BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001F03

Length=547
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006430260.1|  hypothetical protein CICLE_v10013051mg             105   3e-25   
ref|XP_011044769.1|  PREDICTED: 60S acidic ribosomal protein P2B-...    103   7e-25   Populus euphratica
ref|XP_002266030.2|  PREDICTED: 60S acidic ribosomal protein P2 i...    104   8e-25   Vitis vinifera
ref|XP_002313663.1|  60s acidic ribosomal family protein                103   1e-24   Populus trichocarpa [western balsam poplar]
ref|XP_009800754.1|  PREDICTED: 60S acidic ribosomal protein P2-1...    103   2e-24   Nicotiana sylvestris
ref|XP_006347235.1|  PREDICTED: 60S acidic ribosomal protein P2         103   2e-24   Solanum tuberosum [potatoes]
ref|XP_011077887.1|  PREDICTED: 60S acidic ribosomal protein P2B-...    103   2e-24   Sesamum indicum [beniseed]
ref|XP_007015881.1|  60S acidic ribosomal protein P2B, putative i...    102   4e-24   
ref|XP_009589318.1|  PREDICTED: 60S acidic ribosomal protein P2A-...    102   4e-24   Nicotiana tomentosiformis
gb|KJB36388.1|  hypothetical protein B456_006G156700                    102   5e-24   Gossypium raimondii
ref|XP_010651712.1|  PREDICTED: 60S acidic ribosomal protein P2 i...    102   5e-24   Vitis vinifera
gb|EYU35434.1|  hypothetical protein MIMGU_mgv1a016591mg                102   5e-24   Erythranthe guttata [common monkey flower]
ref|XP_006384635.1|  60s acidic ribosomal family protein                101   7e-24   
ref|XP_008227500.1|  PREDICTED: 60S acidic ribosomal protein P2B-...    101   7e-24   Prunus mume [ume]
gb|ABK92597.1|  unknown                                                 101   8e-24   Populus trichocarpa [western balsam poplar]
ref|XP_002529063.1|  60S acidic ribosomal protein P2, putative          101   9e-24   Ricinus communis
ref|XP_009804702.1|  PREDICTED: 60S acidic ribosomal protein P2A-...    101   1e-23   Nicotiana sylvestris
ref|XP_007027672.1|  60S acidic ribosomal protein P2-4                  100   1e-23   Theobroma cacao [chocolate]
gb|KCW87970.1|  hypothetical protein EUGRSUZ_A00378                     100   2e-23   Eucalyptus grandis [rose gum]
ref|XP_006481819.1|  PREDICTED: 60S acidic ribosomal protein P2-2...    100   2e-23   Citrus sinensis [apfelsine]
gb|ACI14380.1|  60S acidic ribosomal protein P2-like protein            100   2e-23   Forsythia suspensa
ref|XP_011088860.1|  PREDICTED: 60S acidic ribosomal protein P2B-...    100   2e-23   
ref|XP_002525251.1|  60S acidic ribosomal protein P2, putative          100   2e-23   
ref|XP_007202715.1|  hypothetical protein PRUPE_ppa012794mg             101   2e-23   
gb|KDP34714.1|  hypothetical protein JCGZ_10919                         100   2e-23   Jatropha curcas
ref|XP_004251036.1|  PREDICTED: 60S acidic ribosomal protein P2-2       100   2e-23   Solanum lycopersicum
ref|XP_007015884.1|  60S acidic ribosomal protein P2B, putative       99.8    3e-23   Theobroma cacao [chocolate]
ref|XP_010064997.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  99.8    3e-23   Eucalyptus grandis [rose gum]
gb|ABM65702.1|  60S acidic ribosomal protein P2                       99.8    4e-23   Juglans regia
ref|XP_008241270.1|  PREDICTED: 60S acidic ribosomal protein P2B-...  99.4    4e-23   Prunus mume [ume]
gb|KJB55651.1|  hypothetical protein B456_009G087300                  99.4    5e-23   Gossypium raimondii
ref|XP_007205887.1|  hypothetical protein PRUPE_ppa011311mg             102   5e-23   
ref|XP_010242613.1|  PREDICTED: 60S acidic ribosomal protein P2-like  99.0    6e-23   Nelumbo nucifera [Indian lotus]
gb|KJB21688.1|  hypothetical protein B456_004G008900                    100   6e-23   Gossypium raimondii
ref|XP_002283025.1|  PREDICTED: 60S acidic ribosomal protein P2       99.0    6e-23   Vitis vinifera
ref|XP_010912250.1|  PREDICTED: 60S acidic ribosomal protein P2B-...  99.0    6e-23   Elaeis guineensis
emb|CDP15388.1|  unnamed protein product                              98.6    1e-22   Coffea canephora [robusta coffee]
ref|XP_011090363.1|  PREDICTED: 60S acidic ribosomal protein P2B-...  98.2    1e-22   Sesamum indicum [beniseed]
ref|XP_011046262.1|  PREDICTED: 60S acidic ribosomal protein P2B-...  98.2    1e-22   Populus euphratica
ref|XP_004241310.1|  PREDICTED: 60S acidic ribosomal protein P2       98.2    1e-22   Solanum lycopersicum
ref|XP_009777027.1|  PREDICTED: 60S acidic ribosomal protein P2-2...  97.8    2e-22   Nicotiana sylvestris
ref|XP_009624065.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  97.8    2e-22   Nicotiana tomentosiformis
emb|CDP06954.1|  unnamed protein product                              97.8    2e-22   Coffea canephora [robusta coffee]
gb|KJB16640.1|  hypothetical protein B456_002G241200                  97.8    2e-22   Gossypium raimondii
gb|KJB21689.1|  hypothetical protein B456_004G009000                  97.8    2e-22   Gossypium raimondii
ref|XP_009629439.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  97.4    2e-22   Nicotiana tomentosiformis
ref|NP_001275119.1|  uncharacterized protein LOC102577788             98.6    2e-22   Solanum tuberosum [potatoes]
ref|XP_011094390.1|  PREDICTED: 60S acidic ribosomal protein P2-1...  97.4    3e-22   Sesamum indicum [beniseed]
ref|XP_010244112.1|  PREDICTED: 60S acidic ribosomal protein P2-like  97.1    3e-22   Nelumbo nucifera [Indian lotus]
gb|ABA40434.1|  60s acidic ribosomal protein-like protein             97.1    4e-22   Solanum tuberosum [potatoes]
ref|XP_006349107.1|  PREDICTED: 60S acidic ribosomal protein P2-2...  97.1    4e-22   Solanum tuberosum [potatoes]
ref|XP_006471373.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  97.1    4e-22   Citrus sinensis [apfelsine]
ref|XP_008783987.1|  PREDICTED: 60S acidic ribosomal protein P2B-...  96.7    4e-22   Phoenix dactylifera
gb|KDO61085.1|  hypothetical protein CISIN_1g033355mg                 97.1    4e-22   Citrus sinensis [apfelsine]
ref|XP_006424296.1|  hypothetical protein CICLE_v10029621mg           96.7    5e-22   Citrus clementina [clementine]
ref|XP_004228456.1|  PREDICTED: 60S acidic ribosomal protein P2       96.7    5e-22   Solanum lycopersicum
gb|EPS74099.1|  hypothetical protein M569_00658                       96.7    5e-22   Genlisea aurea
gb|KHG07914.1|  60S acidic ribosomal P2                               96.7    5e-22   Gossypium arboreum [tree cotton]
ref|XP_010924305.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  96.7    5e-22   Elaeis guineensis
ref|XP_008788306.1|  PREDICTED: 60S acidic ribosomal protein P2B-...  96.3    6e-22   
ref|XP_011467330.1|  PREDICTED: 60S acidic ribosomal protein P2-2...  96.3    7e-22   Fragaria vesca subsp. vesca
ref|XP_008342938.1|  PREDICTED: 60S acidic ribosomal protein P2B-...  95.9    9e-22   Malus domestica [apple tree]
ref|XP_008349090.1|  PREDICTED: 60S acidic ribosomal protein P2-2...  95.9    9e-22   Malus domestica [apple tree]
ref|XP_008355226.1|  PREDICTED: 60S acidic ribosomal protein P2-2...  95.9    1e-21   
ref|XP_008391761.1|  PREDICTED: 60S acidic ribosomal protein P2-2...  95.9    1e-21   
emb|CDP13859.1|  unnamed protein product                              95.5    1e-21   Coffea canephora [robusta coffee]
ref|XP_009364278.1|  PREDICTED: 60S acidic ribosomal protein P2-2...  95.5    1e-21   Pyrus x bretschneideri [bai li]
gb|KDP42715.1|  hypothetical protein JCGZ_23655                       95.5    1e-21   Jatropha curcas
ref|XP_008797513.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  94.7    2e-21   Phoenix dactylifera
ref|XP_009366640.1|  PREDICTED: 60S acidic ribosomal protein P2-2...  94.7    2e-21   Pyrus x bretschneideri [bai li]
ref|XP_003554422.1|  PREDICTED: 60S acidic ribosomal protein P2-2...  94.7    3e-21   Glycine max [soybeans]
ref|XP_009374748.1|  PREDICTED: 60S acidic ribosomal protein P2-2...  94.7    3e-21   Pyrus x bretschneideri [bai li]
ref|XP_006654480.1|  PREDICTED: 60S acidic ribosomal protein P2B-...  94.7    3e-21   Oryza brachyantha
ref|NP_001055683.1|  Os05g0445500                                     94.4    3e-21   
gb|ABK22480.1|  unknown                                               94.4    3e-21   Picea sitchensis
ref|XP_010089386.1|  60S acidic ribosomal protein P2-4                94.4    4e-21   Morus notabilis
gb|EYU35149.1|  hypothetical protein MIMGU_mgv1a016659mg              94.4    4e-21   Erythranthe guttata [common monkey flower]
emb|CDP21644.1|  unnamed protein product                              94.4    4e-21   Coffea canephora [robusta coffee]
gb|EEC79308.1|  hypothetical protein OsI_20141                        96.3    4e-21   Oryza sativa Indica Group [Indian rice]
gb|KHG14059.1|  60S acidic ribosomal P2                               94.4    4e-21   Gossypium arboreum [tree cotton]
ref|XP_010031491.1|  PREDICTED: 60S acidic ribosomal protein P2-1...  94.0    5e-21   Eucalyptus grandis [rose gum]
ref|XP_010069674.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  94.0    6e-21   Eucalyptus grandis [rose gum]
gb|KCW50805.1|  hypothetical protein EUGRSUZ_J00465                   94.0    6e-21   Eucalyptus grandis [rose gum]
ref|XP_003521450.1|  PREDICTED: 60S acidic ribosomal protein P2-1...  94.0    6e-21   Glycine max [soybeans]
ref|XP_008360542.1|  PREDICTED: 60S acidic ribosomal protein P2-1...  94.0    6e-21   
ref|XP_004303010.1|  PREDICTED: 60S acidic ribosomal protein P2-2...  93.6    6e-21   Fragaria vesca subsp. vesca
ref|XP_010275438.1|  PREDICTED: 60S acidic ribosomal protein P2-like  93.6    7e-21   Nelumbo nucifera [Indian lotus]
ref|XP_004150487.1|  PREDICTED: 60S acidic ribosomal protein P2-4...  93.6    1e-20   
ref|XP_004150488.1|  PREDICTED: 60S acidic ribosomal protein P2-4...  93.2    1e-20   Cucumis sativus [cucumbers]
ref|XP_011462847.1|  PREDICTED: 60S acidic ribosomal protein P2B-...  93.2    1e-20   Fragaria vesca subsp. vesca
ref|XP_007162878.1|  hypothetical protein PHAVU_001G1882000g          94.7    1e-20   Phaseolus vulgaris [French bean]
ref|XP_010241325.1|  PREDICTED: 60S acidic ribosomal protein P2-2...  93.2    1e-20   Nelumbo nucifera [Indian lotus]
ref|XP_010926364.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  92.8    1e-20   Elaeis guineensis
ref|XP_009613358.1|  PREDICTED: 60S acidic ribosomal protein P2-like  92.8    1e-20   Nicotiana tomentosiformis
ref|XP_008351356.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...  92.8    2e-20   
ref|XP_010907155.1|  PREDICTED: 60S acidic ribosomal protein P2B-...  92.4    2e-20   Elaeis guineensis
gb|EPS73855.1|  hypothetical protein M569_00918                       92.4    2e-20   Genlisea aurea
ref|XP_009394805.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  92.0    3e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008446770.1|  PREDICTED: 60S acidic ribosomal protein P2-4...  92.0    3e-20   Cucumis melo [Oriental melon]
ref|XP_008348607.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...  92.0    3e-20   
sp|P41099.1|RLA2_PARAR  RecName: Full=60S acidic ribosomal protei...  92.0    3e-20   Parthenium argentatum
ref|XP_004145795.1|  PREDICTED: 60S acidic ribosomal protein P2B-...  92.0    3e-20   Cucumis sativus [cucumbers]
gb|KJB06823.1|  hypothetical protein B456_001G120800                  91.7    4e-20   Gossypium raimondii
ref|XP_010520675.1|  PREDICTED: 60S acidic ribosomal protein P2-4...  90.5    4e-20   Tarenaya hassleriana [spider flower]
gb|AGE45654.1|  ribosomal protein P2B                                 91.7    4e-20   Picea wilsonii
ref|XP_010231320.1|  PREDICTED: 60S acidic ribosomal protein P2B      91.7    4e-20   Brachypodium distachyon [annual false brome]
ref|XP_004293299.1|  PREDICTED: 60S acidic ribosomal protein P2-like  91.7    4e-20   Fragaria vesca subsp. vesca
ref|XP_006858566.1|  hypothetical protein AMTR_s00071p00177850        91.7    4e-20   Amborella trichopoda
gb|EEE63896.1|  hypothetical protein OsJ_18721                        95.1    4e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010521669.1|  PREDICTED: 60S acidic ribosomal protein P2-1...  91.3    5e-20   Tarenaya hassleriana [spider flower]
gb|ACJ86110.1|  unknown                                               90.9    8e-20   Medicago truncatula
gb|AAS20966.1|  60s acidic ribosomal protein                          90.5    1e-19   Hyacinthus orientalis [common hyacinth]
ref|XP_008361098.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...  90.5    1e-19   
gb|AFK46271.1|  unknown                                               90.5    1e-19   Lotus japonicus
gb|KHN25194.1|  60S acidic ribosomal protein P2B                      89.7    1e-19   Glycine soja [wild soybean]
ref|XP_010093218.1|  60S acidic ribosomal protein P2B                 90.5    1e-19   Morus notabilis
ref|XP_006419121.1|  hypothetical protein EUTSA_v10002732mg           90.1    1e-19   Eutrema salsugineum [saltwater cress]
gb|AFK45307.1|  unknown                                               90.1    1e-19   Medicago truncatula
gb|ABK24939.1|  unknown                                               90.1    1e-19   Picea sitchensis
ref|XP_009410961.1|  PREDICTED: 60S acidic ribosomal protein P2B-...  90.1    2e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004490304.1|  PREDICTED: 60S acidic ribosomal protein P2-1...  89.7    2e-19   Cicer arietinum [garbanzo]
ref|XP_006343627.1|  PREDICTED: 60S acidic ribosomal protein P2-like  89.7    2e-19   Solanum tuberosum [potatoes]
ref|XP_009784712.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  89.7    2e-19   Nicotiana sylvestris
ref|XP_002264645.1|  PREDICTED: 60S acidic ribosomal protein P2       89.7    2e-19   Vitis vinifera
ref|XP_009618588.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  89.7    2e-19   Nicotiana tomentosiformis
ref|XP_004243028.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  89.7    2e-19   Solanum lycopersicum
ref|XP_009394231.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  89.4    2e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008358569.1|  PREDICTED: serpin-ZX-like                        94.7    3e-19   Malus domestica [apple tree]
ref|NP_001236459.1|  uncharacterized protein LOC100500331             89.4    3e-19   Glycine max [soybeans]
ref|XP_010683782.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  89.0    3e-19   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008458601.1|  PREDICTED: 60S acidic ribosomal protein P2B-...  89.0    4e-19   Cucumis melo [Oriental melon]
ref|XP_010541287.1|  PREDICTED: 60S acidic ribosomal protein P2-4...  88.6    5e-19   Tarenaya hassleriana [spider flower]
gb|ACG45911.1|  60S acidic ribosomal protein P2A                      88.6    6e-19   Zea mays [maize]
gb|AFW81770.1|  60S acidic ribosomal protein P2B                      89.0    6e-19   
pdb|3J61|SS  Chain s, Localization Of The Large Subunit Ribosomal...  88.2    7e-19   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004297919.1|  PREDICTED: 60S acidic ribosomal protein P2B-...  88.6    7e-19   Fragaria vesca subsp. vesca
ref|XP_004487515.1|  PREDICTED: 60S acidic ribosomal protein P2B-...  88.2    8e-19   Cicer arietinum [garbanzo]
ref|XP_008668723.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  87.8    9e-19   
ref|XP_006358327.1|  PREDICTED: 60S acidic ribosomal protein P2-like  88.2    1e-18   Solanum tuberosum [potatoes]
ref|NP_001235654.1|  uncharacterized protein LOC100499761             87.8    1e-18   Glycine max [soybeans]
ref|XP_006279385.1|  hypothetical protein CARUB_v10008004mg           87.8    1e-18   Capsella rubella
ref|NP_001132823.1|  uncharacterized protein LOC100194313             87.8    1e-18   Zea mays [maize]
ref|NP_001105390.1|  60S acidic ribosomal protein P2B                 87.8    1e-18   Zea mays [maize]
ref|XP_002439881.1|  hypothetical protein SORBIDRAFT_09g021900        87.4    1e-18   Sorghum bicolor [broomcorn]
gb|AFW81220.1|  acidic ribosomal protein P2a-4                        87.8    1e-18   
gb|KEH38965.1|  60S acidic ribosomal protein                          87.4    1e-18   Medicago truncatula
emb|CDP13301.1|  unnamed protein product                              87.0    2e-18   Coffea canephora [robusta coffee]
ref|XP_002960843.1|  hypothetical protein SELMODRAFT_139397           87.4    2e-18   Selaginella moellendorffii
gb|AFK39918.1|  unknown                                               87.4    2e-18   Medicago truncatula
ref|XP_010425874.1|  PREDICTED: 60S acidic ribosomal protein P2-4     87.4    2e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010686061.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  87.0    2e-18   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008655428.1|  PREDICTED: acidic ribosomal protein P2a-2 is...  87.4    2e-18   
ref|XP_010503106.1|  PREDICTED: 60S acidic ribosomal protein P2-4...  87.0    2e-18   Camelina sativa [gold-of-pleasure]
ref|XP_008801232.1|  PREDICTED: 60S acidic ribosomal protein P2-like  87.0    2e-18   Phoenix dactylifera
gb|AAT08664.1|  acidic ribosomal protein                              87.0    2e-18   Hyacinthus orientalis [common hyacinth]
ref|XP_008655431.1|  PREDICTED: 60S acidic ribosomal protein P2B ...  87.4    2e-18   Zea mays [maize]
ref|NP_001105388.1|  acidic ribosomal protein P2a-2                   86.7    3e-18   Zea mays [maize]
ref|XP_004297921.1|  PREDICTED: 60S acidic ribosomal protein P2B-...  86.7    3e-18   Fragaria vesca subsp. vesca
ref|NP_001105377.1|  60S acidic ribosomal protein P2A precursor       86.3    4e-18   Zea mays [maize]
sp|P46252.3|RLA2A_MAIZE  RecName: Full=60S acidic ribosomal prote...  86.3    4e-18   Zea mays [maize]
ref|XP_008655427.1|  PREDICTED: 60S acidic ribosomal protein P2A ...  86.3    4e-18   Zea mays [maize]
ref|XP_004975549.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  86.3    4e-18   Setaria italica
ref|XP_004973771.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  86.3    4e-18   Setaria italica
ref|XP_008462549.1|  PREDICTED: 60S acidic ribosomal protein P2-l...  86.3    4e-18   
ref|XP_002315449.1|  60s acidic ribosomal family protein              86.3    4e-18   Populus trichocarpa [western balsam poplar]
ref|XP_006643860.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  86.3    4e-18   Oryza brachyantha
ref|XP_002441563.1|  hypothetical protein SORBIDRAFT_09g029390        86.3    4e-18   Sorghum bicolor [broomcorn]
gb|AAP80619.1|AF475097_1  acidic ribosomal protein P2                 86.3    5e-18   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002967170.1|  hypothetical protein SELMODRAFT_28094            84.7    5e-18   
ref|XP_006292078.1|  hypothetical protein CARUB_v10018273mg           85.9    5e-18   
ref|XP_002950613.1|  hypothetical protein VOLCADRAFT_120883           85.9    5e-18   Volvox carteri f. nagariensis
ref|XP_004961921.1|  PREDICTED: 60S acidic ribosomal protein P2B-...  85.9    5e-18   Setaria italica
ref|XP_008462550.1|  PREDICTED: 60S acidic ribosomal protein P2-l...  85.9    6e-18   
gb|AFW81218.1|  acidic ribosomal protein P2a                          87.0    6e-18   
gb|KHN27663.1|  60S acidic ribosomal protein P2B                      85.9    6e-18   Glycine soja [wild soybean]
ref|XP_007145332.1|  hypothetical protein PHAVU_007G230200g           85.9    6e-18   Phaseolus vulgaris [French bean]
gb|AFW81221.1|  hypothetical protein ZEAMMB73_796524                  88.6    9e-18   
gb|KJB06824.1|  hypothetical protein B456_001G120800                  85.5    9e-18   Gossypium raimondii
ref|XP_003579690.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  85.1    9e-18   Brachypodium distachyon [annual false brome]
ref|XP_004167615.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...  85.1    1e-17   
ref|NP_190045.1|  60S acidic ribosomal protein P2-4                   85.1    1e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002448737.1|  hypothetical protein SORBIDRAFT_06g032330        85.1    1e-17   Sorghum bicolor [broomcorn]
ref|XP_010514785.1|  PREDICTED: 60S acidic ribosomal protein P2-4...  85.1    1e-17   Camelina sativa [gold-of-pleasure]
ref|XP_004961920.1|  PREDICTED: 60S acidic ribosomal protein P2B-...  85.5    1e-17   
ref|XP_004973770.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  85.9    1e-17   
gb|ACN30980.1|  unknown                                               84.7    1e-17   Zea mays [maize]
ref|XP_002447780.1|  hypothetical protein SORBIDRAFT_06g015440        84.7    1e-17   Sorghum bicolor [broomcorn]
ref|XP_010473164.1|  PREDICTED: 60S acidic ribosomal protein P2-1...  84.7    1e-17   Camelina sativa [gold-of-pleasure]
dbj|BAJ92129.1|  predicted protein                                    84.7    1e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFK40789.1|  unknown                                               84.7    2e-17   Lotus japonicus
gb|KFK32382.1|  hypothetical protein AALP_AA6G233900                  84.3    2e-17   Arabis alpina [alpine rockcress]
ref|XP_009140817.1|  PREDICTED: 60S acidic ribosomal protein P2-2...  84.3    2e-17   Brassica rapa
ref|NP_001047015.1|  Os02g0529700                                     84.3    2e-17   
ref|XP_008663721.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  84.0    3e-17   
dbj|BAH57243.1|  AT2G27710                                            83.6    3e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010510738.1|  PREDICTED: 60S acidic ribosomal protein P2-1...  84.0    3e-17   Camelina sativa [gold-of-pleasure]
ref|NP_001189621.1|  60S acidic ribosomal protein P2-2                83.6    3e-17   Arabidopsis thaliana [mouse-ear cress]
gb|KJB62189.1|  hypothetical protein B456_009G405600                  84.3    3e-17   Gossypium raimondii
ref|XP_004295494.1|  PREDICTED: 60S acidic ribosomal protein P2-4...  84.0    3e-17   Fragaria vesca subsp. vesca
ref|NP_180339.1|  60S acidic ribosomal protein P2-2                   83.6    4e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010417919.1|  PREDICTED: 60S acidic ribosomal protein P2-1     83.6    4e-17   Camelina sativa [gold-of-pleasure]
ref|XP_006647333.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  83.6    4e-17   Oryza brachyantha
ref|XP_004297978.1|  PREDICTED: 60S acidic ribosomal protein P2-4...  83.6    4e-17   Fragaria vesca subsp. vesca
ref|XP_008387857.1|  PREDICTED: 60S acidic ribosomal protein P2-1...  83.6    4e-17   
ref|XP_001694856.1|  acidic ribosomal protein P2                      83.6    4e-17   Chlamydomonas reinhardtii
gb|KHN02245.1|  60S acidic ribosomal protein P2                       82.0    4e-17   Glycine soja [wild soybean]
ref|XP_006295265.1|  hypothetical protein CARUB_v10024352mg           83.6    5e-17   Capsella rubella
gb|EMT02685.1|  60S acidic ribosomal protein P2B                      83.6    5e-17   
gb|EMS66726.1|  60S acidic ribosomal protein P2B                      83.6    5e-17   Triticum urartu
ref|XP_009421130.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  83.6    5e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010473159.1|  PREDICTED: 60S acidic ribosomal protein P2-1...  83.2    5e-17   Camelina sativa [gold-of-pleasure]
ref|NP_001236220.1|  uncharacterized protein LOC100306264             83.2    6e-17   Glycine max [soybeans]
ref|XP_004497613.1|  PREDICTED: 60S acidic ribosomal protein P2-4...  83.2    6e-17   Cicer arietinum [garbanzo]
gb|KIZ04174.1|  60S acidic ribosomal protein P2-4                     82.8    6e-17   Monoraphidium neglectum
ref|XP_004975548.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  85.5    6e-17   
ref|XP_004955604.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  83.6    8e-17   
gb|ABD74514.1|  ribosomal protein                                     82.8    1e-16   Pteris vittata
ref|XP_010514554.1|  PREDICTED: 60S acidic ribosomal protein P2-3...  82.4    1e-16   Camelina sativa [gold-of-pleasure]
ref|XP_003543439.2|  PREDICTED: 60S acidic ribosomal protein P2B-...  83.2    1e-16   Glycine max [soybeans]
ref|XP_004165173.1|  PREDICTED: 60S acidic ribosomal protein P2-4...  82.8    1e-16   
emb|CAN72528.1|  hypothetical protein VITISV_013399                   82.4    1e-16   Vitis vinifera
ref|XP_004955605.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  82.4    1e-16   Setaria italica
gb|KHN21444.1|  60S acidic ribosomal protein P2B                      81.6    1e-16   Glycine soja [wild soybean]
gb|AAP80630.1|AF475108_1  acidic ribosomal protein                    82.8    1e-16   Triticum aestivum [Canadian hard winter wheat]
ref|XP_011024241.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  81.6    2e-16   Populus euphratica
ref|XP_006295264.1|  hypothetical protein CARUB_v10024350mg           82.0    2e-16   Capsella rubella
ref|XP_002875674.1|  hypothetical protein ARALYDRAFT_484870           81.6    2e-16   
ref|XP_006292070.1|  hypothetical protein CARUB_v10018265mg           81.6    2e-16   Capsella rubella
emb|CDX77131.1|  BnaC04g39260D                                        81.6    2e-16   
ref|XP_006409780.1|  hypothetical protein EUTSA_v10017442mg           81.6    2e-16   Eutrema salsugineum [saltwater cress]
gb|AFK33658.1|  unknown                                               81.3    2e-16   Medicago truncatula
ref|XP_003571500.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  81.3    3e-16   Brachypodium distachyon [annual false brome]
gb|AAM65044.1|  60S acidic ribosomal protein P2                       81.3    3e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001784528.1|  predicted protein                                81.3    4e-16   
ref|NP_180340.1|  60S acidic ribosomal protein P2-1                   81.3    4e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001761876.1|  predicted protein                                80.9    4e-16   
ref|XP_010425630.1|  PREDICTED: 60S acidic ribosomal protein P2-3     80.9    4e-16   Camelina sativa [gold-of-pleasure]
ref|XP_001758040.1|  predicted protein                                80.9    5e-16   
ref|XP_002639930.1|  Hypothetical protein CBG08266                    80.5    5e-16   Caenorhabditis briggsae
gb|KGN48246.1|  hypothetical protein Csa_6G451490                     80.5    6e-16   Cucumis sativus [cucumbers]
ref|XP_004167613.1|  PREDICTED: 60S acidic ribosomal protein P2B-...  80.5    7e-16   
ref|XP_006392052.1|  hypothetical protein EUTSA_v10023766mg           80.1    8e-16   Eutrema salsugineum [saltwater cress]
ref|XP_001754567.1|  predicted protein                                80.1    9e-16   
ref|XP_007261576.1|  ribosomal protein 60S                            79.7    9e-16   Fomitiporia mediterranea MF3/22
ref|NP_189491.1|  60S acidic ribosomal protein P2-3                   79.7    1e-15   Arabidopsis thaliana [mouse-ear cress]
gb|AFK35524.1|  unknown                                               79.7    1e-15   Lotus japonicus
ref|XP_011331848.1|  PREDICTED: 60S acidic ribosomal protein P2       79.3    1e-15   Ooceraea biroi
ref|XP_003557330.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  79.3    1e-15   Brachypodium distachyon [annual false brome]
ref|XP_002880973.1|  predicted protein                                79.3    1e-15   Arabidopsis lyrata subsp. lyrata
emb|CDY04508.1|  BnaA07g13340D                                        79.3    2e-15   
ref|XP_010542569.1|  PREDICTED: 60S acidic ribosomal protein P2-4...  79.3    2e-15   Tarenaya hassleriana [spider flower]
ref|XP_009103616.1|  PREDICTED: 60S acidic ribosomal protein P2-2...  79.0    2e-15   Brassica rapa
ref|XP_006284631.1|  hypothetical protein CARUB_v10005874mg           80.1    2e-15   
ref|XP_002862551.1|  hypothetical protein ARALYDRAFT_497404           79.0    2e-15   Arabidopsis lyrata subsp. lyrata
ref|NP_001042268.1|  Os01g0191100                                     78.6    3e-15   
ref|XP_001756207.1|  predicted protein                                78.6    3e-15   
ref|XP_002642304.1|  Hypothetical protein CBG18296                    78.2    3e-15   Caenorhabditis briggsae
ref|XP_010435954.1|  PREDICTED: 60S acidic ribosomal protein P2-5     78.2    4e-15   Camelina sativa [gold-of-pleasure]
ref|XP_002880972.1|  predicted protein                                78.2    4e-15   Arabidopsis lyrata subsp. lyrata
ref|XP_010441119.1|  PREDICTED: 60S acidic ribosomal protein P2-5...  77.4    8e-15   Camelina sativa [gold-of-pleasure]
ref|XP_009111598.1|  PREDICTED: 60S acidic ribosomal protein P2-3...  77.0    9e-15   Brassica rapa
gb|EGC44602.1|  60S acidic ribosomal protein P2                       77.0    9e-15   Histoplasma capsulatum H88
ref|XP_011399325.1|  60S acidic ribosomal protein P2                  77.0    1e-14   Auxenochlorella protothecoides
ref|XP_001907105.1|  hypothetical protein                             76.6    1e-14   Podospora anserina S mat+
ref|XP_006967873.1|  60s ribosomal protein rla2, P2                   76.6    1e-14   Trichoderma reesei QM6a
ref|XP_011266350.1|  PREDICTED: 60S acidic ribosomal protein P2       76.6    1e-14   Camponotus floridanus
gb|AAN52372.1|  ribosomal protein P2                                  77.0    1e-14   Branchiostoma belcheri
gb|KFK33166.1|  hypothetical protein AALP_AA6G339100                  77.0    1e-14   Arabis alpina [alpine rockcress]
emb|CAN75514.1|  hypothetical protein VITISV_042772                   76.6    1e-14   Vitis vinifera
gb|ACY95371.1|  ribosomal protein P2                                  76.6    1e-14   Manduca sexta [Carolina sphinx]
gb|EAZ42058.1|  hypothetical protein OsJ_26618                        76.6    1e-14   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ06215.1|  hypothetical protein OsI_28456                        76.6    1e-14   Oryza sativa Indica Group [Indian rice]
dbj|BAC83094.1|  putative 60S acidic ribosomal protein                77.8    2e-14   Oryza sativa Japonica Group [Japonica rice]
gb|ABV44733.1|  60S acidic ribosomal protein P2-like protein          76.3    2e-14   Phlebotomus papatasi
ref|XP_006395359.1|  hypothetical protein EUTSA_v10005165mg           76.3    2e-14   Eutrema salsugineum [saltwater cress]
ref|XP_004143377.1|  PREDICTED: 60S acidic ribosomal protein P2B-...  77.0    2e-14   Cucumis sativus [cucumbers]
ref|XP_002634216.1|  Hypothetical protein CBG01785                    76.3    2e-14   Caenorhabditis briggsae
gb|EMT15514.1|  60S acidic ribosomal protein P2B                      76.3    2e-14   
ref|XP_011297722.1|  PREDICTED: 60S acidic ribosomal protein P2       76.3    2e-14   Fopius arisanus
ref|XP_008546451.1|  PREDICTED: 60S acidic ribosomal protein P2       76.3    2e-14   
dbj|BAD05855.1|  putative 60S acidiic ribosomal protein P2A           77.0    3e-14   
gb|EEC83203.1|  hypothetical protein OsI_28460                        75.9    3e-14   
ref|XP_009133885.1|  PREDICTED: 60S acidic ribosomal protein P2-1     75.9    3e-14   
ref|XP_002273733.1|  PREDICTED: 60S acidic ribosomal protein P2B      75.9    3e-14   
emb|CAN61098.1|  hypothetical protein VITISV_026175                   75.9    3e-14   
gb|EPX71080.1|  60S acidic ribosomal protein P2B subunit              75.5    3e-14   
ref|NP_595873.1|  60S acidic ribosomal protein P2B                    75.5    4e-14   
ref|NP_001037213.1|  ribosomal protein P2                             75.5    4e-14   
ref|XP_011159603.1|  PREDICTED: 60S acidic ribosomal protein P2       75.5    4e-14   
ref|XP_002868676.1|  hypothetical protein ARALYDRAFT_493981           75.5    4e-14   
ref|XP_002676372.1|  predicted protein                                75.1    4e-14   
gb|EPY51533.1|  ribosomal protein rpa6                                75.1    4e-14   
emb|CDY31188.1|  BnaC03g47030D                                        75.5    4e-14   
ref|XP_007877227.1|  hypothetical protein PFL1_06848                  75.1    5e-14   
emb|CBN08621.1|  ribosomal protein, large, P2                         75.1    5e-14   
ref|NP_198820.1|  60S acidic ribosomal protein P2-5                   75.1    5e-14   
gb|ETN62755.1|  60S acidic ribosomal protein P2                       75.1    5e-14   
ref|XP_001601398.1|  PREDICTED: 60S acidic ribosomal protein P2       75.1    5e-14   
ref|XP_010227810.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  74.7    5e-14   
ref|XP_003557331.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  75.1    5e-14   
gb|EEH10128.1|  60S acidic ribosomal protein P2                       76.6    5e-14   
dbj|BAD26688.1|  60S acidic ribosomal protein P2                      75.1    6e-14   
ref|XP_010228193.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  74.7    6e-14   
ref|XP_010450734.1|  PREDICTED: 60S acidic ribosomal protein P2-5...  75.1    6e-14   
ref|XP_003003683.1|  60S acidic ribosomal protein P2                  74.7    6e-14   
ref|XP_007827937.1|  60S acidic ribosomal protein P2                  74.7    6e-14   
emb|CDX83277.1|  BnaA03g22290D                                        75.1    6e-14   
gb|EHK47605.1|  hypothetical protein TRIATDRAFT_298659                74.7    6e-14   
gb|AAD11446.1|  acidic ribosomal protein P2a-3                        74.7    7e-14   
ref|XP_010495759.1|  PREDICTED: 60S acidic ribosomal protein P2-1...  75.1    7e-14   
gb|EER38969.1|  60S acidic ribosomal protein P2                       74.7    8e-14   
ref|XP_001649060.1|  AAEL014583-PC                                    74.3    8e-14   
ref|XP_009655443.1|  60S acidic ribosomal protein P2                  74.3    8e-14   
ref|XP_011145402.1|  PREDICTED: 60S acidic ribosomal protein P2-like  74.7    8e-14   
ref|XP_001649058.1|  AAEL014583-PA                                    74.3    9e-14   
gb|KIK47394.1|  hypothetical protein CY34DRAFT_247207                 74.3    1e-13   
emb|CBY33355.1|  unnamed protein product                              74.3    1e-13   
emb|CDX71430.1|  BnaC04g16650D                                        74.3    1e-13   
ref|XP_007150093.1|  hypothetical protein PHAVU_005G126000g           74.3    1e-13   
gb|KFB40525.1|  Dpse\GA27615-PA-like protein                          74.3    1e-13   
ref|XP_001864160.1|  60S acidic ribosomal protein P2                  74.3    1e-13   
ref|XP_001831572.2|  60S acidic ribosomal protein P2                  75.1    1e-13   
gb|EHJ71201.1|  hypothetical protein KGM_08664                        73.9    1e-13   
ref|NP_596513.1|  60S acidic ribosomal protein P2A                    73.9    1e-13   
emb|CDY00130.1|  BnaC09g01710D                                        73.9    1e-13   
gb|EHK17156.1|  hypothetical protein TRIVIDRAFT_139551                73.9    1e-13   
dbj|BAM17679.1|  ribosomal protein LP2                                73.9    1e-13   
gb|ABS57437.1|  ribosomal protein P2                                  73.9    1e-13   
ref|XP_006405561.1|  hypothetical protein EUTSA_v10028149mg           73.9    1e-13   
emb|CCA66773.1|  probable ribosomal protein P2                        73.9    2e-13   
ref|XP_011497614.1|  PREDICTED: 60S acidic ribosomal protein P2       73.9    2e-13   
ref|XP_011422440.1|  PREDICTED: 60S acidic ribosomal protein P2-l...  73.6    2e-13   
ref|XP_008879709.1|  hypothetical protein H310_13839                  73.6    2e-13   
ref|XP_011444192.1|  PREDICTED: 60S acidic ribosomal protein P2-like  73.6    2e-13   
ref|NP_001187964.1|  60S acidic ribosomal protein p2                  73.6    2e-13   
gb|EMR80626.1|  putative 60s acidic ribosomal protein p2 protein      73.9    2e-13   
ref|XP_311852.2|  AGAP003025-PA                                       73.2    2e-13   
ref|XP_010507093.1|  PREDICTED: 60S acidic ribosomal protein P2-1...  73.6    2e-13   
ref|XP_002129422.1|  PREDICTED: 60S acidic ribosomal protein P2       73.2    2e-13   
ref|XP_006657594.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  73.6    3e-13   
emb|CBY11295.1|  unnamed protein product                              73.2    3e-13   
dbj|BAN20127.1|  ribosomal protein LP2                                73.2    3e-13   
gb|EAZ03394.1|  hypothetical protein OsI_25537                        73.2    3e-13   
gb|EKC25701.1|  60S acidic ribosomal protein P2                       74.3    3e-13   
ref|XP_002594824.1|  hypothetical protein BRAFLDRAFT_124423           73.2    3e-13   
sp|O01725.1|RLA2_BRAFL  RecName: Full=60S acidic ribosomal protei...  73.2    3e-13   
gb|EFA76098.1|  ribosomal acidic phosphoprotein P2                    73.2    3e-13   
ref|NP_594358.1|  60S acidic ribosomal protein P2C                    73.2    3e-13   
gb|KIP10036.1|  hypothetical protein PHLGIDRAFT_34126                 73.2    3e-13   
emb|CAA54470.1|  ribosomal P2 protein                                 72.8    3e-13   
emb|CEI97934.1|  Putative 60S acidic ribosomal protein P2             72.8    3e-13   
emb|CEG66385.1|  Putative 60S acidic ribosomal protein P2             72.8    3e-13   
ref|XP_011062371.1|  PREDICTED: 60S acidic ribosomal protein P2       72.8    3e-13   
ref|XP_009151867.1|  PREDICTED: 60S acidic ribosomal protein P2-3     72.8    3e-13   
gb|EPY49599.1|  ribosomal protein A4                                  72.8    4e-13   
gb|ABW90411.1|  putative ribosomal protein P2                         72.8    4e-13   
ref|NP_001175120.1|  Os07g0251301                                     72.8    4e-13   
ref|XP_003706347.1|  PREDICTED: 60S acidic ribosomal protein P2-like  72.8    4e-13   
ref|XP_006822991.1|  PREDICTED: 60S acidic ribosomal protein P2-l...  72.4    4e-13   
gb|AAX62403.1|  ribosomal protein P2 isoform A                        72.4    5e-13   
gb|EPY53728.1|  60S acidic ribosomal protein P2B subunit              72.4    5e-13   
gb|EIE81564.1|  hypothetical protein RO3G_06269                       72.4    5e-13   
ref|XP_005177380.1|  PREDICTED: 60S acidic ribosomal protein P2       72.4    5e-13   
ref|XP_003048910.1|  60S acidic ribosomal protein P2                  72.4    5e-13   
ref|XP_004993332.1|  60S acidic ribosomal protein P2                  72.4    5e-13   
gb|AAR87710.1|  60S ribosomal stalk P2 subunit                        72.4    5e-13   
gb|KGB35641.1|  60S acidic ribosomal protein P2                       72.4    6e-13   
gb|KHJ33075.1|  putative ribosomal protein 60s                        72.0    6e-13   
ref|XP_006822992.1|  PREDICTED: 60S acidic ribosomal protein P2-l...  72.0    6e-13   
gb|EPX73881.1|  60S acidic ribosomal protein P2-beta                  72.0    6e-13   
ref|XP_003351714.1|  60S acidic ribosomal protein P2                  72.0    7e-13   
ref|XP_965172.1|  60S acidic ribosomal protein P2                     72.0    7e-13   
gb|ACM09200.1|  60S acidic ribosomal protein P2                       72.0    7e-13   
gb|ESZ92796.1|  60S acidic ribosomal protein P2                       72.0    7e-13   
gb|AAL62467.1|  60S acidic ribosomal protein P2                       72.0    7e-13   
gb|EST08868.1|  cytosolic ribosomal acidic protein                    72.0    7e-13   
ref|XP_004344608.1|  60s Acidic ribosomal protein                     72.0    8e-13   
gb|AAV84269.1|  ribosomal protein P2-like                             72.0    9e-13   
ref|XP_002634214.1|  C. briggsae CBR-RLA-2 protein                    71.6    9e-13   
ref|XP_008106552.1|  PREDICTED: 60S acidic ribosomal protein P2 i...  71.6    9e-13   
gb|AAX62406.1|  ribosomal protein P2 isoform B                        71.6    9e-13   
ref|XP_005849033.1|  hypothetical protein CHLNCDRAFT_51198            71.6    9e-13   
gb|KIL95338.1|  60s acidic ribosomal protein p2                       71.6    9e-13   
ref|XP_001553823.1|  60S acidic ribosomal protein P2                  71.6    1e-12   
emb|CCM02432.1|  predicted protein                                    71.6    1e-12   
gb|EME50007.1|  hypothetical protein DOTSEDRAFT_68758                 71.6    1e-12   
ref|XP_001597505.1|  60S acidic ribosomal protein P2                  71.6    1e-12   
gb|EAZ39748.1|  hypothetical protein OsJ_24186                        71.6    1e-12   
gb|EGT58650.1|  hypothetical protein CAEBREN_18564                    71.2    1e-12   
ref|XP_011145433.1|  PREDICTED: 60S acidic ribosomal protein P2-like  71.2    1e-12   
ref|XP_002092188.1|  RpLP2                                            71.6    1e-12   
ref|XP_003486701.1|  PREDICTED: 60S acidic ribosomal protein P2-like  71.6    1e-12   
sp|Q9GPU2.1|RLA2_EUPRA  RecName: Full=60S acidic ribosomal protei...  71.2    1e-12   
gb|ADT80716.1|  ribosomal protein P2                                  70.1    1e-12   
gb|KFK33742.1|  hypothetical protein AALP_AA5G054100                  71.2    1e-12   
ref|XP_003402444.1|  PREDICTED: 60S acidic ribosomal protein P2-like  71.2    1e-12   
ref|NP_001133207.1|  ribosomal protein, large P2, like 1-2            71.2    1e-12   
gb|AAL50112.1|  acidic ribosomal protein P2                           71.2    1e-12   
ref|XP_009163412.1|  hypothetical protein T265_01187                  71.6    1e-12   
emb|CDX85202.1|  BnaC07g25130D                                        71.2    1e-12   
ref|XP_011111449.1|  hypothetical protein H072_5590                   71.2    1e-12   
ref|NP_001154536.1|  60S acidic ribosomal protein P2-1                71.6    1e-12   
ref|XP_008407179.1|  PREDICTED: 60S acidic ribosomal protein P2-like  71.2    1e-12   
ref|XP_005103046.1|  PREDICTED: 60S acidic ribosomal protein P2-like  71.2    1e-12   
ref|XP_009268557.1|  60S acidic ribosomal protein P2                  70.9    2e-12   
ref|XP_003453702.1|  PREDICTED: 60S acidic ribosomal protein P2-like  70.9    2e-12   
ref|XP_009801559.1|  PREDICTED: 60S acidic ribosomal protein P2-like  72.0    2e-12   
ref|NP_997908.1|  60S acidic ribosomal protein P2                     70.9    2e-12   
gb|KGG50883.1|  hypothetical protein DI09_51p90                       70.9    2e-12   
gb|ACY71258.1|  ribosomal protein P2                                  70.9    2e-12   
gb|ABR27956.1|  ribosomal protein P2                                  70.9    2e-12   
ref|XP_010764780.1|  PREDICTED: 60S acidic ribosomal protein P2-like  70.9    2e-12   
gb|KIJ20865.1|  hypothetical protein PAXINDRAFT_165698                70.5    2e-12   
ref|XP_967910.1|  PREDICTED: 60S acidic ribosomal protein P2          70.5    2e-12   
ref|XP_007401185.1|  hypothetical protein PHACADRAFT_213761           70.9    2e-12   
ref|XP_002469269.1|  60S acidic ribosomal protein P2                  70.5    2e-12   
ref|XP_007546959.1|  PREDICTED: 60S acidic ribosomal protein P2-like  70.9    2e-12   
ref|XP_003108418.1|  CRE-RLA-2 protein                                71.6    2e-12   
ref|XP_008479407.1|  PREDICTED: 60S acidic ribosomal protein P2       70.5    2e-12   
gb|EWC45954.1|  60S acidic ribosomal protein P2                       70.5    2e-12   
emb|CBY31190.1|  unnamed protein product                              70.5    2e-12   
gb|EMP34725.1|  60S acidic ribosomal protein P2                       70.9    3e-12   
ref|XP_009855097.1|  hypothetical protein NEUTE1DRAFT_51458           70.5    3e-12   
ref|XP_009840022.1|  hypothetical protein H257_14010                  70.5    3e-12   
ref|XP_001248451.1|  60S acidic ribosomal protein P2                  70.1    3e-12   
gb|ACM08252.1|  60S acidic ribosomal protein P2                       70.5    3e-12   
gb|KIR45542.1|  60S acidic ribosomal protein P2                       70.1    3e-12   
gb|EFN61415.1|  60S acidic ribosomal protein P2                       75.1    3e-12   
gb|ENN72497.1|  hypothetical protein YQE_10837                        70.1    3e-12   
gb|ABJ96355.1|  60S acidic ribosomal protein P2                       70.1    3e-12   
dbj|GAM23864.1|  hypothetical protein SAMD00019534_070390             70.1    3e-12   
emb|CCF48288.1|  probable ribosomal protein P2                        70.1    3e-12   
emb|CBQ69060.1|  probable ribosomal protein P2                        70.1    3e-12   
ref|XP_571539.1|  ribosomal protein P2                                70.1    3e-12   
gb|ACK77644.1|  LP06614p                                              70.5    3e-12   
ref|XP_001963656.1|  GF20176                                          70.1    3e-12   
gb|ERL95076.1|  hypothetical protein D910_12346                       70.9    4e-12   
ref|XP_010867688.1|  PREDICTED: 60S acidic ribosomal protein P2-like  70.1    4e-12   
gb|EIE91690.1|  60S acidic ribosomal protein P2                       69.7    4e-12   
gb|ACM09537.1|  60S acidic ribosomal protein P2                       70.1    4e-12   
gb|EPX75042.1|  60S acidic ribosomal protein P2B subunit              69.7    4e-12   
emb|CCF44035.1|  hypothetical protein CH063_00500                     69.7    4e-12   
emb|CDY04023.1|  BnaC02g37380D                                        69.7    4e-12   
gb|ACM09422.1|  60S acidic ribosomal protein P2                       69.7    4e-12   
dbj|GAM23685.1|  hypothetical protein SAMD00019534_068600             69.7    4e-12   
dbj|GAC94776.1|  cytosolic ribosomal acidic protein                   69.7    4e-12   
ref|XP_011390923.1|  putative ribosomal protein P2                    69.7    4e-12   
dbj|BAI67896.1|  acidic ribosomal protein                             69.7    4e-12   
dbj|GAK66446.1|  60S acidic ribosomal protein P2                      69.7    4e-12   
dbj|GAC77688.1|  60S acidic ribosomal protein P2                      70.9    4e-12   
emb|CBY18756.1|  unnamed protein product                              69.7    4e-12   
ref|XP_003868438.1|  Rpp2b acidic ribosomal protein                   69.7    4e-12   
ref|NP_523764.1|  ribosomal protein LP2                               69.7    5e-12   
gb|ACM08361.1|  60S acidic ribosomal protein P2                       69.7    5e-12   
ref|XP_005987634.1|  PREDICTED: 60S acidic ribosomal protein P2-like  69.7    5e-12   
ref|XP_006688860.1|  ribosomal protein 60S                            69.7    5e-12   
emb|CEI92286.1|  Putative 60S acidic ribosomal protein P2             69.7    5e-12   
emb|CEG76064.1|  Putative 60S acidic ribosomal protein P2-beta        69.7    5e-12   
ref|XP_011176745.1|  PREDICTED: 60S acidic ribosomal protein P2       69.7    5e-12   
ref|XP_005815430.1|  PREDICTED: 60S acidic ribosomal protein P2-like  69.7    5e-12   
emb|CDS29138.1|  60S acidic ribosomal protein P2                      69.7    5e-12   
ref|XP_009129369.1|  PREDICTED: 60S acidic ribosomal protein P2-3...  69.7    5e-12   
emb|CDY47246.1|  BnaA02g29320D                                        69.7    5e-12   
ref|XP_005729847.1|  PREDICTED: 60S acidic ribosomal protein P2-like  69.3    6e-12   
gb|AAF61073.1|AF220554_1  ribosomal protein large P2                  69.7    6e-12   
gb|KDQ18955.1|  hypothetical protein BOTBODRAFT_103495                69.3    6e-12   
ref|XP_001992691.1|  GH24075                                          69.3    6e-12   
ref|XP_011211973.1|  PREDICTED: 60S acidic ribosomal protein P2       69.3    6e-12   
ref|XP_001729522.1|  hypothetical protein MGL_3557                    69.3    6e-12   
ref|XP_007253399.1|  PREDICTED: 60S acidic ribosomal protein P2-like  69.3    6e-12   
ref|NP_001187032.1|  ribosomal protein P2                             69.3    6e-12   
ref|NP_001107326.1|  uncharacterized protein LOC100135138             69.3    6e-12   
ref|XP_010778753.1|  PREDICTED: 60S acidic ribosomal protein P2-like  69.3    6e-12   
gb|EFW99452.1|  60S acidic ribosomal protein p2                       69.3    6e-12   
ref|XP_003690570.1|  PREDICTED: 60S acidic ribosomal protein P2-like  69.3    6e-12   
ref|XP_009949111.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...  69.3    7e-12   
ref|XP_007865193.1|  ribosomal protein 60S                            69.3    7e-12   
gb|KIR35163.1|  60S acidic ribosomal protein P2                       69.3    7e-12   
ref|XP_002071227.1|  GK25676                                          69.3    7e-12   
gb|AAM51113.1|  SD22208p                                              69.3    7e-12   
ref|XP_002034151.1|  GM21711                                          69.3    7e-12   
ref|XP_010728413.1|  PREDICTED: 60S acidic ribosomal protein P2-like  69.3    7e-12   
ref|XP_008278475.1|  PREDICTED: 60S acidic ribosomal protein P2       69.3    7e-12   
gb|KDR22436.1|  60S acidic ribosomal protein P2-beta                  69.3    8e-12   
ref|XP_001120364.1|  PREDICTED: 60S acidic ribosomal protein P2       68.9    8e-12   
emb|CDQ59569.1|  unnamed protein product                              68.2    8e-12   
ref|XP_007433233.1|  PREDICTED: 60S acidic ribosomal protein P2       68.9    8e-12   
gb|ELR57188.1|  60S acidic ribosomal protein P2                       68.6    9e-12   
ref|XP_006613336.1|  PREDICTED: 60S acidic ribosomal protein P2-like  68.9    9e-12   
ref|XP_001526349.1|  60S acidic ribosomal protein P2-B                68.9    9e-12   
ref|XP_003214823.1|  PREDICTED: 60S acidic ribosomal protein P2 i...  68.9    9e-12   
gb|AFR96082.1|  large subunit acidic ribosomal protein P2             68.9    9e-12   
emb|CBN80745.1|  60S acidic ribosomal protein P2                      68.9    9e-12   
gb|KDQ61763.1|  hypothetical protein JAAARDRAFT_172170                68.9    1e-11   
gb|KFH70565.1|  large subunit ribosomal protein LP2                   68.6    1e-11   
gb|AEE99001.1|  acidic ribosomal protein P2                           68.6    1e-11   
ref|XP_006960532.1|  ribosomal protein 60S                            68.6    1e-11   
gb|EIE83553.1|  hypothetical protein RO3G_08258                       68.6    1e-11   
ref|XP_009702440.1|  PREDICTED: 60S acidic ribosomal protein P2       68.6    1e-11   
ref|XP_004523640.1|  PREDICTED: 60S acidic ribosomal protein P2-like  68.6    1e-11   



>ref|XP_006430260.1| hypothetical protein CICLE_v10013051mg [Citrus clementina]
 gb|ESR43500.1| hypothetical protein CICLE_v10013051mg [Citrus clementina]
Length=144

 Score =   105 bits (263),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +2

Query  74   RKEEMKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIA  253
             KEEMKV+AAYLLAVLGG   PSADD+K IL SVGADC+ +R++LLLS+V+GKDITELIA
Sbjct  28   EKEEMKVVAAYLLAVLGGNTSPSADDIKGILGSVGADCEDNRLELLLSEVKGKDITELIA  87

Query  254  AGREKLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            +GREKLASVPSGGG    AAP++GG  AAPAA E K+E+KVEEKEESDDDMGFSLFD
Sbjct  88   SGREKLASVPSGGGVAVAAAPSAGGAGAAPAAAEAKKEEKVEEKEESDDDMGFSLFD  144



>ref|XP_011044769.1| PREDICTED: 60S acidic ribosomal protein P2B-like [Populus euphratica]
Length=113

 Score =   103 bits (258),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVLGG  CP+A+DLK+IL SVGAD D DRI+LLLS V+GKDITELIA+GRE
Sbjct  1    MKVVAAYLLAVLGGNTCPTAEDLKNILGSVGADADDDRIELLLSSVKGKDITELIASGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            KLASVPSGGG    A  A      A  A+E K+E+KVEEKEESDDDMGFSLFD
Sbjct  61   KLASVPSGGGVAVSAGAAPAAAGGAAPADEAKKEEKVEEKEESDDDMGFSLFD  113



>ref|XP_002266030.2| PREDICTED: 60S acidic ribosomal protein P2 isoform X1 [Vitis 
vinifera]
 emb|CBI17057.3| unnamed protein product [Vitis vinifera]
Length=145

 Score =   104 bits (260),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 102/122 (84%), Gaps = 1/122 (1%)
 Frame = +2

Query  62   PEEQRKE-EMKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDI  238
            PE +R   +MKVIAAYLLAVLGG  CPSA+DLK IL SVGA+ D DRI+LLL++V+GKDI
Sbjct  24   PEGRRSHHKMKVIAAYLLAVLGGNTCPSAEDLKDILGSVGAEADDDRIELLLAEVKGKDI  83

Query  239  TELIAAGREKLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSL  418
            TELIA+GREKLASVPSGGG     A   GGGAAAPAA E K+E+KVEEKEESDDDMGFSL
Sbjct  84   TELIASGREKLASVPSGGGAAVAVAAPGGGGAAAPAAAEPKKEEKVEEKEESDDDMGFSL  143

Query  419  FD  424
            FD
Sbjct  144  FD  145



>ref|XP_002313663.1| 60s acidic ribosomal family protein [Populus trichocarpa]
 gb|ABK94130.1| unknown [Populus trichocarpa]
 gb|ABK94462.1| unknown [Populus trichocarpa]
 gb|ABK95516.1| unknown [Populus trichocarpa]
 gb|ABK95879.1| unknown [Populus trichocarpa]
 gb|EEE87618.1| 60s acidic ribosomal family protein [Populus trichocarpa]
Length=113

 Score =   103 bits (256),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVLGG  CP+A+DLK+IL SVGAD D DRI+LLLS V+GKDITELIA+GRE
Sbjct  1    MKVVAAYLLAVLGGNTCPTAEDLKNILGSVGADADDDRIELLLSSVKGKDITELIASGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            KLASVPSGGG    A  A      A  A E K+E+KVEEKEESDDDMGFSLFD
Sbjct  61   KLASVPSGGGVAVSAGAAPAAAGGAAPAAEAKKEEKVEEKEESDDDMGFSLFD  113



>ref|XP_009800754.1| PREDICTED: 60S acidic ribosomal protein P2-1-like [Nicotiana 
sylvestris]
Length=113

 Score =   103 bits (256),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAA+LLAVLGG A PSA DLK IL+SVGA+ D DR+DLLLSQVEGKDITELIAAGRE
Sbjct  1    MKVIAAFLLAVLGGNASPSAADLKKILASVGAEADDDRVDLLLSQVEGKDITELIAAGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            KLASVP GGGG    A  +GG AAA  A E+K+E+K EEKEESDDDMGFSLFD
Sbjct  61   KLASVPCGGGGGVAVAAPAGGSAAAAPAAEEKKEEKKEEKEESDDDMGFSLFD  113



>ref|XP_006347235.1| PREDICTED: 60S acidic ribosomal protein P2 [Solanum tuberosum]
Length=113

 Score =   103 bits (256),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 92/113 (81%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAAYLLAVLGG  CPS  DLK IL+SVGA+ D DRI LLLSQV+GKDITELIAAGRE
Sbjct  1    MKVIAAYLLAVLGGNTCPSEKDLKKILASVGAEADDDRIQLLLSQVKGKDITELIAAGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            KLASVP+GGG     A   GGGAAAPAA EKKEEKKVEEKEESDDDMGFSLFD
Sbjct  61   KLASVPAGGGAACAVAAPGGGGAAAPAAAEKKEEKKVEEKEESDDDMGFSLFD  113



>ref|XP_011077887.1| PREDICTED: 60S acidic ribosomal protein P2B-like [Sesamum indicum]
Length=114

 Score =   103 bits (256),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAAYLLAVLGG A PSADDLK+IL+SVGA+ D DRI+LLL+QV+GKDITELIAAGRE
Sbjct  1    MKVIAAYLLAVLGGNASPSADDLKNILNSVGAEADDDRIELLLTQVKGKDITELIAAGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_007015881.1| 60S acidic ribosomal protein P2B, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007015882.1| 60S acidic ribosomal protein P2B, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007015883.1| 60S acidic ribosomal protein P2B, putative isoform 1 [Theobroma 
cacao]
 gb|EOY33500.1| 60S acidic ribosomal protein P2B, putative isoform 1 [Theobroma 
cacao]
 gb|EOY33501.1| 60S acidic ribosomal protein P2B, putative isoform 1 [Theobroma 
cacao]
 gb|EOY33502.1| 60S acidic ribosomal protein P2B, putative isoform 1 [Theobroma 
cacao]
Length=113

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 91/113 (81%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAAYLLAVLGG A PSADDLK IL SVGA+ D DRI+LLLS+V+GKDITELIAAGRE
Sbjct  1    MKVIAAYLLAVLGGNANPSADDLKDILGSVGAEADDDRIELLLSEVKGKDITELIAAGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            KLASVP GGG VAVA PA+GGG  A  A E K+E+KVEEKEESDDDMGFSLFD
Sbjct  61   KLASVPCGGGAVAVAVPAAGGGGGAAPAAEAKKEEKVEEKEESDDDMGFSLFD  113



>ref|XP_009589318.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Nicotiana tomentosiformis]
Length=112

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 94/113 (83%), Gaps = 1/113 (1%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAAYLLAVLGG +CP A DLK+IL SVGA+ D DRI+LLLSQVEGKDITELIAAGRE
Sbjct  1    MKVIAAYLLAVLGGNSCPKAKDLKNILGSVGAEADDDRIELLLSQVEGKDITELIAAGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            KL +    GGG    A  +GG AAAPAAEEKKEEKKV EKEESDDDMGFSLFD
Sbjct  61   KL-ASVPAGGGAVAVAAPTGGAAAAPAAEEKKEEKKVVEKEESDDDMGFSLFD  112



>gb|KJB36388.1| hypothetical protein B456_006G156700 [Gossypium raimondii]
 gb|KJB36389.1| hypothetical protein B456_006G156700 [Gossypium raimondii]
Length=113

 Score =   102 bits (253),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVLGG A PSADDLK+IL+SVGAD + +R+ LLLS+V+GKDITELIA+GRE
Sbjct  1    MKVVAAYLLAVLGGNASPSADDLKNILASVGADAEEERLQLLLSEVKGKDITELIASGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            KLASVPSGGG    A+      AAAPAA E K+E+KVEEKEESDDDMGFSLFD
Sbjct  61   KLASVPSGGGVAVAASAPGAAAAAAPAAAETKKEEKVEEKEESDDDMGFSLFD  113



>ref|XP_010651712.1| PREDICTED: 60S acidic ribosomal protein P2 isoform X2 [Vitis 
vinifera]
 emb|CAN73396.1| hypothetical protein VITISV_003816 [Vitis vinifera]
 emb|CAN65595.1| hypothetical protein VITISV_030546 [Vitis vinifera]
Length=113

 Score =   102 bits (253),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAAYLLAVLGG  CPSA+DLK IL SVGA+ D DRI+LLL++V+GKDITELIA+GRE
Sbjct  1    MKVIAAYLLAVLGGNTCPSAEDLKDILGSVGAEADDDRIELLLAEVKGKDITELIASGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            KLASVPSGGG     A   GGGAAAPAA E K+E+KVEEKEESDDDMGFSLFD
Sbjct  61   KLASVPSGGGAAVAVAAPGGGGAAAPAAAEPKKEEKVEEKEESDDDMGFSLFD  113



>gb|EYU35434.1| hypothetical protein MIMGU_mgv1a016591mg [Erythranthe guttata]
 gb|EYU35435.1| hypothetical protein MIMGU_mgv1a016591mg [Erythranthe guttata]
Length=115

 Score =   102 bits (253),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 95/115 (83%), Gaps = 2/115 (2%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAAYLLAVLGG A PS DDLK+IL+SVGAD D D+I+LLLSQ++GKDITELIA+GRE
Sbjct  1    MKVIAAYLLAVLGGNASPSGDDLKNILASVGADADQDKIELLLSQIKGKDITELIASGRE  60

Query  266  KLasvps--ggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            KLASVP+  G   V+      GGGAA  AA E K+E+KVEEKEESDDDMGFSLFD
Sbjct  61   KLASVPAGGGAVAVSAPVGGGGGGAAPAAAAETKKEEKVEEKEESDDDMGFSLFD  115



>ref|XP_006384635.1| 60s acidic ribosomal family protein [Populus trichocarpa]
 gb|ABK93470.1| unknown [Populus trichocarpa]
 gb|ERP62432.1| 60s acidic ribosomal family protein [Populus trichocarpa]
Length=114

 Score =   101 bits (252),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVLGG  CP+A+DLKHIL SVGAD D DRI+LLLS V+GKDITELIA+GRE
Sbjct  1    MKVVAAYLLAVLGGNTCPTAEDLKHILGSVGADADDDRIELLLSSVKGKDITELIASGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_008227500.1| PREDICTED: 60S acidic ribosomal protein P2B-like [Prunus mume]
Length=113

 Score =   101 bits (251),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVLGGK  PSA DLK IL SVGA+ D DRI+LLLS+V+GKDITELIA+GRE
Sbjct  1    MKVVAAYLLAVLGGKTSPSAADLKDILGSVGAEADGDRIELLLSEVKGKDITELIASGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            KLASVPSGGG VA +APA+  GAAAPAA E+K+E+KVEEKE++DDDMGFSLFD
Sbjct  61   KLASVPSGGGAVAYSAPAADAGAAAPAAAEQKKEEKVEEKEDTDDDMGFSLFD  113



>gb|ABK92597.1| unknown [Populus trichocarpa]
 gb|ABK94701.1| unknown [Populus trichocarpa]
Length=114

 Score =   101 bits (251),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVLGG  CP+A+DLKHIL SVGAD D DRI+LLLS V+GKDITELIA+GRE
Sbjct  1    MKVVAAYLLAVLGGNTCPTAEDLKHILGSVGADADDDRIELLLSSVKGKDITELIASGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_002529063.1| 60S acidic ribosomal protein P2, putative [Ricinus communis]
 gb|EEF33307.1| 60S acidic ribosomal protein P2, putative [Ricinus communis]
Length=113

 Score =   101 bits (251),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK++AAYLLAVLGG   PSA+DLK IL SVG D D DRI LLLSQV+GKDITELIAAGRE
Sbjct  1    MKIVAAYLLAVLGGNTSPSAEDLKEILGSVGIDADEDRIGLLLSQVKGKDITELIAAGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            KLASVPSGGG    AA A   G AA  A E K+E+KVEEKEESDDDMGFSLFD
Sbjct  61   KLASVPSGGGVAVAAAAAPAAGGAAAPAAEAKKEEKVEEKEESDDDMGFSLFD  113



>ref|XP_009804702.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Nicotiana sylvestris]
 ref|XP_009804705.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Nicotiana sylvestris]
Length=112

 Score =   101 bits (251),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 93/113 (82%), Gaps = 1/113 (1%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAAYLLAVLGG +CP A DLK IL SVGA+ D DRI+LLLSQVEGKDITELIAAGRE
Sbjct  1    MKVIAAYLLAVLGGNSCPKAKDLKSILGSVGAEADDDRIELLLSQVEGKDITELIAAGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            KL +    GGG    A  +G  AAAPAAEEKKEEKKVEEKEESDDDMGFSLFD
Sbjct  61   KL-ASVPAGGGGVAVAAPTGAAAAAPAAEEKKEEKKVEEKEESDDDMGFSLFD  112



>ref|XP_007027672.1| 60S acidic ribosomal protein P2-4 [Theobroma cacao]
 gb|EOY08174.1| 60S acidic ribosomal protein P2-4 [Theobroma cacao]
Length=113

 Score =   100 bits (250),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAAYLLAVLGG  CPSADDLK IL  VGA+ + DRI LLLS+V+GKDITELIAAGRE
Sbjct  1    MKVIAAYLLAVLGGNTCPSADDLKDILGCVGAEVEDDRIQLLLSEVKGKDITELIAAGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            KLASVPSGGG    AA    G AAAPAA E K+E+KVEEKEESDDDMGFSLFD
Sbjct  61   KLASVPSGGGVAVSAAAPGAGAAAAPAAAETKKEEKVEEKEESDDDMGFSLFD  113



>gb|KCW87970.1| hypothetical protein EUGRSUZ_A00378 [Eucalyptus grandis]
Length=106

 Score =   100 bits (248),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 86/113 (76%), Gaps = 7/113 (6%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVLGG  CPSADDLK IL SVGA+ D DRI+LLLS+V+GKDITELIAAGRE
Sbjct  1    MKVVAAYLLAVLGGNTCPSADDLKDILGSVGAEADDDRIELLLSEVKGKDITELIAAGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            +L         V      +   AAAP A E K+E+KVEEKEESDDDMGFSLFD
Sbjct  61   RL-------ASVPSGGGGAVAVAAAPGAAEAKKEEKVEEKEESDDDMGFSLFD  106



>ref|XP_006481819.1| PREDICTED: 60S acidic ribosomal protein P2-2-like [Citrus sinensis]
 gb|KDO61084.1| hypothetical protein CISIN_1g033355mg [Citrus sinensis]
Length=113

 Score =   100 bits (249),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVLGG   PSADD+K IL SVGADC+ +R++LLLS+V+GKDITELIA+GRE
Sbjct  1    MKVVAAYLLAVLGGNTSPSADDIKGILGSVGADCEDNRLELLLSEVKGKDITELIASGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            KLASVPSGGG    AAP++GG  AAPAA E K+E+KVEEKEESDDDMGFSLFD
Sbjct  61   KLASVPSGGGVAVAAAPSAGGAGAAPAAAEAKKEEKVEEKEESDDDMGFSLFD  113



>gb|ACI14380.1| 60S acidic ribosomal protein P2-like protein [Forsythia suspensa]
Length=115

 Score =   100 bits (249),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAAYLLAVLGG ACPSADDLK ILSSVGA+ + D+I LLL+QV GKDITELIAAGRE
Sbjct  1    MKVIAAYLLAVLGGNACPSADDLKDILSSVGAEANDDQIGLLLTQVTGKDITELIAAGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_011088860.1| PREDICTED: 60S acidic ribosomal protein P2B-like [Sesamum indicum]
Length=115

 Score =   100 bits (249),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVLGG   PSAD+LK ILSSVGA+ D DRI+LLLSQV+GKDITELIAAGRE
Sbjct  1    MKVVAAYLLAVLGGNTSPSADNLKDILSSVGAEADDDRIELLLSQVKGKDITELIAAGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_002525251.1| 60S acidic ribosomal protein P2, putative [Ricinus communis]
 gb|EEF37217.1| 60S acidic ribosomal protein P2, putative [Ricinus communis]
Length=108

 Score =   100 bits (248),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVLG    PSAD++K IL+SVGADCD D+I+LLLSQVEGKDITELIA+GRE
Sbjct  1    MKVVAAYLLAVLGVNTSPSADNIKDILNSVGADCDGDKIELLLSQVEGKDITELIASGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_007202715.1| hypothetical protein PRUPE_ppa012794mg [Prunus persica]
 gb|EMJ03914.1| hypothetical protein PRUPE_ppa012794mg [Prunus persica]
Length=154

 Score =   101 bits (251),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +2

Query  77   KEEMKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAA  256
            + EMKV+AAYLLAVLGG   PSA+DLK IL SVGA+ D DRI LLLS+V+GKDITELIA+
Sbjct  39   QAEMKVVAAYLLAVLGGNTTPSAEDLKDILGSVGAETDDDRIQLLLSEVKGKDITELIAS  98

Query  257  GREKLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            GREKLASVPSGGG VAVAAP +G GAAAPAA E K+E+KVEEKE++DDDMGFSLFD
Sbjct  99   GREKLASVPSGGGAVAVAAPGAGAGAAAPAAAEPKKEEKVEEKEDTDDDMGFSLFD  154



>gb|KDP34714.1| hypothetical protein JCGZ_10919 [Jatropha curcas]
Length=114

 Score =   100 bits (248),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAAYLLAVLGG   PSA+DLK IL SVGAD D D+I LLLSQVEGKDITEL+AAGRE
Sbjct  1    MKVIAAYLLAVLGGNTSPSAEDLKEILGSVGADADDDKIQLLLSQVEGKDITELVAAGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_004251036.1| PREDICTED: 60S acidic ribosomal protein P2-2 [Solanum lycopersicum]
Length=113

 Score =   100 bits (248),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 94/113 (83%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIA+YLLAVLGG   PSA DLK IL+SVGA+ D DRI+LLLSQV+GKDITELIAAGRE
Sbjct  1    MKVIASYLLAVLGGNTSPSAADLKKILASVGAEADDDRIELLLSQVKGKDITELIAAGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            KLASVPSGGGG    A + GGGAAAPAAEEKKEEKKVEEKEESDDDMGFSLFD
Sbjct  61   KLASVPSGGGGGVAVAVSGGGGAAAPAAEEKKEEKKVEEKEESDDDMGFSLFD  113



>ref|XP_007015884.1| 60S acidic ribosomal protein P2B, putative [Theobroma cacao]
 gb|EOY33503.1| 60S acidic ribosomal protein P2B, putative [Theobroma cacao]
Length=112

 Score = 99.8 bits (247),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 91/113 (81%), Gaps = 1/113 (1%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAAYLLAVLGG  CPSADDLK IL SVGA+ D D+I+LLLS+V+GKDITELIAAGRE
Sbjct  1    MKVIAAYLLAVLGGNTCPSADDLKDILGSVGAEADDDKIELLLSEVKGKDITELIAAGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            KL +    GGG    A  + GGAAA  A E K+E+KVEEKEESDDDMGFSLFD
Sbjct  61   KL-ASVPSGGGAVAVAAPAAGGAAAAPAAEAKKEEKVEEKEESDDDMGFSLFD  112



>ref|XP_010064997.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Eucalyptus 
grandis]
 gb|KCW87971.1| hypothetical protein EUGRSUZ_A00378 [Eucalyptus grandis]
Length=116

 Score = 99.8 bits (247),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVLGG  CPSADDLK IL SVGA+ D DRI+LLLS+V+GKDITELIAAGRE
Sbjct  1    MKVVAAYLLAVLGGNTCPSADDLKDILGSVGAEADDDRIELLLSEVKGKDITELIAAGRE  60

Query  266  KL  271
            +L
Sbjct  61   RL  62



>gb|ABM65702.1| 60S acidic ribosomal protein P2 [Juglans regia]
Length=113

 Score = 99.8 bits (247),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+A+YLLAVLGG   P  DDLKHIL SVGA+ D D+I+LLLS+V+GKDITELIAAGRE
Sbjct  1    MKVVASYLLAVLGGNTTPCTDDLKHILGSVGAEADDDKIELLLSEVKGKDITELIAAGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            KLASVPSGGGG+AVAA A G  AAA AA E K+E+KVEEK+ESDDDMGFSLFD
Sbjct  61   KLASVPSGGGGIAVAAAAGGAPAAAAAAAEPKKEEKVEEKKESDDDMGFSLFD  113



>ref|XP_008241270.1| PREDICTED: 60S acidic ribosomal protein P2B-like [Prunus mume]
 ref|XP_008241271.1| PREDICTED: 60S acidic ribosomal protein P2B-like [Prunus mume]
 gb|AAL91663.1| 60s acidic ribosomal protein [Prunus dulcis]
 gb|ABH03379.1| 60S acidic ribosomal protein [Prunus dulcis]
Length=113

 Score = 99.4 bits (246),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVLGG   PSA+DLK IL SVGA+ D DRI LLLS+V+GKDITELIA+GRE
Sbjct  1    MKVVAAYLLAVLGGNTTPSAEDLKDILGSVGAETDDDRIQLLLSEVKGKDITELIASGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            KLASVPSGGG VAVAAP +G GAAAPAA E K+E+KVEEKE++DDDMGFSLFD
Sbjct  61   KLASVPSGGGAVAVAAPGAGAGAAAPAAAEPKKEEKVEEKEDTDDDMGFSLFD  113



>gb|KJB55651.1| hypothetical protein B456_009G087300 [Gossypium raimondii]
Length=113

 Score = 99.4 bits (246),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVLGG   PSADDLK IL SVGA+ D DRI+LLLS+V+GKDITELIA GRE
Sbjct  1    MKVVAAYLLAVLGGNLSPSADDLKDILGSVGAEADDDRIELLLSEVKGKDITELIATGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            KLASVPSGGG VA A  A GGGA+A  A E K+E+KVEEKEESDDDMGFSLFD
Sbjct  61   KLASVPSGGGAVAAAPTAGGGGASAAPAAEAKKEEKVEEKEESDDDMGFSLFD  113



>ref|XP_007205887.1| hypothetical protein PRUPE_ppa011311mg [Prunus persica]
 gb|EMJ07086.1| hypothetical protein PRUPE_ppa011311mg [Prunus persica]
Length=215

 Score =   102 bits (253),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = +2

Query  80   EEMKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAG  259
            +EMKV+AAYLLAVLGGK  PSA DLK IL SVGA+ D DRI+LLLS+V+GKDITE+IA+G
Sbjct  101  DEMKVVAAYLLAVLGGKTSPSAADLKDILGSVGAEADGDRIELLLSEVKGKDITEVIASG  160

Query  260  REKLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            REKLASVPSGGG VA +APA+  GAAAPAA E+K+E+KVEEKE++DDDMGFSLFD
Sbjct  161  REKLASVPSGGGAVAYSAPAADAGAAAPAAAEQKKEEKVEEKEDTDDDMGFSLFD  215



>ref|XP_010242613.1| PREDICTED: 60S acidic ribosomal protein P2-like [Nelumbo nucifera]
Length=114

 Score = 99.0 bits (245),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAAYLLAVLGG A PSADDLK IL SVGA+ D DRI+LLLS+V+GKDITELIA+GRE
Sbjct  1    MKVIAAYLLAVLGGNASPSADDLKDILGSVGAEADDDRIELLLSEVKGKDITELIASGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>gb|KJB21688.1| hypothetical protein B456_004G008900 [Gossypium raimondii]
Length=182

 Score =   100 bits (250),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 95/117 (81%), Gaps = 1/117 (1%)
 Frame = +2

Query  77   KEEMKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAA  256
            K +MKV+AAYLLAVLGG A PSADDLK IL SVGA+ D DRI+LLLS+V+GKDITELIA+
Sbjct  66   KVKMKVVAAYLLAVLGGNASPSADDLKVILGSVGAEADDDRIELLLSEVKGKDITELIAS  125

Query  257  GREKLasvps-ggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            GREKLASVPS GG     A  A GGG  A  A E K+E+KVEEKEESDDDMGFSLFD
Sbjct  126  GREKLASVPSGGGAVAVAAPAAGGGGGGAAPAAEAKKEEKVEEKEESDDDMGFSLFD  182



>ref|XP_002283025.1| PREDICTED: 60S acidic ribosomal protein P2 [Vitis vinifera]
 emb|CBI30271.3| unnamed protein product [Vitis vinifera]
Length=114

 Score = 99.0 bits (245),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAAYLLAVLGG  CPSA+DLK IL SVGA+ D DRI+LLLS+V+GKDITELIA+GRE
Sbjct  1    MKVIAAYLLAVLGGNTCPSANDLKDILGSVGAEADDDRIELLLSEVKGKDITELIASGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_010912250.1| PREDICTED: 60S acidic ribosomal protein P2B-like [Elaeis guineensis]
 gb|AGE46033.1| 60S acidic ribosomal protein P2B [Elaeis guineensis]
Length=112

 Score = 99.0 bits (245),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVLGG  CPSADDLK IL SVGA+ D DRI+LLLS+V+GKDITELIA+GRE
Sbjct  1    MKVVAAYLLAVLGGNTCPSADDLKDILGSVGAEADDDRIELLLSEVKGKDITELIASGRE  60

Query  266  KL  271
            K 
Sbjct  61   KF  62



>emb|CDP15388.1| unnamed protein product [Coffea canephora]
Length=116

 Score = 98.6 bits (244),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVLGG  CPSA+ + +ILSSVGA+ D D+I+LLLSQV GKDITELIAAGRE
Sbjct  1    MKVVAAYLLAVLGGNTCPSAEHVTNILSSVGAEADEDKIELLLSQVNGKDITELIAAGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_011090363.1| PREDICTED: 60S acidic ribosomal protein P2B-like [Sesamum indicum]
Length=115

 Score = 98.2 bits (243),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK++AAYLLAVLGG   PSADDLK IL SVGA+ D DRI+LLL+QV+GKDITELIAAGRE
Sbjct  1    MKIVAAYLLAVLGGNTSPSADDLKDILGSVGAEADEDRIELLLAQVKGKDITELIAAGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_011046262.1| PREDICTED: 60S acidic ribosomal protein P2B-like [Populus euphratica]
Length=114

 Score = 98.2 bits (243),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVLGG  CP+A+DLK+IL SVGAD D DRI+LLLS ++GKD+TELIA+GRE
Sbjct  1    MKVVAAYLLAVLGGNTCPTAEDLKNILGSVGADADDDRIELLLSNMKGKDVTELIASGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_004241310.1| PREDICTED: 60S acidic ribosomal protein P2 [Solanum lycopersicum]
Length=112

 Score = 98.2 bits (243),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 93/113 (82%), Gaps = 1/113 (1%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAAYLLAVLGG   PS  DLK IL+SVGA+ D DRI LLLSQVEGKDITELIAAGRE
Sbjct  1    MKVIAAYLLAVLGGNTSPSEKDLKKILASVGAEADDDRIQLLLSQVEGKDITELIAAGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            KL +    GGG A A  A GGG AAPAAEEKKEEKKVEEKEESDDDMGFSLFD
Sbjct  61   KL-ASVPAGGGAACAVAAPGGGGAAPAAEEKKEEKKVEEKEESDDDMGFSLFD  112



>ref|XP_009777027.1| PREDICTED: 60S acidic ribosomal protein P2-2-like [Nicotiana 
sylvestris]
Length=112

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 91/113 (81%), Gaps = 1/113 (1%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAAYLLAVLGG A PSA DLK IL  VGA+ D DRI+LLLSQVEGKDITELIAAGRE
Sbjct  1    MKVIAAYLLAVLGGNASPSAKDLKSILGCVGAEADDDRIELLLSQVEGKDITELIAAGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            KL +    GGG AVA  A  GGAAA A  E+K+E+K EEKEESDDDMGFSLFD
Sbjct  61   KL-ASVPAGGGGAVAVAAPTGGAAAAAPAEEKKEEKKEEKEESDDDMGFSLFD  112



>ref|XP_009624065.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Nicotiana tomentosiformis]
Length=111

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 88/113 (78%), Gaps = 2/113 (2%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAAYLLAVLGG A PSA DLK IL  VGA+ D DRI LLLSQVEGKDITELIAAGRE
Sbjct  1    MKVIAAYLLAVLGGNASPSAKDLKSILGCVGAEADDDRIKLLLSQVEGKDITELIAAGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            KL       GG +VA  A  GGAAA A  E+K+E+K EEKEESDDDMGFSLFD
Sbjct  61   KL--ASVPAGGGSVAVAAPTGGAAAAAPAEEKKEEKKEEKEESDDDMGFSLFD  111



>emb|CDP06954.1| unnamed protein product [Coffea canephora]
Length=114

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLA+LGG  CPSA D+K IL+SVGAD D ++IDLLLSQV+GKDITELIAAGRE
Sbjct  1    MKVVAAYLLALLGGNTCPSAKDIKAILASVGADADDEKIDLLLSQVDGKDITELIAAGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>gb|KJB16640.1| hypothetical protein B456_002G241200 [Gossypium raimondii]
Length=113

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVLGG   PSADDLK IL SVGA+ + +R+ LLLS+V+GKDITELIA+GRE
Sbjct  1    MKVVAAYLLAVLGGNTSPSADDLKAILGSVGAEAEDERVQLLLSEVKGKDITELIASGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            KLASVPSGGG    AA    G AAAPAA E K+E+KVEEKEESDDDMGFSLFD
Sbjct  61   KLASVPSGGGVAVAAAAPGAGAAAAPAAAEAKKEEKVEEKEESDDDMGFSLFD  113



>gb|KJB21689.1| hypothetical protein B456_004G009000 [Gossypium raimondii]
Length=114

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVLGG A PSADDLK IL SVGA+ D DRI+LLLS+V+GKDITELIA+GRE
Sbjct  1    MKVVAAYLLAVLGGNASPSADDLKVILGSVGAEADDDRIELLLSEVKGKDITELIASGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_009629439.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Nicotiana tomentosiformis]
Length=114

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAA+LLAVLGG A PSA DLK IL+SVGA+ D DR+DLLLSQV+GKDITELIAAGRE
Sbjct  1    MKVIAAFLLAVLGGNASPSAVDLKKILASVGAEADDDRVDLLLSQVKGKDITELIAAGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|NP_001275119.1| uncharacterized protein LOC102577788 [Solanum tuberosum]
 gb|ABA81865.1| unknown [Solanum tuberosum]
Length=162

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAAYLLAVLGG  CPS  DLK IL+SVGA+ D DRI LLLSQV+GKDITELIAAGRE
Sbjct  1    MKVIAAYLLAVLGGNTCPSEKDLKKILASVGAEADDDRIQLLLSQVDGKDITELIAAGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_011094390.1| PREDICTED: 60S acidic ribosomal protein P2-1-like [Sesamum indicum]
Length=115

 Score = 97.4 bits (241),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVLGG A PSA DLK ILSSVGA+ D DRI+LLL+QV+ KDITELIAAGRE
Sbjct  1    MKVVAAYLLAVLGGNATPSAGDLKDILSSVGAEADDDRIELLLTQVKNKDITELIAAGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_010244112.1| PREDICTED: 60S acidic ribosomal protein P2-like [Nelumbo nucifera]
Length=114

 Score = 97.1 bits (240),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK++AAYLLAVLGGK  PSADDLK IL SVGA+ D DRI+LLLS+V+GKDITELIA+GRE
Sbjct  1    MKIVAAYLLAVLGGKIAPSADDLKDILGSVGAEADDDRIELLLSEVKGKDITELIASGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>gb|ABA40434.1| 60s acidic ribosomal protein-like protein [Solanum tuberosum]
Length=115

 Score = 97.1 bits (240),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIA+YLLAVLGG   PSA DLK IL+SVGA+ D DRI+LLLSQV+GKDITELIAAGRE
Sbjct  1    MKVIASYLLAVLGGNTSPSAADLKKILASVGAEADDDRIELLLSQVKGKDITELIAAGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_006349107.1| PREDICTED: 60S acidic ribosomal protein P2-2-like [Solanum tuberosum]
Length=116

 Score = 97.1 bits (240),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIA+YLLAVLGG   PSA DLK IL+SVGA+ D DRI+LLLSQV+GKDITELIAAGRE
Sbjct  1    MKVIASYLLAVLGGNTSPSAADLKKILASVGAEADDDRIELLLSQVKGKDITELIAAGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_006471373.1| PREDICTED: 60S acidic ribosomal protein P2A-like isoform X1 [Citrus 
sinensis]
 ref|XP_006471374.1| PREDICTED: 60S acidic ribosomal protein P2A-like isoform X2 [Citrus 
sinensis]
 ref|XP_006471375.1| PREDICTED: 60S acidic ribosomal protein P2A-like isoform X3 [Citrus 
sinensis]
 ref|XP_006471376.1| PREDICTED: 60S acidic ribosomal protein P2A-like isoform X4 [Citrus 
sinensis]
Length=112

 Score = 97.1 bits (240),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAAYLLAVLGG A PSADDLK+IL SVGA+ D +RI+ LLS+V+GKDITELIA+GRE
Sbjct  1    MKVIAAYLLAVLGGNAKPSADDLKNILGSVGAEADDERIEFLLSEVKGKDITELIASGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_008783987.1| PREDICTED: 60S acidic ribosomal protein P2B-like isoform X1 [Phoenix 
dactylifera]
Length=112

 Score = 96.7 bits (239),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAAYLLAVLGG   P+ADDLK IL SVGA+ D D+I+LLLS+VEGKDITELIA+GRE
Sbjct  1    MKVIAAYLLAVLGGNTSPTADDLKDILGSVGAEADDDKIELLLSEVEGKDITELIASGRE  60

Query  266  KL  271
            K 
Sbjct  61   KF  62



>gb|KDO61085.1| hypothetical protein CISIN_1g033355mg [Citrus sinensis]
Length=121

 Score = 97.1 bits (240),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVLGG   PSADD+K IL SVGADC+ +R++LLLS+V+GKDITELIA+GRE
Sbjct  1    MKVVAAYLLAVLGGNTSPSADDIKGILGSVGADCEDNRLELLLSEVKGKDITELIASGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_006424296.1| hypothetical protein CICLE_v10029621mg [Citrus clementina]
 ref|XP_006424297.1| hypothetical protein CICLE_v10029621mg [Citrus clementina]
 gb|ESR37536.1| hypothetical protein CICLE_v10029621mg [Citrus clementina]
 gb|ESR37537.1| hypothetical protein CICLE_v10029621mg [Citrus clementina]
Length=112

 Score = 96.7 bits (239),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAAYLLAVLGG A PSADDL++IL SVGA+ D +RI+ LLS+V+GKDITELIA+GRE
Sbjct  1    MKVIAAYLLAVLGGNANPSADDLQNILGSVGAEADDERIEFLLSEVKGKDITELIASGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_004228456.1| PREDICTED: 60S acidic ribosomal protein P2 [Solanum lycopersicum]
 ref|XP_006365780.1| PREDICTED: 60S acidic ribosomal protein P2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006365781.1| PREDICTED: 60S acidic ribosomal protein P2-like isoform X2 [Solanum 
tuberosum]
 ref|XP_010327199.1| PREDICTED: 60S acidic ribosomal protein P2 [Solanum lycopersicum]
Length=111

 Score = 96.7 bits (239),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAAYLLAVLGG A PSA DLK+IL  VGA+ D DRI LLLSQV+GKDITELIAAGRE
Sbjct  1    MKVIAAYLLAVLGGNASPSAKDLKNILGCVGAEADDDRIQLLLSQVDGKDITELIAAGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>gb|EPS74099.1| hypothetical protein M569_00658, partial [Genlisea aurea]
Length=121

 Score = 96.7 bits (239),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +2

Query  83   EMKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGR  262
            +MKV+AAYLLAVLGG + P+A+DLK IL SVGAD D +RI+LLLSQV+GKDITELIA+GR
Sbjct  2    DMKVVAAYLLAVLGGNSSPTAEDLKDILGSVGADADDERIELLLSQVKGKDITELIASGR  61

Query  263  EKL  271
            EKL
Sbjct  62   EKL  64



>gb|KHG07914.1| 60S acidic ribosomal P2 [Gossypium arboreum]
Length=114

 Score = 96.7 bits (239),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 94/114 (82%), Gaps = 1/114 (1%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVLGG   PSADDLK IL SVGA+ D DRI+LLLS+V+GKDITELIA+GRE
Sbjct  1    MKVVAAYLLAVLGGNLSPSADDLKDILGSVGAEADDDRIELLLSEVKGKDITELIASGRE  60

Query  266  KLasvps-ggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            KLASVPS GG   A A    GGGA+A  A E K+E+KVEEKEESDDDMGFSLFD
Sbjct  61   KLASVPSGGGAVAAAAPTTGGGGASAAPAAEAKKEEKVEEKEESDDDMGFSLFD  114



>ref|XP_010924305.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Elaeis guineensis]
Length=114

 Score = 96.7 bits (239),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVLGG A PSADDLK IL SVGA+ + +RIDLLL+QV+GKDITELIA GRE
Sbjct  1    MKVVAAYLLAVLGGNANPSADDLKSILESVGAEAEEERIDLLLTQVKGKDITELIATGRE  60

Query  266  KL  271
            K 
Sbjct  61   KF  62



>ref|XP_008788306.1| PREDICTED: 60S acidic ribosomal protein P2B-like [Phoenix dactylifera]
Length=113

 Score = 96.3 bits (238),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVLGG  CP+ADDLK IL SVGA+ D D+I+LLLS+V+GKDITELIA+GRE
Sbjct  1    MKVVAAYLLAVLGGNTCPTADDLKDILGSVGAEADDDKIELLLSEVKGKDITELIASGRE  60

Query  266  KL  271
            K+
Sbjct  61   KV  62



>ref|XP_011467330.1| PREDICTED: 60S acidic ribosomal protein P2-2-like [Fragaria vesca 
subsp. vesca]
Length=114

 Score = 96.3 bits (238),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAAYLLA+LGGK CP+A+D+K ILS+VGA+ D DRI LLL +V+GKDITELIA+GRE
Sbjct  1    MKVIAAYLLALLGGKTCPTAEDIKTILSAVGAEADEDRIQLLLMEVQGKDITELIASGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_008342938.1| PREDICTED: 60S acidic ribosomal protein P2B-like [Malus domestica]
Length=115

 Score = 95.9 bits (237),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 97/115 (84%), Gaps = 2/115 (2%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVLGGK  PSA DLK IL SVGA+ D+D+I+LLLS+V+GKDITELIA+GRE
Sbjct  1    MKVVAAYLLAVLGGKTSPSAADLKDILGSVGAEADSDKIELLLSEVKGKDITELIASGRE  60

Query  266  KLasvps--ggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            KLASVPS  G    +  A   GGGAAAPAA E+K+E+KVEEKEESDDDMGFSLFD
Sbjct  61   KLASVPSGGGAVAYSAPAAGGGGGAAAPAAAEQKKEEKVEEKEESDDDMGFSLFD  115



>ref|XP_008349090.1| PREDICTED: 60S acidic ribosomal protein P2-2-like [Malus domestica]
Length=117

 Score = 95.9 bits (237),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAAYLLAVLGGK  PSA+DLK IL+SVGA+ D DRI LL S++EGKDIT+LIA+GRE
Sbjct  1    MKVIAAYLLAVLGGKNTPSANDLKDILASVGAEADDDRIQLLFSEIEGKDITKLIASGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_008355226.1| PREDICTED: 60S acidic ribosomal protein P2-2-like [Malus domestica]
 ref|XP_008355227.1| PREDICTED: 60S acidic ribosomal protein P2-2-like [Malus domestica]
Length=116

 Score = 95.9 bits (237),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 96/116 (83%), Gaps = 3/116 (3%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVLGGK+ PSA DLK IL SVGA+ D D+I+LLLS+V+GKDITELIA+GRE
Sbjct  1    MKVVAAYLLAVLGGKSSPSAADLKDILGSVGAEADGDKIELLLSEVKGKDITELIASGRE  60

Query  266  KLasvps---ggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            KLASVPS   G    +  A   GGGAA PAA E+K+E+KVEEKEESDDDMGFSLFD
Sbjct  61   KLASVPSGGGGAVAYSTPAAGGGGGAAVPAAAEQKKEEKVEEKEESDDDMGFSLFD  116



>ref|XP_008391761.1| PREDICTED: 60S acidic ribosomal protein P2-2-like [Malus domestica]
Length=115

 Score = 95.9 bits (237),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVLGGK  P+A+DLK IL SVGA+ D DRI LLLS+V+GKDITELIA+GRE
Sbjct  1    MKVVAAYLLAVLGGKTTPTAEDLKDILGSVGAEADDDRIQLLLSEVKGKDITELIASGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>emb|CDP13859.1| unnamed protein product [Coffea canephora]
Length=113

 Score = 95.5 bits (236),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+ AYLLA+LGG  CPS  D+K IL+SVGAD D ++IDLLLSQV+GKDI ELIAAGR+
Sbjct  1    MKVVTAYLLALLGGNTCPSTKDIKAILASVGADVDDEKIDLLLSQVDGKDIIELIAAGRQ  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            KLASVP+GGG     A  + GGAAA  A E K+E+KVEEKEESDDDMGFSLFD
Sbjct  61   KLASVPAGGGAGVAVAAVAAGGAAAAPAAEDKKEEKVEEKEESDDDMGFSLFD  113



>ref|XP_009364278.1| PREDICTED: 60S acidic ribosomal protein P2-2-like [Pyrus x bretschneideri]
Length=116

 Score = 95.5 bits (236),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVLGGK+ PSA DLK IL SVGA+ D D+I+LLLS+V+GKDITELIA+GRE
Sbjct  1    MKVVAAYLLAVLGGKSSPSAADLKDILGSVGAEADGDKIELLLSEVKGKDITELIASGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>gb|KDP42715.1| hypothetical protein JCGZ_23655 [Jatropha curcas]
Length=114

 Score = 95.5 bits (236),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVLGG A PSADD+K ILS VGAD D D++  LLS++EGKDITELIAAGRE
Sbjct  1    MKVVAAYLLAVLGGNAAPSADDIKDILSCVGADVDDDKVRFLLSEIEGKDITELIAAGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_008797513.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Phoenix dactylifera]
Length=110

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVLGG A PS DD+K IL SVGA+ + +RIDLLL+QV+GKDITELIAAGRE
Sbjct  1    MKVVAAYLLAVLGGNADPSTDDIKTILESVGAEGEEERIDLLLTQVKGKDITELIAAGRE  60

Query  266  KL  271
            K 
Sbjct  61   KF  62



>ref|XP_009366640.1| PREDICTED: 60S acidic ribosomal protein P2-2-like [Pyrus x bretschneideri]
 ref|XP_009366641.1| PREDICTED: 60S acidic ribosomal protein P2-2-like [Pyrus x bretschneideri]
Length=114

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVLGGK  P+A+D+K IL SVGA+ D DRI LLLS+V+GKDITELIA+GRE
Sbjct  1    MKVVAAYLLAVLGGKTTPTAEDIKDILGSVGAEADDDRIQLLLSEVKGKDITELIASGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_003554422.1| PREDICTED: 60S acidic ribosomal protein P2-2-like [Glycine max]
Length=113

 Score = 94.7 bits (234),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAAYLLAVLGG A PSADDL+ IL SVGAD + D I   LS+V+GKDI ELIAAGRE
Sbjct  1    MKVIAAYLLAVLGGNAAPSADDLRTILGSVGADANDDNISNFLSEVKGKDIAELIAAGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            KLASVPSGGG     A A GGGAAAPAA E K+E+KVEEKEESDDDMGFSLFD
Sbjct  61   KLASVPSGGGAAVSVAAAPGGGAAAPAAAESKKEEKVEEKEESDDDMGFSLFD  113



>ref|XP_009374748.1| PREDICTED: 60S acidic ribosomal protein P2-2-like [Pyrus x bretschneideri]
Length=117

 Score = 94.7 bits (234),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVLGGK  P+A+D+K IL SVGA+ D DRI LLLS+V+GKDITELIA+GRE
Sbjct  1    MKVVAAYLLAVLGGKTTPTAEDIKDILGSVGAEADDDRIQLLLSEVKGKDITELIASGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_006654480.1| PREDICTED: 60S acidic ribosomal protein P2B-like [Oryza brachyantha]
Length=113

 Score = 94.7 bits (234),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK+IAAYLLAVLGG   PSADD+K+IL SVG + + +R++ L+S++EGKDITE+IAAGRE
Sbjct  1    MKLIAAYLLAVLGGNTSPSADDVKNILESVGVEANEERLEFLISELEGKDITEVIAAGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            K ASVPSGGGG    A  + GG  A  AEE K+E+KVEEKEESDDDMGFSLFD
Sbjct  61   KFASVPSGGGGAIAVAAPAAGGGGAAPAEEAKKEEKVEEKEESDDDMGFSLFD  113



>ref|NP_001055683.1| Os05g0445500 [Oryza sativa Japonica Group]
 gb|AAU44278.1| putative 60S acidic ribosomal protein [Oryza sativa Japonica 
Group]
 dbj|BAF17597.1| Os05g0445500 [Oryza sativa Japonica Group]
 dbj|BAH00501.1| unnamed protein product [Oryza sativa Japonica Group]
Length=113

 Score = 94.4 bits (233),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK+IAAYLLAVLGG   PSADD+K+IL SVG + + +R++ LLS++EGKDITE+IAAGRE
Sbjct  1    MKLIAAYLLAVLGGNTSPSADDIKNILESVGVEANDERLEFLLSELEGKDITEVIAAGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            K ASVPSGGGG    A  +  G  A  AEE K+E+KVEEKEESDDDMGFSLFD
Sbjct  61   KFASVPSGGGGGIAVAAPTAAGGGAAPAEEAKKEEKVEEKEESDDDMGFSLFD  113



>gb|ABK22480.1| unknown [Picea sitchensis]
 gb|ABK23773.1| unknown [Picea sitchensis]
 gb|ABR16343.1| unknown [Picea sitchensis]
 gb|ABR18357.1| unknown [Picea sitchensis]
 gb|ACN40496.1| unknown [Picea sitchensis]
 gb|ACN40723.1| unknown [Picea sitchensis]
Length=114

 Score = 94.4 bits (233),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVLGG   PS+DD+K IL SVG D D D+ID LLSQ+EGKDITE+IA+GRE
Sbjct  1    MKVVAAYLLAVLGGNTSPSSDDIKSILGSVGVDSDDDKIDYLLSQLEGKDITEVIASGRE  60

Query  266  KL  271
            K 
Sbjct  61   KF  62



>ref|XP_010089386.1| 60S acidic ribosomal protein P2-4 [Morus notabilis]
 gb|EXB37739.1| 60S acidic ribosomal protein P2-4 [Morus notabilis]
Length=115

 Score = 94.4 bits (233),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV AAYLLAVLGG A PSA D+K+IL+SVGAD D DRI LLLS++ GKDITE+IAAGRE
Sbjct  1    MKVTAAYLLAVLGGNANPSAYDIKNILASVGADADEDRIKLLLSEIAGKDITEVIAAGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>gb|EYU35149.1| hypothetical protein MIMGU_mgv1a016659mg [Erythranthe guttata]
Length=112

 Score = 94.4 bits (233),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK+IAAYLLAVLGG   PSA+DLKHILSSVGA+ D D I LLL+QV+ KDITELIAAGRE
Sbjct  1    MKIIAAYLLAVLGGNPSPSAEDLKHILSSVGAEADDDMIALLLAQVKDKDITELIAAGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>emb|CDP21644.1| unnamed protein product [Coffea canephora]
Length=113

 Score = 94.4 bits (233),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+ AYLLA+LGG   PSA D+K IL+SVGAD D ++ID+LLSQV+GKDIT+LIAAGRE
Sbjct  1    MKVVTAYLLALLGGNTYPSAKDIKAILASVGADVDDEKIDVLLSQVDGKDITKLIAAGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            KLASVP+GGG     A A+ GGAAA  A E K+E+KVEEKEESDDDMGFSLFD
Sbjct  61   KLASVPAGGGAGVAVAAAAAGGAAAAPAAEDKKEEKVEEKEESDDDMGFSLFD  113



>gb|EEC79308.1| hypothetical protein OsI_20141 [Oryza sativa Indica Group]
Length=188

 Score = 96.3 bits (238),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK+IAAYLLAVLGG   PSADD+K+IL SVG + + +R++ LLS++EGKDITE+IAAGRE
Sbjct  76   MKLIAAYLLAVLGGNTSPSADDIKNILESVGVEANDERLEFLLSELEGKDITEVIAAGRE  135

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            K ASVPSGGGG    A  +  G  A  AEE K+E+KVEEKEESDDDMGFSLFD
Sbjct  136  KFASVPSGGGGGIAVAAPTAAGGGAAPAEEAKKEEKVEEKEESDDDMGFSLFD  188



>gb|KHG14059.1| 60S acidic ribosomal P2 [Gossypium arboreum]
Length=114

 Score = 94.4 bits (233),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAA+LLAVLGG   PSADDLK IL SVGA+ D D+I++LLS+V+GKDITELIA+GRE
Sbjct  1    MKVIAAFLLAVLGGNTNPSADDLKAILGSVGAEADDDKIEMLLSEVKGKDITELIASGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_010031491.1| PREDICTED: 60S acidic ribosomal protein P2-1-like [Eucalyptus 
grandis]
 gb|KCW50802.1| hypothetical protein EUGRSUZ_J00465 [Eucalyptus grandis]
 gb|KCW50803.1| hypothetical protein EUGRSUZ_J00465 [Eucalyptus grandis]
 gb|KCW50804.1| hypothetical protein EUGRSUZ_J00465 [Eucalyptus grandis]
Length=114

 Score = 94.0 bits (232),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAAYLLAVLGG   P+ADDLK IL SVG + D D+I+LLLS+V+GKDITELIA+GRE
Sbjct  1    MKVIAAYLLAVLGGNTTPTADDLKDILGSVGVEADDDKIELLLSEVKGKDITELIASGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_010069674.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Eucalyptus 
grandis]
Length=116

 Score = 94.0 bits (232),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAAYLLAVLGG   PSADDLK IL SVGA+ D D I LLLS+V+GKDITELIAAGRE
Sbjct  1    MKVIAAYLLAVLGGNTTPSADDLKGILGSVGAEADDDGIKLLLSEVKGKDITELIAAGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>gb|KCW50805.1| hypothetical protein EUGRSUZ_J00465 [Eucalyptus grandis]
Length=114

 Score = 94.0 bits (232),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAAYLLAVLGG   P+ADDLK IL SVG + D D+I+LLLS+V+GKDITELIA+GRE
Sbjct  1    MKVIAAYLLAVLGGNTTPTADDLKDILGSVGVEADDDKIELLLSEVKGKDITELIASGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_003521450.1| PREDICTED: 60S acidic ribosomal protein P2-1-like isoform 1 [Glycine 
max]
Length=113

 Score = 94.0 bits (232),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAAYLLAVLGG A PSADDL+ IL SVGAD + D I   LS+V+GKDI ELIA+GRE
Sbjct  1    MKVIAAYLLAVLGGNAAPSADDLRDILGSVGADANDDNISNFLSEVKGKDIVELIASGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            KLASVPSGGG     A A GGG AAPAA E K+E+KVEEKEESDDDMGFSLFD
Sbjct  61   KLASVPSGGGAAVAVAAAPGGGPAAPAAAESKKEEKVEEKEESDDDMGFSLFD  113



>ref|XP_008360542.1| PREDICTED: 60S acidic ribosomal protein P2-1-like [Malus domestica]
 ref|XP_008360549.1| PREDICTED: 60S acidic ribosomal protein P2-1-like [Malus domestica]
Length=116

 Score = 94.0 bits (232),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVLGGK+ PSA DLK IL SVGA+ D D+I+LLL +V+GKDITELIA+GRE
Sbjct  1    MKVVAAYLLAVLGGKSSPSAADLKDILGSVGAEADGDKIELLLXEVKGKDITELIASGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_004303010.1| PREDICTED: 60S acidic ribosomal protein P2-2-like [Fragaria vesca 
subsp. vesca]
Length=114

 Score = 93.6 bits (231),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 97/114 (85%), Gaps = 1/114 (1%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAAYLLAVLGGK  P+A+D+K IL +VGA+ D DRI LLL +V+GKDITELIA+GRE
Sbjct  1    MKVIAAYLLAVLGGKTSPTAEDIKTILGAVGAEADEDRIQLLLKEVKGKDITELIASGRE  60

Query  266  KLasv-psggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            KLASV   GGG VAVAAPA G G AAPAA E K+E+KVEEKEESDDDMGFSLFD
Sbjct  61   KLASVPSGGGGAVAVAAPAGGAGGAAPAAAEAKKEEKVEEKEESDDDMGFSLFD  114



>ref|XP_010275438.1| PREDICTED: 60S acidic ribosomal protein P2-like [Nelumbo nucifera]
Length=114

 Score = 93.6 bits (231),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAAYLLAVLGG   PSADDLK IL SVGA+ + DR++LLLS+++GKDITELIA+GRE
Sbjct  1    MKVIAAYLLAVLGGNLQPSADDLKSILGSVGAEAEDDRLELLLSEIKGKDITELIASGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_004150487.1| PREDICTED: 60S acidic ribosomal protein P2-4-like isoform 1 [Cucumis 
sativus]
 ref|XP_004165174.1| PREDICTED: 60S acidic ribosomal protein P2-4-like isoform 2 [Cucumis 
sativus]
Length=128

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK++AAYLLAVLGG + PSA DLK IL SVGA+ D +RI+LLLS V+GKDITELIA+GRE
Sbjct  1    MKIVAAYLLAVLGGNSNPSAKDLKDILGSVGAEVDEERINLLLSNVKGKDITELIASGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_004150488.1| PREDICTED: 60S acidic ribosomal protein P2-4-like isoform 2 [Cucumis 
sativus]
 ref|XP_004165175.1| PREDICTED: 60S acidic ribosomal protein P2-4-like isoform 3 [Cucumis 
sativus]
 gb|KGN52200.1| hypothetical protein Csa_5G615230 [Cucumis sativus]
Length=114

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK++AAYLLAVLGG + PSA DLK IL SVGA+ D +RI+LLLS V+GKDITELIA+GRE
Sbjct  1    MKIVAAYLLAVLGGNSNPSAKDLKDILGSVGAEVDEERINLLLSNVKGKDITELIASGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_011462847.1| PREDICTED: 60S acidic ribosomal protein P2B-like [Fragaria vesca 
subsp. vesca]
Length=122

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAAY+LAVLGG   P+ADD+K IL SVGA+ D DRI+LLLSQ++GKDI E++A+GRE
Sbjct  1    MKVIAAYMLAVLGGNTSPTADDVKKILGSVGAEADNDRIELLLSQMKGKDINEVVASGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_007162878.1| hypothetical protein PHAVU_001G1882000g, partial [Phaseolus vulgaris]
 gb|ESW34872.1| hypothetical protein PHAVU_001G1882000g, partial [Phaseolus vulgaris]
Length=176

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 56/70 (80%), Gaps = 2/70 (3%)
 Frame = +2

Query  62   PEEQRKEEMKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  241
            P  +RK  MKVIAAYLLAVLGG A PSADDL+ IL SVGAD + D I   LS+V+GKDIT
Sbjct  66   PAFRRK--MKVIAAYLLAVLGGNAAPSADDLRLILGSVGADANDDNISNFLSEVKGKDIT  123

Query  242  ELIAAGREKL  271
            ELIAAGREKL
Sbjct  124  ELIAAGREKL  133



>ref|XP_010241325.1| PREDICTED: 60S acidic ribosomal protein P2-2-like [Nelumbo nucifera]
Length=116

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAAYLLAVLGG   PSADDLK IL SVGA+ + DRI LLL++V+GKDITELIA+GRE
Sbjct  1    MKVIAAYLLAVLGGNLQPSADDLKTILGSVGAEAEDDRIKLLLTEVKGKDITELIASGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_010926364.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Elaeis guineensis]
Length=115

 Score = 92.8 bits (229),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVLGG   PSADD+K IL SVGA+ + +RIDLLL+QV GKDITELIA+GRE
Sbjct  1    MKVVAAYLLAVLGGNVDPSADDIKAILESVGAESEEERIDLLLTQVRGKDITELIASGRE  60

Query  266  KL  271
            K 
Sbjct  61   KF  62



>ref|XP_009613358.1| PREDICTED: 60S acidic ribosomal protein P2-like [Nicotiana tomentosiformis]
Length=114

 Score = 92.8 bits (229),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAAYLLA LGG   PSADDL+ IL+SVGA+ D  +I+LLLSQV+GKDITELIAAG++
Sbjct  1    MKVIAAYLLAQLGGNTNPSADDLRKILNSVGAEIDESKIELLLSQVKGKDITELIAAGKQ  60

Query  266  KL  271
            +L
Sbjct  61   QL  62



>ref|XP_008351356.1| PREDICTED: LOW QUALITY PROTEIN: 60S acidic ribosomal protein 
P2B-like [Malus domestica]
Length=116

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 98/116 (84%), Gaps = 3/116 (3%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPS-ADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGR  262
            MKV+AAYLLAVLGGKA PS A DLK IL SVGA+ D+D+I+LLLS+V+GKDITELIA+GR
Sbjct  1    MKVVAAYLLAVLGGKASPSLAADLKDILGSVGAEADSDKIELLLSEVKGKDITELIASGR  60

Query  263  EKLasvps--ggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            EKLASVPS  G    +  A   GGGAAAPAA E+KEE+KVEEKEESDDDMGFSLFD
Sbjct  61   EKLASVPSGGGAVAYSAPAAVGGGGAAAPAAAEQKEEEKVEEKEESDDDMGFSLFD  116



>ref|XP_010907155.1| PREDICTED: 60S acidic ribosomal protein P2B-like [Elaeis guineensis]
Length=112

 Score = 92.4 bits (228),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVLGG   P+ADDLK IL SVG + D DRI+ LLS+V+GKDITEL+A+GRE
Sbjct  1    MKVVAAYLLAVLGGNTSPTADDLKDILGSVGIEADDDRIEFLLSEVKGKDITELVASGRE  60

Query  266  KL  271
            K 
Sbjct  61   KF  62



>gb|EPS73855.1| hypothetical protein M569_00918, partial [Genlisea aurea]
Length=120

 Score = 92.4 bits (228),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +2

Query  83   EMKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGR  262
            +MKV+AAYLLAVLGG   PS +DLK IL SVGA+   DRI+LLLSQV+GKDITELIA+GR
Sbjct  2    KMKVVAAYLLAVLGGNNSPSTEDLKDILGSVGAEAADDRIELLLSQVKGKDITELIASGR  61

Query  263  EKL  271
            EKL
Sbjct  62   EKL  64



>ref|XP_009394805.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Musa acuminata 
subsp. malaccensis]
Length=114

 Score = 92.0 bits (227),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 86/114 (75%), Gaps = 1/114 (1%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAAYLLAVLGG + PSA D+  IL SVGA+ D  RI+L LS+VEGKDITELIAAGRE
Sbjct  1    MKVIAAYLLAVLGGNSHPSAGDITSILESVGAEVDVKRINLFLSEVEGKDITELIAAGRE  60

Query  266  KLasvp-sggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            K ASVP  G       A A G  A +  AEE K+E+KVEEKEESDDDMGFSLFD
Sbjct  61   KFASVPSGGAVAAVSVAGAGGAAAGSAPAEEPKKEEKVEEKEESDDDMGFSLFD  114



>ref|XP_008446770.1| PREDICTED: 60S acidic ribosomal protein P2-4-like [Cucumis melo]
Length=114

 Score = 92.0 bits (227),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK++AAYLLAVLGG   PSA DLK IL SVGA+ D +RI+LLLS V+GKD+TELIA+GRE
Sbjct  1    MKIVAAYLLAVLGGNTSPSAKDLKDILGSVGAEIDEERIELLLSNVKGKDVTELIASGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_008348607.1| PREDICTED: LOW QUALITY PROTEIN: 60S acidic ribosomal protein 
P2-2-like [Malus domestica]
Length=116

 Score = 92.0 bits (227),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 96/116 (83%), Gaps = 3/116 (3%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSAD-DLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGR  262
            MKV+AAYLLAVLGGKA PSA  DLK IL SVGA+ D D+I+LLLS+V+GKDITELIA+GR
Sbjct  1    MKVVAAYLLAVLGGKASPSAAADLKDILGSVGAEADXDKIELLLSEVKGKDITELIASGR  60

Query  263  EKLasvps--ggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            EKLASVPS  G    +  A   GGGAAAPAA E+K E+KVEEKEESDDDMGFSLFD
Sbjct  61   EKLASVPSGGGAVAYSAPAAXGGGGAAAPAAAEQKXEEKVEEKEESDDDMGFSLFD  116



>sp|P41099.1|RLA2_PARAR RecName: Full=60S acidic ribosomal protein P2 [Parthenium argentatum]
 emb|CAA55047.1| 60s acidic ribosomal protein P2 [Parthenium argentatum]
Length=114

 Score = 92.0 bits (227),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAA+LLA+LGG   P+ +DLK IL+SVGAD D D+I+LLLSQV+GKDITELIA+GRE
Sbjct  1    MKVIAAFLLALLGGNTSPTDEDLKSILASVGADADDDKIELLLSQVKGKDITELIASGRE  60

Query  266  KL  271
            +L
Sbjct  61   RL  62



>ref|XP_004145795.1| PREDICTED: 60S acidic ribosomal protein P2B-like [Cucumis sativus]
 ref|XP_004160090.1| PREDICTED: 60S acidic ribosomal protein P2B-like [Cucumis sativus]
 gb|KGN46936.1| hypothetical protein Csa_6G151730 [Cucumis sativus]
Length=115

 Score = 92.0 bits (227),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 91/115 (79%), Gaps = 2/115 (2%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVLGG   P ADD+K IL+SVGA+ D +RI LLL++V+GKDITELIA+GRE
Sbjct  1    MKVVAAYLLAVLGGNTSPGADDVKSILNSVGAEIDEERITLLLAEVKGKDITELIASGRE  60

Query  266  KLas--vpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            KLAS     G   V+ AA  + GG AA A  E+K+E+KVEEKEESDDDMGFSLFD
Sbjct  61   KLASVPSGGGAIAVSAAAGGATGGGAAAAPAEQKKEEKVEEKEESDDDMGFSLFD  115



>gb|KJB06823.1| hypothetical protein B456_001G120800 [Gossypium raimondii]
Length=116

 Score = 91.7 bits (226),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAA+LLAVLGG   PSADDLK IL SV A+ D D+I++LLS+V+GKDITELIA+GRE
Sbjct  1    MKVIAAFLLAVLGGNTNPSADDLKAILGSVAAEADDDKIEMLLSEVKGKDITELIASGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_010520675.1| PREDICTED: 60S acidic ribosomal protein P2-4-like, partial [Tarenaya 
hassleriana]
Length=74

 Score = 90.5 bits (223),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAA+LLAVLGGKA PSA D+K IL SVGA+ D + I+LLL +V GKDITELIA+GRE
Sbjct  1    MKVIAAFLLAVLGGKASPSAADIKDILGSVGAEVDEESIELLLKEVSGKDITELIASGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>gb|AGE45654.1| ribosomal protein P2B [Picea wilsonii]
Length=115

 Score = 91.7 bits (226),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            M+V+AAYLLAVLGG + PS+DD+K IL SVGAD D ++ID LLSQ++GKDITE+IA+GRE
Sbjct  1    MRVVAAYLLAVLGGNSKPSSDDIKSILGSVGADADDEKIDFLLSQLDGKDITEVIASGRE  60

Query  266  KL  271
            K 
Sbjct  61   KF  62



>ref|XP_010231320.1| PREDICTED: 60S acidic ribosomal protein P2B [Brachypodium distachyon]
Length=113

 Score = 91.7 bits (226),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK+IAAYLLA LGG +CP+ADD+K+IL SVGA+ D D+++ LL++++ KDITE+IAAGRE
Sbjct  1    MKLIAAYLLAYLGGNSCPTADDIKNILESVGAEADEDKLEFLLAELKDKDITEVIAAGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            K ASVPSGGG ++V APA+     A  A E K+E+KVEEKEESDDDMGFSLFD
Sbjct  61   KFASVPSGGGAISVGAPAAAAAGGAAPAAEAKKEEKVEEKEESDDDMGFSLFD  113



>ref|XP_004293299.1| PREDICTED: 60S acidic ribosomal protein P2-like [Fragaria vesca 
subsp. vesca]
Length=113

 Score = 91.7 bits (226),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAY+LAVLGG A PSADD+K IL SVGA+ D ++I+LLLSQ++GKDIT+L+A+G+E
Sbjct  1    MKVVAAYMLAVLGGNASPSADDVKKILGSVGAEADDNKIELLLSQLKGKDITDLVASGKE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_006858566.1| hypothetical protein AMTR_s00071p00177850 [Amborella trichopoda]
 gb|ERN20033.1| hypothetical protein AMTR_s00071p00177850 [Amborella trichopoda]
Length=118

 Score = 91.7 bits (226),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK +A+YLLAVLGG A PS DD+K IL SVGAD D +RI+ LLS+V+GKDITELIA+GRE
Sbjct  1    MKYVASYLLAVLGGNAQPSVDDIKKILGSVGADADEERIEYLLSEVKGKDITELIASGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>gb|EEE63896.1| hypothetical protein OsJ_18721 [Oryza sativa Japonica Group]
Length=308

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK+IAAYLLAVLGG   PSADD+K+IL SVG + + +R++ LLS++EGKDITE+IAAGRE
Sbjct  196  MKLIAAYLLAVLGGNTSPSADDIKNILESVGVEANDERLEFLLSELEGKDITEVIAAGRE  255

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            K ASVPSGGGG    A  +  G  A  AEE K+E+KVEEKEESDDDMGFSLFD
Sbjct  256  KFASVPSGGGGGIAVAAPTAAGGGAAPAEEAKKEEKVEEKEESDDDMGFSLFD  308


 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK+IAAYLLAVLGG   PSADD+K+IL SVG + + +R++ LLS++EGKDITE+IAAGRE
Sbjct  85   MKLIAAYLLAVLGGNTSPSADDIKNILESVGVEANDERLEFLLSELEGKDITEVIAAGRE  144

Query  266  KL  271
            K 
Sbjct  145  KF  146



>ref|XP_010521669.1| PREDICTED: 60S acidic ribosomal protein P2-1-like [Tarenaya hassleriana]
Length=113

 Score = 91.3 bits (225),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AA+LL+VLGGKA P+A+D+K IL SVGA+   + I LLL +V GKDITELIAAGRE
Sbjct  1    MKVVAAFLLSVLGGKASPTAEDIKDILGSVGAEASDEEIQLLLKEVSGKDITELIAAGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            KLASVPSGGG    AAPA+GGG AA  A E+K+E+K EEKEESDDDMGFSLFD
Sbjct  61   KLASVPSGGGVAVAAAPAAGGGGAAAPAAEEKKEEKKEEKEESDDDMGFSLFD  113



>gb|ACJ86110.1| unknown [Medicago truncatula]
 gb|AFK38581.1| unknown [Medicago truncatula]
 gb|KEH16333.1| 60S acidic ribosomal protein [Medicago truncatula]
Length=113

 Score = 90.9 bits (224),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK+IAAY+LAVLGG + PSADD+K ILSSVG + +   I+LLLS+V+GKD  ELIA+GRE
Sbjct  1    MKIIAAYMLAVLGGNSAPSADDIKTILSSVGVEAEDSNIELLLSEVKGKDFAELIASGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            KLASVPSGGG VAVAA   G  AAA  A E KEEKKVEEKEESDDDMGFSLFD
Sbjct  61   KLASVPSGGGAVAVAASGGGAAAAAAPAAEAKEEKKVEEKEESDDDMGFSLFD  113



>gb|AAS20966.1| 60s acidic ribosomal protein [Hyacinthus orientalis]
Length=114

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVLGG   PSA+ +K IL SVGAD + DRI+LLLS+V+GKDITELIA+GRE
Sbjct  1    MKVVAAYLLAVLGGNTTPSAEVIKDILGSVGADAEDDRIELLLSEVKGKDITELIASGRE  60

Query  266  KL  271
            K 
Sbjct  61   KF  62



>ref|XP_008361098.1| PREDICTED: LOW QUALITY PROTEIN: 60S acidic ribosomal protein 
P2B-like [Malus domestica]
Length=116

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 95/116 (82%), Gaps = 3/116 (3%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPS-ADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGR  262
            MKV+AAYLLAVLGGK  PS A DLK IL SVGA+ D D+I+LLLS+V+GKDITELIA+GR
Sbjct  1    MKVVAAYLLAVLGGKTSPSLAADLKDILGSVGAEADXDKIELLLSEVKGKDITELIASGR  60

Query  263  EKLasvps--ggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            EKLASVPS  G    +  A   GGGAAAPA  E+KEE+KVEEKEESDDDMGFSLFD
Sbjct  61   EKLASVPSGGGAVAYSAPAAXGGGGAAAPAXAEQKEEEKVEEKEESDDDMGFSLFD  116



>gb|AFK46271.1| unknown [Lotus japonicus]
Length=115

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAAYLLAVLGG   PSADDLK ILSSVGAD D +++  LLS+V+GKD+ E+IA+GRE
Sbjct  1    MKVIAAYLLAVLGGNTAPSADDLKSILSSVGADADDEKLSFLLSEVKGKDLAEVIASGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>gb|KHN25194.1| 60S acidic ribosomal protein P2B [Glycine soja]
Length=88

 Score = 89.7 bits (221),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVLGG   PSADD+K IL SVG + D DRI+  LS+V+GKDI ELIAAG+E
Sbjct  1    MKVVAAYLLAVLGGNNTPSADDIKEILGSVGIEADEDRIESFLSEVKGKDIVELIAAGKE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_010093218.1| 60S acidic ribosomal protein P2B [Morus notabilis]
 gb|EXB53716.1| 60S acidic ribosomal protein P2B [Morus notabilis]
Length=116

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK+IAAYLLAVLGG   PSA DLK ILSSVG + D  RI LLL++V+GKDITELIA+GRE
Sbjct  1    MKIIAAYLLAVLGGNTSPSAGDLKDILSSVGVEPDEGRIQLLLTEVKGKDITELIASGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_006419121.1| hypothetical protein EUTSA_v10002732mg [Eutrema salsugineum]
 gb|ESQ37557.1| hypothetical protein EUTSA_v10002732mg [Eutrema salsugineum]
Length=112

 Score = 90.1 bits (222),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AA+LLAVLGG A PSAD++K I+ +VGAD D + IDLLL +V GKDITELIA GRE
Sbjct  1    MKVVAAFLLAVLGGNANPSADNIKDIIGAVGADVDGESIDLLLKEVSGKDITELIATGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>gb|AFK45307.1| unknown [Medicago truncatula]
Length=113

 Score = 90.1 bits (222),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK+IAAY+LAVLGG + PSADD+K ILSSVG + +   I+LLLS+V+GKD  ELIA GRE
Sbjct  1    MKIIAAYMLAVLGGNSAPSADDIKTILSSVGVEAEDSNIELLLSEVKGKDFAELIARGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            KLASVPSGGG VAVAA   G  AAA  A E KEEKKVEEKEESDDDMGFSLFD
Sbjct  61   KLASVPSGGGAVAVAASGGGAAAAAAPAAEAKEEKKVEEKEESDDDMGFSLFD  113



>gb|ABK24939.1| unknown [Picea sitchensis]
 gb|ACN40890.1| unknown [Picea sitchensis]
Length=115

 Score = 90.1 bits (222),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            M+V+AAYLLAVLGG + PS++D+K IL SVGAD D ++ID LLSQ++GKDITE+IA+GRE
Sbjct  1    MRVVAAYLLAVLGGNSKPSSEDIKSILGSVGADADDEKIDFLLSQLDGKDITEVIASGRE  60

Query  266  KL  271
            K 
Sbjct  61   KF  62



>ref|XP_009410961.1| PREDICTED: 60S acidic ribosomal protein P2B-like [Musa acuminata 
subsp. malaccensis]
Length=115

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAAYLLAVLGG   PSADD+K IL SVGA+ D  RID LLS+ +GKD+TELIAAGRE
Sbjct  1    MKVIAAYLLAVLGGNTQPSADDIKCILESVGAEVDDGRIDFLLSEAKGKDVTELIAAGRE  60

Query  266  KL  271
            K 
Sbjct  61   KF  62



>ref|XP_004490304.1| PREDICTED: 60S acidic ribosomal protein P2-1-like [Cicer arietinum]
Length=114

 Score = 89.7 bits (221),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK+IAAYLLAVLGGKA P++DD+KHIL+SVG + + ++I+LLL +V+GKD  ELIA+GRE
Sbjct  1    MKIIAAYLLAVLGGKAAPTSDDIKHILTSVGIEAEDEKIELLLGEVKGKDFAELIASGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_006343627.1| PREDICTED: 60S acidic ribosomal protein P2-like [Solanum tuberosum]
Length=112

 Score = 89.7 bits (221),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIA YLLAVLGG   P+A+DLK ILSSVGA+ D  +I+LLLSQV+G+D+ ELIAAGRE
Sbjct  1    MKVIATYLLAVLGGNTNPTAEDLKAILSSVGAEADDTKIELLLSQVKGRDLAELIAAGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_009784712.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Nicotiana sylvestris]
Length=111

 Score = 89.7 bits (221),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAAYLLA LGG A P A++LK ILSSVGA+ D ++++LLLSQV+GKD+TELIAAGRE
Sbjct  1    MKVIAAYLLAALGGNASPMAEELKAILSSVGAEADNEKMELLLSQVKGKDLTELIAAGRE  60



>ref|XP_002264645.1| PREDICTED: 60S acidic ribosomal protein P2 [Vitis vinifera]
 emb|CBI40248.3| unnamed protein product [Vitis vinifera]
Length=115

 Score = 89.7 bits (221),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAAYLLA LGG   P ADDLK IL SVGA+ D D I+LLLS+V+GKDITELIA+GRE
Sbjct  1    MKVIAAYLLAALGGNGSPCADDLKSILGSVGAEADDDGIELLLSEVKGKDITELIASGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_009618588.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Nicotiana tomentosiformis]
Length=112

 Score = 89.7 bits (221),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAAYLL  LGG A P+A+DLK ILSSVGA+ D ++I+LLLSQV+GKD+ ELIAAGRE
Sbjct  1    MKVIAAYLLGALGGNASPTAEDLKAILSSVGAEADNEKIELLLSQVKGKDLAELIAAGRE  60



>ref|XP_004243028.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Solanum lycopersicum]
Length=112

 Score = 89.7 bits (221),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAAYL+A LGG + PSA+DLK IL+SVGA+ D  +I+LLLSQVEG+DI ELIAAG+E
Sbjct  1    MKVIAAYLMAQLGGNSNPSANDLKKILNSVGAEIDDVKIELLLSQVEGRDINELIAAGKE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_009394231.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Musa acuminata 
subsp. malaccensis]
Length=112

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 88/113 (78%), Gaps = 1/113 (1%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAAYLLAVLGG   PSA DLK IL SVGA+ D  R+DL LS+V+GKD+ ELIAAGRE
Sbjct  1    MKVIAAYLLAVLGGNTRPSAGDLKSILESVGAEVDEKRVDLFLSEVKGKDLAELIAAGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            K  +    GG VA  A ++ G  AAPAAEE K+E+KVEEKEESDDDMGFSLFD
Sbjct  61   KF-ASVPSGGAVAAVAVSAPGAGAAPAAEEPKKEEKVEEKEESDDDMGFSLFD  112



>ref|XP_008358569.1| PREDICTED: serpin-ZX-like [Malus domestica]
Length=498

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV AAYLLAVLGGK  PSA+DLK IL SVGA+ D DRI LLLS+VE KDITELIA+GRE
Sbjct  1    MKVEAAYLLAVLGGKTSPSAEDLKDILGSVGAEADDDRIQLLLSEVESKDITELIASGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|NP_001236459.1| uncharacterized protein LOC100500331 [Glycine max]
 ref|XP_006588397.1| PREDICTED: uncharacterized protein LOC100500331 isoform X1 [Glycine 
max]
 gb|ACU15383.1| unknown [Glycine max]
Length=114

 Score = 89.4 bits (220),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVLGG   PSADD+K IL SVG + D DRI+  LS+V+GKDI ELIAAG+E
Sbjct  1    MKVVAAYLLAVLGGNNTPSADDIKEILGSVGIEADEDRIESFLSEVKGKDIVELIAAGKE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_010683782.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Beta vulgaris 
subsp. vulgaris]
Length=111

 Score = 89.0 bits (219),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 81/113 (72%), Gaps = 2/113 (2%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLA LGG A PSA DLK I ++VG + D  RI+L +SQV+GKDITELIAAGRE
Sbjct  1    MKVVAAYLLACLGGNANPSASDLKSIFNAVGIEADDKRIELFMSQVKGKDITELIAAGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            KL       GG  VAA        A  A E ++E+KVEEKEESDDDMGFSLFD
Sbjct  61   KL--ASVPSGGACVAAAPGAAAGGAAPAAEAQKEEKVEEKEESDDDMGFSLFD  111



>ref|XP_008458601.1| PREDICTED: 60S acidic ribosomal protein P2B-like [Cucumis melo]
Length=115

 Score = 89.0 bits (219),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVLGG   P  DD+K IL+SVG + D +RI LLLS+V+GKD+TELIA+GRE
Sbjct  1    MKVVAAYLLAVLGGNTSPGVDDVKAILNSVGVEIDEERITLLLSEVKGKDVTELIASGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_010541287.1| PREDICTED: 60S acidic ribosomal protein P2-4-like [Tarenaya hassleriana]
 ref|XP_010541288.1| PREDICTED: 60S acidic ribosomal protein P2-4-like [Tarenaya hassleriana]
Length=112

 Score = 88.6 bits (218),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 90/113 (80%), Gaps = 1/113 (1%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK IAA+LLAVLGGKA PSA D+K IL SVGA+ D + I+LLL +V GKDITELIA+GRE
Sbjct  1    MKAIAAFLLAVLGGKASPSARDIKDILGSVGAEVDEESIELLLKEVSGKDITELIASGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            KL +    GGG    A A  GG+AAPAAEE+K+E+K EEKEESDDDMGFSLFD
Sbjct  61   KL-ASVPSGGGGVAVASAPAGGSAAPAAEEEKKEEKKEEKEESDDDMGFSLFD  112



>gb|ACG45911.1| 60S acidic ribosomal protein P2A [Zea mays]
Length=113

 Score = 88.6 bits (218),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK +AAYLLAVL G + PSA+DL  IL SVG + D ++++LLLSQ+ GKDITELIAAGRE
Sbjct  1    MKFVAAYLLAVLAGNSSPSAEDLTSILESVGCEVDNEKMELLLSQLSGKDITELIAAGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            K ASVP GGGGVAVAA A   G     A E K+E+KVEEKEESDDDMGFSLFD
Sbjct  61   KFASVPCGGGGVAVAAAAPAAGGGGAPAAEAKKEEKVEEKEESDDDMGFSLFD  113



>gb|AFW81770.1| 60S acidic ribosomal protein P2B [Zea mays]
Length=136

 Score = 89.0 bits (219),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAAYLLAVLGG   P+ADD+K IL SVGA+ D ++++ LL++++ KDITE+IAAGRE
Sbjct  24   MKVIAAYLLAVLGGNTSPTADDVKSILESVGAEADEEKLEFLLTELKDKDITEVIAAGRE  83

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            +L+SVPSGGG + + APA+  G  A  AEE K+E+KVEEKEESD+DMGFSLFD
Sbjct  84   RLSSVPSGGGAIDMGAPAAVAGGGAAPAEEAKKEEKVEEKEESDEDMGFSLFD  136



>pdb|3J61|SS Chain s, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 pdb|3J61|TT Chain t, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 gb|EMS51076.1| 60S acidic ribosomal protein P2A [Triticum urartu]
 gb|EMT13753.1| 60S acidic ribosomal protein P2A [Aegilops tauschii]
Length=113

 Score = 88.2 bits (217),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK IAAYLLA L G A PSA+DL  IL SVG + D ++++L+LSQV+GKDITEL+AAGRE
Sbjct  1    MKFIAAYLLAYLSGNASPSAEDLTSILESVGCEIDNEKMELMLSQVKGKDITELLAAGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            K A+VPSGGGGVAV+A A   G AA  A E K+E+KV EKEESDDDMGFSLFD
Sbjct  61   KFAAVPSGGGGVAVSAAAPAAGGAAAPAAESKKEEKVVEKEESDDDMGFSLFD  113



>ref|XP_004297919.1| PREDICTED: 60S acidic ribosomal protein P2B-like [Fragaria vesca 
subsp. vesca]
Length=122

 Score = 88.6 bits (218),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAAY+LAVLGG   P+ADD+K IL SVGA+ D DRI+LLLSQ++ K+I E++A+GRE
Sbjct  1    MKVIAAYMLAVLGGNTSPTADDVKKILGSVGAEVDNDRIELLLSQMKDKEINEVVASGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_004487515.1| PREDICTED: 60S acidic ribosomal protein P2B-like [Cicer arietinum]
Length=113

 Score = 88.2 bits (217),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK+IAAYLL+VLGG + PSADD+K IL SVG + + ++I+LLL++V+GKD  ELIA+GRE
Sbjct  1    MKIIAAYLLSVLGGNSSPSADDVKKILHSVGIEAEDEKIELLLTEVKGKDFAELIASGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            KL+SVPSGGG VAV+A  +GG AAA  A E KEEKKVEEKEESDDDMGFSLFD
Sbjct  61   KLSSVPSGGGAVAVSAAPAGGAAAAAPAAEAKEEKKVEEKEESDDDMGFSLFD  113



>ref|XP_008668723.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Zea mays]
 gb|ACG24768.1| 60S acidic ribosomal protein P2A [Zea mays]
 gb|ACN35134.1| unknown [Zea mays]
 tpg|DAA35449.1| TPA: acidic ribosomal protein P2a-3 [Zea mays]
Length=113

 Score = 87.8 bits (216),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 85/113 (75%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK +AAYLLAVL G + PSA+DL  IL SVG + D ++++LLLSQ+ GKDITELIAAGRE
Sbjct  1    MKFVAAYLLAVLAGNSSPSAEDLTAILESVGCEVDNEKMELLLSQLSGKDITELIAAGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            K ASVP GGGG    A A      A  A E K+E+KVEEKEESDDDMGFSLFD
Sbjct  61   KFASVPCGGGGGMAVAAAGPAAGGAAPAAEAKKEEKVEEKEESDDDMGFSLFD  113



>ref|XP_006358327.1| PREDICTED: 60S acidic ribosomal protein P2-like [Solanum tuberosum]
Length=118

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAAYLLA LGG + PS++DLK IL+SVGA+ D  +I+LLLSQVEGKDI ELIAAG++
Sbjct  1    MKVIAAYLLAQLGGNSNPSSNDLKKILNSVGAEIDDVKIELLLSQVEGKDINELIAAGKQ  60

Query  266  KL  271
            +L
Sbjct  61   RL  62



>ref|NP_001235654.1| uncharacterized protein LOC100499761 [Glycine max]
 gb|ACU13532.1| unknown [Glycine max]
Length=114

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVLGG   PSAD +K IL SVG + D DRI+  LS+V+GKDI ELIAAGRE
Sbjct  1    MKVVAAYLLAVLGGNNSPSADVIKEILGSVGVEADEDRIESFLSEVKGKDIVELIAAGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_006279385.1| hypothetical protein CARUB_v10008004mg [Capsella rubella]
 gb|EOA12283.1| hypothetical protein CARUB_v10008004mg [Capsella rubella]
Length=113

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV AA+LLAVLGG A PSAD++K I+ +VGAD D + I+LLL +V+GKDI ELIAAGRE
Sbjct  1    MKVAAAFLLAVLGGNANPSADNIKDIIGAVGADVDGESIELLLKEVKGKDIAELIAAGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            KLASVPSGGGG    A A   G  A  A  +K+E K EEKEESDDDMGFSLF+
Sbjct  61   KLASVPSGGGGGGAVAAAPSSGGGAAPAAAEKKEAKKEEKEESDDDMGFSLFE  113



>ref|NP_001132823.1| uncharacterized protein LOC100194313 [Zea mays]
 ref|XP_008654443.1| PREDICTED: uncharacterized protein LOC100194313 isoform X1 [Zea 
mays]
 gb|ACF81831.1| unknown [Zea mays]
 gb|ACG24896.1| 60S acidic ribosomal protein P2A [Zea mays]
 gb|ACG33360.1| 60S acidic ribosomal protein P2A [Zea mays]
 gb|AFW81222.1| acidic ribosomal protein P2a-4 isoform 1 [Zea mays]
 gb|AFW81223.1| acidic ribosomal protein P2a-4 isoform 2 [Zea mays]
 gb|AFW81224.1| acidic ribosomal protein P2a-4 isoform 3 [Zea mays]
 gb|AFW81225.1| acidic ribosomal protein P2a-4 isoform 4 [Zea mays]
Length=112

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVL G A PSA+DL  IL SVG + D +R++LLLSQ+ GKDITELIAAGRE
Sbjct  1    MKVVAAYLLAVLAGNASPSAEDLTGILESVGCEVDNERMELLLSQLSGKDITELIAAGRE  60

Query  266  KL  271
            K 
Sbjct  61   KF  62



>ref|NP_001105390.1| 60S acidic ribosomal protein P2B [Zea mays]
 ref|XP_008655432.1| PREDICTED: 60S acidic ribosomal protein P2B isoform X1 [Zea mays]
 sp|O24415.1|RLA2B_MAIZE RecName: Full=60S acidic ribosomal protein P2B [Zea mays]
 gb|AAB71080.1| acidic ribosomal protein P2b [Zea mays]
 gb|ACF80071.1| unknown [Zea mays]
 gb|ACG35973.1| 60S acidic ribosomal protein P2B [Zea mays]
 gb|ACG37482.1| 60S acidic ribosomal protein P2B [Zea mays]
 gb|AFW81766.1| 60S acidic ribosomal protein P2B isoform 1 [Zea mays]
 gb|AFW81767.1| 60S acidic ribosomal protein P2B isoform 2 [Zea mays]
Length=113

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAAYLLAVLGG   P+ADD+K IL SVGA+ D ++++ LL++++ KDITE+IAAGRE
Sbjct  1    MKVIAAYLLAVLGGNTSPTADDVKSILESVGAEADEEKLEFLLTELKDKDITEVIAAGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            +L+SVPSGGG + + APA+  G  A  AEE K+E+KVEEKEESD+DMGFSLFD
Sbjct  61   RLSSVPSGGGAIDMGAPAAVAGGGAAPAEEAKKEEKVEEKEESDEDMGFSLFD  113



>ref|XP_002439881.1| hypothetical protein SORBIDRAFT_09g021900 [Sorghum bicolor]
 gb|EES18311.1| hypothetical protein SORBIDRAFT_09g021900 [Sorghum bicolor]
Length=112

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAAYLLAVLGG   P+ADD+K+IL SVGA+ D ++++ LL++++ KDITE+IAAGRE
Sbjct  1    MKVIAAYLLAVLGGNTSPTADDVKNILESVGAEADEEKLEFLLTELKDKDITEVIAAGRE  60

Query  266  KL  271
            +L
Sbjct  61   RL  62



>gb|AFW81220.1| acidic ribosomal protein P2a-4 [Zea mays]
Length=120

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVL G A PSA+DL  IL SVG + D +R++LLLSQ+ GKDITELIAAGRE
Sbjct  9    MKVVAAYLLAVLAGNASPSAEDLTGILESVGCEVDNERMELLLSQLSGKDITELIAAGRE  68

Query  266  KL  271
            K 
Sbjct  69   KF  70



>gb|KEH38965.1| 60S acidic ribosomal protein [Medicago truncatula]
Length=113

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK+IAAYLLAVLGG   PSA DLK IL SVG + +   I+LLLS+V+GKD  ELIA+GRE
Sbjct  1    MKIIAAYLLAVLGGNQSPSASDLKQILGSVGVEAEDCNIELLLSEVKGKDFAELIASGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            KLASVPSGGG VAV+A   GG AAA  A E KEEKKVEEKEESDDDMGFSLFD
Sbjct  61   KLASVPSGGGAVAVSAATGGGAAAAAPAAEAKEEKKVEEKEESDDDMGFSLFD  113



>emb|CDP13301.1| unnamed protein product [Coffea canephora]
Length=106

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 83/113 (73%), Gaps = 7/113 (6%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+ AYLLA+L G  CPSA D+K I++SVGAD D ++I +LLSQV+GKDIT+LIAAGRE
Sbjct  1    MKVVTAYLLALLEGNTCPSAKDIKAIIASVGADVDDEKIYVLLSQVDGKDITKLIAAGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            KL         V     A   GAAA  A E K+E+K+EEKEESDDDMGFSLFD
Sbjct  61   KL-------ASVPAGGGAGVAGAAAAPAAEDKKEEKIEEKEESDDDMGFSLFD  106



>ref|XP_002960843.1| hypothetical protein SELMODRAFT_139397 [Selaginella moellendorffii]
 gb|EFJ38382.1| hypothetical protein SELMODRAFT_139397 [Selaginella moellendorffii]
Length=113

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK+IAAYLLAVLGG  CPS+DD+K ILSSVGA+ D  ++  L+S++EGKDI ELIA GR+
Sbjct  1    MKLIAAYLLAVLGGNECPSSDDIKGILSSVGAEADETKLSHLMSELEGKDIVELIAEGRD  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            K ASVPSGG G AVAA A    +AA A E  KE  K EEKEESDDDMGFSLF+
Sbjct  61   KFASVPSGGAGGAVAAAAPAASSAAAAPEAAKEAPKEEEKEESDDDMGFSLFE  113



>gb|AFK39918.1| unknown [Medicago truncatula]
Length=113

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 90/113 (80%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK+IAAYLLAVLGG   PSA DLK IL SVG + +   I+LLLS+V+GKD  ELIA+GRE
Sbjct  1    MKIIAAYLLAVLGGNQSPSASDLKQILGSVGVEAEDCNIELLLSEVKGKDFAELIASGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            KLASVPSGGG VAV A   GG AAA  A E KEEKKVEEKEESDDDMGFSLFD
Sbjct  61   KLASVPSGGGAVAVFAATGGGAAAAAPAAEAKEEKKVEEKEESDDDMGFSLFD  113



>ref|XP_010425874.1| PREDICTED: 60S acidic ribosomal protein P2-4 [Camelina sativa]
Length=113

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV AA+LLAVLGG A PSA+++K I+ +VGAD D + IDLLL +V GKDI ELIA+GRE
Sbjct  1    MKVAAAFLLAVLGGNANPSAENIKDIIGAVGADVDGESIDLLLKEVSGKDIAELIASGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            KLASVPSGG  VAVAA  S GG  A  A  +K+E K EEKEESDDDMGFSLF+
Sbjct  61   KLASVPSGGACVAVAAAPSSGGGGAAPAAAEKKEAKKEEKEESDDDMGFSLFE  113



>ref|XP_010686061.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Beta vulgaris 
subsp. vulgaris]
Length=112

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 84/113 (74%), Gaps = 1/113 (1%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK++ AYLLA LGGK+ P+ DD+KHILSSVG + D DR+ L  ++V GKD+ ELIAAGRE
Sbjct  1    MKIVCAYLLAALGGKSSPTVDDVKHILSSVGIEADEDRLKLFFNEVSGKDLAELIAAGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            KL +    GGG   AA A G G  A AA E  +E+KVEEKEESDDDMGFSLFD
Sbjct  61   KL-ATVPSGGGGVAAAAAPGAGGGAAAAAEAPKEEKVEEKEESDDDMGFSLFD  112



>ref|XP_008655428.1| PREDICTED: acidic ribosomal protein P2a-2 isoform X2 [Zea mays]
 ref|XP_008655429.1| PREDICTED: acidic ribosomal protein P2a-2 isoform X2 [Zea mays]
 gb|ACR38037.1| unknown [Zea mays]
 gb|AFW81214.1| hypothetical protein ZEAMMB73_006495 [Zea mays]
Length=131

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK +AAYLLAVL G A PSA+DL  IL SVG + D +R++LLLSQ+ GKDITELIAAGRE
Sbjct  1    MKFVAAYLLAVLAGNASPSAEDLTAILESVGCEVDNERMELLLSQLSGKDITELIAAGRE  60

Query  266  KL  271
            K 
Sbjct  61   KF  62



>ref|XP_010503106.1| PREDICTED: 60S acidic ribosomal protein P2-4-like [Camelina sativa]
Length=113

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 90/113 (80%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV AA+LLAVLGG A PSA ++K I+ +VGAD D + IDLLL +V GKDI ELIA+GRE
Sbjct  1    MKVAAAFLLAVLGGNANPSAQNIKDIIGAVGADVDGESIDLLLKEVSGKDIAELIASGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            KLASVPSGGG  AVAA  S GGAAA  A  +K+E K EEKEESDDDMGFSLF+
Sbjct  61   KLASVPSGGGCGAVAAAPSSGGAAAAPAAAEKKEAKKEEKEESDDDMGFSLFE  113



>ref|XP_008801232.1| PREDICTED: 60S acidic ribosomal protein P2-like [Phoenix dactylifera]
 ref|XP_008779283.1| PREDICTED: 60S acidic ribosomal protein P2-like [Phoenix dactylifera]
Length=115

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAAYLLAVLGG   PS+DDLK IL SVG +   DRI+ LLS+V+GKDITEL+A GRE
Sbjct  1    MKVIAAYLLAVLGGNNNPSSDDLKDILGSVGVEAGDDRIEFLLSEVKGKDITELVACGRE  60

Query  266  K  268
            K
Sbjct  61   K  61



>gb|AAT08664.1| acidic ribosomal protein [Hyacinthus orientalis]
Length=114

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVLGG   PSA+ +K IL SVGA+ + DRI LLLS+V+GKDITELIA+GRE
Sbjct  1    MKVVAAYLLAVLGGNTTPSAEVIKDILGSVGAEAEDDRILLLLSEVKGKDITELIASGRE  60

Query  266  KL  271
            K 
Sbjct  61   KF  62



>ref|XP_008655431.1| PREDICTED: 60S acidic ribosomal protein P2B isoform X2 [Zea mays]
 gb|ACN33932.1| unknown [Zea mays]
 gb|AFW81768.1| 60S acidic ribosomal protein P2B [Zea mays]
Length=136

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAAYLLAVLGG   P+ADD+K IL SVGA+ D ++++ LL++++ KDITE+IAAGRE
Sbjct  24   MKVIAAYLLAVLGGNTSPTADDVKSILESVGAEADEEKLEFLLTELKDKDITEVIAAGRE  83

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            +L+SVPSGGG + + APA+  G  A  AEE K+E+KVEEKEESD+DMGFSLFD
Sbjct  84   RLSSVPSGGGAIDMGAPAAVAGGGAAPAEEAKKEEKVEEKEESDEDMGFSLFD  136



>ref|NP_001105388.1| acidic ribosomal protein P2a-2 [Zea mays]
 ref|XP_008655430.1| PREDICTED: acidic ribosomal protein P2a-2 isoform X1 [Zea mays]
 gb|AAD11459.1| acidic ribosomal protein P2a-2 [Zea mays]
 gb|ACG37632.1| 60S acidic ribosomal protein P2A [Zea mays]
 gb|ACG39438.1| 60S acidic ribosomal protein P2A [Zea mays]
 gb|ACL52769.1| unknown [Zea mays]
 gb|ACN27443.1| unknown [Zea mays]
 gb|AFW81212.1| 60S acidic ribosomal protein P2AAcidic ribosomal protein P2a-2 
isoform 1 [Zea mays]
 gb|AFW81213.1| 60S acidic ribosomal protein P2AAcidic ribosomal protein P2a-2 
isoform 2 [Zea mays]
Length=112

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK +AAYLLAVL G A PSA+DL  IL SVG + D +R++LLLSQ+ GKDITELIAAGRE
Sbjct  1    MKFVAAYLLAVLAGNASPSAEDLTAILESVGCEVDNERMELLLSQLSGKDITELIAAGRE  60

Query  266  KL  271
            K 
Sbjct  61   KF  62



>ref|XP_004297921.1| PREDICTED: 60S acidic ribosomal protein P2B-like [Fragaria vesca 
subsp. vesca]
Length=122

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAAY+LA+LGG   P+A D+K IL SVGA+ D DRI+LLLSQ++ KDI E++A+GRE
Sbjct  1    MKVIAAYMLAILGGNTSPTAGDVKKILGSVGAEADNDRIELLLSQMKYKDINEVVASGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|NP_001105377.1| 60S acidic ribosomal protein P2A precursor [Zea mays]
 gb|AAC49360.1| acidic ribosomal protein P2 [Zea mays]
Length=112

 Score = 86.3 bits (212),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK +AAYLLAVL G A PSADDL  IL SVG + D ++++LLLSQ+ GKDITELIAAGRE
Sbjct  1    MKFVAAYLLAVLAGNASPSADDLTAILESVGCEVDNEKMELLLSQLSGKDITELIAAGRE  60

Query  266  KL  271
            K 
Sbjct  61   KF  62



>sp|P46252.3|RLA2A_MAIZE RecName: Full=60S acidic ribosomal protein P2A; Short=P2 [Zea 
mays]
 emb|CAA60251.1| 60S acidic ribosomal protein [Zea mays]
 gb|ACG24651.1| 60S acidic ribosomal protein P2A [Zea mays]
 gb|ACG27449.1| 60S acidic ribosomal protein P2A [Zea mays]
 gb|ACG36965.1| 60S acidic ribosomal protein P2A [Zea mays]
Length=112

 Score = 86.3 bits (212),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK +AAYLLAVL G A PSADDL  IL SVG + D ++++LLLSQ+ GKDITELIAAGRE
Sbjct  1    MKFVAAYLLAVLAGNASPSADDLTAILESVGCEVDNEKMELLLSQLSGKDITELIAAGRE  60

Query  266  KL  271
            K 
Sbjct  61   KF  62



>ref|XP_008655427.1| PREDICTED: 60S acidic ribosomal protein P2A isoform X1 [Zea mays]
 gb|ACR34136.1| unknown [Zea mays]
 gb|AFW81215.1| acidic ribosomal protein P2a isoform 1 [Zea mays]
 gb|AFW81216.1| acidic ribosomal protein P2a isoform 2 [Zea mays]
 gb|AFW81217.1| acidic ribosomal protein P2a isoform 3 [Zea mays]
Length=112

 Score = 86.3 bits (212),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK +AAYLLAVL G A PSADDL  IL SVG + D ++++LLLSQ+ GKDITELIAAGRE
Sbjct  1    MKFVAAYLLAVLAGNASPSADDLTAILESVGCEVDNEKMELLLSQLSGKDITELIAAGRE  60

Query  266  KL  271
            K 
Sbjct  61   KF  62



>ref|XP_004975549.1| PREDICTED: 60S acidic ribosomal protein P2A-like isoform X2 [Setaria 
italica]
Length=112

 Score = 86.3 bits (212),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK +AAYLLAVL G   PSA+DL  IL SVGA+ D ++++LLLSQ+ GKDITELIAAGRE
Sbjct  1    MKFVAAYLLAVLAGNNSPSAEDLTTILESVGAEVDNEKMELLLSQLSGKDITELIAAGRE  60

Query  266  KL  271
            K 
Sbjct  61   KF  62



>ref|XP_004973771.1| PREDICTED: 60S acidic ribosomal protein P2A-like isoform X2 [Setaria 
italica]
Length=112

 Score = 86.3 bits (212),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK +AAYLLAVL G   PSA+DL  IL SVGA+ D ++++LLLSQ+ GKDITELIAAGRE
Sbjct  1    MKFVAAYLLAVLAGNNSPSAEDLTTILESVGAEVDNEKMELLLSQLSGKDITELIAAGRE  60

Query  266  KL  271
            K 
Sbjct  61   KF  62



>ref|XP_008462549.1| PREDICTED: 60S acidic ribosomal protein P2-like isoform X1 [Cucumis 
melo]
Length=118

 Score = 86.3 bits (212),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVLGG   PSA D+  IL SVGA+ D ++I+LLL++V+GKDITELIA GRE
Sbjct  1    MKVVAAYLLAVLGGNKTPSAQDINTILYSVGAEADVEKIELLLAEVKGKDITELIACGRE  60

Query  266  KL  271
            K+
Sbjct  61   KM  62



>ref|XP_002315449.1| 60s acidic ribosomal family protein [Populus trichocarpa]
 gb|EEF01620.1| 60s acidic ribosomal family protein [Populus trichocarpa]
Length=110

 Score = 86.3 bits (212),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 54/62 (87%), Gaps = 1/62 (2%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK +AA+LLAVLGG   PSA+D+K IL+SVGA+ D D+I+LLLSQV+ KDITELIAAGRE
Sbjct  1    MKTVAAFLLAVLGGNNSPSAEDIKKILASVGAEAD-DKIELLLSQVKDKDITELIAAGRE  59

Query  266  KL  271
            KL
Sbjct  60   KL  61



>ref|XP_006643860.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Oryza brachyantha]
Length=113

 Score = 86.3 bits (212),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK ++AYL+AVL G + P+A+DL  IL SVG + D+++++LLLSQV G+DITELIA+GRE
Sbjct  1    MKFVSAYLMAVLAGNSNPTAEDLTAILESVGCEIDSEKMELLLSQVSGRDITELIASGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            K ASVPSGGG     A  + GGA    A E K+E+KVEEKEESDDDMGFSLFD
Sbjct  61   KFASVPSGGGAAVAVAAPASGGAGGAPAAEAKKEEKVEEKEESDDDMGFSLFD  113



>ref|XP_002441563.1| hypothetical protein SORBIDRAFT_09g029390 [Sorghum bicolor]
 gb|EES19993.1| hypothetical protein SORBIDRAFT_09g029390 [Sorghum bicolor]
Length=112

 Score = 86.3 bits (212),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK IAAYLLAVL G + PSA+DL  IL SVG + D +R++LLLSQ+ GKDITELIAAGRE
Sbjct  1    MKFIAAYLLAVLAGNSSPSAEDLTAILESVGCEVDNERMELLLSQLSGKDITELIAAGRE  60

Query  266  KL  271
            K 
Sbjct  61   KF  62



>gb|AAP80619.1|AF475097_1 acidic ribosomal protein P2, partial [Triticum aestivum]
 gb|AAP80644.1|AF475123_1 acidic ribosomal protein P2a-2 [Triticum aestivum]
Length=112

 Score = 86.3 bits (212),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = +2

Query  89   KVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGREK  268
            K IAAYLLA L G A PSA+DL  IL SVG + D ++++L+LSQV+GKDITEL+AAGREK
Sbjct  1    KFIAAYLLAYLSGNASPSAEDLTSILESVGCEIDNEKMELMLSQVKGKDITELLAAGREK  60

Query  269  LasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
             A+VPSGGGGVAV+A A   G AA  A E K+E+KV EKEESDDDMGFSLFD
Sbjct  61   FAAVPSGGGGVAVSAAAPAAGGAAAPAAESKKEEKVVEKEESDDDMGFSLFD  112



>ref|XP_002967170.1| hypothetical protein SELMODRAFT_28094, partial [Selaginella moellendorffii]
 gb|EFJ31769.1| hypothetical protein SELMODRAFT_28094, partial [Selaginella moellendorffii]
Length=69

 Score = 84.7 bits (208),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK+IAAYLLAVLGG  CPS+DD+K ILSSVGA+ D  ++  L+S++EGKDI ELIA GR+
Sbjct  1    MKLIAAYLLAVLGGNECPSSDDIKGILSSVGAEADETKLSHLMSELEGKDIVELIAEGRD  60

Query  266  KL  271
            K 
Sbjct  61   KF  62



>ref|XP_006292078.1| hypothetical protein CARUB_v10018273mg [Capsella rubella]
 gb|EOA24976.1| hypothetical protein CARUB_v10018273mg [Capsella rubella]
Length=112

 Score = 85.9 bits (211),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV AA+LLAVLGG A PSAD++K I+ +VGAD D + I+LLL +V+GKDI ELIAAGRE
Sbjct  1    MKVAAAFLLAVLGGNANPSADNIKDIIGAVGADVDGESIELLLKEVKGKDIAELIAAGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_002950613.1| hypothetical protein VOLCADRAFT_120883 [Volvox carteri f. nagariensis]
 gb|EFJ48359.1| hypothetical protein VOLCADRAFT_120883 [Volvox carteri f. nagariensis]
Length=115

 Score = 85.9 bits (211),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            M+V++AYLLAVLGGKA P+ADD+  ILSSVG + DAD+++ L+S++EGKD+ E++AAGR 
Sbjct  1    MRVVSAYLLAVLGGKASPTADDINKILSSVGVEADADKVNKLISELEGKDLQEVLAAGRA  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_004961921.1| PREDICTED: 60S acidic ribosomal protein P2B-like isoform X2 [Setaria 
italica]
Length=112

 Score = 85.9 bits (211),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK+IAAYLLAVLGG   P+ADD+K IL SVGA+ D +++D LL++++ KDITE+IAAGRE
Sbjct  1    MKMIAAYLLAVLGGNTSPTADDVKSILESVGAETDEEKLDFLLTELKDKDITEVIAAGRE  60

Query  266  KL  271
            K 
Sbjct  61   KF  62



>ref|XP_008462550.1| PREDICTED: 60S acidic ribosomal protein P2-like isoform X2 [Cucumis 
melo]
Length=115

 Score = 85.9 bits (211),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVLGG   PSA D+  IL SVGA+ D ++I+LLL++V+GKDITELIA GRE
Sbjct  1    MKVVAAYLLAVLGGNKTPSAQDINTILYSVGAEADVEKIELLLAEVKGKDITELIACGRE  60

Query  266  KL  271
            K+
Sbjct  61   KM  62



>gb|AFW81218.1| acidic ribosomal protein P2a [Zea mays]
Length=164

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK +AAYLLAVL G A PSADDL  IL SVG + D ++++LLLSQ+ GKDITELIAAGRE
Sbjct  1    MKFVAAYLLAVLAGNASPSADDLTAILESVGCEVDNEKMELLLSQLSGKDITELIAAGRE  60

Query  266  KL  271
            K 
Sbjct  61   KF  62



>gb|KHN27663.1| 60S acidic ribosomal protein P2B [Glycine soja]
Length=111

 Score = 85.9 bits (211),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVLGG   PSADD+KHIL +VGA+ + + I+LLL++V+GKD  ELIA+G E
Sbjct  1    MKVVAAYLLAVLGGNPSPSADDIKHILGAVGAEAENELIELLLTEVKGKDFNELIASGSE  60

Query  266  KL  271
            K+
Sbjct  61   KM  62



>ref|XP_007145332.1| hypothetical protein PHAVU_007G230200g [Phaseolus vulgaris]
 gb|ESW17326.1| hypothetical protein PHAVU_007G230200g [Phaseolus vulgaris]
Length=114

 Score = 85.9 bits (211),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVLGG   PSA  +K IL SVGA+ D DRI+L LS+V+GKDI E+IAAGRE
Sbjct  1    MKVVAAYLLAVLGGNQSPSAAVIKDILGSVGAEADDDRIELFLSEVKGKDIVEVIAAGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>gb|AFW81221.1| hypothetical protein ZEAMMB73_796524, partial [Zea mays]
Length=317

 Score = 88.6 bits (218),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +2

Query  80   EEMKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAG  259
              MKV+AAYLLAVL G A PSA+DL  IL SVG + D +R++LLLSQ+ GKDITELIAAG
Sbjct  7    SRMKVVAAYLLAVLAGNASPSAEDLTGILESVGCEVDNERMELLLSQLSGKDITELIAAG  66

Query  260  REKL  271
            REK 
Sbjct  67   REKF  70



>gb|KJB06824.1| hypothetical protein B456_001G120800 [Gossypium raimondii]
Length=114

 Score = 85.5 bits (210),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 53/62 (85%), Gaps = 2/62 (3%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAA+LLAVLGG   PSADDLK IL S  A+ D D+I++LLS+V+GKDITELIA+GRE
Sbjct  1    MKVIAAFLLAVLGGNTNPSADDLKAILGS--AEADDDKIEMLLSEVKGKDITELIASGRE  58

Query  266  KL  271
            KL
Sbjct  59   KL  60



>ref|XP_003579690.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Brachypodium 
distachyon]
 ref|XP_010239875.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Brachypodium 
distachyon]
Length=113

 Score = 85.1 bits (209),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK IAAYLLA L G + PSA+DL  IL SVG + D ++++L+LSQV+GKDI EL+AAGRE
Sbjct  1    MKFIAAYLLAYLSGNSSPSAEDLTTILESVGCEIDNEKMELMLSQVKGKDIAELLAAGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            K ASVPSGGGGVAVAA A   G    A   +K+E+KV EKEESDDDMGFSLFD
Sbjct  61   KFASVPSGGGGVAVAAAAPASGGGGAAPAAEKKEEKVVEKEESDDDMGFSLFD  113



>ref|XP_004167615.1| PREDICTED: LOW QUALITY PROTEIN: 60S acidic ribosomal protein 
P2B-like [Cucumis sativus]
Length=115

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVLGG   PSA D+  ILSSVGA+ + ++I+LL+++++GKDITELIA GRE
Sbjct  1    MKVVAAYLLAVLGGNKTPSAQDINTILSSVGAEAEVEKIELLIAELKGKDITELIAYGRE  60

Query  266  KL  271
            K+
Sbjct  61   KM  62



>ref|NP_190045.1| 60S acidic ribosomal protein P2-4 [Arabidopsis thaliana]
 ref|NP_974384.1| 60S acidic ribosomal protein P2-4 [Arabidopsis thaliana]
 sp|Q9LXM8.1|RLA24_ARATH RecName: Full=60S acidic ribosomal protein P2-4 [Arabidopsis 
thaliana]
 emb|CAB88541.1| acidic ribosomal protein P2-like [Arabidopsis thaliana]
 gb|AAO44014.1| At3g44590 [Arabidopsis thaliana]
 dbj|BAF00290.1| acidic ribosomal protein P2 -like [Arabidopsis thaliana]
 gb|AEE77918.1| 60S acidic ribosomal protein P2-4 [Arabidopsis thaliana]
 gb|AEE77919.1| 60S acidic ribosomal protein P2-4 [Arabidopsis thaliana]
Length=111

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV AA+LLAVLGG A PSAD++K I+ +VGAD D + I+LLL +V GKDI ELIA+GRE
Sbjct  1    MKVAAAFLLAVLGGNANPSADNIKDIIGAVGADVDGESIELLLKEVSGKDIAELIASGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_002448737.1| hypothetical protein SORBIDRAFT_06g032330 [Sorghum bicolor]
 gb|EES13065.1| hypothetical protein SORBIDRAFT_06g032330 [Sorghum bicolor]
Length=112

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK IAAYLLAVLGG   PSA+DL  IL SVG + D ++++LLLSQ+ GKDITELIAAGRE
Sbjct  1    MKFIAAYLLAVLGGNLSPSAEDLAAILESVGCEVDNEKMELLLSQLSGKDITELIAAGRE  60

Query  266  KL  271
            K 
Sbjct  61   KF  62



>ref|XP_010514785.1| PREDICTED: 60S acidic ribosomal protein P2-4-like [Camelina sativa]
 ref|XP_010514786.1| PREDICTED: 60S acidic ribosomal protein P2-4-like [Camelina sativa]
Length=113

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV AA+LLAVLGG A PSA+++K I+ +VGAD D + I+LLL ++ GKDI ELIA+GRE
Sbjct  1    MKVAAAFLLAVLGGNANPSAENIKDIIGAVGADVDGESIELLLKEMSGKDIAELIASGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            KLASVPSGGG  AVAA  S GGAAA  A  +K+E K EEKEESDDDMGFSLF+
Sbjct  61   KLASVPSGGGCGAVAAAPSSGGAAAAPAAAEKKEAKKEEKEESDDDMGFSLFE  113



>ref|XP_004961920.1| PREDICTED: 60S acidic ribosomal protein P2B-like isoform X1 [Setaria 
italica]
Length=128

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK+IAAYLLAVLGG   P+ADD+K IL SVGA+ D +++D LL++++ KDITE+IAAGRE
Sbjct  1    MKMIAAYLLAVLGGNTSPTADDVKSILESVGAETDEEKLDFLLTELKDKDITEVIAAGRE  60

Query  266  KL  271
            K 
Sbjct  61   KF  62



>ref|XP_004973770.1| PREDICTED: 60S acidic ribosomal protein P2A-like isoform X1 [Setaria 
italica]
Length=148

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK +AAYLLAVL G   PSA+DL  IL SVGA+ D ++++LLLSQ+ GKDITELIAAGRE
Sbjct  1    MKFVAAYLLAVLAGNNSPSAEDLTTILESVGAEVDNEKMELLLSQLSGKDITELIAAGRE  60

Query  266  KL  271
            K 
Sbjct  61   KF  62



>gb|ACN30980.1| unknown [Zea mays]
Length=112

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK +AAYLLAVL G + PSA+DL  IL SVG + D ++++LLLSQ+ GKDITELIAAGRE
Sbjct  1    MKFVAAYLLAVLAGNSSPSAEDLTAILESVGCEVDNEKMELLLSQLSGKDITELIAAGRE  60

Query  266  KL  271
            K 
Sbjct  61   KF  62



>ref|XP_002447780.1| hypothetical protein SORBIDRAFT_06g015440 [Sorghum bicolor]
 gb|EES12108.1| hypothetical protein SORBIDRAFT_06g015440 [Sorghum bicolor]
Length=112

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK +AAYLLAVL G   PS +DLK IL SVGA+ D+++++ LLSQV GKDITELIAAGRE
Sbjct  1    MKFVAAYLLAVLAGNNDPSVEDLKTILESVGAETDSEKMEHLLSQVSGKDITELIAAGRE  60

Query  266  KL  271
            K 
Sbjct  61   KF  62



>ref|XP_010473164.1| PREDICTED: 60S acidic ribosomal protein P2-1-like [Camelina sativa]
Length=114

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAA+LLAVL GKA P++ D+K IL SVGA+ +  +I+LLL +V+GKD+TELIAAGRE
Sbjct  1    MKVIAAFLLAVLSGKASPTSSDIKDILGSVGAETEDSQIELLLKEVKGKDLTELIAAGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>dbj|BAJ92129.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=113

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 90/113 (80%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK IAAYLLA L G A PSA+DL  IL SVG + D ++++L+L QV+GKDITEL+AAGRE
Sbjct  1    MKFIAAYLLAYLSGNASPSAEDLTSILESVGCEIDNEKMELMLCQVKGKDITELLAAGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            K A+VPSGGGGVAV+A A   G AA  A E K+E+KV EKEESDDDMGFSLFD
Sbjct  61   KFAAVPSGGGGVAVSAAAPSAGGAAAPAAESKKEEKVVEKEESDDDMGFSLFD  113



>gb|AFK40789.1| unknown [Lotus japonicus]
Length=115

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVLGG + PSADDLK+IL SVG + + + I+LLL +V+GKD  ELIA+GRE
Sbjct  1    MKVVAAYLLAVLGGNSSPSADDLKNILGSVGIEIEDELIELLLKEVKGKDFAELIASGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>gb|KFK32382.1| hypothetical protein AALP_AA6G233900 [Arabis alpina]
Length=115

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AA+LLAVLGGKA P++ D+K IL SVGA+ +  +I+LLL +V+GKD+ ELIAAGRE
Sbjct  1    MKVVAAFLLAVLGGKASPTSGDIKAILGSVGAESEDAQIELLLKEVKGKDVAELIAAGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_009140817.1| PREDICTED: 60S acidic ribosomal protein P2-2-like [Brassica rapa]
 emb|CDY30535.1| BnaA04g15980D [Brassica napus]
Length=113

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AA+LLAVL GKACP++ D+K IL+SVG + +  +I+LLL +V GKD+ ELIA GRE
Sbjct  1    MKVVAAFLLAVLSGKACPTSADIKVILNSVGCETEDSQIELLLKEVNGKDVAELIAVGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            KLASVPSGGGGVA+A+  S GG    A  E K+E+K EEKEESDDDMGFSLF+
Sbjct  61   KLASVPSGGGGVAMASAPSAGGGGGAAPAEAKKEEKKEEKEESDDDMGFSLFE  113



>ref|NP_001047015.1| Os02g0529700 [Oryza sativa Japonica Group]
 dbj|BAD25435.1| putative 60S acidic ribosomal protein P2A [Oryza sativa Japonica 
Group]
 dbj|BAF08929.1| Os02g0529700 [Oryza sativa Japonica Group]
 gb|EAY86117.1| hypothetical protein OsI_07489 [Oryza sativa Indica Group]
 gb|EAZ23293.1| hypothetical protein OsJ_06990 [Oryza sativa Japonica Group]
 dbj|BAH00255.1| unnamed protein product [Oryza sativa Japonica Group]
Length=113

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK I+AYLLA L G   PSA+DL  IL SVGA+ D  +++LLLSQ+ GKDITE+IA+GRE
Sbjct  1    MKFISAYLLATLAGNPNPSAEDLTTILESVGAEVDHGKMELLLSQLAGKDITEIIASGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            K ASVP GGGGVAVAA A   G  A    E K+E+KVEEKEESDDDMGFSLFD
Sbjct  61   KFASVPCGGGGVAVAAAAPAAGGGAAPQSEAKKEEKVEEKEESDDDMGFSLFD  113



>ref|XP_008663721.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Zea mays]
 gb|ACF86127.1| unknown [Zea mays]
 gb|ACG30918.1| 60S acidic ribosomal protein P2A [Zea mays]
 gb|AFW59828.1| acidic ribosomal protein P2a-4 [Zea mays]
Length=111

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK +AAYLLAVL G + PSA+DL  IL SVG + D ++++LLLSQ+ GKDITELIAAGRE
Sbjct  1    MKFVAAYLLAVLAGNSSPSAEDLTAILESVGCEVDNEKMELLLSQLSGKDITELIAAGRE  60

Query  266  KL  271
            K 
Sbjct  61   KF  62



>dbj|BAH57243.1| AT2G27710 [Arabidopsis thaliana]
Length=97

 Score = 83.6 bits (205),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVL GKA P++ D+K IL SVGA+ +  +I+LLL +V+GKD+ ELIAAGRE
Sbjct  1    MKVVAAYLLAVLSGKASPTSADIKTILGSVGAETEDSQIELLLKEVKGKDLAELIAAGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_010510738.1| PREDICTED: 60S acidic ribosomal protein P2-1-like [Camelina sativa]
 ref|XP_010510744.1| PREDICTED: 60S acidic ribosomal protein P2-1-like [Camelina sativa]
Length=114

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AA+LLAVL GKA P++ D+K IL SVGA+ +  +I+LLL +V+GKD+TELIAAGRE
Sbjct  1    MKVVAAFLLAVLSGKASPTSTDIKDILGSVGAETEDSQIELLLKEVKGKDLTELIAAGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|NP_001189621.1| 60S acidic ribosomal protein P2-2 [Arabidopsis thaliana]
 gb|AEC08032.1| 60S acidic ribosomal protein P2-2 [Arabidopsis thaliana]
Length=98

 Score = 83.6 bits (205),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVL GKA P++ D+K IL SVGA+ +  +I+LLL +V+GKD+ ELIAAGRE
Sbjct  1    MKVVAAYLLAVLSGKASPTSADIKTILGSVGAETEDSQIELLLKEVKGKDLAELIAAGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>gb|KJB62189.1| hypothetical protein B456_009G405600 [Gossypium raimondii]
Length=126

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAV G K  PSA D+K IL+SVGA+ D D+I LLL +++GKD+TELIA+GRE
Sbjct  1    MKVVAAYLLAVPGSKTNPSAADIKKILASVGAEADDDKIQLLLYEMKGKDVTELIASGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_004295494.1| PREDICTED: 60S acidic ribosomal protein P2-4-like [Fragaria vesca 
subsp. vesca]
Length=109

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAAYLLA LGG   PSADDLK I  +VGA+ D DR++L  SQV+GK+I EL+A+G+E
Sbjct  1    MKVIAAYLLARLGGNTDPSADDLKRICGAVGAEIDGDRLELFFSQVDGKNIDELVASGKE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|NP_180339.1| 60S acidic ribosomal protein P2-2 [Arabidopsis thaliana]
 ref|NP_850106.1| 60S acidic ribosomal protein P2-2 [Arabidopsis thaliana]
 ref|NP_973549.1| 60S acidic ribosomal protein P2-2 [Arabidopsis thaliana]
 sp|Q9SLF7.1|RLA22_ARATH RecName: Full=60S acidic ribosomal protein P2-2 [Arabidopsis 
thaliana]
 gb|AAL16198.1|AF428429_1 At2g27710/F15K20.19 [Arabidopsis thaliana]
 gb|AAC73029.1| 60S acidic ribosomal protein P2 [Arabidopsis thaliana]
 gb|AAL32932.1| 60S acidic ribosomal protein P2 [Arabidopsis thaliana]
 gb|AAP21326.1| At2g27710 [Arabidopsis thaliana]
 dbj|BAH19900.1| AT2G27710 [Arabidopsis thaliana]
 gb|AEC08029.1| 60S acidic ribosomal protein P2-2 [Arabidopsis thaliana]
 gb|AEC08030.1| 60S acidic ribosomal protein P2-2 [Arabidopsis thaliana]
 gb|AEC08031.1| 60S acidic ribosomal protein P2-2 [Arabidopsis thaliana]
Length=115

 Score = 83.6 bits (205),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVL GKA P++ D+K IL SVGA+ +  +I+LLL +V+GKD+ ELIAAGRE
Sbjct  1    MKVVAAYLLAVLSGKASPTSADIKTILGSVGAETEDSQIELLLKEVKGKDLAELIAAGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_010417919.1| PREDICTED: 60S acidic ribosomal protein P2-1 [Camelina sativa]
Length=114

 Score = 83.6 bits (205),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AA+LLAVL GKA P++ D+K +L SVGA+ +  +I+LLL +V+GKD+TELIAAGRE
Sbjct  1    MKVVAAFLLAVLSGKASPTSSDIKDVLGSVGAETEDSQIELLLKEVKGKDLTELIAAGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_006647333.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Oryza brachyantha]
Length=113

 Score = 83.6 bits (205),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 86/113 (76%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK I+AYLLA L G   PSA+DL  IL SVGA+ D  +++ LLSQ+ GKDITE+IA+GRE
Sbjct  1    MKFISAYLLATLAGNPNPSAEDLSTILESVGAEVDQGKMEFLLSQLAGKDITEIIASGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            K ASVP GGGGVAVAA A   G  A    E K+E+KVEEKEESDDDMGFSLFD
Sbjct  61   KFASVPCGGGGVAVAAAAPVVGGGAAPQAEAKKEEKVEEKEESDDDMGFSLFD  113



>ref|XP_004297978.1| PREDICTED: 60S acidic ribosomal protein P2-4-like [Fragaria vesca 
subsp. vesca]
Length=110

 Score = 83.6 bits (205),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAY+LA LGG   PSADDLK IL +VGA+ D  RI+L LS+V GK+I EL+A+G+E
Sbjct  1    MKVLAAYMLARLGGNTNPSADDLKRILGAVGAEIDGHRIELFLSKVNGKNIDELVASGKE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_008387857.1| PREDICTED: 60S acidic ribosomal protein P2-1-like [Malus domestica]
 ref|XP_008359754.1| PREDICTED: 60S acidic ribosomal protein P2-1-like [Malus domestica]
 ref|XP_008366740.1| PREDICTED: 60S acidic ribosomal protein P2-1-like [Malus domestica]
Length=112

 Score = 83.6 bits (205),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLL VLGG   PS +DLK IL SVGA+ D   I LLLS VEGKDI ELIA GRE
Sbjct  1    MKVLAAYLLXVLGGNTAPSTEDLKDILRSVGAEADDGEIQLLLSGVEGKDIAELIAXGRE  60

Query  266  KL  271
            K+
Sbjct  61   KM  62



>ref|XP_001694856.1| acidic ribosomal protein P2 [Chlamydomonas reinhardtii]
 gb|EDP02008.1| acidic ribosomal protein P2 [Chlamydomonas reinhardtii]
Length=109

 Score = 83.6 bits (205),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            M+V++AYLLAVLGGKA P+ADD+  ILSSVG + +A++++ L+S++EGK++ E+IAAGR 
Sbjct  1    MRVVSAYLLAVLGGKANPTADDVNKILSSVGVEAEAEKVNKLISELEGKNLAEVIAAGRS  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>gb|KHN02245.1| 60S acidic ribosomal protein P2 [Glycine soja]
Length=64

 Score = 82.0 bits (201),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAG  259
            MKVIAAYLLAVLGG A PSADDL+ IL SVGAD + D I   LS+V+GKDI ELIA+G
Sbjct  1    MKVIAAYLLAVLGGNAAPSADDLRTILGSVGADANDDNISNFLSEVKGKDIVELIASG  58



>ref|XP_006295265.1| hypothetical protein CARUB_v10024352mg [Capsella rubella]
 gb|EOA28163.1| hypothetical protein CARUB_v10024352mg [Capsella rubella]
Length=114

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVL GKA PS+ D+K IL SVGA+ +  +I+LLL +V+GKD+ ELIAAGRE
Sbjct  1    MKVVAAYLLAVLSGKASPSSADIKGILGSVGAETEDSQIELLLKEVKGKDLAELIAAGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>gb|EMT02685.1| 60S acidic ribosomal protein P2B [Aegilops tauschii]
Length=113

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK+IAAYLLA LGG + PSA D+K+IL SVGA+ D ++++ LL++++GKDITE+IA+GRE
Sbjct  1    MKLIAAYLLAYLGGNSSPSAADVKNILDSVGAEADEEKLEFLLAELKGKDITEVIASGRE  60

Query  266  KL  271
            K 
Sbjct  61   KF  62



>gb|EMS66726.1| 60S acidic ribosomal protein P2B [Triticum urartu]
Length=113

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK+IAAYLLA LGG + PSA D+K+IL SVGA+ D ++++ LL++++GKDITE+IA+GRE
Sbjct  1    MKLIAAYLLAYLGGNSSPSAADVKNILDSVGAEADEEKLEFLLAELKGKDITEVIASGRE  60

Query  266  KL  271
            K 
Sbjct  61   KF  62



>ref|XP_009421130.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009421131.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Musa acuminata 
subsp. malaccensis]
Length=116

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAAYLLAVLGG   P+  D+K IL SVGAD   ++I+LLLSQV GKD+TELIA GRE
Sbjct  1    MKVIAAYLLAVLGGNISPTTGDVKGILESVGADVVDEKIELLLSQVGGKDLTELIATGRE  60

Query  266  KL  271
            K 
Sbjct  61   KF  62



>ref|XP_010473159.1| PREDICTED: 60S acidic ribosomal protein P2-1-like [Camelina sativa]
Length=114

 Score = 83.2 bits (204),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AA+LLAVL GKA P++ D+K IL SVGA+ +  +I+LLL +V+GKD+TELIAAGRE
Sbjct  1    MKVVAAFLLAVLSGKASPTSADIKDILGSVGAETEDSQIELLLKEVKGKDLTELIAAGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|NP_001236220.1| uncharacterized protein LOC100306264 [Glycine max]
 gb|ACU14365.1| unknown [Glycine max]
Length=111

 Score = 83.2 bits (204),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVLGG   PSAD +KHIL +VGA+ + + I+LLL++V+GKD  ELIA+G E
Sbjct  1    MKVVAAYLLAVLGGNPSPSADGIKHILGAVGAEAENELIELLLTEVKGKDFNELIASGSE  60

Query  266  KL  271
            K+
Sbjct  61   KM  62



>ref|XP_004497613.1| PREDICTED: 60S acidic ribosomal protein P2-4-like [Cicer arietinum]
Length=113

 Score = 83.2 bits (204),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAV+GG   PSA  +K IL SVG++ + +RI+  LS+V GKDI E+IAAG+E
Sbjct  1    MKVVAAYLLAVIGGNNSPSAKTIKDILGSVGSEAEDERIESFLSEVSGKDIAEIIAAGKE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            KLASVPSGGG VAV+A  + GG AAPAA E K+E+KVEEKEESDDDMGFSLFD
Sbjct  61   KLASVPSGGGAVAVSAAPASGGGAAPAAAEAKKEEKVEEKEESDDDMGFSLFD  113



>gb|KIZ04174.1| 60S acidic ribosomal protein P2-4 [Monoraphidium neglectum]
Length=107

 Score = 82.8 bits (203),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            M+V++A LLAVLGGKA P+ DD+K IL SVG + DAD +  LL ++EGKDI ELIAAGRE
Sbjct  1    MRVVSAVLLAVLGGKANPTEDDVKKILGSVGVEADADSVQRLLKELEGKDIAELIAAGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_004975548.1| PREDICTED: 60S acidic ribosomal protein P2A-like isoform X1 [Setaria 
italica]
Length=252

 Score = 85.5 bits (210),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK +AAYLLAVL G   PSA+DL  IL SVGA+ D ++++LLLSQ+ GKDITELIAAGRE
Sbjct  1    MKFVAAYLLAVLAGNNSPSAEDLTTILESVGAEVDNEKMELLLSQLSGKDITELIAAGRE  60

Query  266  KL  271
            K 
Sbjct  61   KF  62



>ref|XP_004955604.1| PREDICTED: 60S acidic ribosomal protein P2A-like isoform X1 [Setaria 
italica]
Length=138

 Score = 83.6 bits (205),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK +AAYLLAVL G   PSA+DL  IL SVG + D ++++LLLSQ+ G+DITELIAAGRE
Sbjct  1    MKFVAAYLLAVLAGNPSPSAEDLSAILESVGCEIDNEKMELLLSQLSGRDITELIAAGRE  60

Query  266  KL  271
            K 
Sbjct  61   KF  62



>gb|ABD74514.1| ribosomal protein, partial [Pteris vittata]
Length=127

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +2

Query  77   KEEMKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAA  256
            + +MKV+AAYLLA+LGGKA PS DD++ IL SVGA+ D D++DL   ++ GKD+ E++A 
Sbjct  7    RTKMKVVAAYLLALLGGKAAPSPDDIRSILGSVGAEADDDKLDLFFKELAGKDVNEVLAL  66

Query  257  GREKL  271
            GREK 
Sbjct  67   GREKF  71



>ref|XP_010514554.1| PREDICTED: 60S acidic ribosomal protein P2-3-like [Camelina sativa]
Length=115

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAA+LLA LGGK  P+++DLK IL SVGA+ D  RIDLL S ++  D+TELIAAGRE
Sbjct  1    MKVIAAFLLAKLGGKENPTSNDLKKILESVGAEIDESRIDLLFSLIKDHDVTELIAAGRE  60

Query  266  KL  271
            K+
Sbjct  61   KM  62



>ref|XP_003543439.2| PREDICTED: 60S acidic ribosomal protein P2B-like [Glycine max]
Length=149

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 91/129 (71%), Gaps = 8/129 (6%)
 Frame = +2

Query  62   PEEQRKE-------EMKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQ  220
            P+ Q+K        +MKV+AAYLLAVLGG   PSADD+K+IL +VGA+ + + I+LLL++
Sbjct  21   PKSQKKRNRNRNLADMKVVAAYLLAVLGGNPSPSADDIKNILGAVGAEAEHELIELLLTE  80

Query  221  VEGKDITELIAAGREKLa-svpsggggvavaapasgggaaapaaeekkeekkveekeesD  397
            V+GKD  EL+A+G EK++     G      AAPA G G  A  A E KEEKKVEEKEESD
Sbjct  81   VKGKDFNELLASGSEKISAVAGGGAAVAVAAAPAGGAGGGAAPAAEAKEEKKVEEKEESD  140

Query  398  DDMGFSLFD  424
            DDMGFSLFD
Sbjct  141  DDMGFSLFD  149



>ref|XP_004165173.1| PREDICTED: 60S acidic ribosomal protein P2-4-like isoform 1 [Cucumis 
sativus]
Length=131

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 95/131 (73%), Gaps = 18/131 (14%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSV-----------------GADCDADRIDLLL  214
            MK++AAYLLAVLGG + PSA DLK IL SV                 GA+ D +RI+LLL
Sbjct  1    MKIVAAYLLAVLGGNSNPSAKDLKDILGSVKYVEWGHNLSFPNRFAVGAEVDEERINLLL  60

Query  215  SQVEGKDITELIAAGREKLasv-psggggvavaapasgggaaapaaeekkeekkveekee  391
            S V+GKDITELIA+GREKLASV   GG  VAVAA   GGGAAAPA  E K+E+KVEEKEE
Sbjct  61   SNVKGKDITELIASGREKLASVPSGGGAAVAVAAGGGGGGAAAPAPAEAKKEEKVEEKEE  120

Query  392  sDDDMGFSLFD  424
            SDDDMGFSLFD
Sbjct  121  SDDDMGFSLFD  131



>emb|CAN72528.1| hypothetical protein VITISV_013399 [Vitis vinifera]
Length=111

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLL VLGG   P ADDLK IL SVGA+ D D I+LLLS+V+GKDI ELIA  RE
Sbjct  1    MKVMAAYLLVVLGGNVSPCADDLKSILGSVGAEVDDDGIELLLSEVKGKDIIELIAFRRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_004955605.1| PREDICTED: 60S acidic ribosomal protein P2A-like isoform X2 [Setaria 
italica]
Length=112

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK +AAYLLAVL G   PSA+DL  IL SVG + D ++++LLLSQ+ G+DITELIAAGRE
Sbjct  1    MKFVAAYLLAVLAGNPSPSAEDLSAILESVGCEIDNEKMELLLSQLSGRDITELIAAGRE  60

Query  266  KL  271
            K 
Sbjct  61   KF  62



>gb|KHN21444.1| 60S acidic ribosomal protein P2B [Glycine soja]
Length=92

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVLGG   PSADD+K+IL +VGA+ + + I+LLL++V+GKD  EL+A+G E
Sbjct  1    MKVVAAYLLAVLGGNPSPSADDIKNILGAVGAEAEHELIELLLTEVKGKDFNELLASGSE  60

Query  266  KL  271
            K+
Sbjct  61   KI  62



>gb|AAP80630.1|AF475108_1 acidic ribosomal protein [Triticum aestivum]
Length=138

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK+IAAYLLA LGG + PSA D+K+IL SVGA+ D ++++ LL++++GKDITE+IA+GRE
Sbjct  26   MKLIAAYLLAYLGGNSSPSAADVKNILDSVGAEADEEKLEFLLAELKGKDITEVIASGRE  85

Query  266  KL  271
            K 
Sbjct  86   KF  87



>ref|XP_011024241.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Populus euphratica]
Length=109

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 53/62 (85%), Gaps = 1/62 (2%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK +AA+LLAVLGG   PSA+D+K IL+SVGA+ D D+I+LLLSQV+ +DITEL+A GRE
Sbjct  1    MKTVAAFLLAVLGGNNSPSAEDIKKILASVGAEAD-DKIELLLSQVKDRDITELLAVGRE  59

Query  266  KL  271
            KL
Sbjct  60   KL  61



>ref|XP_006295264.1| hypothetical protein CARUB_v10024350mg [Capsella rubella]
 gb|EOA28162.1| hypothetical protein CARUB_v10024350mg [Capsella rubella]
Length=114

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AA+LLAVL GKA P++ D+K IL SVGA+ +  +I+LLL +V+GKD+ ELIAAGRE
Sbjct  1    MKVVAAFLLAVLSGKASPTSGDIKTILGSVGAETEDSQIELLLKEVKGKDLAELIAAGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_002875674.1| hypothetical protein ARALYDRAFT_484870 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51933.1| hypothetical protein ARALYDRAFT_484870 [Arabidopsis lyrata subsp. 
lyrata]
Length=111

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 77/113 (68%), Gaps = 2/113 (2%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV AA+LLAVLGG A P A+++K I+ +VGAD D + I+LLL +V GKDI ELIA+GRE
Sbjct  1    MKVAAAFLLAVLGGNANPCAENIKDIIGAVGADVDGESIELLLKEVSGKDIAELIASGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            KL       GG    + A   G     A  +K+E K EEKEESDDDMGFSLF+
Sbjct  61   KL--ASVPSGGGGAVSAALSSGGGGAPAAVEKKEAKKEEKEESDDDMGFSLFE  111



>ref|XP_006292070.1| hypothetical protein CARUB_v10018265mg [Capsella rubella]
 gb|EOA24968.1| hypothetical protein CARUB_v10018265mg [Capsella rubella]
Length=116

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAA+LLA LGG   P+ +DLK IL SVGA+ D  RIDLL S V+  D+TELIAAGRE
Sbjct  1    MKVIAAFLLAKLGGNESPTPNDLKKILESVGAEIDESRIDLLFSLVKDHDVTELIAAGRE  60

Query  266  KL  271
            K+
Sbjct  61   KM  62



>emb|CDX77131.1| BnaC04g39260D [Brassica napus]
Length=113

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AA+LLAVL GKACP++ D+K IL+SVG + +  +I+LLL +V GKD+ ELIA GRE
Sbjct  1    MKVVAAFLLAVLSGKACPTSADIKVILNSVGCETEDSQIELLLKEVNGKDVAELIAVGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_006409780.1| hypothetical protein EUTSA_v10017442mg [Eutrema salsugineum]
 gb|ESQ51233.1| hypothetical protein EUTSA_v10017442mg [Eutrema salsugineum]
Length=115

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AA+LLAVL GKA P++ D+K IL SVGA+ +  +I+LLL +V+GKD+ ELIAAGRE
Sbjct  1    MKVVAAFLLAVLSGKASPTSGDIKDILGSVGAETEDSQIELLLKEVKGKDLAELIAAGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>gb|AFK33658.1| unknown [Medicago truncatula]
 gb|KEH42065.1| 60S acidic ribosomal protein [Medicago truncatula]
Length=112

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVLGG   PSA  +K IL SVGAD + +RI+  LS+++GKDI E+IA+GRE
Sbjct  1    MKVVAAYLLAVLGGDNTPSAKTIKDILGSVGADAEDNRIESFLSEIKGKDIAEVIASGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_003571500.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Brachypodium 
distachyon]
Length=113

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK IAAYLLA L G +  SA+DL  IL SVG + D ++++ +LSQV+GKDI EL+AAGRE
Sbjct  1    MKYIAAYLLAYLSGNSSTSAEDLTTILESVGCEIDNEKMEFMLSQVKGKDIVELLAAGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            K ASVPSGGGGVAVAA A   G A  A   +K+ +KVEEKEESDDDMGFSLFD
Sbjct  61   KFASVPSGGGGVAVAAAAPASGCAGAAPAAEKKVEKVEEKEESDDDMGFSLFD  113



>gb|AAM65044.1| 60S acidic ribosomal protein P2 [Arabidopsis thaliana]
Length=115

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLAVL GKA P++ D+K IL SVGA+ +  +I+LLL +V+GKD+ ELIAAGRE
Sbjct  1    MKVVAAYLLAVLSGKASPTSADIKTILGSVGAETEDSQIELLLKEVKGKDLAELIAAGRE  60

Query  266  KL  271
             L
Sbjct  61   NL  62



>ref|XP_001784528.1| predicted protein [Physcomitrella patens]
 gb|EDQ50649.1| predicted protein [Physcomitrella patens]
Length=115

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLA+LGG + PSA D++ IL +VGA+ D  RI LLL ++EGKDI E+IAAG+E
Sbjct  1    MKVVAAYLLALLGGNSAPSAKDIESILGAVGAEADPSRISLLLKELEGKDILEVIAAGKE  60

Query  266  KL  271
            K 
Sbjct  61   KF  62



>ref|NP_180340.1| 60S acidic ribosomal protein P2-1 [Arabidopsis thaliana]
 sp|P51407.2|RLA21_ARATH RecName: Full=60S acidic ribosomal protein P2-1 [Arabidopsis 
thaliana]
 gb|AAK95281.1|AF410295_1 At2g27720/F15K20.18 [Arabidopsis thaliana]
 gb|AAC73028.1| 60S acidic ribosomal protein P2 [Arabidopsis thaliana]
 gb|AAM10341.1| At2g27720/F15K20.18 [Arabidopsis thaliana]
 gb|AAM63156.1| 60S acidic ribosomal protein P2 [Arabidopsis thaliana]
 gb|AEC08033.1| 60S acidic ribosomal protein P2-1 [Arabidopsis thaliana]
Length=115

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AA+LLAVL GKA P+  D+K IL SVGA+ +  +I+LLL +V+GKD+ ELIAAGRE
Sbjct  1    MKVVAAFLLAVLSGKASPTTGDIKDILGSVGAETEDSQIELLLKEVKGKDLAELIAAGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_001761876.1| predicted protein [Physcomitrella patens]
 gb|EDQ73317.1| predicted protein [Physcomitrella patens]
Length=114

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLA+LGG   PSA D++ IL +VGA+ DA R+ LLL ++EGKDI E+IAAG+E
Sbjct  1    MKVVAAYLLALLGGNPSPSAKDIEAILGAVGAEADASRVSLLLKELEGKDILEVIAAGKE  60

Query  266  KL  271
            K 
Sbjct  61   KF  62



>ref|XP_010425630.1| PREDICTED: 60S acidic ribosomal protein P2-3 [Camelina sativa]
Length=114

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAA+LLA LGG   P+++DLK IL SVGA+ D  RIDLL S ++  D+TELIAAGRE
Sbjct  1    MKVIAAFLLAKLGGNENPTSNDLKKILESVGAEIDESRIDLLFSLIKDHDVTELIAAGRE  60

Query  266  KL  271
            K+
Sbjct  61   KM  62



>ref|XP_001758040.1| predicted protein [Physcomitrella patens]
 gb|EDQ77282.1| predicted protein [Physcomitrella patens]
Length=114

 Score = 80.9 bits (198),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLA+LGG + P+A D++ IL +VGA+ DA R+ LLL ++EGKDI E+IAAG+E
Sbjct  1    MKVVAAYLLALLGGNSAPTAKDIESILGAVGAEADAARVSLLLKELEGKDILEVIAAGKE  60

Query  266  KL  271
            K 
Sbjct  61   KF  62



>ref|XP_002639930.1| Hypothetical protein CBG08266 [Caenorhabditis briggsae]
 emb|CAP28124.1| Protein CBG08266 [Caenorhabditis briggsae]
Length=110

 Score = 80.5 bits (197),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 79/113 (70%), Gaps = 3/113 (3%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            M+ I+AYLLAVLGG A P ADD+++ILS+VG D +A+ ++L++S +EGK+I ELIAAG  
Sbjct  1    MRYISAYLLAVLGGNANPHADDIENILSAVGVDANAESVNLVVSGLEGKNIEELIAAGSA  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            KL    +  GGV  A+ A+     A  A + K  KK E KEESDDDMGF LFD
Sbjct  61   KL---ATISGGVGAASSAAPVTGGAAPAADNKPAKKEEPKEESDDDMGFGLFD  110



>gb|KGN48246.1| hypothetical protein Csa_6G451490 [Cucumis sativus]
Length=115

 Score = 80.5 bits (197),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK++AAYLLA+LGG   PS  D+K IL+SVG + + +RI+LLLSQV+GKD+ EL+A GRE
Sbjct  1    MKIVAAYLLAILGGNTHPSIHDIKAILASVGVEAEDERIELLLSQVKGKDVAELVACGRE  60

Query  266  KL  271
            K+
Sbjct  61   KM  62



>ref|XP_004167613.1| PREDICTED: 60S acidic ribosomal protein P2B-like [Cucumis sativus]
Length=115

 Score = 80.5 bits (197),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MK++AAYLLA+LGG   PS  D+K IL+SVG + + +RI+LLLSQV+GKD+ EL+A GRE
Sbjct  1    MKIVAAYLLAILGGNTHPSIHDIKAILASVGVEAEDERIELLLSQVKGKDVAELVACGRE  60

Query  266  KL  271
            K+
Sbjct  61   KM  62



>ref|XP_006392052.1| hypothetical protein EUTSA_v10023766mg [Eutrema salsugineum]
 gb|ESQ29338.1| hypothetical protein EUTSA_v10023766mg [Eutrema salsugineum]
Length=115

 Score = 80.1 bits (196),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AA+LLAVL GKA P++ D+K IL SVGA+ +  +I+LLL +V+GKD+ ELIAAGRE
Sbjct  1    MKVVAAFLLAVLSGKASPTSADIKDILGSVGAETEDAQIELLLKEVKGKDLAELIAAGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_001754567.1| predicted protein [Physcomitrella patens]
 gb|EDQ80537.1| predicted protein [Physcomitrella patens]
Length=114

 Score = 80.1 bits (196),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLA+LGG + PSA D++ IL +VGA+ D  R+ LLL ++EGKDI E+IAAG+E
Sbjct  1    MKVVAAYLLALLGGNSSPSAKDIEAILGAVGAEADPSRVSLLLKELEGKDILEVIAAGKE  60

Query  266  KL  271
            K 
Sbjct  61   KF  62



>ref|XP_007261576.1| ribosomal protein 60S [Fomitiporia mediterranea MF3/22]
 gb|EJD07624.1| ribosomal protein 60S [Fomitiporia mediterranea MF3/22]
Length=112

 Score = 79.7 bits (195),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            M+ IAAYLL  +GGK+ PS DD+KH+L SVGAD D DR+  LLS++EGKDI ELI  G  
Sbjct  1    MRYIAAYLLLQIGGKSSPSTDDIKHVLGSVGADVDDDRLSKLLSELEGKDIAELITEGSS  60

Query  266  KL  271
            K 
Sbjct  61   KF  62



>ref|NP_189491.1| 60S acidic ribosomal protein P2-3 [Arabidopsis thaliana]
 sp|Q9LH85.1|RLA23_ARATH RecName: Full=60S acidic ribosomal protein P2-3 [Arabidopsis 
thaliana]
 dbj|BAB01952.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM63824.1| acidic ribosomal protein P2b (rpp2b), putative [Arabidopsis thaliana]
 gb|AAO42015.1| putative acidic ribosomal protein P2b (rpp2b) [Arabidopsis thaliana]
 gb|AAO50620.1| putative acidic ribosomal protein P2b (rpp2b) [Arabidopsis thaliana]
 gb|AEE77453.1| 60S acidic ribosomal protein P2-3 [Arabidopsis thaliana]
Length=115

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAA+LLA LGG   P+++DLK IL SVGA+ D  +IDLL S ++  D+TELIAAGRE
Sbjct  1    MKVIAAFLLAKLGGNENPTSNDLKKILESVGAEIDETKIDLLFSLIKDHDVTELIAAGRE  60

Query  266  KL  271
            K+
Sbjct  61   KM  62



>gb|AFK35524.1| unknown [Lotus japonicus]
 gb|AFK44218.1| unknown [Lotus japonicus]
Length=114

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKVIAAY+LAVLGG   PSA ++K I+ SVG D D DRI   LS+++GKD+ E+IAAG+E
Sbjct  1    MKVIAAYMLAVLGGNNSPSAAEIKKIIGSVGGDADDDRIASFLSELKGKDLAEVIAAGKE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>ref|XP_011331848.1| PREDICTED: 60S acidic ribosomal protein P2 [Cerapachys biroi]
 gb|EZA58716.1| 60S acidic ribosomal protein P2 [Cerapachys biroi]
Length=113

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            M+ +AAYLLAVLGGKA PS +D++ ILSSVG + DA+++  ++S++ GK I ELIA G+E
Sbjct  1    MRYVAAYLLAVLGGKASPSQNDIEKILSSVGIETDAEKLKKVISELNGKSIDELIAQGKE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            KL+S+P GG   A AA  + G AA    ++++++   EE E  DDDMGF LFD
Sbjct  61   KLSSMPVGGAAAAAAAAPASGAAAPVEEKKEEKKPAKEESESEDDDMGFGLFD  113



>ref|XP_003557330.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Brachypodium 
distachyon]
Length=110

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            M+ +AAYLLA LGG   P+ DD++ IL SVGA+ +  ++D+L  +VEGKDI+EL+AAGRE
Sbjct  1    MRFVAAYLLATLGGNQSPTKDDVRAILGSVGAEVEEYKLDILFKEVEGKDISELLAAGRE  60

Query  266  KL  271
            K 
Sbjct  61   KF  62



>ref|XP_002880973.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57232.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=114

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AA+LLAVL GKA PS+ D+K IL SVGA+ +  +I+LLL +V+GKD+ E+IA+GRE
Sbjct  1    MKVVAAFLLAVLSGKASPSSGDIKTILGSVGAESEDAQIELLLKEVKGKDLAEVIASGRE  60

Query  266  KL  271
            KL
Sbjct  61   KL  62



>emb|CDY04508.1| BnaA07g13340D [Brassica napus]
Length=113

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDITELIAAGRE  265
            MKV+AAYLLA L GKA P++ D+K IL SVG + +  +I+LLL +V GKD+ +LIAAGRE
Sbjct  1    MKVVAAYLLAALSGKASPTSADIKQILGSVGCESEDSQIELLLKEVSGKDLCDLIAAGRE  60

Query  266  KLasvpsggggvavaapasgggaaapaaeekkeekkveekeesDDDMGFSLFD  424
            KLASVPSGGGGVA+AA  S GG     A E K+E+K EEKEESDDDMGFSLF+
Sbjct  61   KLASVPSGGGGVAMAAAPSAGGGGGAPAAEAKKEEKKEEKEESDDDMGFSLFE  113



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 592801777335