BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001F01

Length=274
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAF36300.1|  hypothetical protein                                 82.4    5e-16   Ipomoea trifida
gb|AAQ62572.1|  glycosyltransferase 10                                81.6    8e-16   Ipomoea trifida
gb|AAQ62570.1|  glycosyltransferase 1                                 81.6    8e-16   Ipomoea trifida



>dbj|BAF36300.1| hypothetical protein [Ipomoea trifida]
Length=571

 Score = 82.4 bits (202),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 38/43 (88%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  146  MAGVAINEVELMMPELRGPGGDVAAQMRLMWDLVKAPLIVPAL  274
            MAG  INEVELMMPELRGPGGD+AAQMRLM+DLVKAPLIVP L
Sbjct  1    MAGETINEVELMMPELRGPGGDMAAQMRLMYDLVKAPLIVPVL  43



>gb|AAQ62572.1| glycosyltransferase 10 [Ipomoea trifida]
 dbj|BAF36343.1| hypothetical protein [Ipomoea trifida]
Length=537

 Score = 81.6 bits (200),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 38/43 (88%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  146  MAGVAINEVELMMPELRGPGGDVAAQMRLMWDLVKAPLIVPAL  274
            MAG  INEVELMMPELRGPGGD+AAQMRLM+DLVKAPLIVP L
Sbjct  1    MAGETINEVELMMPELRGPGGDMAAQMRLMYDLVKAPLIVPVL  43



>gb|AAQ62570.1| glycosyltransferase 1 [Ipomoea trifida]
 gb|AAS79578.1| putative glycosyltransferase [Ipomoea trifida]
Length=537

 Score = 81.6 bits (200),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 38/43 (88%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  146  MAGVAINEVELMMPELRGPGGDVAAQMRLMWDLVKAPLIVPAL  274
            MAG  INEVELMMPELRGPGGD+AAQMRLM+DLVKAPLIVP L
Sbjct  1    MAGETINEVELMMPELRGPGGDMAAQMRLMYDLVKAPLIVPVL  43



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 561713539050