
Length=771

 Score =   340 bits (871),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 171/181 (94%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  509  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  568

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVL+PKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPG+MEGT 
Sbjct  569  AISTVDVLSPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGIMEGTT  628

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP G+LVMLTPLIVGI FGVETLSGVLAGALVSGVQIAISA
Sbjct  629  KPDYATCVKISTDASIKEMIPPGSLVMLTPLIVGILFGVETLSGVLAGALVSGVQIAISA  688

Query  543  S  545
            S
Sbjct  689  S  689



>ref|XP_002890120.1| vacuolar-type H+-pumping pyrophosphatase 1 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH66379.1| vacuolar-type H+-pumping pyrophosphatase 1 [Arabidopsis lyrata 
subsp. lyrata]
Length=770

 Score =   340 bits (871),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 172/181 (95%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  508  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  567

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I TVDVLTPKV IGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  568  GIHTVDVLTPKVIIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  627

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP G LVMLTPLIVG FFGVETLSGVLAG+LVSGVQIAISA
Sbjct  628  KPDYATCVKISTDASIKEMIPPGCLVMLTPLIVGFFFGVETLSGVLAGSLVSGVQIAISA  687

Query  543  S  545
            S
Sbjct  688  S  688



>ref|XP_006416887.1| hypothetical protein EUTSA_v10006869mg [Eutrema salsugineum]
 gb|ESQ35240.1| hypothetical protein EUTSA_v10006869mg [Eutrema salsugineum]
Length=771

 Score =   340 bits (871),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 171/181 (94%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  509  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  568

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             + TVDVLTPKV IGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  569  GVHTVDVLTPKVIIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  628

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP G LVMLTPLIVG FFGVETLSGVLAG+LVSGVQIAISA
Sbjct  629  KPDYATCVKISTDASIKEMIPPGCLVMLTPLIVGFFFGVETLSGVLAGSLVSGVQIAISA  688

Query  543  S  545
            S
Sbjct  689  S  689



>ref|XP_007217159.1| hypothetical protein PRUPE_ppa001776mg [Prunus persica]
 gb|EMJ18358.1| hypothetical protein PRUPE_ppa001776mg [Prunus persica]
Length=767

 Score =   340 bits (871),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 171/181 (94%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  505  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  564

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  565  AISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  624

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALV+LTPLIVG  FGVETLSGVLAG+LVSGVQ+AISA
Sbjct  625  KPDYATCVKISTDASIKEMIPPGALVILTPLIVGTLFGVETLSGVLAGSLVSGVQVAISA  684

Query  543  S  545
            S
Sbjct  685  S  685



>ref|NP_001268155.1| vacuolar pyrophosphatase [Vitis vinifera]
 emb|CAD89675.2| vacuolar pyrophosphatase [Vitis vinifera]
Length=764

 Score =   340 bits (871),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 172/181 (95%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  501  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  560

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  561  AISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  620

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG   GVETL+GVLAG+LVSGVQIAISA
Sbjct  621  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTLLGVETLAGVLAGSLVSGVQIAISA  680

Query  543  S  545
            S
Sbjct  681  S  681



>emb|CAN65456.1| hypothetical protein VITISV_035221 [Vitis vinifera]
Length=764

 Score =   340 bits (871),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 172/181 (95%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  501  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  560

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  561  AISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  620

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG   GVETL+GVLAG+LVSGVQIAISA
Sbjct  621  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTLLGVETLAGVLAGSLVSGVQIAISA  680

Query  543  S  545
            S
Sbjct  681  S  681



>gb|AAR08913.2| pyrophosphate-energized vacuolar membrane proton pump [Eutrema 
salsugineum]
Length=771

 Score =   340 bits (871),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 171/181 (94%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  509  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  568

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             + TVDVLTPKV IGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  569  GVHTVDVLTPKVIIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  628

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP G LVMLTPLIVG FFGVETLSGVLAG+LVSGVQIAISA
Sbjct  629  KPDYATCVKISTDASIKEMIPPGCLVMLTPLIVGFFFGVETLSGVLAGSLVSGVQIAISA  688

Query  543  S  545
            S
Sbjct  689  S  689



>ref|XP_009117814.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1 [Brassica rapa]
Length=768

 Score =   340 bits (871),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 171/181 (94%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  506  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  565

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             + TVDVLTPKV IGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  566  GVHTVDVLTPKVIIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  625

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP G LVMLTPLIVG FFGVETLSGVLAG+LVSGVQIAISA
Sbjct  626  KPDYATCVKISTDASIKEMIPPGCLVMLTPLIVGFFFGVETLSGVLAGSLVSGVQIAISA  685

Query  543  S  545
            S
Sbjct  686  S  686



>gb|AGJ81362.1| vacuolar H+ pyrophosphatase 1 [Brassica napus]
Length=768

 Score =   340 bits (871),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 171/181 (94%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  506  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  565

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             + TVDVLTPKV IGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  566  GVHTVDVLTPKVIIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  625

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP G LVMLTPLIVG FFGVETLSGVLAG+LVSGVQIAISA
Sbjct  626  KPDYATCVKISTDASIKEMIPPGCLVMLTPLIVGFFFGVETLSGVLAGSLVSGVQIAISA  685

Query  543  S  545
            S
Sbjct  686  S  686



>ref|XP_008679906.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Zea mays]
Length=859

 Score =   342 bits (876),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  597  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  656

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGT 
Sbjct  657  AISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTT  716

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGI FGVETL+GVLAGALVSGVQIAISA
Sbjct  717  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGILFGVETLAGVLAGALVSGVQIAISA  776

Query  543  S  545
            S
Sbjct  777  S  777



>gb|AES91661.2| vacuolar H+-translocating inorganic pyrophosphatase [Medicago 
truncatula]
Length=624

 Score =   335 bits (860),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 167/176 (95%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  413  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  472

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I+TVDVLTPKVFIGLLVG+MLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  473  GITTVDVLTPKVFIGLLVGSMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  532

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQI  530
            KPDYATCV ISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAG+LVSGVQ+
Sbjct  533  KPDYATCVTISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQV  588



>emb|CBI25554.3| unnamed protein product [Vitis vinifera]
Length=764

 Score =   339 bits (870),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 172/181 (95%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  501  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  560

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  561  AISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  620

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG   GVETL+GVLAG+LVSGVQIAISA
Sbjct  621  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTLLGVETLAGVLAGSLVSGVQIAISA  680

Query  543  S  545
            S
Sbjct  681  S  681



>emb|CDX83972.1| BnaC08g16730D [Brassica napus]
Length=769

 Score =   339 bits (870),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 171/181 (94%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  507  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  566

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             + TVDVLTPKV IGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  567  GVHTVDVLTPKVIIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  626

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP G LVMLTPLIVG FFGVETLSGVLAG+LVSGVQIAISA
Sbjct  627  KPDYATCVKISTDASIKEMIPPGCLVMLTPLIVGFFFGVETLSGVLAGSLVSGVQIAISA  686

Query  543  S  545
            S
Sbjct  687  S  687



>gb|KFK42469.1| hypothetical protein AALP_AA2G261100 [Arabis alpina]
Length=769

 Score =   339 bits (870),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 171/181 (94%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  506  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  565

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I TVDVLTPKV IGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  566  GIQTVDVLTPKVVIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  625

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP G LVMLTPLIVGIFFGVETLSGVL G+L+SGVQIAISA
Sbjct  626  KPDYATCVKISTDASIKEMIPPGCLVMLTPLIVGIFFGVETLSGVLTGSLISGVQIAISA  685

Query  543  S  545
            S
Sbjct  686  S  686



>dbj|BAE98517.1| hypothetical protein [Arabidopsis thaliana]
Length=767

 Score =   339 bits (870),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 172/181 (95%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  505  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  564

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I TVDVLTPKV IGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  565  GIHTVDVLTPKVIIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  624

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP G LVMLTPLIVG FFGVETLSGVLAG+LVSGVQIAISA
Sbjct  625  KPDYATCVKISTDASIKEMIPPGCLVMLTPLIVGFFFGVETLSGVLAGSLVSGVQIAISA  684

Query  543  S  545
            S
Sbjct  685  S  685



>emb|CDX96835.1| BnaA08g23780D [Brassica napus]
Length=769

 Score =   339 bits (870),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 171/181 (94%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  507  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  566

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             + TVDVLTPKV IGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  567  GVHTVDVLTPKVIIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  626

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP G LVMLTPLIVG FFGVETLSGVLAG+LVSGVQIAISA
Sbjct  627  KPDYATCVKISTDASIKEMIPPGCLVMLTPLIVGFFFGVETLSGVLAGSLVSGVQIAISA  686

Query  543  S  545
            S
Sbjct  687  S  687



>ref|XP_006389422.1| Pyrophosphate-energized vacuolar membrane proton pump family 
protein [Populus trichocarpa]
 gb|ABK95131.1| unknown [Populus trichocarpa]
 gb|ERP48336.1| Pyrophosphate-energized vacuolar membrane proton pump family 
protein [Populus trichocarpa]
Length=768

 Score =   339 bits (870),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  506  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  565

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEV RQFN IPGLMEGTA
Sbjct  566  AISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVCRQFNTIPGLMEGTA  625

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMI  GALVMLTPLIVGIFFGVETLSGVLAG+LVSGVQIAISA
Sbjct  626  KPDYATCVKISTDASIKEMIAPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQIAISA  685

Query  543  S  545
            S
Sbjct  686  S  686



>ref|XP_003564217.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Brachypodium distachyon]
Length=762

 Score =   339 bits (870),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 170/181 (94%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  500  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  559

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             +  VDVL+PKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  560  GVKVVDVLSPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  619

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPL+VG FFGVETLSGVLAGALVSGVQIAISA
Sbjct  620  KPDYATCVKISTDASIKEMIPPGALVMLTPLVVGTFFGVETLSGVLAGALVSGVQIAISA  679

Query  543  S  545
            S
Sbjct  680  S  680



>ref|NP_001288904.1| uncharacterized protein LOC103836019 [Brassica rapa]
 gb|AET95910.1| AVP1-1 [Brassica rapa]
Length=769

 Score =   339 bits (870),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 171/181 (94%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  507  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  566

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             + TVDVLTPKV IGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  567  GVHTVDVLTPKVIIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  626

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP G LVMLTPLIVG FFGVETLSGVLAG+LVSGVQIAISA
Sbjct  627  KPDYATCVKISTDASIKEMIPPGCLVMLTPLIVGFFFGVETLSGVLAGSLVSGVQIAISA  686

Query  543  S  545
            S
Sbjct  687  S  687



>gb|EYU24628.1| hypothetical protein MIMGU_mgv1a001756mg [Erythranthe guttata]
Length=764

 Score =   339 bits (870),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 170/181 (94%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  503  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  562

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I+ VDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  563  GITKVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNEIPGLMEGTA  622

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDAS++EMIP GALVMLTPLIVG FFGVETLSGVLAG+L+SGVQIAISA
Sbjct  623  KPDYATCVKISTDASLREMIPPGALVMLTPLIVGTFFGVETLSGVLAGSLISGVQIAISA  682

Query  543  S  545
            S
Sbjct  683  S  683



>gb|AEI17665.1| vacuolar H+-pyrophosphatase [Salicornia europaea]
Length=764

 Score =   339 bits (869),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 172/181 (95%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSH IRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  502  PISDNAGGIAEMAGMSHSIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  561

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  562  SISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  621

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYA CVKISTDASIKEMIP GALVMLTPLIVG  FGVETLSGVLAG+LVSGVQIAISA
Sbjct  622  KPDYANCVKISTDASIKEMIPPGALVMLTPLIVGTLFGVETLSGVLAGSLVSGVQIAISA  681

Query  543  S  545
            S
Sbjct  682  S  682



>emb|CAN69652.1| hypothetical protein VITISV_010537 [Vitis vinifera]
Length=443

 Score =   330 bits (845),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 164/181 (91%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSH+IR+RTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  181  PISDNAGGIAEMAGMSHKIRQRTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  240

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I TVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEG A
Sbjct  241  GIETVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGRA  300

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDAS++EMIP GALVMLTPLI G  FGVETL+GVLAG+LVSGVQ+AISA
Sbjct  301  KPDYATCVKISTDASLREMIPPGALVMLTPLIAGTLFGVETLAGVLAGSLVSGVQVAISA  360

Query  543  S  545
            S
Sbjct  361  S  361



>ref|NP_001288927.1| uncharacterized protein LOC103832483 [Brassica rapa]
 gb|AET95911.1| AVP1-2 [Brassica rapa]
Length=769

 Score =   339 bits (869),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 171/181 (94%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  506  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  565

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             + TVDVLTPKV IGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  566  GVQTVDVLTPKVVIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  625

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP G LVMLTPLIVG FFGVETLSGVLAG+LVSGVQIAISA
Sbjct  626  KPDYATCVKISTDASIKEMIPPGCLVMLTPLIVGFFFGVETLSGVLAGSLVSGVQIAISA  685

Query  543  S  545
            S
Sbjct  686  S  686



>emb|CDX87313.1| BnaA07g35600D [Brassica napus]
Length=769

 Score =   339 bits (869),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 171/181 (94%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  506  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  565

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             + TVDVLTPKV IGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  566  GVQTVDVLTPKVVIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  625

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP G LVMLTPLIVG FFGVETLSGVLAG+LVSGVQIAISA
Sbjct  626  KPDYATCVKISTDASIKEMIPPGCLVMLTPLIVGFFFGVETLSGVLAGSLVSGVQIAISA  685

Query  543  S  545
            S
Sbjct  686  S  686



>ref|XP_006427442.1| hypothetical protein CICLE_v10024946mg [Citrus clementina]
 gb|ESR40682.1| hypothetical protein CICLE_v10024946mg [Citrus clementina]
Length=683

 Score =   337 bits (863),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 167/176 (95%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  504  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  563

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I+TVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGT 
Sbjct  564  GITTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTT  623

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQI  530
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAG+LVSGVQ+
Sbjct  624  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQV  679



>emb|CDY36581.1| BnaA06g10340D [Brassica napus]
Length=771

 Score =   339 bits (869),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 171/181 (94%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  509  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  568

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             + TVDVLTPKV IGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  569  GVHTVDVLTPKVIIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  628

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP G LVMLTPLIVG FFGVETLSGVLAG+LVSGVQIAISA
Sbjct  629  KPDYATCVKISTDASIKEMIPPGCLVMLTPLIVGFFFGVETLSGVLAGSLVSGVQIAISA  688

Query  543  S  545
            S
Sbjct  689  S  689



>gb|EPS59584.1| pyrophosphate-energized vacuolar membrane proton pump, partial 
[Genlisea aurea]
Length=599

 Score =   334 bits (857),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 164/176 (93%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRE TDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  424  PISDNAGGIAEMAGMSHRIRETTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  483

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
            ++S+VDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGL+EGTA
Sbjct  484  DVSSVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLIEGTA  543

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQI  530
            KPDYATCVKISTDASI+EMIP GALVMLTPL+VGIFFGVETLSGVLAGALVSGVQ+
Sbjct  544  KPDYATCVKISTDASIREMIPPGALVMLTPLVVGIFFGVETLSGVLAGALVSGVQV  599



>emb|CDY53310.1| BnaA09g56670D [Brassica napus]
Length=802

 Score =   340 bits (871),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 171/181 (94%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  506  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  565

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             + TVDVLTPKV IGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  566  GVHTVDVLTPKVIIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  625

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP G LVMLTPLIVG FFGVETLSGVLAG+LVSGVQIAISA
Sbjct  626  KPDYATCVKISTDASIKEMIPPGCLVMLTPLIVGFFFGVETLSGVLAGSLVSGVQIAISA  685

Query  543  S  545
            S
Sbjct  686  S  686



>dbj|BAF63470.1| vacuolar proton-pyrophosphatase [Potamogeton distinctus]
Length=767

 Score =   338 bits (868),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 169/181 (93%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALD+AGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  505  PISDNAGGIAEMAGMSHRIRERTDALDSAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  564

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             IS+VDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGT 
Sbjct  565  AISSVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTV  624

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            +PDYA+CVKISTDASI+EMIP GALVMLTPLIVG FFGVETLSGVLAGALVSGVQIAISA
Sbjct  625  RPDYASCVKISTDASIREMIPPGALVMLTPLIVGTFFGVETLSGVLAGALVSGVQIAISA  684

Query  543  S  545
            S
Sbjct  685  S  685



>gb|AET95912.1| PHP1 [Lagenaria siceraria]
Length=768

 Score =   338 bits (868),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 171/181 (94%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  506  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  565

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             +  VDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  566  GVHVVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  625

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGI FGVETLSGVLAG+LVSGVQIAISA
Sbjct  626  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGILFGVETLSGVLAGSLVSGVQIAISA  685

Query  543  S  545
            S
Sbjct  686  S  686



>ref|XP_009392139.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Musa acuminata subsp. malaccensis]
Length=766

 Score =   338 bits (868),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 170/181 (94%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSR+
Sbjct  504  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRS  563

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN+IPGLMEG+A
Sbjct  564  AISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNSIPGLMEGSA  623

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYA CVKISTDASI+EMIP GALVMLTPLIVG  FGVETLSGVLAG+LVSGVQIAISA
Sbjct  624  KPDYANCVKISTDASIREMIPPGALVMLTPLIVGTLFGVETLSGVLAGSLVSGVQIAISA  683

Query  543  S  545
            S
Sbjct  684  S  684



>ref|XP_009407207.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Musa acuminata subsp. malaccensis]
Length=766

 Score =   338 bits (868),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 170/181 (94%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  504  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  563

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN+IPG+MEG A
Sbjct  564  AISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNSIPGIMEGNA  623

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASI+EMIP GALVMLTPLIVG  FGVETL+GVLAGALVSGVQIAISA
Sbjct  624  KPDYATCVKISTDASIREMIPPGALVMLTPLIVGTLFGVETLAGVLAGALVSGVQIAISA  683

Query  543  S  545
            S
Sbjct  684  S  684



>ref|XP_010429951.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like isoform X1 [Camelina sativa]
 ref|XP_010429952.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like isoform X2 [Camelina sativa]
Length=769

 Score =   338 bits (868),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 171/181 (94%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  506  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  565

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I TVDVLTPKV IGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  566  GIHTVDVLTPKVVIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  625

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP G LVMLTPLIVG FFGVETLSGVLAG+L+SGVQIAISA
Sbjct  626  KPDYATCVKISTDASIKEMIPPGCLVMLTPLIVGFFFGVETLSGVLAGSLISGVQIAISA  685

Query  543  S  545
            S
Sbjct  686  S  686



>ref|XP_010244912.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Nelumbo nucifera]
Length=765

 Score =   338 bits (867),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 170/181 (94%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  503  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  562

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             IS VDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN+IPG+MEGT 
Sbjct  563  AISAVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNSIPGIMEGTT  622

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG+ FGVETLSGVLAG+LVSGVQIAISA
Sbjct  623  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGVIFGVETLSGVLAGSLVSGVQIAISA  682

Query  543  S  545
            S
Sbjct  683  S  683



>ref|XP_009403196.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Musa acuminata subsp. malaccensis]
Length=763

 Score =   338 bits (867),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 169/181 (93%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  501  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  560

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLM+G+ 
Sbjct  561  AISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMDGST  620

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            +PDYATCVKISTDASIKEMIP GALV+LTPLIVG FFGVETLSGVLAG+LVSGVQIAISA
Sbjct  621  RPDYATCVKISTDASIKEMIPPGALVLLTPLIVGTFFGVETLSGVLAGSLVSGVQIAISA  680

Query  543  S  545
            S
Sbjct  681  S  681



>gb|AAL57660.1| At1g15690/F7H2_3 [Arabidopsis thaliana]
Length=770

 Score =   338 bits (867),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 171/181 (94%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  508  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  567

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I TVDVLTPKV IGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLM+GTA
Sbjct  568  GIHTVDVLTPKVIIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMKGTA  627

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP G LVMLTPLIVG FFGVETLSGVLAG+LVSGVQIAISA
Sbjct  628  KPDYATCVKISTDASIKEMIPPGCLVMLTPLIVGFFFGVETLSGVLAGSLVSGVQIAISA  687

Query  543  S  545
            S
Sbjct  688  S  688



>gb|ABD98735.1| vacuolar H+-pyrophosphatase [Oxybasis glauca]
Length=763

 Score =   338 bits (866),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 171/181 (94%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSH IRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  501  PISDNAGGIAEMAGMSHSIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  560

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGT 
Sbjct  561  AISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNEIPGLMEGTT  620

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYA CVKISTDASIKEMIP GALVMLTPLIVG  FGVETLSGVLAG+LVSGVQIAISA
Sbjct  621  KPDYANCVKISTDASIKEMIPPGALVMLTPLIVGTLFGVETLSGVLAGSLVSGVQIAISA  680

Query  543  S  545
            S
Sbjct  681  S  681



>gb|AAA61610.1| pyrophosphatase [Beta vulgaris]
Length=765

 Score =   338 bits (866),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 170/181 (94%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  503  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  562

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I TVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEV +QFN IPGL+EGTA
Sbjct  563  SIQTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVPKQFNTIPGLLEGTA  622

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG FFGVETLSGVLAG+LVSGVQIAISA
Sbjct  623  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTFFGVETLSGVLAGSLVSGVQIAISA  682

Query  543  S  545
            S
Sbjct  683  S  683



>gb|AAL84953.1| At1g15690/F7H2_3 [Arabidopsis thaliana]
Length=770

 Score =   338 bits (866),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 171/181 (94%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  508  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  567

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I TVDVLTPKV IGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  568  GIHTVDVLTPKVIIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  627

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP G LVMLTPLIVG FFGVETLSGVLAG+LVSGVQIA SA
Sbjct  628  KPDYATCVKISTDASIKEMIPPGCLVMLTPLIVGFFFGVETLSGVLAGSLVSGVQIATSA  687

Query  543  S  545
            S
Sbjct  688  S  688



>gb|AGQ50316.1| vaculoar H+ pyrophosphatase [Prosopis juliflora]
Length=764

 Score =   338 bits (866),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 170/181 (94%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  502  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  561

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPG++EG +
Sbjct  562  AISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGIIEGHS  621

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG FFGVETLSGVLAG+LVSG QIAISA
Sbjct  622  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTFFGVETLSGVLAGSLVSGAQIAISA  681

Query  543  S  545
            S
Sbjct  682  S  682



>emb|CDY39975.1| BnaC06g40530D [Brassica napus]
Length=769

 Score =   338 bits (866),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 169/181 (93%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  506  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  565

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             + TVDVLTPKV IGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  566  GVQTVDVLTPKVVIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  625

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP G LVMLTPLIVG FFGVETLSGVLAG+LVSGVQ+A+SA
Sbjct  626  KPDYATCVKISTDASIKEMIPPGCLVMLTPLIVGFFFGVETLSGVLAGSLVSGVQVALSA  685

Query  543  S  545
            S
Sbjct  686  S  686



>ref|NP_001266772.1| uncharacterized protein LOC101027208 [Zea mays]
 gb|ACN33286.1| unknown [Zea mays]
 gb|ACR36585.1| unknown [Zea mays]
Length=762

 Score =   337 bits (865),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 170/181 (94%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  500  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  559

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             +  VDVL+PKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  560  GVKVVDVLSPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  619

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG  FGVETLSGVLAGALVSGVQIAISA
Sbjct  620  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTLFGVETLSGVLAGALVSGVQIAISA  679

Query  543  S  545
            S
Sbjct  680  S  680



>ref|XP_004303283.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Fragaria vesca subsp. vesca]
Length=767

 Score =   338 bits (866),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 170/181 (94%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  505  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  564

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEG A
Sbjct  565  AISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGLA  624

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALV+LTPLIVG  FGVETLSGVLAG+LVSGVQ+AISA
Sbjct  625  KPDYATCVKISTDASIKEMIPPGALVILTPLIVGTLFGVETLSGVLAGSLVSGVQVAISA  684

Query  543  S  545
            S
Sbjct  685  S  685



>ref|XP_004150506.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Cucumis sativus]
 gb|KGN65098.1| hypothetical protein Csa_1G212840 [Cucumis sativus]
Length=768

 Score =   338 bits (866),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 170/181 (94%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  506  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  565

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             +  VD+LTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  566  GVVVVDLLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  625

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGI FGVETLSGVLAG+LVSGVQIAISA
Sbjct  626  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGILFGVETLSGVLAGSLVSGVQIAISA  685

Query  543  S  545
            S
Sbjct  686  S  686



>ref|XP_008443926.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Cucumis melo]
Length=768

 Score =   337 bits (865),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 170/181 (94%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  506  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  565

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             +  VD+LTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  566  GVVVVDLLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  625

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGI FGVETLSGVLAG+LVSGVQIAISA
Sbjct  626  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGILFGVETLSGVLAGSLVSGVQIAISA  685

Query  543  S  545
            S
Sbjct  686  S  686



>gb|ABO45933.1| vacuolar H+-pyrophosphatase [Halostachys caspica]
Length=764

 Score =   337 bits (865),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 171/181 (94%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSH+IRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  502  PISDNAGGIAEMAGMSHKIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  561

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  562  SISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  621

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KP YA CVKISTDASIKEMIP GALVMLTPLIVG  FGVETLSGVLAG+LVSGVQIAISA
Sbjct  622  KPGYANCVKISTDASIKEMIPPGALVMLTPLIVGTLFGVETLSGVLAGSLVSGVQIAISA  681

Query  543  S  545
            S
Sbjct  682  S  682



>emb|CDY33390.1| BnaC05g11930D [Brassica napus]
Length=771

 Score =   338 bits (866),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 170/181 (94%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEM GMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  509  PISDNAGGIAEMVGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  568

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             + TVDVLTPKV IGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  569  GVHTVDVLTPKVIIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  628

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP G LVMLTPLIVG FFGVETLSGVLAG+LVSGVQIAISA
Sbjct  629  KPDYATCVKISTDASIKEMIPPGCLVMLTPLIVGFFFGVETLSGVLAGSLVSGVQIAISA  688

Query  543  S  545
            S
Sbjct  689  S  689



>gb|AFW85592.1| vacuolar proton pump-like protein [Zea mays]
Length=762

 Score =   337 bits (865),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 170/181 (94%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  500  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  559

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             +  VDVL+PKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  560  GVKVVDVLSPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  619

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG  FGVETLSGVLAGALVSGVQIAISA
Sbjct  620  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTLFGVETLSGVLAGALVSGVQIAISA  679

Query  543  S  545
            S
Sbjct  680  S  680



>gb|EMT29715.1| Pyrophosphate-energized vacuolar membrane proton pump [Aegilops 
tauschii]
Length=761

 Score =   337 bits (864),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 170/181 (94%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  499  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  558

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             +  VDVL+PKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  559  GVKVVDVLSPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  618

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG  FGVETLSGVLAGALVSGVQIAISA
Sbjct  619  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTLFGVETLSGVLAGALVSGVQIAISA  678

Query  543  S  545
            S
Sbjct  679  S  679



>gb|ACA63883.1| vacuolar proton-inorganic pyrophosphatase [Hordeum vulgare]
Length=762

 Score =   337 bits (864),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 170/181 (94%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  500  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  559

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             +  VDVL+PKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  560  GVKVVDVLSPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  619

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG  FGVETLSGVLAGALVSGVQIAISA
Sbjct  620  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTLFGVETLSGVLAGALVSGVQIAISA  679

Query  543  S  545
            S
Sbjct  680  S  680



>ref|XP_007013601.1| Inorganic H pyrophosphatase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY31220.1| Inorganic H pyrophosphatase family protein isoform 2 [Theobroma 
cacao]
Length=734

 Score =   336 bits (862),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 168/175 (96%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  508  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  567

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEG+A
Sbjct  568  AISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGSA  627

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQ  527
            KPDYATCVKISTDASIKEMIP GALVMLTPL+VGIFFGVETLSGVLAG+LVSGVQ
Sbjct  628  KPDYATCVKISTDASIKEMIPPGALVMLTPLLVGIFFGVETLSGVLAGSLVSGVQ  682



>ref|XP_006852851.1| hypothetical protein AMTR_s00033p00195690 [Amborella trichopoda]
 gb|ERN14318.1| hypothetical protein AMTR_s00033p00195690 [Amborella trichopoda]
Length=765

 Score =   337 bits (864),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 170/181 (94%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  503  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  562

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTV+VL+PKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEG A
Sbjct  563  AISTVNVLSPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGLA  622

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG  FGVETLSGVLAG+LVSGVQIAISA
Sbjct  623  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTLFGVETLSGVLAGSLVSGVQIAISA  682

Query  543  S  545
            S
Sbjct  683  S  683



>sp|Q06572.2|AVP_HORVU RecName: Full=Pyrophosphate-energized vacuolar membrane proton 
pump; AltName: Full=Pyrophosphate-energized inorganic pyrophosphatase; 
Short=H(+)-PPase [Hordeum vulgare]
 dbj|BAA02717.2| inorganic pyrophosphatase [Hordeum vulgare subsp. vulgare]
Length=762

 Score =   337 bits (864),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 170/181 (94%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  500  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  559

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             +  VDVL+PKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  560  GVKVVDVLSPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  619

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG  FGVETLSGVLAGALVSGVQIAISA
Sbjct  620  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTLFGVETLSGVLAGALVSGVQIAISA  679

Query  543  S  545
            S
Sbjct  680  S  680



>dbj|BAJ88084.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=762

 Score =   337 bits (864),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 170/181 (94%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  500  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  559

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             +  VDVL+PKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  560  GVKVVDVLSPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  619

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG  FGVETLSGVLAGALVSGVQIAISA
Sbjct  620  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTLFGVETLSGVLAGALVSGVQIAISA  679

Query  543  S  545
            S
Sbjct  680  S  680



>ref|XP_010472923.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like [Camelina sativa]
Length=769

 Score =   337 bits (864),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 170/181 (94%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  506  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  565

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I TVDVLTPKV IGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  566  GIQTVDVLTPKVVIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  625

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP G LVMLTPLIVG FFGVETLSGVLAG+L+SGVQIAI A
Sbjct  626  KPDYATCVKISTDASIKEMIPPGCLVMLTPLIVGFFFGVETLSGVLAGSLISGVQIAIFA  685

Query  543  S  545
            S
Sbjct  686  S  686



>ref|XP_007023298.1| Inorganic H pyrophosphatase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY25920.1| Inorganic H pyrophosphatase family protein isoform 2 [Theobroma 
cacao]
Length=769

 Score =   337 bits (864),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 172/182 (95%), Positives = 175/182 (96%), Gaps = 1/182 (1%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  506  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  565

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEG A
Sbjct  566  AISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGHA  625

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGV-QIAIS  539
            +PDY+TCVKISTDASIKEMIP GALVMLTPLIVG FFGVETLSGVLAGALVSGV QIAIS
Sbjct  626  RPDYSTCVKISTDASIKEMIPPGALVMLTPLIVGTFFGVETLSGVLAGALVSGVQQIAIS  685

Query  540  AS  545
            AS
Sbjct  686  AS  687



>gb|EPS68114.1| inorganic pyrophosphatase, partial [Genlisea aurea]
Length=765

 Score =   337 bits (863),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 171/181 (94%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGM+H IRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  505  PISDNAGGIAEMAGMAHDIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  564

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  565  GISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  624

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG  FGVETLSGVLAG+LVSGVQIAISA
Sbjct  625  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTIFGVETLSGVLAGSLVSGVQIAISA  684

Query  543  S  545
            S
Sbjct  685  S  685



>ref|XP_010417704.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like [Camelina sativa]
Length=769

 Score =   337 bits (863),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 170/181 (94%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  506  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  565

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I TVDVLTPKV IGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  566  GIQTVDVLTPKVVIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  625

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP G LVMLTPLIVG FFGVETLSGVLAG+L+SGVQIAI A
Sbjct  626  KPDYATCVKISTDASIKEMIPPGCLVMLTPLIVGFFFGVETLSGVLAGSLISGVQIAIFA  685

Query  543  S  545
            S
Sbjct  686  S  686



>ref|XP_003609464.1| Vacuolar proton-inorganic pyrophosphatase [Medicago truncatula]
Length=715

 Score =   335 bits (859),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 167/176 (95%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  504  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  563

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I+TVDVLTPKVFIGLLVG+MLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  564  GITTVDVLTPKVFIGLLVGSMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  623

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQI  530
            KPDYATCV ISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAG+LVSGVQ+
Sbjct  624  KPDYATCVTISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQV  679



>gb|EMS65629.1| Pyrophosphate-energized vacuolar membrane proton pump [Triticum 
urartu]
Length=762

 Score =   336 bits (862),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 169/181 (93%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  500  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  559

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             +  VDVL+PKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  560  GVKVVDVLSPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  619

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASI+EMIP GALVMLTPLIVG  FGVETLSGVLAGALVSGVQIAISA
Sbjct  620  KPDYATCVKISTDASIREMIPPGALVMLTPLIVGTLFGVETLSGVLAGALVSGVQIAISA  679

Query  543  S  545
            S
Sbjct  680  S  680



>ref|XP_008245918.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like [Prunus mume]
Length=759

 Score =   336 bits (862),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 168/181 (93%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSH IRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGA+VSRA
Sbjct  497  PISDNAGGIAEMAGMSHEIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAYVSRA  556

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I TVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  557  GIETVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  616

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDAS+KEMIP GALVMLTPLI G FFGVETL+G+LAG+LVSGVQIAISA
Sbjct  617  KPDYATCVKISTDASLKEMIPPGALVMLTPLIAGTFFGVETLAGILAGSLVSGVQIAISA  676

Query  543  S  545
            S
Sbjct  677  S  677



>ref|XP_006300952.1| hypothetical protein CARUB_v10021340mg [Capsella rubella]
 gb|EOA33850.1| hypothetical protein CARUB_v10021340mg [Capsella rubella]
Length=780

 Score =   337 bits (863),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 170/181 (94%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  517  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  576

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I  VDVLTPKV IGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  577  GIHKVDVLTPKVVIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  636

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP G LVMLTPLIVG FFGVETLSGVLAG+L+SGVQIAISA
Sbjct  637  KPDYATCVKISTDASIKEMIPPGCLVMLTPLIVGFFFGVETLSGVLAGSLISGVQIAISA  696

Query  543  S  545
            S
Sbjct  697  S  697



>gb|ADD51840.1| pyrophosphatase [Cucumis sativus]
Length=768

 Score =   336 bits (862),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 169/181 (93%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  506  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  565

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             +  +D+LTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  566  GVVVLDLLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  625

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGI FGVETLSGVLAG+LVSGVQIAISA
Sbjct  626  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGILFGVETLSGVLAGSLVSGVQIAISA  685

Query  543  S  545
            S
Sbjct  686  S  686



>ref|XP_008359855.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1 [Malus domestica]
Length=759

 Score =   336 bits (862),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 168/181 (93%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSH IRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGA+VSRA
Sbjct  497  PISDNAGGIAEMAGMSHEIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAYVSRA  556

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I TVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  557  GIETVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  616

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDAS+KEMIP GALVMLTPLI G FFGVETL+G+LAG+LVSGVQIAISA
Sbjct  617  KPDYATCVKISTDASLKEMIPPGALVMLTPLIAGTFFGVETLAGILAGSLVSGVQIAISA  676

Query  543  S  545
            S
Sbjct  677  S  677



>ref|XP_007208066.1| hypothetical protein PRUPE_ppa001833mg [Prunus persica]
 gb|EMJ09265.1| hypothetical protein PRUPE_ppa001833mg [Prunus persica]
Length=759

 Score =   336 bits (862),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 168/181 (93%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSH IRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGA+VSRA
Sbjct  497  PISDNAGGIAEMAGMSHEIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAYVSRA  556

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I TVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  557  GIETVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  616

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDAS+KEMIP GALVMLTPLI G FFGVETL+G+LAG+LVSGVQIAISA
Sbjct  617  KPDYATCVKISTDASLKEMIPPGALVMLTPLIAGTFFGVETLAGILAGSLVSGVQIAISA  676

Query  543  S  545
            S
Sbjct  677  S  677



>gb|AAL11507.1|AF367447_1 vacuolar H+-pyrophosphatase [Prunus persica]
Length=759

 Score =   336 bits (862),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 168/181 (93%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSH IRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGA+VSRA
Sbjct  497  PISDNAGGIAEMAGMSHEIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAYVSRA  556

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I TVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  557  GIETVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  616

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDAS+KEMIP GALVMLTPLI G FFGVETL+G+LAG+LVSGVQIAISA
Sbjct  617  KPDYATCVKISTDASLKEMIPPGALVMLTPLIAGTFFGVETLAGILAGSLVSGVQIAISA  676

Query  543  S  545
            S
Sbjct  677  S  677



>ref|XP_006389797.1| hypothetical protein EUTSA_v10018163mg [Eutrema salsugineum]
 gb|ESQ27083.1| hypothetical protein EUTSA_v10018163mg [Eutrema salsugineum]
Length=768

 Score =   336 bits (862),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 170/181 (94%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  505  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  564

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I  VDVLTPKV IGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  565  GIERVDVLTPKVVIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  624

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP G LVMLTPLIVG FFGVETLSGVLAG+L+SGVQIAISA
Sbjct  625  KPDYATCVKISTDASIKEMIPPGCLVMLTPLIVGFFFGVETLSGVLAGSLISGVQIAISA  684

Query  543  S  545
            S
Sbjct  685  S  685



>ref|XP_002517682.1| Pyrophosphate-energized vacuolar membrane proton pump, putative 
[Ricinus communis]
 gb|EEF44846.1| Pyrophosphate-energized vacuolar membrane proton pump, putative 
[Ricinus communis]
Length=1051

 Score =   342 bits (878),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  425  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  484

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEG A
Sbjct  485  AISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGHA  544

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG FFGVETLSGVLAG+LVSGVQIAISA
Sbjct  545  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTFFGVETLSGVLAGSLVSGVQIAISA  604

Query  543  S  545
            S
Sbjct  605  S  605



>ref|XP_009373278.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like [Pyrus x bretschneideri]
Length=759

 Score =   336 bits (861),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 168/181 (93%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSH IRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGA+VSRA
Sbjct  497  PISDNAGGIAEMAGMSHEIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAYVSRA  556

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I TVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  557  GIETVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  616

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDAS+KEMIP GALVMLTPLI G FFGVETL+G+LAG+LVSGVQIAISA
Sbjct  617  KPDYATCVKISTDASLKEMIPPGALVMLTPLIAGTFFGVETLAGILAGSLVSGVQIAISA  676

Query  543  S  545
            S
Sbjct  677  S  677



>ref|XP_009630145.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like isoform X2 [Nicotiana tomentosiformis]
Length=698

 Score =   334 bits (856),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 166/181 (92%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSH IRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGA+VSRA
Sbjct  499  PISDNAGGIAEMAGMSHSIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAYVSRA  558

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I TVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN+IPGLMEGTA
Sbjct  559  GIKTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNSIPGLMEGTA  618

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDAS++EMIP GALVMLTPLI G FFGVETL+GVLAG+LVSGVQ+AISA
Sbjct  619  KPDYATCVKISTDASLREMIPPGALVMLTPLIAGTFFGVETLAGVLAGSLVSGVQVAISA  678

Query  543  S  545
            S
Sbjct  679  S  679



>gb|ACT98610.2| vacuolar proton-inorganic pyrophosphatase [Diplachne fusca]
Length=763

 Score =   335 bits (860),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 169/181 (93%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAA VSLALFGAFVSRA
Sbjct  501  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAAFVSLALFGAFVSRA  560

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             +  VDVL+PKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  561  GVKVVDVLSPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  620

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG  FGVETLSGVLAGALVSGVQIAISA
Sbjct  621  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTLFGVETLSGVLAGALVSGVQIAISA  680

Query  543  S  545
            S
Sbjct  681  S  681



>ref|XP_004964695.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Setaria italica]
Length=762

 Score =   335 bits (860),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 169/181 (93%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  500  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  559

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             +  VDVL+PKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGT 
Sbjct  560  GVKVVDVLSPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTG  619

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG  FGVETLSGVLAGALVSGVQIAISA
Sbjct  620  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTLFGVETLSGVLAGALVSGVQIAISA  679

Query  543  S  545
            S
Sbjct  680  S  680



>ref|XP_006427443.1| hypothetical protein CICLE_v10024946mg [Citrus clementina]
 gb|ESR40683.1| hypothetical protein CICLE_v10024946mg [Citrus clementina]
Length=746

 Score =   335 bits (859),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 167/175 (95%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  504  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  563

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I+TVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGT 
Sbjct  564  GITTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTT  623

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQ  527
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVGIFFGVETLSGVLAG+LVSGVQ
Sbjct  624  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQ  678



>gb|AFW77130.1| hypothetical protein ZEAMMB73_840165 [Zea mays]
Length=819

 Score =   337 bits (863),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 170/181 (94%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  501  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  560

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             +  VDVL+PKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  561  GVKVVDVLSPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  620

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG  FGVETLSGVLAGALVSGVQIAISA
Sbjct  621  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTLFGVETLSGVLAGALVSGVQIAISA  680

Query  543  S  545
            S
Sbjct  681  S  681



>ref|NP_001056966.1| Os06g0178900 [Oryza sativa Japonica Group]
 dbj|BAA08233.1| vacuolar H+-pyrophosphatase [Oryza sativa (japonica cultivar-group)]
 dbj|BAA31524.1| ovp2 [Oryza sativa]
 dbj|BAC22237.1| putative inorganic pyrophosphatase [Oryza sativa Japonica Group]
 dbj|BAF18880.1| Os06g0178900 [Oryza sativa Japonica Group]
 gb|EAY99896.1| hypothetical protein OsI_21891 [Oryza sativa Indica Group]
 gb|EAZ36023.1| hypothetical protein OsJ_20329 [Oryza sativa Japonica Group]
 dbj|BAG90185.1| unnamed protein product [Oryza sativa Japonica Group]
Length=767

 Score =   335 bits (860),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 169/181 (93%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  505  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  564

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             +  VDVL+PKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN+IPGLMEGT 
Sbjct  565  GVKVVDVLSPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNSIPGLMEGTG  624

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG  FGVETLSGVLAGALVSGVQIAISA
Sbjct  625  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTLFGVETLSGVLAGALVSGVQIAISA  684

Query  543  S  545
            S
Sbjct  685  S  685



>ref|XP_009763189.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like isoform X1 [Nicotiana sylvestris]
Length=667

 Score =   333 bits (853),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 166/181 (92%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSH IRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGA+VSRA
Sbjct  405  PISDNAGGIAEMAGMSHSIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAYVSRA  464

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I TVDVL PKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN+IPGLMEGTA
Sbjct  465  GIKTVDVLAPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNSIPGLMEGTA  524

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDAS+KEMIP GALVMLTPLI G FFGVETL+GVLAG+LVSGVQ+AISA
Sbjct  525  KPDYATCVKISTDASLKEMIPPGALVMLTPLIAGTFFGVETLAGVLAGSLVSGVQVAISA  584

Query  543  S  545
            S
Sbjct  585  S  585



>gb|ADJ67258.1| vaculor H+-pyrophosphatase [Sorghum bicolor]
Length=763

 Score =   335 bits (859),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 169/181 (93%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  501  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  560

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ++ VDVL+PKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVR QFN IPGLMEGTA
Sbjct  561  GVTVVDVLSPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRTQFNTIPGLMEGTA  620

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG  FGVETLSGVLAGALVSGVQIAISA
Sbjct  621  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTLFGVETLSGVLAGALVSGVQIAISA  680

Query  543  S  545
            S
Sbjct  681  S  681



>gb|ABK91685.1| vacuolar H+-pyrophosphatase [Kalidium foliatum]
Length=764

 Score =   335 bits (858),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 170/181 (94%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  502  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  561

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGLLVGAMLPYWFSA TMKSVG  ALKMVE VRRQFN IPGLMEGTA
Sbjct  562  SISTVDVLTPKVFIGLLVGAMLPYWFSATTMKSVGSVALKMVEGVRRQFNTIPGLMEGTA  621

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYA CVKISTDASIKEMIP GALVMLTPLIVG  FGVETLSGVLAG+LVSGVQIAISA
Sbjct  622  KPDYANCVKISTDASIKEMIPPGALVMLTPLIVGTLFGVETLSGVLAGSLVSGVQIAISA  681

Query  543  S  545
            S
Sbjct  682  S  682



>ref|XP_006344755.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like [Solanum tuberosum]
Length=761

 Score =   335 bits (858),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 167/181 (92%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSH IRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGA+VSRA
Sbjct  499  PISDNAGGIAEMAGMSHSIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAYVSRA  558

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             I TVDVL+PKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN+IPGLMEGTA
Sbjct  559  GIKTVDVLSPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNSIPGLMEGTA  618

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDAS+KEMIP GALVMLTPLI G FFGVETL+GVLAG+LVSGVQ+AISA
Sbjct  619  KPDYATCVKISTDASLKEMIPPGALVMLTPLIAGTFFGVETLAGVLAGSLVSGVQVAISA  678

Query  543  S  545
            S
Sbjct  679  S  679



>ref|XP_006656699.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Oryza brachyantha]
Length=801

 Score =   335 bits (860),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 169/181 (93%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  539  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  598

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             +  VDVL+PKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGT 
Sbjct  599  GVKVVDVLSPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTT  658

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALVMLTPLIVG  FGVETLSGVLAGALVSGVQIAISA
Sbjct  659  KPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTLFGVETLSGVLAGALVSGVQIAISA  718

Query  543  S  545
            S
Sbjct  719  S  719



>gb|ABR16052.1| unknown [Picea sitchensis]
Length=764

 Score =   334 bits (857),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 168/181 (93%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAG SH+IRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  503  PISDNAGGIAEMAGFSHKIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  562

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             IS VDVLTPKVFIGLLVGAMLPYWFSAMTMKSVG AALKMVEEVRRQF +IPGLMEGTA
Sbjct  563  AISKVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFRDIPGLMEGTA  622

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDAS++EMIP GALVMLTPLIVG  FGVETLSGVLAGALVSGVQ+AISA
Sbjct  623  KPDYATCVKISTDASLREMIPPGALVMLTPLIVGTLFGVETLSGVLAGALVSGVQVAISA  682

Query  543  S  545
            S
Sbjct  683  S  683



>ref|XP_008372806.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Malus domestica]
Length=1179

 Score =   342 bits (878),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  3    PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  182
            PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA
Sbjct  505  PISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRA  564

Query  183  EISTVDVLTPKVFIGLLVGAMLPYWFSAMTMKSVGKAALKMVEEVRRQFNNIPGLMEGTA  362
             ISTVDVLTPKVFIGL+VGAMLPYWFSAMTMKSVG AALKMVEEVRRQFN IPGLMEGTA
Sbjct  565  AISTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTA  624

Query  363  KPDYATCVKISTDASIKEMIPRGALVMLTPLIVGIFFGVETLSGVLAGALVSGVQIAISA  542
            KPDYATCVKISTDASIKEMIP GALV+LTPLIVG FFGVETLSGVLAG+LVSGVQIAISA
Sbjct  625  KPDYATCVKISTDASIKEMIPPGALVILTPLIVGTFFGVETLSGVLAGSLVSGVQIAISA  684

Query  543  S  545
            S
Sbjct  685  S  685



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 592801777335