BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001E23

Length=558
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

sp|P48976.2|CALM_MALDO  RecName: Full=Calmodulin; Short=CaM             166   1e-74   Malus domestica [apple tree]
ref|XP_004287204.1|  PREDICTED: calmodulin-7                            163   2e-73   Fragaria vesca subsp. vesca
ref|NP_001268169.1|  calmodulin                                         163   2e-73   
ref|XP_010271350.1|  PREDICTED: calmodulin                              162   5e-72   Nelumbo nucifera [Indian lotus]
gb|AFA89861.2|  calmodulin 1                                            160   6e-72   Lilium longiflorum [Easter lily]
ref|XP_010645766.1|  PREDICTED: calmodulin                              162   1e-71   Vitis vinifera
ref|XP_010243681.1|  PREDICTED: calmodulin-like                         159   2e-71   Nelumbo nucifera [Indian lotus]
ref|XP_010271115.1|  PREDICTED: calmodulin-like                         160   2e-71   Nelumbo nucifera [Indian lotus]
ref|XP_011073165.1|  PREDICTED: calmodulin                              160   4e-71   Sesamum indicum [beniseed]
ref|XP_008798212.1|  PREDICTED: calmodulin                              159   5e-71   Phoenix dactylifera
ref|NP_001234786.1|  calmodulin                                         161   6e-71   Solanum lycopersicum
gb|EYU24499.1|  hypothetical protein MIMGU_mgv1a015687mg                160   8e-71   Erythranthe guttata [common monkey flower]
ref|XP_010069460.1|  PREDICTED: calmodulin                              160   1e-70   Eucalyptus grandis [rose gum]
gb|ACR15761.1|  calmodulin isoform 1                                    160   1e-70   Solanum tuberosum [potatoes]
ref|XP_006374229.1|  calmodulin-like protein 6a                         160   1e-70   Populus trichocarpa [western balsam poplar]
ref|NP_001275042.1|  calmodulin-1                                       160   2e-70   Solanum tuberosum [potatoes]
sp|P13868.2|CALM1_SOLTU  RecName: Full=Calmodulin-1; Short=CaM-1        161   2e-70   Solanum tuberosum [potatoes]
ref|XP_002317717.1|  calmodulin-like protein 6a                         160   3e-70   Populus trichocarpa [western balsam poplar]
gb|AAW02790.1|  calmodulin 2                                            157   4e-70   Codonopsis lanceolata
gb|ABA27137.1|  calmodulin 1                                            162   4e-70   Catharanthus roseus [chatas]
ref|XP_010936850.1|  PREDICTED: calmodulin                              161   4e-70   Elaeis guineensis
gb|ABK94169.1|  unknown                                                 158   1e-69   Populus trichocarpa [western balsam poplar]
sp|P27163.2|CALM2_PETHY  RecName: Full=Calmodulin-2; Short=CaM-2        157   2e-69   Petunia x hybrida [garden petunia]
emb|CAH57706.1|  calmodulin                                             159   2e-69   Quercus petraea [durmast oak]
dbj|BAG38057.1|  unnamed protein product                                150   7e-68   Homo sapiens [man]
gb|ADV17372.1|  calmodulin                                              150   1e-67   Ganoderma lucidum
ref|XP_007209738.1|  hypothetical protein PRUPE_ppa012922mg             154   1e-67   Prunus persica
emb|CCA71197.1|  probable Calmodulin                                    149   3e-67   Serendipita indica DSM 11827
ref|XP_008393461.1|  PREDICTED: calmodulin                              153   7e-67   
ref|XP_008375032.1|  PREDICTED: calmodulin-like                         152   1e-66   Malus domestica [apple tree]
gb|AGB85032.1|  calmodulin-like protein                                 154   2e-66   Auxenochlorella protothecoides
ref|XP_004299498.1|  PREDICTED: calmodulin-like                         151   2e-66   Fragaria vesca subsp. vesca
ref|XP_009355982.1|  PREDICTED: calmodulin-like                         149   2e-65   Pyrus x bretschneideri [bai li]
gb|KJB53085.1|  hypothetical protein B456_008G292900                    144   3e-65   Gossypium raimondii
gb|AAK25753.1|AF334833_1  calmodulin                                    155   4e-65   Castanea sativa
sp|Q40642.1|CML1_ORYSI  RecName: Full=Calmodulin-like protein 1; ...    152   5e-65   Oryza sativa Indica Group [Indian rice]
ref|XP_008986517.1|  PREDICTED: calmodulin                              151   2e-64   
gb|KIW16124.1|  calmodulin                                              142   3e-64   Exophiala spinifera
gb|KFX88509.1|  hypothetical protein O988_09002                         141   3e-64   Pseudogymnoascus sp. VKM F-3808
ref|XP_008081431.1|  EF-hand                                            142   3e-64   Glarea lozoyensis ATCC 20868
ref|XP_011113630.1|  hypothetical protein H072_7905                     140   3e-64   
gb|KFY44228.1|  hypothetical protein V495_03553                         141   5e-64   Pseudogymnoascus sp. VKM F-4514 (FW-929)
emb|CCE34004.1|  probable calmodulin                                    141   5e-64   Claviceps purpurea 20.1
gb|KFX94087.1|  hypothetical protein V490_04534                         141   5e-64   Pseudogymnoascus sp. VKM F-3557
ref|NP_001044583.1|  Os01g0810300                                       150   6e-64   
gb|EXA43615.1|  calmodulin                                              142   8e-64   Fusarium oxysporum f. sp. pisi HDV247
gb|ERT02366.1|  calmodulin                                              142   8e-64   Sporothrix schenckii ATCC 58251
gb|EWG47167.1|  calmodulin                                              142   8e-64   Fusarium verticillioides 7600
gb|EXK44111.1|  calmodulin                                              142   9e-64   Fusarium oxysporum f. sp. melonis 26406
gb|EMT66361.1|  Calmodulin                                              142   9e-64   Fusarium oxysporum f. sp. cubense race 4
gb|EWZ46812.1|  calmodulin                                              142   1e-63   Fusarium oxysporum Fo47
gb|ENH63033.1|  Calmodulin                                              142   1e-63   Fusarium oxysporum f. sp. cubense race 1
gb|ELR03702.1|  calmodulin                                              140   1e-63   Pseudogymnoascus destructans 20631-21
gb|EFX01025.1|  calmodulin                                              142   1e-63   Grosmannia clavigera kw1407
ref|XP_001267009.1|  calmodulin                                         141   1e-63   Aspergillus fischeri NRRL 181
ref|XP_011401016.1|  Calmodulin                                         156   1e-63   Auxenochlorella protothecoides
gb|KFY53599.1|  hypothetical protein V496_07465                         142   1e-63   Pseudogymnoascus sp. VKM F-4515 (FW-2607)
dbj|GAM85876.1|  hypothetical protein ANO11243_038860                   142   1e-63   fungal sp. No.11243
gb|KEQ72355.1|  EF-hand                                                 141   2e-63   Aureobasidium namibiae CBS 147.97
gb|KFA72401.1|  hypothetical protein S40288_09541                       142   2e-63   Stachybotrys chartarum IBT 40288
gb|KIW78510.1|  calmodulin                                              141   2e-63   Fonsecaea pedrosoi CBS 271.37
gb|KDD73483.1|  hypothetical protein H632_c2130p0                       150   2e-63   Helicosporidium sp. ATCC 50920
gb|KFY20747.1|  hypothetical protein V491_03461                         142   2e-63   Pseudogymnoascus sp. VKM F-3775
ref|XP_001224933.1|  calmodulin                                         140   2e-63   Chaetomium globosum CBS 148.51
gb|KIW95870.1|  calmodulin                                              141   3e-63   Cladophialophora bantiana CBS 173.52
gb|EME44997.1|  hypothetical protein DOTSEDRAFT_70894                   140   3e-63   Dothistroma septosporum NZE10
gb|KIL90559.1|  calmodulin                                              142   3e-63   Fusarium avenaceum
ref|XP_001248642.1|  calmodulin (CaM)                                   140   3e-63   Coccidioides immitis RS
gb|KIW00695.1|  calmodulin                                              139   3e-63   Verruconis gallopava
ref|XP_006967657.1|  regulatory protein calmodulin                      141   4e-63   Trichoderma reesei QM6a
gb|KFH43286.1|  Calmodulin-like protein                                 140   5e-63   Acremonium chrysogenum ATCC 11550
ref|XP_003853858.1|  calcium ion binding, calmodulin                    139   5e-63   Zymoseptoria tritici IPO323
ref|XP_009222302.1|  calmodulin                                         140   5e-63   Gaeumannomyces tritici R3-111a-1
ref|XP_002484900.1|  calmodulin                                         142   5e-63   Talaromyces stipitatus ATCC 10500
gb|KGQ05861.1|  Calmodulin                                              139   5e-63   Beauveria bassiana D1-5
ref|XP_007802600.1|  Calmodulin                                         141   5e-63   Endocarpon pusillum Z07020
gb|KHO00914.1|  calmodulin                                              141   6e-63   Metarhizium album ARSEF 1941
ref|XP_007599517.1|  calmodulin                                         141   6e-63   
gb|KFA46710.1|  hypothetical protein S40293_07792                       140   6e-63   Stachybotrys chartarum IBT 40293
gb|KFA64713.1|  hypothetical protein S40285_05290                       140   6e-63   Stachybotrys chlorohalonata IBT 40285
ref|XP_002622905.1|  calmodulin A                                       142   6e-63   Blastomyces gilchristii SLH14081
gb|AAC96324.1|  calmodulin                                              140   7e-63   Magnaporthe grisea
ref|XP_009561681.1|  PREDICTED: calmodulin, striated muscle             142   7e-63   Cuculus canorus
ref|XP_765284.1|  calmodulin                                            142   7e-63   Theileria parva strain Muguga
emb|CEF74092.1|  unnamed protein product                                140   7e-63   
gb|ABY87953.1|  hypothetical protein                                    139   8e-63   Stachybotrys elegans
ref|XP_007288182.1|  calmodulin                                         140   9e-63   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gb|ENH79701.1|  calmodulin                                              140   1e-62   
ref|XP_001552123.1|  calmodulin                                         140   1e-62   Botrytis cinerea B05.10
gb|AAG00262.1|AF089808_1  calmodulin                                    138   1e-62   Magnaporthe grisea
gb|EPE09638.1|  calmodulin                                              140   1e-62   Ophiostoma piceae UAMH 11346
ref|XP_006669179.1|  calmodulin                                         140   1e-62   Cordyceps militaris CM01
ref|XP_006727741.1|  PREDICTED: calmodulin-like                         145   2e-62   Leptonychotes weddellii
ref|XP_008600562.1|  calmodulin-like protein                            139   2e-62   Beauveria bassiana ARSEF 2860
gb|KHJ31687.1|  putative calmodulin                                     137   2e-62   Erysiphe necator
gb|AAA33569.1|  calmodulin                                              140   2e-62   Neurospora crassa
gb|EKC29242.1|  Calmodulin                                              149   2e-62   Crassostrea gigas
ref|XP_011119385.1|  hypothetical protein AOL_s00043g597                140   5e-62   Arthrobotrys oligospora ATCC 24927
ref|XP_951999.1|  calmodulin                                            140   9e-62   Theileria annulata
ref|XP_007673454.1|  hypothetical protein BAUCODRAFT_22484              140   9e-62   Baudoinia panamericana UAMH 10762
ref|XP_009690713.1|  calmodulin                                         138   1e-61   Theileria orientalis strain Shintoku
gb|KFX47024.1|  Calmodulin                                              135   2e-61   Talaromyces marneffei PM1
ref|XP_005144642.1|  PREDICTED: calmodulin isoform X2                   148   2e-61   Melopsittacus undulatus
ref|XP_659651.1|  CALM_EMENI Calmodulin (CaM)                           140   3e-61   Aspergillus nidulans FGSC A4
ref|XP_008787894.1|  PREDICTED: calmodulin-like isoform X1              141   4e-61   Phoenix dactylifera
ref|XP_006727042.1|  PREDICTED: calmodulin-like                         139   5e-61   Leptonychotes weddellii
gb|KID69826.1|  EF-hand-like domain protein                             131   1e-60   Metarhizium anisopliae ARSEF 549
ref|XP_007819860.2|  adaptor protein complex gamma-adaptin subunit      131   1e-60   Metarhizium robertsii ARSEF 23
ref|XP_007793474.1|  putative calmodulin protein                        133   2e-60   
gb|EQB57576.1|  hypothetical protein CGLO_02286                         142   3e-60   Colletotrichum gloeosporioides Cg-14
ref|XP_007919083.1|  putative calmodulin protein                        140   3e-60   Phaeoacremonium minimum UCRPA7
ref|XP_007583009.1|  putative calmodulin protein                        136   3e-60   
emb|CCD10980.1|  calmodulin                                             137   3e-60   Aspergillus proliferans
ref|XP_006644879.1|  PREDICTED: calmodulin-like protein 1-like          137   1e-59   
emb|CCG28539.1|  calmodulin                                             134   1e-59   Aspergillus candidus
ref|XP_007719746.1|  calmodulin                                         128   2e-59   Capronia coronata CBS 617.96
gb|EZF28696.1|  calmodulin                                              129   2e-59   Trichophyton interdigitale H6
ref|XP_007814902.1|  calmodulin                                         129   3e-59   Metarhizium acridum CQMa 102
gb|KID73029.1|  EF-hand-like domain protein                             128   7e-59   Metarhizium brunneum ARSEF 3297
gb|ELQ43648.1|  calmodulin                                              128   7e-59   Magnaporthe oryzae Y34
emb|CAA10472.1|  calmodulin-like protein CaML3                          136   8e-59   Branchiostoma lanceolatum [common lancelet]
gb|ADN68241.1|  calmodulin                                              140   8e-59   Colletotrichum gloeosporioides
gb|KIE00442.1|  EF-hand-like domain protein                             127   9e-59   Metarhizium majus ARSEF 297
emb|CCD10985.2|  calmodulin                                             134   9e-59   Aspergillus aculeatinus
dbj|BAE58300.1|  unnamed protein product                                141   9e-59   Aspergillus oryzae RIB40
gb|ADN68243.1|  calmodulin                                              140   1e-58   Colletotrichum gloeosporioides
emb|CCF70746.1|  calmodulin                                             134   2e-58   Aspergillus calidoustus
gb|KIX95728.1|  hypothetical protein Z520_08435                         127   2e-58   Fonsecaea multimorphosa CBS 102226
gb|AAS15749.1|  calmodulin                                              135   2e-58   Penicillium rolfsii
ref|XP_002456511.1|  hypothetical protein SORBIDRAFT_03g037630          131   2e-58   Sorghum bicolor [broomcorn]
emb|CCH57529.1|  calmodulin                                             134   2e-58   Aspergillus cibarius
gb|ADN68264.1|  calmodulin                                              139   3e-58   Colletotrichum gloeosporioides
gb|ADN68283.1|  calmodulin                                              140   3e-58   Colletotrichum gloeosporioides
emb|CCU82138.1|  calmodulin                                             128   3e-58   Blumeria graminis f. sp. hordei DH14
gb|ADN68282.1|  calmodulin                                              140   3e-58   Colletotrichum gloeosporioides
emb|CCA30569.1|  calmodulin                                             134   3e-58   Aspergillus cibarius
gb|ADN68266.1|  calmodulin                                              138   3e-58   Colletotrichum gloeosporioides
gb|AIN40651.1|  calmodulin                                              140   4e-58   Colletotrichum arxii
gb|ADN68265.1|  calmodulin                                              140   4e-58   Colletotrichum gloeosporioides
gb|KEQ66637.1|  EF-hand protein                                         141   5e-58   Aureobasidium melanogenum CBS 110374
gb|AIB03824.1|  calmodulin                                              125   5e-58   Epichloe bromicola
gb|AAS15750.1|  calmodulin                                              133   6e-58   Penicillium manginii
gb|ADN68287.1|  calmodulin                                              139   6e-58   Colletotrichum acutatum
gb|ABQ00494.1|  calmodulin                                              133   6e-58   [Geosmithia] sp. NRRL 35616
gb|AFK30325.1|  calmodulin                                              140   6e-58   Colletotrichum brevisporum
gb|AIA77819.1|  calmodulin                                              137   8e-58   Aspergillus carbonarius
gb|ADN68259.1|  calmodulin                                              140   8e-58   Colletotrichum gloeosporioides
ref|XP_005670261.1|  PREDICTED: calmodulin-like                         136   8e-58   
gb|ADN68246.1|  calmodulin                                              137   9e-58   Colletotrichum gloeosporioides
emb|CCM43805.1|  Calmodulin                                             139   9e-58   Aspergillus sp. ITEM 14783
gb|ADN68286.1|  calmodulin                                              137   9e-58   Colletotrichum acutatum
gb|ABS31365.1|  calmodulin                                              132   1e-57   
gb|AGR66889.1|  calmodulin                                              140   1e-57   Colletotrichum gloeosporioides
gb|AIB03865.1|  calmodulin                                              125   1e-57   Epichloe typhina
emb|CCF55025.1|  calmodulin                                             132   1e-57   Aspergillus puniceus
gb|AJA71496.1|  calmodulin                                              136   1e-57   Colletotrichum riograndense
gb|ADE19215.1|  calmodulin                                              132   1e-57   Penicillium megasporum
gb|ABU62610.1|  calmodulin                                              132   1e-57   Penicillium parvulum
ref|XP_006420057.1|  hypothetical protein CICLE_v10006151mg             140   1e-57   Citrus clementina [clementine]
gb|ABG36555.1|  calmodulin                                              132   2e-57   Penicillium olsonii
ref|XP_011030612.1|  PREDICTED: calmodulin-like protein 8               141   2e-57   Populus euphratica
gb|AIB03840.1|  calmodulin                                              125   2e-57   Epichloe tembladerae
gb|AIN40652.1|  calmodulin                                              138   2e-57   Colletotrichum gigasporum
ref|XP_011427026.1|  PREDICTED: calmodulin-A-like                       138   2e-57   Crassostrea gigas
gb|AFK43190.1|  unknown                                                 139   3e-57   Lotus japonicus
gb|ABU96706.1|  calmodulin                                              130   3e-57   Penicillium syriacum
gb|AIB03828.1|  calmodulin                                              125   4e-57   Epichloe pampeana
ref|XP_002314661.1|  calmodulin 8 family protein                        141   4e-57   Populus trichocarpa [western balsam poplar]
gb|AGR66907.1|  calmodulin                                              139   4e-57   Colletotrichum fructicola
gb|AGN04153.2|  calmodulin                                              130   4e-57   Aspergillus tubingensis
emb|CCM43807.1|  Calmodulin                                             139   4e-57   Aspergillus japonicus
emb|CCM43803.1|  calmodulin                                             139   4e-57   Aspergillus fijiensis
gb|AAK69619.1|  calmodulin                                              140   4e-57   Fusarium proliferatum
gb|AGR66896.1|  calmodulin                                              138   4e-57   Colletotrichum gloeosporioides
gb|ABQ00510.1|  calmodulin                                              130   4e-57   Penicillium decaturense
gb|ABW72282.1|  calmodulin                                              130   5e-57   Aspergillus ruber
gb|ABQ00516.1|  calmodulin                                              131   5e-57   Penicillium glabrum
ref|XP_504759.1|  YALI0E34111p                                          131   6e-57   Yarrowia lipolytica CLIB122
gb|AGR66925.1|  calmodulin                                              139   6e-57   Colletotrichum citri
ref|XP_005387595.1|  PREDICTED: calmodulin-like                         125   7e-57   
gb|ABW17527.1|  calmodulin                                              132   7e-57   Aspergillus ostianus
gb|AAS15767.1|  calmodulin                                              134   7e-57   Penicillium jensenii
gb|AGR66924.1|  calmodulin                                              137   8e-57   Colletotrichum citri
gb|ABS29367.1|  calmodulin                                              129   8e-57   Aspergillus janus
emb|CCA30568.1|  calmodulin                                             125   1e-56   Aspergillus kanagawaensis
gb|ABW17529.1|  calmodulin                                              130   1e-56   Aspergillus ostianus
gb|AHH28236.1|  calmodulin                                              128   1e-56   Penicillium fusisporum
gb|ACZ69450.1|  calmodulin                                              140   1e-56   Colletotrichum fructicola
gb|ABW72598.1|  calmodulin                                              130   1e-56   Aspergillus subsessilis
dbj|BAK64559.1|  calmodulin                                             125   1e-56   Aspergillus unguis
emb|CCM43800.1|  Calmodulin                                             139   2e-56   Aspergillus aculeatus
emb|CCD10983.1|  calmodulin                                             125   3e-56   Aspergillus aculeatus
ref|XP_009420538.1|  PREDICTED: calmodulin-like                         134   4e-56   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADW19791.1|  calmodulin                                              140   5e-56   Colletotrichum boninense
gb|AFM38207.1|  calmodulin                                              129   6e-56   Aspergillus sp. LW-2012
ref|XP_009420537.1|  PREDICTED: calmodulin-2-like                       128   6e-56   Musa acuminata subsp. malaccensis [pisang utan]
emb|CCM43802.1|  calmodulin                                             139   6e-56   Aspergillus fijiensis
gb|ABQ00515.1|  calmodulin                                              132   6e-56   Penicillium angulare
gb|ACZ69456.1|  calmodulin                                              138   6e-56   Colletotrichum siamense
gb|ABQ00498.1|  calmodulin                                              130   7e-56   Penicillium sp. NRRL 35620
gb|ACT80139.1|  calmodulin                                              137   8e-56   Aspergillus ruber
emb|CCA30570.1|  calmodulin                                             125   9e-56   Aspergillus costiformis
gb|AFN53720.1|  calmodulin                                              125   1e-55   Aspergillus terreus
gb|ABU62609.1|  calmodulin                                              125   1e-55   Penicillium parvulum
gb|ABQ00453.1|  calmodulin                                              125   1e-55   Penicillium meleagrinum var. viridiflavum
emb|CCE46006.2|  calmodulin                                             134   1e-55   Aspergillus brunneoviolaceus
ref|XP_002870301.1|  hypothetical protein ARALYDRAFT_330049             137   2e-55   Arabidopsis lyrata subsp. lyrata
gb|ABU55280.2|  calmodulin                                              132   2e-55   Aspergillus fumigatus
gb|ABU55241.1|  calmodulin                                              132   2e-55   Aspergillus cejpii
gb|ABV82924.1|  calmodulin                                              131   2e-55   Aspergillus tubingensis
gb|AGK30434.1|  calmodulin                                              137   2e-55   Colletotrichum hymenocallidis
gb|ABU55219.2|  calmodulin                                              131   2e-55   Aspergillus fumigatus
gb|AGR66927.1|  calmodulin                                              140   2e-55   Colletotrichum sp. zzgmzg1
gb|ABW69728.1|  calmodulin                                              132   3e-55   Aspergillus albertensis
gb|ABW69714.1|  calmodulin                                              129   3e-55   Aspergillus caelatus
emb|CDM22389.1|  calmodulin                                             124   4e-55   Aspergillus tritici
gb|ABW69731.1|  calmodulin                                              132   4e-55   Aspergillus alliaceus
gb|AID49853.1|  calmodulin                                              132   4e-55   Aspergillus creber
ref|NP_193200.1|  calmodulin-like protein 8                             137   4e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010613677.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    131   5e-55   
ref|XP_001210822.1|  calmodulin                                         126   5e-55   Aspergillus terreus NIH2624
gb|AII72224.1|  calmodulin                                              132   5e-55   Aspergillus terreus
gb|ABW04746.1|  calmodulin                                              132   6e-55   Aspergillus sp. NRRL 2161
emb|CCF78823.2|  calmodulin                                             125   6e-55   Aspergillus westerdijkiae
gb|AHB34581.1|  calmodulin                                              134   9e-55   Colletotrichum truncatum
ref|XP_790786.3|  PREDICTED: calmodulin-like protein 12-like            125   9e-55   
gb|AEO13244.1|  calmodulin                                              125   9e-55   Aspergillus minisclerotigenes
gb|ABU55274.2|  calmodulin                                              125   1e-54   Aspergillus cejpii
gb|ADW19797.1|  calmodulin                                              135   1e-54   Colletotrichum karsti
ref|XP_006838912.1|  hypothetical protein AMTR_s00002p00269730          140   1e-54   Amborella trichopoda
emb|CBY85697.1|  calmodulin                                             134   2e-54   Aspergillus quadricinctus
ref|XP_004054725.1|  PREDICTED: calmodulin-like                         129   2e-54   
ref|XP_005065475.1|  PREDICTED: calmodulin-like                         120   2e-54   
gb|AAW67156.1|  calmodulin                                              132   2e-54   Penicillium thiersii
dbj|BAK64535.1|  calmodulin                                             122   3e-54   Aspergillus spinulosporus
gb|AGQ57205.2|  calmodulin                                              134   3e-54   Colletotrichum alienum
emb|CCF72068.1|  calmodulin                                             120   3e-54   Aspergillus insuetus
emb|CBY85701.1|  calmodulin                                             134   4e-54   Aspergillus terreus
gb|AEO13242.1|  calmodulin                                              125   4e-54   Aspergillus minisclerotigenes
gb|ABW04798.1|  calmodulin                                              125   5e-54   Aspergillus ostianus
gb|EYU23698.1|  hypothetical protein MIMGU_mgv1a023732mg                130   7e-54   Erythranthe guttata [common monkey flower]
gb|AFP66109.1|  calmodulin                                              132   7e-54   Aspergillus amoenus
emb|CBY85685.1|  calmodulin                                             133   7e-54   Aspergillus tubingensis
dbj|BAK64557.1|  calmodulin                                             120   9e-54   Aspergillus striatus
gb|KEF60247.1|  calmodulin                                              141   9e-54   Exophiala aquamarina CBS 119918
ref|XP_004391302.1|  PREDICTED: LOW QUALITY PROTEIN: calmodulin-l...    126   1e-53   Trichechus manatus latirostris
ref|XP_002565163.1|  Pc22g12180                                         126   1e-53   Penicillium rubens Wisconsin 54-1255
gb|AGR66928.1|  calmodulin                                              140   1e-53   Colletotrichum sp. gnqczg15
gb|AIZ66412.1|  calmodulin                                              134   2e-53   Alternaria gansuensis
gb|ABW72302.1|  calmodulin                                              132   3e-53   Aspergillus restrictus
emb|CCD10986.1|  calmodulin                                             134   4e-53   Aspergillus fumigatiaffinis
dbj|BAK64538.1|  calmodulin                                             118   4e-53   Aspergillus foveolatus
ref|XP_003020433.1|  hypothetical protein TRV_05472                     130   4e-53   Trichophyton verrucosum HKI 0517
dbj|BAK64550.1|  calmodulin                                             118   4e-53   Aspergillus purpureus
gb|ADN79053.1|  calmodulin                                              120   5e-53   Penicillium raistrickii
gb|AHC70552.1|  calmodulin                                              139   5e-53   Fusarium anthophilum
emb|CBY85683.1|  calmodulin                                             134   6e-53   Aspergillus welwitschiae
emb|CBY85696.1|  calmodulin                                             134   6e-53   Aspergillus tritici
gb|AEO13249.1|  calmodulin                                              125   6e-53   Aspergillus sp. 08AAsp67
emb|CBY85699.1|  calmodulin                                             134   9e-53   Aspergillus tabacinus
ref|XP_458926.2|  DEHA2D10582p                                          118   9e-53   Debaryomyces hansenii CBS767
gb|AIZ66413.1|  calmodulin                                              134   1e-52   Alternaria gansuensis
gb|AIZ66414.1|  calmodulin                                              134   1e-52   Alternaria gansuensis
gb|AID49855.1|  calmodulin                                              129   1e-52   Aspergillus thermomutatus
emb|CBY85682.1|  calmodulin                                             134   1e-52   Aspergillus luchuensis
gb|AFP66126.1|  calmodulin                                              132   1e-52   Aspergillus sydowii
gb|AGG38139.1|  calmodulin                                              137   2e-52   Aspergillus pseudoglaucus
gb|ACC38418.1|  calmodulin                                              125   2e-52   Penicillium gerundense
ref|XP_004196648.1|  Piso0_003872                                       117   3e-52   
gb|AFP93966.1|  calmodulin                                              125   3e-52   Aspergillus japonicus
gb|AII72221.1|  calmodulin                                              118   3e-52   Aspergillus awamori
gb|AFP66123.1|  calmodulin                                              132   4e-52   Aspergillus creber
gb|AHJ60498.1|  calmodulin                                              132   5e-52   
gb|AIM54382.1|  calmodulin                                              125   6e-52   Colletotrichum theobromicola
gb|KFY22392.1|  hypothetical protein V493_06630                         142   7e-52   Pseudogymnoascus sp. VKM F-4281 (FW-2241)
emb|CBY85706.1|  calmodulin                                             135   7e-52   Aspergillus tabacinus
gb|AHJ60495.1|  calmodulin                                              132   7e-52   
gb|ACZ69439.1|  calmodulin                                              125   8e-52   Colletotrichum spaethianum
ref|XP_011129786.1|  calmodulin                                         130   8e-52   Gregarina niphandrodes
emb|CBY85710.1|  calmodulin                                             135   9e-52   
dbj|BAK64543.1|  calmodulin                                             122   9e-52   
gb|ADN79056.1|  calmodulin                                              124   9e-52   
emb|CBY85703.1|  calmodulin                                             135   1e-51   
gb|AIM54387.1|  calmodulin                                              125   1e-51   
gb|ACY69172.1|  calmodulin                                              125   1e-51   
emb|CBY85692.1|  calmodulin                                             134   1e-51   
gb|AIG13031.1|  calmodulin                                              137   1e-51   
gb|AHJ60497.1|  calmodulin                                              131   1e-51   
emb|CBY85724.1|  calmodulin                                             134   2e-51   
gb|AIE13621.1|  calmodulin                                              129   2e-51   
gb|AER10502.1|  calmodulin                                              134   2e-51   
dbj|BAK64565.1|  calmodulin                                             120   2e-51   
gb|AFN40682.1|  calmodulin                                              134   2e-51   
ref|XP_002420201.1|  CaM, putative; calmodulin, putative                114   2e-51   
ref|XP_008062378.1|  PREDICTED: LOW QUALITY PROTEIN: orphan sodiu...    120   2e-51   
gb|EWC46978.1|  calmodulin                                              140   3e-51   
dbj|BAK64567.1|  calmodulin                                             120   3e-51   
gb|ABS29377.1|  calmodulin                                              125   3e-51   
dbj|BAK64544.1|  calmodulin                                             120   3e-51   
emb|CBY85714.1|  calmodulin                                             135   3e-51   
gb|AEO13255.1|  calmodulin                                              125   3e-51   
ref|XP_007280046.1|  calmodulin                                         142   3e-51   
gb|AEO13241.1|  calmodulin                                              115   3e-51   
gb|AFN40767.1|  calmodulin                                              133   3e-51   
gb|KFY83286.1|  hypothetical protein V498_08181                         142   3e-51   
gb|AFN40684.1|  calmodulin                                              132   4e-51   
gb|AFN40649.1|  calmodulin                                              132   4e-51   
ref|XP_006684309.1|  hypothetical protein CANTEDRAFT_118328             114   5e-51   
sp|P23286.2|CALM_CANAX  RecName: Full=Calmodulin; Short=CaM             114   6e-51   
ref|XP_003867318.1|  Cmd1 calmodulin                                    114   6e-51   
gb|EHL02509.1|  putative Calmodulin                                     141   7e-51   
emb|CCM43806.1|  Calmodulin                                             132   7e-51   
ref|XP_007433390.1|  PREDICTED: calmodulin-like                         115   7e-51   
emb|CAE47316.2|  calmodulin                                             132   7e-51   
gb|AFN40704.1|  calmodulin                                              132   8e-51   
ref|XP_007750506.1|  calmodulin                                         141   9e-51   
dbj|BAK64560.1|  calmodulin                                             119   1e-50   
gb|ADN79054.1|  calmodulin                                              120   1e-50   
ref|XP_711861.1|  likely calmodulin                                     114   1e-50   
ref|XP_001387021.1|  calmodulin                                         114   1e-50   
gb|AIQ82882.1|  calmodulin                                              122   1e-50   
dbj|BAK64570.1|  calmodulin                                             118   1e-50   
gb|AGV76400.1|  calmodulin                                              125   1e-50   
emb|CBY85704.1|  calmodulin                                             131   1e-50   
gb|AFN40651.1|  calmodulin                                              130   1e-50   
gb|AFD18811.1|  calmodulin                                              125   2e-50   
gb|KIX06088.1|  calmodulin                                              141   2e-50   
emb|CCM43809.1|  Calmodulin                                             140   2e-50   
emb|CBY85719.1|  calmodulin                                             134   2e-50   
ref|NP_001167662.1|  calmodulin                                         172   2e-50   
gb|AAT73624.1|  calmodulin cam-211                                      139   2e-50   
dbj|BAK64564.1|  calmodulin                                             119   2e-50   
gb|AGL95863.1|  calmodulin                                              140   3e-50   
ref|XP_008246824.1|  PREDICTED: LOW QUALITY PROTEIN: calmodulin-l...    124   3e-50   
gb|AEW26260.1|  calmodulin                                              130   3e-50   
ref|XP_007372997.1|  hypothetical protein SPAPADRAFT_58807              114   3e-50   
dbj|BAK64563.1|  calmodulin                                             116   3e-50   
gb|ADW19792.1|  calmodulin                                              121   3e-50   
emb|CCM43813.1|  Calmodulin                                             139   3e-50   
emb|CCM43801.1|  Calmodulin                                             134   3e-50   
gb|EEE54295.1|  hypothetical protein OsJ_01227                          171   4e-50   
dbj|BAM68215.1|  calmodulin                                             118   4e-50   
dbj|BAK64551.1|  calmodulin                                             122   4e-50   
gb|ACX56278.1|  calmodulin                                              169   4e-50   
gb|AFP33929.1|  calmodulin                                              125   4e-50   
gb|AAK72000.1|  calmodulin                                              168   5e-50   
gb|ADW78256.1|  calmodulin                                              118   5e-50   
emb|CAA06306.1|  CaM-1                                                  169   5e-50   
gb|AHA35753.2|  calmodulin                                              124   5e-50   
dbj|BAK64558.1|  calmodulin                                             122   5e-50   
gb|AAK25752.1|AF334832_1  calmodulin                                    168   5e-50   
emb|CCM43811.1|  Calmodulin                                             139   5e-50   
gb|KDO57357.1|  hypothetical protein CISIN_1g0315341mg                  168   6e-50   
gb|ACX56272.1|  calmodulin                                              169   6e-50   
ref|XP_002488928.1|  hypothetical protein SORBIDRAFT_1599s002010        169   6e-50   
gb|AIA22646.1|  calmodulin                                              129   6e-50   
gb|AER10498.1|  calmodulin                                              129   6e-50   
ref|XP_004252866.2|  PREDICTED: LOW QUALITY PROTEIN: calmodulin         171   6e-50   
gb|EPS64249.1|  hypothetical protein M569_10535                         169   6e-50   
gb|AFN40650.1|  calmodulin                                              128   8e-50   
gb|ADT89773.1|  calmodulin                                              169   1e-49   
ref|XP_004961665.1|  PREDICTED: calmodulin-2-like isoform X1            169   1e-49   
gb|AAT73620.1|  caomodulin cam-207                                      169   1e-49   
ref|XP_006470430.1|  PREDICTED: calmodulin-like isoform X3              169   1e-49   
ref|XP_003632230.1|  PREDICTED: calmodulin-7 isoform X1                 170   1e-49   
gb|KHN34595.1|  Calmodulin                                              169   1e-49   
ref|NP_189967.1|  calmodulin 7                                          169   1e-49   
gb|AFK45794.1|  unknown                                                 169   1e-49   
gb|AFK42827.1|  unknown                                                 169   1e-49   
gb|ACG63497.1|  TCH                                                     169   1e-49   
gb|AAT73618.1|  calmodulin cam-205                                      169   1e-49   
gb|AAK83301.1|  calmodulin-like protein                                 167   1e-49   
ref|XP_006369409.1|  calmodulin-like protein 6a                         169   1e-49   
ref|NP_001238237.1|  calmodulin                                         169   1e-49   
gb|ACB32228.1|  calmodulin                                              169   1e-49   
gb|ABK22713.1|  unknown                                                 169   1e-49   
gb|AGZ84228.1|  calmodulin                                              169   1e-49   
ref|XP_009405855.1|  PREDICTED: calmodulin                              169   1e-49   
gb|ACT53872.1|  calmodulin                                              169   1e-49   
gb|ABW72297.1|  calmodulin                                              125   2e-49   
emb|CAM12360.1|  Z-box binding factor 3                                 168   2e-49   
gb|AFW78488.1|  calmodulin1                                             170   2e-49   
ref|NP_001049948.1|  Os03g0319300                                       169   2e-49   
sp|P04353.2|CALM_SPIOL  RecName: Full=Calmodulin; Short=CaM             169   2e-49   
gb|ACX56275.1|  calmodulin                                              167   2e-49   
ref|XP_009782645.1|  PREDICTED: calmodulin-7-like isoform X2            169   2e-49   
ref|XP_004984569.1|  PREDICTED: calmodulin-like isoform X2              169   2e-49   
ref|XP_010673215.1|  PREDICTED: calmodulin                              169   2e-49   
ref|XP_009391621.1|  PREDICTED: calmodulin                              169   2e-49   
ref|NP_001105490.1|  calmodulin                                         169   2e-49   
ref|XP_009140755.1|  PREDICTED: calmodulin-7-like                       169   2e-49   
dbj|BAK64542.1|  calmodulin                                             118   2e-49   
gb|AAQ63461.1|  calmodulin 4                                            169   2e-49   
ref|XP_006378996.1|  hypothetical protein POPTR_0009s02660g             169   2e-49   
emb|CDX77060.1|  BnaC04g38550D                                          169   2e-49   
ref|XP_010521595.1|  PREDICTED: calmodulin                              169   2e-49   
ref|NP_850096.1|  calmodulin 5                                          167   2e-49   
ref|XP_008811949.1|  PREDICTED: calmodulin-7 isoform X1                 169   2e-49   
ref|XP_010551920.1|  PREDICTED: calmodulin-7-like                       168   2e-49   
ref|XP_007015563.1|  Calmodulin 5                                       169   2e-49   
gb|KJB21752.1|  hypothetical protein B456_004G012100                    167   2e-49   
ref|XP_004144099.1|  PREDICTED: calmodulin-related protein-like         168   2e-49   
emb|CBI24333.3|  unnamed protein product                                168   2e-49   
sp|Q7DMP0.1|CALM2_SOLTU  RecName: Full=Calmodulin-2/4; Short=CaM-2/4    167   2e-49   
ref|XP_009393093.1|  PREDICTED: calmodulin-like                         168   2e-49   
tpg|DAA41801.1|  TPA: calmodulin                                        169   2e-49   
gb|ADK23955.1|  calmodulin                                              168   2e-49   
gb|AEA03083.1|  calmodulin                                              127   2e-49   
gb|AAT73623.1|  calmodulin cam-210                                      168   2e-49   
ref|XP_006470428.1|  PREDICTED: calmodulin-like isoform X1              169   2e-49   
gb|ACX56277.1|  calmodulin                                              167   3e-49   
gb|KDP45998.1|  hypothetical protein JCGZ_14905                         169   3e-49   
emb|CBY85691.1|  calmodulin                                             134   3e-49   
ref|XP_004961666.1|  PREDICTED: calmodulin-2-like isoform X2            168   3e-49   
ref|XP_003632229.1|  PREDICTED: calmodulin-7 isoform X2                 168   3e-49   
gb|AGL95877.1|  calmodulin                                              137   3e-49   
ref|XP_006470429.1|  PREDICTED: calmodulin-like isoform X2              169   3e-49   
gb|AEB71065.1|  calmodulin                                              126   3e-49   
gb|AGW21711.1|  calmodulin 3                                            167   3e-49   
gb|AIA22643.1|  calmodulin                                              126   3e-49   
gb|ADY38663.1|  calmodulin-related protein CAM53                        167   4e-49   
emb|CCJ51912.1|  calmodulin                                             125   4e-49   
ref|XP_007202636.1|  hypothetical protein PRUPE_ppa012070mg             169   4e-49   
dbj|BAK43096.1|  calmodulin                                             118   4e-49   
ref|XP_009402452.1|  PREDICTED: calmodulin                              167   4e-49   
ref|NP_001275359.1|  calmodulin-5/6/7/8                                 167   4e-49   
gb|AFA89864.1|  calmodulin 4                                            167   4e-49   
gb|AFU72864.1|  calmodulin                                              113   5e-49   
gb|ACG31559.1|  calmodulin                                              167   5e-49   
ref|NP_850860.1|  calmodulin 6                                          167   5e-49   
gb|ADW78252.1|  calmodulin                                              120   5e-49   
gb|ACX56274.1|  calmodulin                                              166   5e-49   
ref|XP_009404694.1|  PREDICTED: calmodulin-like                         167   5e-49   
ref|XP_008810798.1|  PREDICTED: calmodulin-7-like                       167   5e-49   
ref|XP_004249098.1|  PREDICTED: calmodulin                              167   5e-49   
ref|XP_003624801.1|  Calmodulin                                         167   5e-49   
emb|CAH57708.1|  calmodulin                                             167   5e-49   
gb|ADK25937.1|  calmodulin                                              167   5e-49   
emb|CAA78058.1|  calmodulin                                             167   5e-49   
gb|EMT08774.1|  Calmodulin                                              168   5e-49   
gb|AAA32765.1|  calmodulin-3                                            167   5e-49   
ref|NP_180271.1|  calmodulin 5                                          167   5e-49   
ref|XP_009417893.1|  PREDICTED: calmodulin-3                            167   5e-49   
ref|NP_001105547.1|  calmodulin2                                        167   5e-49   
gb|ABR21759.1|  calmodulin                                              167   6e-49   
gb|KJB21751.1|  hypothetical protein B456_004G012100                    168   6e-49   
emb|CCM43812.1|  Calmodulin                                             135   6e-49   
sp|A2WNH1.2|CALM3_ORYSI  RecName: Full=Calmodulin-3; Short=CaM-3        167   6e-49   
ref|XP_010510825.1|  PREDICTED: calmodulin-5-like                       168   6e-49   
ref|NP_001189724.1|  calmodulin 2                                       167   6e-49   
emb|CCM43810.1|  Calmodulin                                             134   6e-49   
ref|NP_001236109.1|  uncharacterized protein LOC100527439               167   6e-49   
dbj|BAK43093.1|  calmodulin                                             118   6e-49   
emb|CAD20350.1|  calmodulin 1                                           167   6e-49   
emb|CAD91997.1|  calmodulin                                             125   6e-49   
ref|NP_001055907.1|  Os05g0491100                                       167   6e-49   
emb|CAC84562.1|  putative calmodulin                                    167   6e-49   
ref|XP_009120715.1|  PREDICTED: LOW QUALITY PROTEIN: calmodulin         167   7e-49   
gb|AAC49581.1|  calmodulin TaCaM2-1                                     167   7e-49   
gb|AHJ60500.1|  calmodulin                                              126   7e-49   
ref|XP_010417845.1|  PREDICTED: calmodulin-5 isoform X1                 168   7e-49   
tpg|DAA64211.1|  TPA: calmodulin                                        172   7e-49   
gb|ABR21762.1|  calmodulin                                              167   7e-49   
ref|XP_009419686.1|  PREDICTED: calmodulin-like                         167   7e-49   
gb|AAL79908.1|AF474074_1  calmodulin                                    167   7e-49   
ref|XP_004251248.1|  PREDICTED: calmodulin                              168   7e-49   
gb|ABG82015.1|  calmodulin                                              167   8e-49   
emb|CAA66148.1|  CaMF                                                   167   8e-49   
ref|XP_006295105.1|  hypothetical protein CARUB_v10024180mg             167   8e-49   
gb|AAT73616.1|  calmodulin cam-203                                      167   8e-49   
ref|XP_006408585.1|  hypothetical protein EUTSA_v10002103mg             168   8e-49   
gb|ABR21756.1|  calmodulin                                              167   8e-49   
gb|ABR21718.1|  calmodulin                                              167   8e-49   
gb|ACF84469.1|  unknown                                                 167   8e-49   
gb|AAD34242.1|AF084394_1  calmodulin mutant SYNCAM10                    167   8e-49   
ref|XP_002879035.1|  calmodulin-2                                       168   8e-49   
sp|P27164.2|CALM3_PETHY  RecName: Full=Calmodulin-related protein       168   9e-49   
ref|XP_009380569.1|  PREDICTED: calmodulin-like                         168   9e-49   
gb|KDO66347.1|  hypothetical protein CISIN_1g0446441mg                  167   9e-49   
gb|AIA22642.1|  calmodulin                                              125   9e-49   
gb|AHC97115.1|  calmodulin                                              125   9e-49   
prf||1109190A  calmodulin                                               167   9e-49
gb|ABR21750.1|  calmodulin                                              167   9e-49   
ref|XP_009150282.1|  PREDICTED: calmodulin-like                         167   9e-49   
gb|AAA16320.1|  calmodulin                                              167   9e-49   
ref|NP_850097.1|  calmodulin 5                                          168   9e-49   
sp|P04464.3|CALM_WHEAT  RecName: Full=Calmodulin; Short=CaM             167   9e-49   
ref|XP_001954365.1|  GF16772                                            124   9e-49   
ref|XP_003567308.1|  PREDICTED: calmodulin-3                            167   1e-48   
ref|XP_006294957.1|  hypothetical protein CARUB_v10024013mg             169   1e-48   
ref|XP_009782644.1|  PREDICTED: calmodulin-7-like isoform X1            167   1e-48   
gb|AEB71063.1|  calmodulin                                              124   1e-48   
gb|ABK22644.1|  unknown                                                 166   1e-48   
gb|AJG39837.1|  calmodulin                                              125   1e-48   
gb|AIA79663.1|  calmodulin                                              125   1e-48   
ref|NP_001105455.1|  calmodulin                                         166   1e-48   
tpg|DAA45101.1|  TPA: calmodulin3                                       167   1e-48   
gb|ACU22802.1|  unknown                                                 166   1e-48   
ref|XP_010553894.1|  PREDICTED: calmodulin-7-like                       166   1e-48   
ref|XP_010497669.1|  PREDICTED: calmodulin-1-like                       165   1e-48   



>sp|P48976.2|CALM_MALDO RecName: Full=Calmodulin; Short=CaM [Malus domestica]
 emb|CAA43142.1| Calmodulin [Malus domestica]
Length=149

 Score =   166 bits (419),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = +1

Query  253  GMGQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTD  432
            G G + F   LNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTD
Sbjct  60   GNGTIDFPEPLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTD  119

Query  433  EEVDEMIREADVDGDGQINYEEFVKVMMAK  522
            EEVDEMIREADVDGDGQINYEEFVKVMMAK
Sbjct  120  EEVDEMIREADVDGDGQINYEEFVKVMMAK  149


 Score =   140 bits (354),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 68/68 (100%), Positives = 68/68 (100%), Gaps = 0/68 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPE  278
            NGTIDFPE
Sbjct  61   NGTIDFPE  68


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEF  281
            G+G I++ EF
Sbjct  133  GDGQINYEEF  142


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = +1

Query  292  MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  471
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  1    MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  59

Query  472  GDGQINYEEFVKVMMAK  522
            G+G I++ E + +M  K
Sbjct  60   GNGTIDFPEPLNLMARK  76



>ref|XP_004287204.1| PREDICTED: calmodulin-7 [Fragaria vesca subsp. vesca]
Length=149

 Score =   163 bits (412),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 80/88 (91%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISA+ELRHVMTNLGEKLTDEE
Sbjct  62   GTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISASELRHVMTNLGEKLTDEE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            V+EMI+EADVDGDGQINYEEFVKVMMAK
Sbjct  122  VNEMIQEADVDGDGQINYEEFVKVMMAK  149


 Score =   139 bits (351),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 67/69 (97%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTE ELQDMINEVDAD 
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEVELQDMINEVDADS  60

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  61   NGTIDFPEF  69


 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFRVFDKDQNGFISASELRHVMTNLGEKLTDEEVNEMIQEADVD  132

Query  252  GNGTIDFPEF  281
            G+G I++ EF
Sbjct  133  GDGQINYEEF  142


 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = +1

Query  292  MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  471
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  1    MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEVELQDMINEVDAD  59

Query  472  GDGQINYEEFVKVMMAK  522
             +G I++ EF+ +M  K
Sbjct  60   SNGTIDFPEFLNLMARK  76



>ref|NP_001268169.1| calmodulin [Vitis vinifera]
 gb|AAL58535.1| calmodulin [Vitis vinifera]
Length=149

 Score =   163 bits (412),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = +1

Query  253  GMGQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTD  432
            G G + F   LNLMARKMKDTDSEEELK++FRVFDKDQNGFISAAELRHVMTNLGEKLTD
Sbjct  60   GNGTIDFPESLNLMARKMKDTDSEEELKKSFRVFDKDQNGFISAAELRHVMTNLGEKLTD  119

Query  433  EEVDEMIREADVDGDGQINYEEFVKVMMAK  522
            EEVDEMIREADVDGDGQINYEEFVKVMMAK
Sbjct  120  EEVDEMIREADVDGDGQINYEEFVKVMMAK  149


 Score =   139 bits (351),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 67/68 (99%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLTDDQISEFKEAFSLFDKDGDGCI TKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTDDQISEFKEAFSLFDKDGDGCIATKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPE  278
            NGTIDFPE
Sbjct  61   NGTIDFPE  68


 Score = 61.6 bits (148),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = +1

Query  292  MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  471
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  1    MADQLTD-DQISEFKEAFSLFDKDGDGCIATKELGTVMRSLGQNPTEAELQDMINEVDAD  59

Query  472  GDGQINYEEFVKVMMAK  522
            G+G I++ E + +M  K
Sbjct  60   GNGTIDFPESLNLMARK  76


 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E K++F +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKKSFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEF  281
            G+G I++ EF
Sbjct  133  GDGQINYEEF  142



>ref|XP_010271350.1| PREDICTED: calmodulin [Nelumbo nucifera]
Length=149

 Score =   162 bits (409),  Expect(2) = 5e-72, Method: Compositional matrix adjust.
 Identities = 78/88 (89%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FLNLMARKMKDTDSEEELKEAF+VFDKDQNGFISAAELRHVMTNLGEKLTDEE
Sbjct  62   GTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREADVDGDGQ+NYEEFV++M+AK
Sbjct  122  VDEMIREADVDGDGQVNYEEFVRMMLAK  149


 Score =   136 bits (342),  Expect(2) = 5e-72, Method: Compositional matrix adjust.
 Identities = 65/69 (94%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+QLT++QISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD 
Sbjct  1    MAEQLTEEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQ  60

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  61   NGTIDFPEF  69


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEF  281
            G+G +++ EF
Sbjct  133  GDGQVNYEEF  142


 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D +G I++ EF+ 
Sbjct  12   EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQNGTIDFPEFLN  71

Query  508  VMMAK  522
            +M  K
Sbjct  72   LMARK  76



>gb|AFA89861.2| calmodulin 1 [Lilium longiflorum]
Length=149

 Score =   160 bits (405),  Expect(2) = 6e-72, Method: Compositional matrix adjust.
 Identities = 77/88 (88%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FLNLMARKMKDTDSEEELKEAF+VFDKDQNGFISAAELRHVMTNLGEKLTDEE
Sbjct  62   GTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD+DGDGQ+NYEEFV++M+AK
Sbjct  122  VDEMIREADMDGDGQVNYEEFVRMMLAK  149


 Score =   137 bits (346),  Expect(2) = 6e-72, Method: Compositional matrix adjust.
 Identities = 66/69 (96%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLT+DQI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD 
Sbjct  1    MADQLTEDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQ  60

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  61   NGTIDFPEF  69


 Score = 60.8 bits (146),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADMD  132

Query  252  GNGTIDFPEF  281
            G+G +++ EF
Sbjct  133  GDGQVNYEEF  142


 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D +G I++ EF+ 
Sbjct  12   EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQNGTIDFPEFLN  71

Query  508  VMMAK  522
            +M  K
Sbjct  72   LMARK  76



>ref|XP_010645766.1| PREDICTED: calmodulin [Vitis vinifera]
 emb|CAN72522.1| hypothetical protein VITISV_019208 [Vitis vinifera]
 emb|CBI38257.3| unnamed protein product [Vitis vinifera]
 emb|CDO98639.1| unnamed protein product [Coffea canephora]
Length=149

 Score =   162 bits (409),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 78/88 (89%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FLNLMARKMKDTDSEEELKEAF+VFDKDQNGFISAAELRHVMTNLGEKLTDEE
Sbjct  62   GTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREADVDGDGQ+NYEEFV++M+AK
Sbjct  122  VDEMIREADVDGDGQVNYEEFVRMMLAK  149


 Score =   135 bits (339),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+QLT++QI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD 
Sbjct  1    MAEQLTEEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQ  60

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  61   NGTIDFPEF  69


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEF  281
            G+G +++ EF
Sbjct  133  GDGQVNYEEF  142


 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D +G I++ EF+ 
Sbjct  12   EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQNGTIDFPEFLN  71

Query  508  VMMAK  522
            +M  K
Sbjct  72   LMARK  76



>ref|XP_010243681.1| PREDICTED: calmodulin-like [Nelumbo nucifera]
Length=149

 Score =   159 bits (403),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FLNLMARKMKDTDSEEELKEAF+VFDKDQNGFISAAELRHVMTNLGEKLTDEE
Sbjct  62   GTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            V+EMIREAD+DGDGQ+NYEEFV++M+AK
Sbjct  122  VEEMIREADIDGDGQVNYEEFVRMMLAK  149


 Score =   136 bits (342),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 65/69 (94%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+QLT++QISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD 
Sbjct  1    MAEQLTEEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQ  60

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  61   NGTIDFPEF  69


 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+++MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEEVEEMIREADID  132

Query  252  GNGTIDFPEF  281
            G+G +++ EF
Sbjct  133  GDGQVNYEEF  142


 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D +G I++ EF+ 
Sbjct  12   EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQNGTIDFPEFLN  71

Query  508  VMMAK  522
            +M  K
Sbjct  72   LMARK  76



>ref|XP_010271115.1| PREDICTED: calmodulin-like [Nelumbo nucifera]
Length=149

 Score =   160 bits (404),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 77/88 (88%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FLNLMARKMKDTDSEEELKEAF+VFDKDQNGFISAAELRHVMTNLGEKLTDEE
Sbjct  62   GTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREADVDGDGQ+NYEEFV++M+ K
Sbjct  122  VDEMIREADVDGDGQVNYEEFVRMMLGK  149


 Score =   135 bits (341),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 65/69 (94%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+QLT++QISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD 
Sbjct  1    MAEQLTEEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQ  60

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  61   NGTIDFPEF  69


 Score = 61.6 bits (148),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEF  281
            G+G +++ EF
Sbjct  133  GDGQVNYEEF  142


 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D +G I++ EF+ 
Sbjct  12   EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQNGTIDFPEFLN  71

Query  508  VMMAK  522
            +M  K
Sbjct  72   LMARK  76



>ref|XP_011073165.1| PREDICTED: calmodulin [Sesamum indicum]
Length=149

 Score =   160 bits (404),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 77/88 (88%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FLNLMARKMKD DSEEELKEAF+VFDKDQNGFISAAELRHVMTNLGEKLTDEE
Sbjct  62   GTIDFPEFLNLMARKMKDADSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREADVDGDGQ+NYEEFV++M+AK
Sbjct  122  VDEMIREADVDGDGQVNYEEFVRMMLAK  149


 Score =   135 bits (339),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+QLT++QI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD 
Sbjct  1    MAEQLTEEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQ  60

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  61   NGTIDFPEF  69


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDADSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEF  281
            G+G +++ EF
Sbjct  133  GDGQVNYEEF  142


 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D +G I++ EF+ 
Sbjct  12   EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQNGTIDFPEFLN  71

Query  508  VMMAK  522
            +M  K
Sbjct  72   LMARK  76



>ref|XP_008798212.1| PREDICTED: calmodulin [Phoenix dactylifera]
Length=149

 Score =   159 bits (403),  Expect(2) = 5e-71, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FLNLMARKMKDTDSEEELKEAF+VFDKDQNGFISAAELRHVMTNLGEKLTDEE
Sbjct  62   GTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            V+EMIREAD+DGDGQ+NYEEFV++M+AK
Sbjct  122  VEEMIREADIDGDGQVNYEEFVRMMLAK  149


 Score =   135 bits (339),  Expect(2) = 5e-71, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+QLT++QI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD 
Sbjct  1    MAEQLTEEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQ  60

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  61   NGTIDFPEF  69


 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+++MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEEVEEMIREADID  132

Query  252  GNGTIDFPEF  281
            G+G +++ EF
Sbjct  133  GDGQVNYEEF  142


 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D +G I++ EF+ 
Sbjct  12   EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQNGTIDFPEFLN  71

Query  508  VMMAK  522
            +M  K
Sbjct  72   LMARK  76



>ref|NP_001234786.1| calmodulin [Solanum lycopersicum]
 ref|XP_009589661.1| PREDICTED: calmodulin [Nicotiana tomentosiformis]
 ref|XP_009776698.1| PREDICTED: calmodulin [Nicotiana sylvestris]
 sp|P27161.2|CALM_SOLLC RecName: Full=Calmodulin; Short=CaM [Solanum lycopersicum]
 gb|AAA34144.1| calmodulin [Solanum lycopersicum]
 emb|CAA09302.1| calmodulin 3 protein [Capsicum annuum]
 dbj|BAB61907.1| calmodulin NtCaM1 [Nicotiana tabacum]
 dbj|BAB61908.1| calmodulin NtCaM2 [Nicotiana tabacum]
 emb|CAC84563.1| putative calmodulin [Solanum commersonii]
Length=149

 Score =   161 bits (408),  Expect(2) = 6e-71, Method: Compositional matrix adjust.
 Identities = 77/88 (88%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FLNLMARKMKDTDSEEELKEAF+VFDKDQNGFISAAELRHVMTNLGEKLTDEE
Sbjct  62   GTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD+DGDGQ+NYEEFV++M+AK
Sbjct  122  VDEMIREADIDGDGQVNYEEFVRMMLAK  149


 Score =   132 bits (333),  Expect(2) = 6e-71, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+QLT++QI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMI+EVDAD 
Sbjct  1    MAEQLTEEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMISEVDADQ  60

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  61   NGTIDFPEF  69


 Score = 61.2 bits (147),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADID  132

Query  252  GNGTIDFPEF  281
            G+G +++ EF
Sbjct  133  GDGQVNYEEF  142


 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D +G I++ EF+ 
Sbjct  12   EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMISEVDADQNGTIDFPEFLN  71

Query  508  VMMAK  522
            +M  K
Sbjct  72   LMARK  76



>gb|EYU24499.1| hypothetical protein MIMGU_mgv1a015687mg [Erythranthe guttata]
Length=149

 Score =   160 bits (404),  Expect(2) = 8e-71, Method: Compositional matrix adjust.
 Identities = 77/88 (88%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FLNLMARKMKDTDSEEELKEAF+VFDKDQNGFISAAELRHVM NLGEKLTDEE
Sbjct  62   GTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMANLGEKLTDEE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREADVDGDGQ+NYEEFV++M+AK
Sbjct  122  VDEMIREADVDGDGQVNYEEFVRMMLAK  149


 Score =   134 bits (336),  Expect(2) = 8e-71, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+QLT++QI+EFKEAFSLFDKDGDGCIT+KELGTVMRSLGQNPTEAELQDMINEVDAD 
Sbjct  1    MAEQLTEEQIAEFKEAFSLFDKDGDGCITSKELGTVMRSLGQNPTEAELQDMINEVDADQ  60

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  61   NGTIDFPEF  69


 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMANLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEF  281
            G+G +++ EF
Sbjct  133  GDGQVNYEEF  142


 Score = 60.8 bits (146),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I++ EL  VM +LG+  T+ E+ +MI E D D +G I++ EF+ 
Sbjct  12   EFKEAFSLFDKDGDGCITSKELGTVMRSLGQNPTEAELQDMINEVDADQNGTIDFPEFLN  71

Query  508  VMMAK  522
            +M  K
Sbjct  72   LMARK  76



>ref|XP_010069460.1| PREDICTED: calmodulin [Eucalyptus grandis]
Length=149

 Score =   160 bits (404),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 77/88 (88%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FLNLMARKMKDTDSEEELKEAF+VFDKDQNGFISAAELRHVMTNLGEKLTDEE
Sbjct  62   GTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            V+EMIREADVDGDGQ+NYEEFV++M+AK
Sbjct  122  VEEMIREADVDGDGQVNYEEFVRMMLAK  149


 Score =   133 bits (335),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+QLT++QI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAEL+DMINEVDAD 
Sbjct  1    MAEQLTEEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELRDMINEVDADQ  60

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  61   NGTIDFPEF  69


 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+++MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEEVEEMIREADVD  132

Query  252  GNGTIDFPEF  281
            G+G +++ EF
Sbjct  133  GDGQVNYEEF  142


 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D +G I++ EF+ 
Sbjct  12   EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELRDMINEVDADQNGTIDFPEFLN  71

Query  508  VMMAK  522
            +M  K
Sbjct  72   LMARK  76



>gb|ACR15761.1| calmodulin isoform 1 [Solanum tuberosum]
Length=149

 Score =   160 bits (405),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FLNLMARKMKDTDSEEELKEAF+VFDKDQNGFISAAELRHVMTNLGE+LTDEE
Sbjct  62   GTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGERLTDEE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD+DGDGQ+NYEEFV++M+AK
Sbjct  122  VDEMIREADIDGDGQVNYEEFVRMMLAK  149


 Score =   132 bits (333),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+QLT++QI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMI+EVDAD 
Sbjct  1    MAEQLTEEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMISEVDADQ  60

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  61   NGTIDFPEF  69


 Score = 61.2 bits (147),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGERLTDEEVDEMIREADID  132

Query  252  GNGTIDFPEF  281
            G+G +++ EF
Sbjct  133  GDGQVNYEEF  142


 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D +G I++ EF+ 
Sbjct  12   EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMISEVDADQNGTIDFPEFLN  71

Query  508  VMMAK  522
            +M  K
Sbjct  72   LMARK  76



>ref|XP_006374229.1| calmodulin-like protein 6a [Populus trichocarpa]
 ref|XP_011035530.1| PREDICTED: calmodulin-like [Populus euphratica]
 gb|ERP52026.1| calmodulin-like protein 6a [Populus trichocarpa]
Length=149

 Score =   160 bits (404),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 77/88 (88%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FLNLMARKMKDTDSEEELKEAF+VFDKDQNGFISAAELRHVMTNLGEKLTDEE
Sbjct  62   GTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            V+EMIREADVDGDGQ+NYEEFV++M+AK
Sbjct  122  VEEMIREADVDGDGQVNYEEFVRMMLAK  149


 Score =   133 bits (334),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            M +QLT++QI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD 
Sbjct  1    MTEQLTEEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQ  60

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  61   NGTIDFPEF  69


 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+++MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEEVEEMIREADVD  132

Query  252  GNGTIDFPEF  281
            G+G +++ EF
Sbjct  133  GDGQVNYEEF  142


 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D +G I++ EF+ 
Sbjct  12   EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQNGTIDFPEFLN  71

Query  508  VMMAK  522
            +M  K
Sbjct  72   LMARK  76



>ref|NP_001275042.1| calmodulin-1 [Solanum tuberosum]
 gb|ACX85428.1| calmodulin isoform 1 [Solanum tuberosum]
Length=149

 Score =   160 bits (404),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FLNL+ARKMKDTDSEEELKEAF+VFDKDQNGFISAAELRHVMTNLGEKLTDEE
Sbjct  62   GTIDFPEFLNLIARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD+DGDGQ+NYEEFV++M+AK
Sbjct  122  VDEMIREADIDGDGQVNYEEFVRMMLAK  149


 Score =   132 bits (333),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+QLT++QI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMI+EVDAD 
Sbjct  1    MAEQLTEEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMISEVDADQ  60

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  61   NGTIDFPEF  69


 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = +3

Query  96   DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFP  275
            D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D DG+G +++ 
Sbjct  81   DSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYE  140

Query  276  EF  281
            EF
Sbjct  141  EF  142


 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D +G I++ EF+ 
Sbjct  12   EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMISEVDADQNGTIDFPEFLN  71

Query  508  VMMAK  522
            ++  K
Sbjct  72   LIARK  76



>sp|P13868.2|CALM1_SOLTU RecName: Full=Calmodulin-1; Short=CaM-1 [Solanum tuberosum]
 gb|AAA74405.1| calmodulin [Solanum tuberosum]
Length=149

 Score =   161 bits (408),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 77/88 (88%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FLNLMARKMKDTDSEEELKEAF+VFDKDQNGFISAAELRHVMTNLGEKLTDEE
Sbjct  62   GTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD+DGDGQ+NYEEFV++M+AK
Sbjct  122  VDEMIREADIDGDGQVNYEEFVRMMLAK  149


 Score =   131 bits (329),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+QLT++QI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMI+E DAD 
Sbjct  1    MAEQLTEEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMISEADADQ  60

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  61   NGTIDFPEF  69


 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI EAD D +G I++ EF+ 
Sbjct  12   EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMISEADADQNGTIDFPEFLN  71

Query  508  VMMAK  522
            +M  K
Sbjct  72   LMARK  76


 Score = 61.2 bits (147),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADID  132

Query  252  GNGTIDFPEF  281
            G+G +++ EF
Sbjct  133  GDGQVNYEEF  142



>ref|XP_002317717.1| calmodulin-like protein 6a [Populus trichocarpa]
 ref|XP_011000741.1| PREDICTED: calmodulin [Populus euphratica]
 gb|ABK94542.1| unknown [Populus trichocarpa]
 gb|EEE95937.1| calmodulin-like protein 6a [Populus trichocarpa]
Length=149

 Score =   160 bits (405),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 77/88 (88%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FLNLMARKMKDTDSEEELKEAF+VFDKDQNGFISAAELRHVMTNLGEKLTDEE
Sbjct  62   GTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            V+EMIREADVDGDGQ+NYEEFV++M+AK
Sbjct  122  VEEMIREADVDGDGQVNYEEFVRMMLAK  149


 Score =   132 bits (331),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            M++QLT++QI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMI+EVDAD 
Sbjct  1    MSEQLTEEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMISEVDADQ  60

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  61   NGTIDFPEF  69


 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+++MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEEVEEMIREADVD  132

Query  252  GNGTIDFPEF  281
            G+G +++ EF
Sbjct  133  GDGQVNYEEF  142


 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D +G I++ EF+ 
Sbjct  12   EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMISEVDADQNGTIDFPEFLN  71

Query  508  VMMAK  522
            +M  K
Sbjct  72   LMARK  76



>gb|AAW02790.1| calmodulin 2 [Codonopsis lanceolata]
Length=149

 Score =   157 bits (396),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 75/88 (85%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FLNLMARKMKDTDSEEELKEAF+VF KDQNG+ISAAELRHVMTNLGEKLTDEE
Sbjct  62   GTIDFPEFLNLMARKMKDTDSEEELKEAFKVFGKDQNGYISAAELRHVMTNLGEKLTDEE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD+DGDGQ+NYEEFV++M+AK
Sbjct  122  VDEMIREADMDGDGQVNYEEFVRMMLAK  149


 Score =   135 bits (339),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+QLT++QI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD 
Sbjct  1    MAEQLTEEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQ  60

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  61   NGTIDFPEF  69


 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D +G I++ EF+ 
Sbjct  12   EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQNGTIDFPEFLN  71

Query  508  VMMAK  522
            +M  K
Sbjct  72   LMARK  76


 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +F KD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFKVFGKDQNGYISAAELRHVMTNLGEKLTDEEVDEMIREADMD  132

Query  252  GNGTIDFPEF  281
            G+G +++ EF
Sbjct  133  GDGQVNYEEF  142



>gb|ABA27137.1| calmodulin 1 [Catharanthus roseus]
Length=149

 Score =   162 bits (409),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 78/88 (89%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FLNLMARKMKDTDSEEELKEAF+VFDKDQNGFISAAELRHVMTNLGEKLTDEE
Sbjct  62   GTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREADVDGDGQ+NYEEFV++M+AK
Sbjct  122  VDEMIREADVDGDGQVNYEEFVRMMLAK  149


 Score =   130 bits (326),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+QLT++QI+EFKEAFSLFDKDG GCITTKELGTVMRSLGQNPTEAELQDM NEVDAD 
Sbjct  1    MAEQLTEEQIAEFKEAFSLFDKDGGGCITTKELGTVMRSLGQNPTEAELQDMTNEVDADQ  60

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  61   NGTIDFPEF  69


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  132

Query  252  GNGTIDFPEF  281
            G+G +++ EF
Sbjct  133  GDGQVNYEEF  142


 Score = 58.2 bits (139),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD  G I+  EL  VM +LG+  T+ E+ +M  E D D +G I++ EF+ 
Sbjct  12   EFKEAFSLFDKDGGGCITTKELGTVMRSLGQNPTEAELQDMTNEVDADQNGTIDFPEFLN  71

Query  508  VMMAK  522
            +M  K
Sbjct  72   LMARK  76



>ref|XP_010936850.1| PREDICTED: calmodulin [Elaeis guineensis]
Length=149

 Score =   161 bits (408),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 77/88 (88%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FLNLMARKMKDTDSEEELKEAF+VFDKDQNGFISAAELRHVMTNLGEKLTDEE
Sbjct  62   GTIDFSEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD+DGDGQ+NYEEFV++M+AK
Sbjct  122  VDEMIREADIDGDGQVNYEEFVRMMLAK  149


 Score =   130 bits (326),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+QLT++QI+EFKEAFSLFDKDGDGCITTKEL TVMRSLGQNPTEAELQDMINEVDAD 
Sbjct  1    MAEQLTEEQIAEFKEAFSLFDKDGDGCITTKELSTVMRSLGQNPTEAELQDMINEVDADQ  60

Query  255  NGTIDFPEF  281
            NGTIDF EF
Sbjct  61   NGTIDFSEF  69


 Score = 61.6 bits (148),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADID  132

Query  252  GNGTIDFPEF  281
            G+G +++ EF
Sbjct  133  GDGQVNYEEF  142


 Score = 61.2 bits (147),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D +G I++ EF+ 
Sbjct  12   EFKEAFSLFDKDGDGCITTKELSTVMRSLGQNPTEAELQDMINEVDADQNGTIDFSEFLN  71

Query  508  VMMAK  522
            +M  K
Sbjct  72   LMARK  76



>gb|ABK94169.1| unknown [Populus trichocarpa]
Length=149

 Score =   158 bits (399),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FLNLMARKMKDTDSEEELKEAF+VFDKDQNGFISAAELRHVMTNLGEKLTDEE
Sbjct  62   GTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            V+EMIREADVDGDGQ++YEEFV++M+AK
Sbjct  122  VEEMIREADVDGDGQVSYEEFVRMMLAK  149


 Score =   131 bits (330),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            M +QLT++QI+EFKEAFSLFDKDGDGCITTKELGTVMRSLG+NPTEAELQDMINEVDAD 
Sbjct  1    MTEQLTEEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGRNPTEAELQDMINEVDADQ  60

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  61   NGTIDFPEF  69


 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+++MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEEVEEMIREADVD  132

Query  252  GNGTIDFPEF  281
            G+G + + EF
Sbjct  133  GDGQVSYEEF  142


 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG   T+ E+ +MI E D D +G I++ EF+ 
Sbjct  12   EFKEAFSLFDKDGDGCITTKELGTVMRSLGRNPTEAELQDMINEVDADQNGTIDFPEFLN  71

Query  508  VMMAK  522
            +M  K
Sbjct  72   LMARK  76



>sp|P27163.2|CALM2_PETHY RecName: Full=Calmodulin-2; Short=CaM-2 [Petunia x hybrida]
 gb|AAA33725.1| calmodulin [Petunia x hybrida]
Length=149

 Score =   157 bits (396),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 74/88 (84%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FLNLMARKMKDTDSEEELKEAF+VFDKDQNG+ISAA++RHVMTNLGEKLTDEE
Sbjct  62   GTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGYISAADVRHVMTNLGEKLTDEE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD+DGDGQ+NYEEFV++M+AK
Sbjct  122  VDEMIREADMDGDGQVNYEEFVRMMLAK  149


 Score =   133 bits (334),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+QLT++QI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMI+EVDAD 
Sbjct  1    MAEQLTEEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMISEVDADQ  60

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  61   NGTIDFPEF  69


 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D +G I++ EF+ 
Sbjct  12   EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMISEVDADQNGTIDFPEFLN  71

Query  508  VMMAK  522
            +M  K
Sbjct  72   LMARK  76


 Score = 58.9 bits (141),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  ++  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFKVFDKDQNGYISAADVRHVMTNLGEKLTDEEVDEMIREADMD  132

Query  252  GNGTIDFPEF  281
            G+G +++ EF
Sbjct  133  GDGQVNYEEF  142



>emb|CAH57706.1| calmodulin [Quercus petraea]
Length=149

 Score =   159 bits (403),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FLNLMARKMKDTDSEEEL+EAF+VFDKDQNGFISAAELRHVMTNLGEKLTDEE
Sbjct  62   GTIDFSEFLNLMARKMKDTDSEEELREAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD+DGDGQ+NYEEFV++M+AK
Sbjct  122  VDEMIREADLDGDGQVNYEEFVRMMLAK  149


 Score =   130 bits (326),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+QL ++QI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD 
Sbjct  1    MAEQLMEEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQ  60

Query  255  NGTIDFPEF  281
            NGTIDF EF
Sbjct  61   NGTIDFSEF  69


 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELREAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADLD  132

Query  252  GNGTIDFPEF  281
            G+G +++ EF
Sbjct  133  GDGQVNYEEF  142


 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D +G I++ EF+ 
Sbjct  12   EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQNGTIDFSEFLN  71

Query  508  VMMAK  522
            +M  K
Sbjct  72   LMARK  76



>dbj|BAG38057.1| unnamed protein product [Homo sapiens]
Length=149

 Score =   150 bits (380),  Expect(2) = 7e-68, Method: Compositional matrix adjust.
 Identities = 72/90 (80%), Positives = 81/90 (90%), Gaps = 0/90 (0%)
 Frame = +1

Query  253  GMGQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTD  432
            G G + F   L +MARKMKDTDSEEE++EAFRVFDKD NG+ISAAELRHVMTNLGEKLTD
Sbjct  60   GNGTIDFPESLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTD  119

Query  433  EEVDEMIREADVDGDGQINYEEFVKVMMAK  522
            EEVDEMIREAD+DGDGQ+NYEEFV++M AK
Sbjct  120  EEVDEMIREADIDGDGQVNYEEFVQMMTAK  149


 Score =   133 bits (335),  Expect(2) = 7e-68, Method: Compositional matrix adjust.
 Identities = 64/68 (94%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLT++QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NGTIDFPE  278
            NGTIDFPE
Sbjct  61   NGTIDFPE  68


 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FDKDG+G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADID  132

Query  252  GNGTIDFPEF  281
            G+G +++ EF
Sbjct  133  GDGQVNYEEF  142


 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D DG+G I++ E + 
Sbjct  12   EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPESLT  71

Query  508  VMMAK  522
            +M  K
Sbjct  72   MMARK  76



>gb|ADV17372.1| calmodulin [Ganoderma lucidum]
Length=149

 Score =   150 bits (379),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKM+DTDSEEE+KEAF+VFDKD NG+ISAAELRHVMTNLGEKL+D E
Sbjct  62   GTIDFPEFLTMMARKMRDTDSEEEIKEAFKVFDKDGNGYISAAELRHVMTNLGEKLSDSE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREADVDGDGQINYEEFVK+M++K
Sbjct  122  VDEMIREADVDGDGQINYEEFVKMMLSK  149


 Score =   133 bits (334),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQL+++QISEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDAD 
Sbjct  1    MADQLSEEQISEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADR  60

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  61   NGTIDFPEF  69


 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 48/70 (69%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKDG+G I+  EL  VM +LG+  +++E+ +MI E D D
Sbjct  73   MARKMRDTDSEEEIKEAFKVFDKDGNGYISAAELRHVMTNLGEKLSDSEVDEMIREADVD  132

Query  252  GNGTIDFPEF  281
            G+G I++ EF
Sbjct  133  GDGQINYEEF  142


 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 3/76 (4%)
 Frame = +1

Query  304  MKDTDSEE---ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDG  474
            M D  SEE   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D 
Sbjct  1    MADQLSEEQISEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADR  60

Query  475  DGQINYEEFVKVMMAK  522
            +G I++ EF+ +M  K
Sbjct  61   NGTIDFPEFLTMMARK  76



>ref|XP_007209738.1| hypothetical protein PRUPE_ppa012922mg [Prunus persica]
 ref|XP_008240397.1| PREDICTED: calmodulin-like [Prunus mume]
 gb|EMJ10937.1| hypothetical protein PRUPE_ppa012922mg [Prunus persica]
Length=149

 Score =   154 bits (388),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 74/88 (84%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FLNLMARKMKDTDSEEEL+EAF+VFDKDQNGFISAAELRHVM NLGEKLTDEE
Sbjct  62   GTIDFSEFLNLMARKMKDTDSEEELREAFKVFDKDQNGFISAAELRHVMANLGEKLTDEE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDGQ+NYEEFV++M+ K
Sbjct  122  VDEMIREADEDGDGQVNYEEFVRMMLNK  149


 Score =   129 bits (325),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+QLT++QI+EFKEAF LFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD 
Sbjct  1    MAEQLTEEQIAEFKEAFCLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQ  60

Query  255  NGTIDFPEF  281
            NGTIDF EF
Sbjct  61   NGTIDFSEF  69


 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELREAFKVFDKDQNGFISAAELRHVMANLGEKLTDEEVDEMIREADED  132

Query  252  GNGTIDFPEF  281
            G+G +++ EF
Sbjct  133  GDGQVNYEEF  142


 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D +G I++ EF+ 
Sbjct  12   EFKEAFCLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQNGTIDFSEFLN  71

Query  508  VMMAK  522
            +M  K
Sbjct  72   LMARK  76



>emb|CCA71197.1| probable Calmodulin [Piriformospora indica DSM 11827]
Length=149

 Score =   149 bits (375),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE+KEAF+VFDKD NG+IS+AELRHVM NLGEKLTD E
Sbjct  62   GTVDFPEFLTMMARKMKDTDSEEEIKEAFKVFDKDGNGYISSAELRHVMLNLGEKLTDSE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREADVDGDGQINYEEFVK+M++K
Sbjct  122  VDEMIREADVDGDGQINYEEFVKMMLSK  149


 Score =   133 bits (334),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLT++QISEFKEAFSLFDKDGDG ITT+ELGTVMRSLGQNPTEAELQDMINEVDAD 
Sbjct  1    MADQLTEEQISEFKEAFSLFDKDGDGTITTRELGTVMRSLGQNPTEAELQDMINEVDADS  60

Query  255  NGTIDFPEF  281
            NGT+DFPEF
Sbjct  61   NGTVDFPEF  69


 Score = 67.0 bits (162),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 49/70 (70%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKDG+G I++ EL  VM +LG+  T++E+ +MI E D D
Sbjct  73   MARKMKDTDSEEEIKEAFKVFDKDGNGYISSAELRHVMLNLGEKLTDSEVDEMIREADVD  132

Query  252  GNGTIDFPEF  281
            G+G I++ EF
Sbjct  133  GDGQINYEEF  142


 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D +G +++ EF+ 
Sbjct  12   EFKEAFSLFDKDGDGTITTRELGTVMRSLGQNPTEAELQDMINEVDADSNGTVDFPEFLT  71

Query  508  VMMAK  522
            +M  K
Sbjct  72   MMARK  76



>ref|XP_008393461.1| PREDICTED: calmodulin [Malus domestica]
 ref|XP_009360032.1| PREDICTED: calmodulin [Pyrus x bretschneideri]
 ref|XP_009360033.1| PREDICTED: calmodulin [Pyrus x bretschneideri]
Length=149

 Score =   153 bits (386),  Expect(2) = 7e-67, Method: Compositional matrix adjust.
 Identities = 74/88 (84%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FLNLMARKMKDTDSEEELKEAF+VFDKDQNGFISAAELRHVM NLGEKLTDEE
Sbjct  62   GTIDFSEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMANLGEKLTDEE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            V+EMIREAD DGDGQ+NYEEFV++M+ K
Sbjct  122  VNEMIREADEDGDGQVNYEEFVRMMLNK  149


 Score =   128 bits (321),  Expect(2) = 7e-67, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+QLT++QI+EFKEAF LFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMI+EVDAD 
Sbjct  1    MAEQLTEEQIAEFKEAFCLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMISEVDADQ  60

Query  255  NGTIDFPEF  281
            NGTIDF EF
Sbjct  61   NGTIDFSEF  69


 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMANLGEKLTDEEVNEMIREADED  132

Query  252  GNGTIDFPEF  281
            G+G +++ EF
Sbjct  133  GDGQVNYEEF  142


 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D +G I++ EF+ 
Sbjct  12   EFKEAFCLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMISEVDADQNGTIDFSEFLN  71

Query  508  VMMAK  522
            +M  K
Sbjct  72   LMARK  76



>ref|XP_008375032.1| PREDICTED: calmodulin-like [Malus domestica]
Length=149

 Score =   152 bits (384),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 74/88 (84%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FLNLMARKMKDTDSEEELKEAF+VFDKDQNGFISAAELRHVM NLGEKLTDEE
Sbjct  62   GTIDFSEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMANLGEKLTDEE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            V EMIREAD DGDGQ+NYEEFV++M+ K
Sbjct  122  VSEMIREADDDGDGQVNYEEFVRMMLNK  149


 Score =   127 bits (320),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+QLT++QI+EFKEAF LFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMI+EVDAD 
Sbjct  1    MAEQLTEEQIAEFKEAFCLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMISEVDADQ  60

Query  255  NGTIDFPEF  281
            NGTIDF EF
Sbjct  61   NGTIDFSEF  69


 Score = 60.8 bits (146),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMANLGEKLTDEEVSEMIREADDD  132

Query  252  GNGTIDFPEF  281
            G+G +++ EF
Sbjct  133  GDGQVNYEEF  142


 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D +G I++ EF+ 
Sbjct  12   EFKEAFCLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMISEVDADQNGTIDFSEFLN  71

Query  508  VMMAK  522
            +M  K
Sbjct  72   LMARK  76



>gb|AGB85032.1| calmodulin-like protein, partial [Auxenochlorella protothecoides]
Length=192

 Score =   154 bits (390),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 73/88 (83%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL+LMARKMKD+DSEEEL+EAF+VFDKD NGFIS+AELRHVMTNLGEKLTDEE
Sbjct  64   GTIDFPEFLSLMARKMKDSDSEEELREAFKVFDKDGNGFISSAELRHVMTNLGEKLTDEE  123

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDGQ+NYEEFVK+M+AK
Sbjct  124  VDEMIREADADGDGQVNYEEFVKMMLAK  151


 Score =   125 bits (313),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +3

Query  69   LTMADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDA  248
            +T A QLTD+Q++EFKEAF+LFDKDGDG ITTKELGTVMRSLGQNPTEAEL+DMI+EVDA
Sbjct  1    MTEAAQLTDEQVAEFKEAFALFDKDGDGTITTKELGTVMRSLGQNPTEAELKDMISEVDA  60

Query  249  DGNGTIDFPEF  281
            D NGTIDFPEF
Sbjct  61   DKNGTIDFPEF  71


 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 49/70 (70%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FDKDG+G I++ EL  VM +LG+  T+ E+ +MI E DAD
Sbjct  75   MARKMKDSDSEEELREAFKVFDKDGNGFISSAELRHVMTNLGEKLTDEEVDEMIREADAD  134

Query  252  GNGTIDFPEF  281
            G+G +++ EF
Sbjct  135  GDGQVNYEEF  144


 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D +G I++ EF+ 
Sbjct  14   EFKEAFALFDKDGDGTITTKELGTVMRSLGQNPTEAELKDMISEVDADKNGTIDFPEFLS  73

Query  508  VMMAK  522
            +M  K
Sbjct  74   LMARK  78



>ref|XP_004299498.1| PREDICTED: calmodulin-like [Fragaria vesca subsp. vesca]
Length=149

 Score =   151 bits (382),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 72/88 (82%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FLNLMARKMKDTDSEEEL+EAF+VFDKDQNG+ISAAELRHVM NLGEKLTDEE
Sbjct  62   GTIDFSEFLNLMARKMKDTDSEEELREAFKVFDKDQNGYISAAELRHVMANLGEKLTDEE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDGQ+NY+EFV++M+ K
Sbjct  122  VDEMIREADEDGDGQVNYDEFVRMMLNK  149


 Score =   127 bits (320),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            M +QLT++QI+EFKEAF LFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD 
Sbjct  1    MTEQLTEEQIAEFKEAFCLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQ  60

Query  255  NGTIDFPEF  281
            NGTIDF EF
Sbjct  61   NGTIDFSEF  69


 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEELREAFKVFDKDQNGYISAAELRHVMANLGEKLTDEEVDEMIREADED  132

Query  252  GNGTIDFPEF  281
            G+G +++ EF
Sbjct  133  GDGQVNYDEF  142


 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D +G I++ EF+ 
Sbjct  12   EFKEAFCLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQNGTIDFSEFLN  71

Query  508  VMMAK  522
            +M  K
Sbjct  72   LMARK  76



>ref|XP_009355982.1| PREDICTED: calmodulin-like [Pyrus x bretschneideri]
Length=149

 Score =   149 bits (375),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 72/88 (82%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FLNLMARKMKDTDS+EELKEAF+VFDKDQNGFISAAELRHVM NLGEKLTDEE
Sbjct  62   GTIDFSEFLNLMARKMKDTDSDEELKEAFKVFDKDQNGFISAAELRHVMANLGEKLTDEE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            V+EMI EAD DGDGQ+NYEEFV++M+ K
Sbjct  122  VNEMICEADEDGDGQVNYEEFVRMMLNK  149


 Score =   127 bits (319),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+QLT++QI+EFKEAF LFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMI+EVDAD 
Sbjct  1    MAEQLTEEQIAEFKEAFCLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMISEVDADQ  60

Query  255  NGTIDFPEF  281
            NGTIDF EF
Sbjct  61   NGTIDFSEF  69


 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSDEELKEAFKVFDKDQNGFISAAELRHVMANLGEKLTDEEVNEMICEADED  132

Query  252  GNGTIDFPEF  281
            G+G +++ EF
Sbjct  133  GDGQVNYEEF  142


 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D +G I++ EF+ 
Sbjct  12   EFKEAFCLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMISEVDADQNGTIDFSEFLN  71

Query  508  VMMAK  522
            +M  K
Sbjct  72   LMARK  76



>gb|KJB53085.1| hypothetical protein B456_008G292900 [Gossypium raimondii]
Length=150

 Score =   144 bits (364),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FLNL+ARKMKDT+SEEELKEAF+VFDKDQNGFISA +LRH MTNLGE LTDEE
Sbjct  62   GTIDFPEFLNLIARKMKDTESEEELKEAFKVFDKDQNGFISATDLRHAMTNLGEILTDEE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMM  516
            VDEMI EAD DGDGQ+NYEEFV++MM
Sbjct  122  VDEMIHEADTDGDGQVNYEEFVRMMM  147


 Score =   130 bits (328),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            M DQLTD+QI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQ MINEV AD 
Sbjct  1    MVDQLTDEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQGMINEVGADQ  60

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  61   NGTIDFPEF  69


 Score = 55.8 bits (133),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +3

Query  108  EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            E KEAF +FDKD +G I+  +L   M +LG+  T+ E+ +MI+E D DG+G +++ EF
Sbjct  85   ELKEAFKVFDKDQNGFISATDLRHAMTNLGEILTDEEVDEMIHEADTDGDGQVNYEEF  142


 Score = 55.5 bits (132),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+  MI E   D +G I++ EF+ 
Sbjct  12   EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQGMINEVGADQNGTIDFPEFLN  71

Query  508  VMMAK  522
            ++  K
Sbjct  72   LIARK  76



>gb|AAK25753.1|AF334833_1 calmodulin [Castanea sativa]
Length=148

 Score =   155 bits (393),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 74/88 (84%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FLNLMARKMKDTDSEEELKEAF+VFDKDQNGFISAAELRHVMTNLGEKLTDEE
Sbjct  61   GTIDFSEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEE  120

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMI++AD+DGDGQ+NY+EFV++M+AK
Sbjct  121  VDEMIQKADLDGDGQVNYQEFVRMMLAK  148


 Score =   119 bits (298),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 62/69 (90%), Gaps = 1/69 (1%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA QLT  QI+EFK  FSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD 
Sbjct  1    MAGQLTG-QIAEFKGIFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQ  59

Query  255  NGTIDFPEF  281
            NGTIDF EF
Sbjct  60   NGTIDFSEF  68


 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI + D D
Sbjct  72   MARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIQKADLD  131

Query  252  GNGTIDFPEF  281
            G+G +++ EF
Sbjct  132  GDGQVNYQEF  141


 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E K  F +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D +G I++ EF+ 
Sbjct  11   EFKGIFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQNGTIDFSEFLN  70

Query  508  VMMAK  522
            +M  K
Sbjct  71   LMARK  75



>sp|Q40642.1|CML1_ORYSI RecName: Full=Calmodulin-like protein 1; AltName: Full=OsCaM61; 
Flags: Precursor [Oryza sativa Indica Group]
 gb|AAA98933.1| novel calmodulin-like protein [Oryza sativa]
 gb|AAC18355.1| calmodulin-like protein [Oryza sativa Indica Group]
 gb|AAF33852.1| calmodulin-like protein [Oryza sativa Indica Group]
 gb|EAY76219.1| hypothetical protein OsI_04155 [Oryza sativa Indica Group]
 gb|ADI87406.1| calmodulin-like protein [Oryza sativa]
 gb|ADI87408.1| calmodulin-like protein [Oryza sativa]
Length=187

 Score =   152 bits (385),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 73/88 (83%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F+ FL LMARK++D DSEEELKEAFRVFDKDQNGFISAAELRHVM N+GE+LTDEE
Sbjct  62   GNIEFKEFLGLMARKLRDKDSEEELKEAFRVFDKDQNGFISAAELRHVMANIGERLTDEE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            V EMI EADVDGDGQINYEEFVK MMAK
Sbjct  122  VGEMISEADVDGDGQINYEEFVKCMMAK  149


 Score =   122 bits (306),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQL+++QI EF+EAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMI+EVDAD 
Sbjct  1    MADQLSEEQIVEFREAFSLFDKDGDGSITTKELGTVMRSLGQNPTEAELQDMISEVDADS  60

Query  255  NGTIDFPEF  281
            NG I+F EF
Sbjct  61   NGNIEFKEF  69


 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA +L D D   E KEAF +FDKD +G I+  EL  VM ++G+  T+ E+ +MI+E D D
Sbjct  73   MARKLRDKDSEEELKEAFRVFDKDQNGFISAAELRHVMANIGERLTDEEVGEMISEADVD  132

Query  252  GNGTIDFPEF  281
            G+G I++ EF
Sbjct  133  GDGQINYEEF  142


 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 3/76 (4%)
 Frame = +1

Query  304  MKDTDSEE---ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDG  474
            M D  SEE   E +EAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D 
Sbjct  1    MADQLSEEQIVEFREAFSLFDKDGDGSITTKELGTVMRSLGQNPTEAELQDMISEVDADS  60

Query  475  DGQINYEEFVKVMMAK  522
            +G I ++EF+ +M  K
Sbjct  61   NGNIEFKEFLGLMARK  76



>ref|XP_008986517.1| PREDICTED: calmodulin [Callithrix jacchus]
Length=150

 Score =   151 bits (381),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = +1

Query  262  QLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEV  441
             LT Q+ L +MARKMKDTDSEEE++EAFRVFDKD NG+ISAAELRHVMTNLGEKLTDEEV
Sbjct  64   HLTSQNSLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEV  123

Query  442  DEMIREADVDGDGQINYEEFVKVMMAK  522
            DEMIREAD+DGDGQ+NYEEFV++M AK
Sbjct  124  DEMIREADIDGDGQVNYEEFVQMMTAK  150


 Score =   121 bits (304),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 61/62 (98%), Gaps = 0/62 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLT++QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  255  NG  260
            NG
Sbjct  61   NG  62


 Score = 63.9 bits (154),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FDKDG+G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  74   MARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADID  133

Query  252  GNGTIDFPEF  281
            G+G +++ EF
Sbjct  134  GDGQVNYEEF  143


 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D DG+G     +   
Sbjct  12   EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGYHLTSQNSL  71

Query  508  VMMAK  522
             MMA+
Sbjct  72   TMMAR  76



>gb|KIW16124.1| calmodulin [Exophiala spinifera]
Length=209

 Score =   142 bits (359),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  122  GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  181

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  182  VDEMIREADQDGDGRIDYNEFVQLMMQK  209


 Score =   129 bits (325),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +3

Query  63   RALTMADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEV  242
            R   MAD LT++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEV
Sbjct  57   RLPNMADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEV  116

Query  243  DADGNGTIDFPEF  281
            DAD NGTIDFPEF
Sbjct  117  DADNNGTIDFPEF  129


 Score = 62.8 bits (151),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 47/140 (34%), Positives = 69/140 (49%), Gaps = 13/140 (9%)
 Frame = +1

Query  124  SACLTR---TEMVALLPRSWEQLCGHWGRTQ-LRLSFRI*SMKLMLMGMGQLTFQSFLNL  291
            S C ++   T     +P  ++ L G    T     S+      L L      T  SF  L
Sbjct  3    SGCFSQALATAQATDMPTPYKVLVGRKNNTPSAPRSYD----SLALYHSIATTDSSFARL  58

Query  292  MARKMKDTDSEE---ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREA  462
                M D+ +EE   E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E 
Sbjct  59   --PNMADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEV  116

Query  463  DVDGDGQINYEEFVKVMMAK  522
            D D +G I++ EF+ +M  K
Sbjct  117  DADNNGTIDFPEFLTMMARK  136


 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  133  MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  192

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  193  GDGRIDYNEF  202



>gb|KFX88509.1| hypothetical protein O988_09002 [Pseudogymnoascus pannorum VKM 
F-3808]
Length=189

 Score =   141 bits (356),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSE+E++EAF+VFD+D NGFISAAELRHVMT++GEKLTDEE
Sbjct  102  GTIDFPEFLTMMARKMKDTDSEDEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDEE  161

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  162  VDEMIREADQDGDGRIDYNEFVQLMMQK  189


 Score =   130 bits (327),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LT+DQ+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD 
Sbjct  41   MADALTEDQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  100

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  101  NGTIDFPEF  109


 Score = 62.0 bits (149),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  113  MARKMKDTDSEDEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDEEVDEMIREADQD  172

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  173  GDGRIDYNEF  182


 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +1

Query  316  DSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYE  495
            D   E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ 
Sbjct  48   DQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFP  107

Query  496  EFVKVMMAK  522
            EF+ +M  K
Sbjct  108  EFLTMMARK  116



>ref|XP_008081431.1| EF-hand [Glarea lozoyensis ATCC 20868]
 gb|EPE31702.1| EF-hand [Glarea lozoyensis ATCC 20868]
Length=203

 Score =   142 bits (358),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  116  GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  175

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  176  VDEMIREADQDGDGRIDYNEFVQLMMQK  203


 Score =   129 bits (325),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LT++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD 
Sbjct  55   MADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  114

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  115  NGTIDFPEF  123


 Score = 62.0 bits (149),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  127  MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  186

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  187  GDGRIDYNEF  196


 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 3/76 (4%)
 Frame = +1

Query  304  MKDTDSEE---ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDG  474
            M D+ +EE   E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D 
Sbjct  55   MADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  114

Query  475  DGQINYEEFVKVMMAK  522
            +G I++ EF+ +M  K
Sbjct  115  NGTIDFPEFLTMMARK  130



>ref|XP_011113630.1| hypothetical protein H072_7905 [Dactylellina haptotyla CBS 200.50]
 gb|EPS38312.1| hypothetical protein H072_7905 [Dactylellina haptotyla CBS 200.50]
Length=202

 Score =   140 bits (354),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NG+ISAAELRHVMT++GEKLTD E
Sbjct  115  GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGYISAAELRHVMTSIGEKLTDAE  174

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  175  VDEMIREADQDGDGRIDYNEFVQLMMQK  202


 Score =   131 bits (330),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +3

Query  72   TMADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            T ADQLT++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD
Sbjct  53   TWADQLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDAD  112

Query  252  GNGTIDFPEF  281
             NGTIDFPEF
Sbjct  113  NNGTIDFPEF  122


 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+AE+ +MI E D D
Sbjct  126  MARKMKDTDSEEEIREAFKVFDRDNNGYISAAELRHVMTSIGEKLTDAEVDEMIREADQD  185

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  186  GDGRIDYNEF  195


 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  65   EFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  124

Query  508  VMMAK  522
            +M  K
Sbjct  125  MMARK  129



>gb|KFY44228.1| hypothetical protein V495_03553 [Pseudogymnoascus pannorum VKM 
F-4514 (FW-929)]
 gb|KFY57857.1| hypothetical protein V497_05261 [Pseudogymnoascus pannorum VKM 
F-4516 (FW-969)]
Length=209

 Score =   141 bits (356),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSE+E++EAF+VFD+D NGFISAAELRHVMT++GEKLTDEE
Sbjct  122  GTIDFPEFLTMMARKMKDTDSEDEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDEE  181

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  182  VDEMIREADQDGDGRIDYNEFVQLMMQK  209


 Score =   130 bits (326),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LT+DQ+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD 
Sbjct  61   MADALTEDQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  120

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  121  NGTIDFPEF  129


 Score = 62.0 bits (149),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  133  MARKMKDTDSEDEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDEEVDEMIREADQD  192

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  193  GDGRIDYNEF  202


 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 67/133 (50%), Gaps = 15/133 (11%)
 Frame = +1

Query  169  SWEQ---LCGHW-------GRTQLRLSFRI*SMKLM--LMGMGQLTFQSFLNLMARKMKD  312
            SW++   + G W       GRT  + S    S      L  + + T    L+     M D
Sbjct  4    SWDKDNNIWGGWQLEGIGAGRTSAQSSLPQLSPPYFDNLENITKYTSHLQLHHQTSNMAD  63

Query  313  TDSEE---ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQ  483
              +E+   E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G 
Sbjct  64   ALTEDQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGT  123

Query  484  INYEEFVKVMMAK  522
            I++ EF+ +M  K
Sbjct  124  IDFPEFLTMMARK  136



>emb|CCE34004.1| probable calmodulin [Claviceps purpurea 20.1]
Length=175

 Score =   141 bits (356),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  88   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  147

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  148  VDEMIREADQDGDGRIDYNEFVQLMMQK  175


 Score =   130 bits (326),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +3

Query  69   LTMADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDA  248
            L MAD LT++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDA
Sbjct  25   LIMADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDA  84

Query  249  DGNGTIDFPEF  281
            D NGTIDFPEF
Sbjct  85   DNNGTIDFPEF  95


 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 53/86 (62%), Gaps = 3/86 (3%)
 Frame = +1

Query  274  QSFLNLMARKMKDTDSEE---ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVD  444
            QS L+     M D+ +EE   E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ 
Sbjct  17   QSILDTHFLIMADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQ  76

Query  445  EMIREADVDGDGQINYEEFVKVMMAK  522
            +MI E D D +G I++ EF+ +M  K
Sbjct  77   DMINEVDADNNGTIDFPEFLTMMARK  102


 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  99   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  158

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  159  GDGRIDYNEF  168



>gb|KFX94087.1| hypothetical protein V490_04534 [Pseudogymnoascus pannorum VKM 
F-3557]
Length=209

 Score =   141 bits (356),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSE+E++EAF+VFD+D NGFISAAELRHVMT++GEKLTDEE
Sbjct  122  GTIDFPEFLTMMARKMKDTDSEDEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDEE  181

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  182  VDEMIREADQDGDGRIDYNEFVQLMMQK  209


 Score =   129 bits (325),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LT+DQ+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD 
Sbjct  61   MADALTEDQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  120

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  121  NGTIDFPEF  129


 Score = 61.6 bits (148),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  133  MARKMKDTDSEDEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDEEVDEMIREADQD  192

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  193  GDGRIDYNEF  202


 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +1

Query  316  DSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYE  495
            D   E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ 
Sbjct  68   DQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFP  127

Query  496  EFVKVMMAK  522
            EF+ +M  K
Sbjct  128  EFLTMMARK  136



>ref|NP_001044583.1| Os01g0810300 [Oryza sativa Japonica Group]
 sp|Q8S1Y9.1|CML1_ORYSJ RecName: Full=Calmodulin-like protein 1; AltName: Full=OsCAM61; 
Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAB89640.1| putative calmodulin [Oryza sativa Japonica Group]
 dbj|BAF06497.1| Os01g0810300 [Oryza sativa Japonica Group]
 gb|EAZ13896.1| hypothetical protein OsJ_03822 [Oryza sativa Japonica Group]
 dbj|BAG92193.1| unnamed protein product [Oryza sativa Japonica Group]
Length=187

 Score =   150 bits (380),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 72/88 (82%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F+ FL LMARK++D DSEEELKEAFRVFDKDQNGFISA ELRHVM N+GE+LTDEE
Sbjct  62   GNIEFKEFLGLMARKLRDKDSEEELKEAFRVFDKDQNGFISATELRHVMANIGERLTDEE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            V EMI EADVDGDGQINYEEFVK MMAK
Sbjct  122  VGEMISEADVDGDGQINYEEFVKCMMAK  149


 Score =   120 bits (301),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQL+++QI EF+EAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMI+EVD D 
Sbjct  1    MADQLSEEQIGEFREAFSLFDKDGDGSITTKELGTVMRSLGQNPTEAELQDMISEVDTDS  60

Query  255  NGTIDFPEF  281
            NG I+F EF
Sbjct  61   NGNIEFKEF  69


 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA +L D D   E KEAF +FDKD +G I+  EL  VM ++G+  T+ E+ +MI+E D D
Sbjct  73   MARKLRDKDSEEELKEAFRVFDKDQNGFISATELRHVMANIGERLTDEEVGEMISEADVD  132

Query  252  GNGTIDFPEF  281
            G+G I++ EF
Sbjct  133  GDGQINYEEF  142


 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 3/76 (4%)
 Frame = +1

Query  304  MKDTDSEE---ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDG  474
            M D  SEE   E +EAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D 
Sbjct  1    MADQLSEEQIGEFREAFSLFDKDGDGSITTKELGTVMRSLGQNPTEAELQDMISEVDTDS  60

Query  475  DGQINYEEFVKVMMAK  522
            +G I ++EF+ +M  K
Sbjct  61   NGNIEFKEFLGLMARK  76



>gb|EXA43615.1| calmodulin [Fusarium oxysporum f. sp. pisi HDV247]
 gb|EXK91543.1| calmodulin [Fusarium oxysporum f. sp. raphani 54005]
 gb|EXL84304.1| calmodulin [Fusarium oxysporum f. sp. conglutinans race 2 54008]
 gb|EXM22417.1| calmodulin [Fusarium oxysporum f. sp. vasinfectum 25433]
Length=220

 Score =   142 bits (359),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  133  GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  192

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  193  VDEMIREADQDGDGRIDYNEFVQLMMQK  220


 Score =   128 bits (321),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LT++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD 
Sbjct  72   MADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  131

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  132  NGTIDFPEF  140


 Score = 62.4 bits (150),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 62/131 (47%), Gaps = 16/131 (12%)
 Frame = +1

Query  139  RTEMVALLPRSWEQLCGHWGRTQLRLSFRI*SMKLMLMGMGQLTFQSFLNLMARKMKDTD  318
            R++ +   PR       H        SF        L+    L   S        M D+ 
Sbjct  30   RSDTLGSRPRDLRTCPSHLS------SFSCDRHPPFLLSQPLLPHTS-------NMADSL  76

Query  319  SEE---ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQIN  489
            +EE   E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I+
Sbjct  77   TEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTID  136

Query  490  YEEFVKVMMAK  522
            + EF+ +M  K
Sbjct  137  FPEFLTMMARK  147


 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  144  MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  203

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  204  GDGRIDYNEF  213



>gb|ERT02366.1| calmodulin [Sporothrix schenckii ATCC 58251]
Length=163

 Score =   142 bits (359),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTDEE
Sbjct  76   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDEE  135

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  136  VDEMIREADQDGDGRIDYNEFVQLMMQK  163


 Score =   127 bits (320),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +3

Query  63   RALTMADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEV  242
            R   +A+ LT++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEV
Sbjct  11   RPRALAESLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEV  70

Query  243  DADGNGTIDFPEF  281
            DAD NGTIDFPEF
Sbjct  71   DADNNGTIDFPEF  83


 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  87   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDEEVDEMIREADQD  146

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  147  GDGRIDYNEF  156


 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  26   EFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  85

Query  508  VMMAK  522
            +M  K
Sbjct  86   MMARK  90



>gb|EWG47167.1| calmodulin [Fusarium verticillioides 7600]
Length=220

 Score =   142 bits (359),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  133  GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  192

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  193  VDEMIREADQDGDGRIDYNEFVQLMMQK  220


 Score =   128 bits (321),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LT++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD 
Sbjct  72   MADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  131

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  132  NGTIDFPEF  140


 Score = 62.0 bits (149),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 62/131 (47%), Gaps = 16/131 (12%)
 Frame = +1

Query  139  RTEMVALLPRSWEQLCGHWGRTQLRLSFRI*SMKLMLMGMGQLTFQSFLNLMARKMKDTD  318
            R++ +   PR       H        SF        L+    L   S        M D+ 
Sbjct  30   RSDTLGSRPRDLRTCPSHLS------SFSCDRHPPFLLSQPLLPHTSI-------MADSL  76

Query  319  SEE---ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQIN  489
            +EE   E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I+
Sbjct  77   TEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTID  136

Query  490  YEEFVKVMMAK  522
            + EF+ +M  K
Sbjct  137  FPEFLTMMARK  147


 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  144  MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  203

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  204  GDGRIDYNEF  213



>gb|EXK44111.1| calmodulin [Fusarium oxysporum f. sp. melonis 26406]
Length=220

 Score =   142 bits (358),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  133  GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  192

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  193  VDEMIREADQDGDGRIDYNEFVQLMMQK  220


 Score =   128 bits (321),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LT++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD 
Sbjct  72   MADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  131

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  132  NGTIDFPEF  140


 Score = 62.0 bits (149),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 62/131 (47%), Gaps = 16/131 (12%)
 Frame = +1

Query  139  RTEMVALLPRSWEQLCGHWGRTQLRLSFRI*SMKLMLMGMGQLTFQSFLNLMARKMKDTD  318
            R++ +   PR       H        SF        L+    L   S        M D+ 
Sbjct  30   RSDTLGSRPRDLRTCPSHLS------SFSCDRHPPFLLSQPLLPHTS-------NMADSL  76

Query  319  SEE---ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQIN  489
            +EE   E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I+
Sbjct  77   TEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTID  136

Query  490  YEEFVKVMMAK  522
            + EF+ +M  K
Sbjct  137  FPEFLTMMARK  147


 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  144  MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  203

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  204  GDGRIDYNEF  213



>gb|EMT66361.1| Calmodulin [Fusarium oxysporum f. sp. cubense race 4]
 gb|EXM02436.1| calmodulin [Fusarium oxysporum f. sp. cubense tropical race 4 
54006]
Length=220

 Score =   142 bits (358),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  133  GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  192

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  193  VDEMIREADQDGDGRIDYNEFVQLMMQK  220


 Score =   128 bits (321),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LT++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD 
Sbjct  72   MADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  131

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  132  NGTIDFPEF  140


 Score = 62.4 bits (150),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 62/131 (47%), Gaps = 16/131 (12%)
 Frame = +1

Query  139  RTEMVALLPRSWEQLCGHWGRTQLRLSFRI*SMKLMLMGMGQLTFQSFLNLMARKMKDTD  318
            R++ +   PR       H        SF        L+    L   S        M D+ 
Sbjct  30   RSDTLGSRPRDLRTCPSHLS------SFSCDRHPPFLLSQPLLPHTS-------NMADSL  76

Query  319  SEE---ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQIN  489
            +EE   E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I+
Sbjct  77   TEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTID  136

Query  490  YEEFVKVMMAK  522
            + EF+ +M  K
Sbjct  137  FPEFLTMMARK  147


 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  144  MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  203

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  204  GDGRIDYNEF  213



>gb|EWZ46812.1| calmodulin [Fusarium oxysporum Fo47]
 gb|EWZ84821.1| calmodulin [Fusarium oxysporum f. sp. lycopersici MN25]
 gb|EXL47084.1| calmodulin [Fusarium oxysporum f. sp. radicis-lycopersici 26381]
Length=220

 Score =   142 bits (358),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  133  GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  192

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  193  VDEMIREADQDGDGRIDYNEFVQLMMQK  220


 Score =   128 bits (321),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LT++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD 
Sbjct  72   MADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  131

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  132  NGTIDFPEF  140


 Score = 62.0 bits (149),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 62/131 (47%), Gaps = 16/131 (12%)
 Frame = +1

Query  139  RTEMVALLPRSWEQLCGHWGRTQLRLSFRI*SMKLMLMGMGQLTFQSFLNLMARKMKDTD  318
            R++ +   PR       H        SF        L+    L   S        M D+ 
Sbjct  30   RSDTLGSRPRDLRTCPSHLS------SFSCDRHPPFLLSQPLLPHTS-------NMADSL  76

Query  319  SEE---ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQIN  489
            +EE   E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I+
Sbjct  77   TEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTID  136

Query  490  YEEFVKVMMAK  522
            + EF+ +M  K
Sbjct  137  FPEFLTMMARK  147


 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  144  MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  203

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  204  GDGRIDYNEF  213



>gb|ENH63033.1| Calmodulin [Fusarium oxysporum f. sp. cubense race 1]
Length=220

 Score =   142 bits (358),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  133  GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  192

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  193  VDEMIREADQDGDGRIDYNEFVQLMMQK  220


 Score =   128 bits (321),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LT++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD 
Sbjct  72   MADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  131

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  132  NGTIDFPEF  140


 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  144  MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  203

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  204  GDGRIDYNEF  213


 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 3/76 (4%)
 Frame = +1

Query  304  MKDTDSEE---ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDG  474
            M D+ +EE   E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D 
Sbjct  72   MADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  131

Query  475  DGQINYEEFVKVMMAK  522
            +G I++ EF+ +M  K
Sbjct  132  NGTIDFPEFLTMMARK  147



>gb|ELR03702.1| calmodulin [Pseudogymnoascus destructans 20631-21]
 gb|KFY05495.1| hypothetical protein V492_08497 [Pseudogymnoascus pannorum VKM 
F-4246]
 gb|KFY41216.1| hypothetical protein V494_03134 [Pseudogymnoascus pannorum VKM 
F-4513 (FW-928)]
 gb|KFY71619.1| hypothetical protein V499_08208 [Pseudogymnoascus pannorum VKM 
F-103]
 gb|KFY84295.1| hypothetical protein V500_09428 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
 gb|KFZ06914.1| hypothetical protein V501_06948 [Pseudogymnoascus pannorum VKM 
F-4519 (FW-2642)]
 gb|KFZ25459.1| hypothetical protein V502_00063 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=149

 Score =   140 bits (354),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSE+E++EAF+VFD+D NGFISAAELRHVMT++GEKLTDEE
Sbjct  62   GTIDFPEFLTMMARKMKDTDSEDEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDEE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  122  VDEMIREADQDGDGRIDYNEFVQLMMQK  149


 Score =   129 bits (325),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LT+DQ+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD 
Sbjct  1    MADALTEDQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  60

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  61   NGTIDFPEF  69


 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEDEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDEEVDEMIREADQD  132

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  133  GDGRIDYNEF  142


 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +1

Query  316  DSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYE  495
            D   E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ 
Sbjct  8    DQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFP  67

Query  496  EFVKVMMAK  522
            EF+ +M  K
Sbjct  68   EFLTMMARK  76



>gb|EFX01025.1| calmodulin [Grosmannia clavigera kw1407]
 gb|AIY26822.1| calmodulin [Grosmannia clavigera]
Length=149

 Score =   142 bits (357),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT +GEKLTDEE
Sbjct  62   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTTIGEKLTDEE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  122  VDEMIREADQDGDGRIDYNEFVQLMMQK  149


 Score =   128 bits (322),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LT++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD 
Sbjct  1    MADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  60

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  61   NGTIDFPEF  69


 Score = 60.8 bits (146),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM ++G+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTTIGEKLTDEEVDEMIREADQD  132

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  133  GDGRIDYNEF  142


 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 3/76 (4%)
 Frame = +1

Query  304  MKDTDSEE---ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDG  474
            M D+ +EE   E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D 
Sbjct  1    MADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  60

Query  475  DGQINYEEFVKVMMAK  522
            +G I++ EF+ +M  K
Sbjct  61   NGTIDFPEFLTMMARK  76



>ref|XP_001267009.1| calmodulin [Neosartorya fischeri NRRL 181]
 gb|EAW25112.1| calmodulin [Neosartorya fischeri NRRL 181]
Length=149

 Score =   141 bits (355),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  62   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  122  VDEMIREADQDGDGRIDYNEFVQLMMQK  149


 Score =   129 bits (324),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LT+DQ+SE+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD 
Sbjct  1    MADSLTEDQVSEYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  60

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  61   NGTIDFPEF  69


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  132

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  133  GDGRIDYNEF  142


 Score = 58.9 bits (141),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +1

Query  316  DSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYE  495
            D   E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ 
Sbjct  8    DQVSEYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFP  67

Query  496  EFVKVMMAK  522
            EF+ +M  K
Sbjct  68   EFLTMMARK  76



>ref|XP_011401016.1| Calmodulin [Auxenochlorella protothecoides]
 gb|KFM22510.1| Calmodulin [Auxenochlorella protothecoides]
Length=235

 Score =   156 bits (394),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 73/88 (83%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL+LMARKMKD+DSEEEL+EAF+VFDKD NGFIS+AELRHVMTNLGEKLTDEE
Sbjct  63   GTIDFPEFLSLMARKMKDSDSEEELREAFKVFDKDGNGFISSAELRHVMTNLGEKLTDEE  122

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDGQ+NYEEFVK+M+AK
Sbjct  123  VDEMIREADADGDGQVNYEEFVKMMLAK  150


 Score =   114 bits (284),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 53/61 (87%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +3

Query  99   QISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPE  278
             ++EFKEAF+LFDKDGDG ITTKELGTVMRSLGQNPTEAEL+DMI+EVDAD NGTIDFPE
Sbjct  10   HVAEFKEAFALFDKDGDGTITTKELGTVMRSLGQNPTEAELKDMISEVDADKNGTIDFPE  69

Query  279  F  281
            F
Sbjct  70   F  70


 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 49/70 (70%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FDKDG+G I++ EL  VM +LG+  T+ E+ +MI E DAD
Sbjct  74   MARKMKDSDSEEELREAFKVFDKDGNGFISSAELRHVMTNLGEKLTDEEVDEMIREADAD  133

Query  252  GNGTIDFPEF  281
            G+G +++ EF
Sbjct  134  GDGQVNYEEF  143


 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D +G I++ EF+ 
Sbjct  13   EFKEAFALFDKDGDGTITTKELGTVMRSLGQNPTEAELKDMISEVDADKNGTIDFPEFLS  72

Query  508  VMMAK  522
            +M  K
Sbjct  73   LMARK  77



>gb|KFY53599.1| hypothetical protein V496_07465 [Pseudogymnoascus pannorum VKM 
F-4515 (FW-2607)]
Length=197

 Score =   142 bits (357),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSE+E++EAF+VFD+D NGFISAAELRHVMT++GEKLTDEE
Sbjct  110  GTIDFPEFLTMMARKMKDTDSEDEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDEE  169

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  170  VDEMIREADQDGDGRIDYNEFVQLMMQK  197


 Score =   128 bits (321),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            +AD LT+DQ+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD 
Sbjct  49   IADALTEDQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  108

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  109  NGTIDFPEF  117


 Score = 61.6 bits (148),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  121  MARKMKDTDSEDEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDEEVDEMIREADQD  180

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  181  GDGRIDYNEF  190


 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +1

Query  316  DSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYE  495
            D   E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ 
Sbjct  56   DQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFP  115

Query  496  EFVKVMMAK  522
            EF+ +M  K
Sbjct  116  EFLTMMARK  124



>dbj|GAM85876.1| hypothetical protein ANO11243_038860 [fungal sp. No.11243]
Length=149

 Score =   142 bits (357),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  62   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  122  VDEMIREADTDGDGRIDYNEFVQLMMQK  149


 Score =   128 bits (321),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LT++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD 
Sbjct  1    MADALTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  60

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  61   NGTIDFPEF  69


 Score = 62.0 bits (149),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADTD  132

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  133  GDGRIDYNEF  142


 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  12   EFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  71

Query  508  VMMAK  522
            +M  K
Sbjct  72   MMARK  76



>gb|KEQ72355.1| EF-hand [Aureobasidium pullulans var. namibiae CBS 147.97]
Length=215

 Score =   141 bits (356),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  128  GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  187

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  188  VDEMIREADQDGDGRIDYNEFVQLMMQK  215


 Score =   128 bits (321),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LT++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD 
Sbjct  67   MADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  126

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  127  NGTIDFPEF  135


 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 58/88 (66%), Gaps = 4/88 (5%)
 Frame = +1

Query  268  TFQSFLNLMARKMKDTDSEE---ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            TFQ+ L+ +A +M D+ +EE   E KEAF +FDKD +G I+  EL  VM +LG+  ++ E
Sbjct  56   TFQANLSHIA-QMADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESE  114

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            + +MI E D D +G I++ EF+ +M  K
Sbjct  115  LQDMINEVDADNNGTIDFPEFLTMMARK  142


 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  139  MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  198

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  199  GDGRIDYNEF  208



>gb|KFA72401.1| hypothetical protein S40288_09541 [Stachybotrys chartarum IBT 
40288]
Length=195

 Score =   142 bits (357),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  108  GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  167

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  168  VDEMIREADQDGDGRIDYNEFVQLMMQK  195


 Score =   127 bits (320),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = +3

Query  69   LTMADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDA  248
            L  AD LT++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDA
Sbjct  45   LAQADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDA  104

Query  249  DGNGTIDFPEF  281
            D NGTIDFPEF
Sbjct  105  DNNGTIDFPEF  115


 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  119  MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  178

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  179  GDGRIDYNEF  188


 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  58   EFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  117

Query  508  VMMAK  522
            +M  K
Sbjct  118  MMARK  122



>gb|KIW78510.1| calmodulin [Fonsecaea pedrosoi CBS 271.37]
Length=162

 Score =   141 bits (355),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  75   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  134

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  135  VDEMIREADQDGDGRIDYNEFVQLMMQK  162


 Score =   128 bits (322),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  66   ALTMADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVD  245
            A  +AD LT++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVD
Sbjct  11   AAAVADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVD  70

Query  246  ADGNGTIDFPEF  281
            AD NGTIDFPEF
Sbjct  71   ADNNGTIDFPEF  82


 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  86   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  145

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  146  GDGRIDYNEF  155


 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 53/89 (60%), Gaps = 3/89 (3%)
 Frame = +1

Query  265  LTFQSFLNLMARKMKDTDSEE---ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  435
            + +     L A  + D+ +EE   E KEAF +FDKD +G I+  EL  VM +LG+  ++ 
Sbjct  1    MVWHHMAILTAAAVADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSES  60

Query  436  EVDEMIREADVDGDGQINYEEFVKVMMAK  522
            E+ +MI E D D +G I++ EF+ +M  K
Sbjct  61   ELQDMINEVDADNNGTIDFPEFLTMMARK  89



>gb|KDD73483.1| hypothetical protein H632_c2130p0 [Helicosporidium sp. ATCC 50920]
Length=155

 Score =   150 bits (380),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 73/88 (83%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FLNLMA KMKDTDSEEEL+EAFRVFDKD NGFISAAELRHVMTNLGEKLT+EE
Sbjct  68   GTIDFPEFLNLMAIKMKDTDSEEELREAFRVFDKDGNGFISAAELRHVMTNLGEKLTEEE  127

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDGQ+NYEEFV++M++K
Sbjct  128  VDEMIREADSDGDGQVNYEEFVQMMLSK  155


 Score =   118 bits (296),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 66/75 (88%), Gaps = 4/75 (5%)
 Frame = +3

Query  69   LTMADQLTDDQISEFKEAFSLFDKDGD----GCITTKELGTVMRSLGQNPTEAELQDMIN  236
            +T A QLT++Q++EFKEAF+LFDKDGD    G ITTKELGTVMRSLGQNPTEAELQ+MI 
Sbjct  1    MTDASQLTEEQVAEFKEAFALFDKDGDVRLNGTITTKELGTVMRSLGQNPTEAELQEMIR  60

Query  237  EVDADGNGTIDFPEF  281
            EVDAD NGTIDFPEF
Sbjct  61   EVDADNNGTIDFPEF  75


 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 48/70 (69%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FDKDG+G I+  EL  VM +LG+  TE E+ +MI E D+D
Sbjct  79   MAIKMKDTDSEEELREAFRVFDKDGNGFISAAELRHVMTNLGEKLTEEEVDEMIREADSD  138

Query  252  GNGTIDFPEF  281
            G+G +++ EF
Sbjct  139  GDGQVNYEEF  148


 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 44/69 (64%), Gaps = 4/69 (6%)
 Frame = +1

Query  328  ELKEAFRVFDKDQ----NGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYE  495
            E KEAF +FDKD     NG I+  EL  VM +LG+  T+ E+ EMIRE D D +G I++ 
Sbjct  14   EFKEAFALFDKDGDVRLNGTITTKELGTVMRSLGQNPTEAELQEMIREVDADNNGTIDFP  73

Query  496  EFVKVMMAK  522
            EF+ +M  K
Sbjct  74   EFLNLMAIK  82



>gb|KFY20747.1| hypothetical protein V491_03461 [Pseudogymnoascus pannorum VKM 
F-3775]
Length=177

 Score =   142 bits (357),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSE+E++EAF+VFD+D NGFISAAELRHVMT++GEKLTDEE
Sbjct  90   GTIDFPEFLTMMARKMKDTDSEDEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDEE  149

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  150  VDEMIREADQDGDGRIDYNEFVQLMMQK  177


 Score =   127 bits (319),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +3

Query  78   ADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGN  257
            AD LT+DQ+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD N
Sbjct  30   ADALTEDQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNN  89

Query  258  GTIDFPEF  281
            GTIDFPEF
Sbjct  90   GTIDFPEF  97


 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 54/90 (60%), Gaps = 1/90 (1%)
 Frame = +1

Query  253  GMGQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTD  432
             + QL+   F NL A  + + D   E KEAF +FDKD +G I+  EL  VM +LG+  ++
Sbjct  16   SLPQLSPPDFDNLEADALTE-DQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSE  74

Query  433  EEVDEMIREADVDGDGQINYEEFVKVMMAK  522
             E+ +MI E D D +G I++ EF+ +M  K
Sbjct  75   SELQDMINEVDADNNGTIDFPEFLTMMARK  104


 Score = 61.6 bits (148),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  101  MARKMKDTDSEDEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDEEVDEMIREADQD  160

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  161  GDGRIDYNEF  170



>ref|XP_001224933.1| calmodulin [Chaetomium globosum CBS 148.51]
 ref|XP_961276.2| calmodulin A [Neurospora crassa OR74A]
 ref|XP_001912045.1| hypothetical protein [Podospora anserina S mat+]
 ref|XP_003000158.1| calmodulin [Verticillium alfalfae VaMs.102]
 ref|XP_003047731.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 ref|XP_003343807.1| calmodulin protein (CaM) [Sordaria macrospora k-hell]
 ref|XP_003662043.1| hypothetical protein MYCTH_65137 [Myceliophthora thermophila 
ATCC 42464]
 ref|XP_003649609.1| hypothetical protein THITE_2169415 [Thielavia terrestris NRRL 
8126]
 ref|XP_003709613.1| hypothetical protein MGG_16201 [Magnaporthe oryzae 70-15]
 ref|XP_003840767.1| similar to calmodulin [Leptosphaeria maculans JN3]
 ref|XP_006697075.1| putative calmodulin protein [Chaetomium thermophilum var. thermophilum 
DSM 1495]
 ref|XP_007692504.1| hypothetical protein COCMIDRAFT_40782 [Bipolaris oryzae ATCC 
44560]
 ref|XP_007700407.1| hypothetical protein COCSADRAFT_37379 [Bipolaris sorokiniana 
ND90Pr]
 ref|XP_007707322.1| hypothetical protein COCCADRAFT_32528 [Bipolaris zeicola 26-R-13]
 ref|XP_007834347.1| Calmodulin [Pestalotiopsis fici W106-1]
 ref|XP_007925227.1| hypothetical protein MYCFIDRAFT_163418 [Pseudocercospora fijiensis 
CIRAD86]
 ref|XP_008029153.1| hypothetical protein SETTUDRAFT_155967 [Setosphaeria turcica 
Et28A]
 ref|XP_009158698.1| hypothetical protein HMPREF1120_06249 [Exophiala dermatitidis 
NIH/UT8656]
 ref|XP_009256781.1| hypothetical protein FPSE_05388 [Fusarium pseudograminearum CS3096]
 ref|XP_009652490.1| calmodulin [Verticillium dahliae VdLs.17]
 ref|XP_009847720.1| hypothetical protein NEUTE1DRAFT_115724 [Neurospora tetrasperma 
FGSC 2508]
 ref|XP_011317740.1| hypothetical protein FGSG_01891 [Fusarium graminearum PH-1]
 sp|P61859.2|CALM_NEUCR RecName: Full=Calmodulin; Short=CaM [Neurospora crassa OR74A]
 sp|P61860.2|CALM_COLTR RecName: Full=Calmodulin; Short=CaM [Colletotrichum trifolii]
 sp|P61861.2|CALM_COLGL RecName: Full=Calmodulin; Short=CaM [Colletotrichum gloeosporioides]
 sp|Q9UWF0.4|CALM_MAGO7 RecName: Full=Calmodulin; Short=CaM [Magnaporthe oryzae 70-15]
 emb|CAA50271.1| calmodulin [Neurospora crassa]
 gb|AAA33564.1| calmodulin [Neurospora crassa]
 gb|AAA51652.1| calmodulin [Colletotrichum trifolii]
 gb|AAC62516.1| calmodulin [Colletotrichum gloeosporioides]
 emb|CAD36980.1| calmodulin [Neurospora crassa]
 gb|EAQ86024.1| calmodulin [Chaetomium globosum CBS 148.51]
 gb|ABF06561.1| calmodulin [Bipolaris oryzae]
 gb|ABJ97286.1| calmodulin [Setosphaeria turcica]
 gb|EAA32040.2| calmodulin A [Neurospora crassa OR74A]
 emb|CAP73874.1| unnamed protein product [Podospora anserina S mat+]
 gb|ACM61854.1| calmodulin [Epichloe festucae]
 gb|ACM61855.1| calmodulin [Epichloe festucae]
 gb|ACP19820.1| calmodulin [Magnaporthe grisea]
 gb|EEQ90610.1| calmodulin A [Blastomyces dermatitidis ER-3]
 gb|EEU42018.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gb|EEY23243.1| calmodulin [Verticillium alfalfae VaMs.102]
 gb|EFQ26136.1| hypothetical protein GLRG_01280 [Colletotrichum graminicola M1.001]
 emb|CBX97288.1| similar to calmodulin [Leptosphaeria maculans JN3]
 gb|ADU18527.1| calmodulin [Bipolaris maydis]
 gb|EGE86735.1| calmodulin [Blastomyces dermatitidis ATCC 18188]
 gb|EGO60436.1| hypothetical protein NEUTE1DRAFT_115724 [Neurospora tetrasperma 
FGSC 2508]
 gb|EGS17457.1| putative calmodulin protein [Chaetomium thermophilum var. thermophilum 
DSM 1495]
 gb|EGU86584.1| hypothetical protein FOXB_02913 [Fusarium oxysporum Fo5176]
 gb|EGY23153.1| calmodulin [Verticillium dahliae VdLs.17]
 gb|AEO63273.1| hypothetical protein THITE_2169415 [Thielavia terrestris NRRL 
8126]
 gb|AEO56798.1| hypothetical protein MYCTH_65137 [Myceliophthora thermophila 
ATCC 42464]
 gb|EGZ75588.1| EF-hand protein [Neurospora tetrasperma FGSC 2509]
 gb|EHA57001.1| hypothetical protein MGG_16201 [Magnaporthe oryzae 70-15]
 gb|EHY58237.1| hypothetical protein HMPREF1120_06249 [Exophiala dermatitidis 
NIH/UT8656]
 emb|CCC10695.1| putative calmodulin protein (CaM) [Sordaria macrospora k-hell]
 emb|CCF38422.1| calmodulin [Colletotrichum higginsianum]
 gb|EKG12167.1| Recoverin [Macrophomina phaseolina MS6]
 gb|EKJ74423.1| hypothetical protein FPSE_05388 [Fusarium pseudograminearum CS3096]
 gb|EMD63606.1| hypothetical protein COCSADRAFT_37379 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD92789.1| hypothetical protein COCHEDRAFT_1172284 [Bipolaris maydis C5]
 gb|EME84603.1| hypothetical protein MYCFIDRAFT_163418 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EMF13294.1| calmodulin A [Sphaerulina musiva SO2202]
 gb|ENI04823.1| hypothetical protein COCC4DRAFT_197319 [Bipolaris maydis ATCC 
48331]
 gb|EOA83439.1| hypothetical protein SETTUDRAFT_155967 [Setosphaeria turcica 
Et28A]
 emb|CCT73106.1| probable calmodulin [Fusarium fujikuroi IMI 58289]
 gb|EQL35575.1| calmodulin [Blastomyces dermatitidis ATCC 26199]
 emb|CCX07280.1| Similar to Calmodulin; acc. no. P61859 [Pyronema omphalodes CBS 
100304]
 gb|ESU07255.1| hypothetical protein FGSG_01891 [Fusarium graminearum PH-1]
 gb|ETS80046.1| Calmodulin [Pestalotiopsis fici W106-1]
 gb|EUC38318.1| hypothetical protein COCCADRAFT_32528 [Bipolaris zeicola 26-R-13]
 gb|EUC40985.1| hypothetical protein COCMIDRAFT_40782 [Bipolaris oryzae ATCC 
44560]
 gb|EUN31706.1| hypothetical protein COCVIDRAFT_33656 [Bipolaris victoriae FI3]
 gb|EWZ00769.1| calmodulin [Fusarium oxysporum FOSC 3-a]
 gb|EYB34385.1| hypothetical protein FG05_01891 [Fusarium graminearum]
 gb|KDN69496.1| putative calmodulin [Colletotrichum sublineola]
 gb|KEQ89327.1| EF-hand protein [Aureobasidium pullulans EXF-150]
 gb|KEQ96817.1| hypothetical protein AUEXF2481DRAFT_27948 [Aureobasidium subglaciale 
EXF-2481]
 gb|KEY64813.1| hypothetical protein S7711_09145 [Stachybotrys chartarum IBT 
7711]
 gb|KEZ46713.1| hypothetical protein SAPIO_CDS0561 [Scedosporium apiospermum]
 emb|CDP26273.1| Putative calmodulin [Podospora anserina S mat+]
 gb|KHE87401.1| hypothetical protein GE21DRAFT_8112 [Neurospora crassa]
 emb|CEJ94591.1| Putative EF-hand [Torrubiella hemipterigena]
 gb|KIN07467.1| hypothetical protein OIDMADRAFT_16160 [Oidiodendron maius Zn]
 gb|KIV80805.1| calmodulin [Exophiala sideris]
 gb|KIV90550.1| calmodulin [Exophiala mesophila]
 gb|KIW24380.1| calmodulin [Cladophialophora immunda]
 gb|KIW45349.1| calmodulin [Exophiala oligosperma]
 gb|KIW49526.1| calmodulin [Exophiala xenobiotica]
 gb|KIW73375.1| calmodulin [Capronia semiimmersa]
Length=149

 Score =   140 bits (354),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  62   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  122  VDEMIREADQDGDGRIDYNEFVQLMMQK  149


 Score =   128 bits (322),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LT++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD 
Sbjct  1    MADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  60

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  61   NGTIDFPEF  69


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  132

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  133  GDGRIDYNEF  142


 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 3/76 (4%)
 Frame = +1

Query  304  MKDTDSEE---ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDG  474
            M D+ +EE   E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D 
Sbjct  1    MADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  60

Query  475  DGQINYEEFVKVMMAK  522
            +G I++ EF+ +M  K
Sbjct  61   NGTIDFPEFLTMMARK  76



>gb|KIW95870.1| calmodulin [Cladophialophora bantiana CBS 173.52]
Length=159

 Score =   141 bits (355),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  72   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  131

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  132  VDEMIREADQDGDGRIDYNEFVQLMMQK  159


 Score =   127 bits (320),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +3

Query  72   TMADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            T AD LT++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD
Sbjct  10   TAADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDAD  69

Query  252  GNGTIDFPEF  281
             NGTIDFPEF
Sbjct  70   NNGTIDFPEF  79


 Score = 61.6 bits (148),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  83   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  142

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  143  GDGRIDYNEF  152


 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  22   EFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  81

Query  508  VMMAK  522
            +M  K
Sbjct  82   MMARK  86



>gb|EME44997.1| hypothetical protein DOTSEDRAFT_70894 [Dothistroma septosporum 
NZE10]
Length=149

 Score =   140 bits (354),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  62   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  122  VDEMIREADQDGDGRIDYNEFVQLMMQK  149


 Score =   128 bits (321),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LT++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD 
Sbjct  1    MADALTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  60

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  61   NGTIDFPEF  69


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  132

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  133  GDGRIDYNEF  142


 Score = 58.9 bits (141),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  12   EFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  71

Query  508  VMMAK  522
            +M  K
Sbjct  72   MMARK  76



>gb|KIL90559.1| calmodulin [Fusarium avenaceum]
Length=271

 Score =   142 bits (359),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  184  GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  243

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  244  VDEMIREADQDGDGRIDYNEFVQLMMQK  271


 Score =   125 bits (315),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            +AD LT++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD 
Sbjct  123  VADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  182

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  183  NGTIDFPEF  191


 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  195  MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  254

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  255  GDGRIDYNEF  264


 Score = 60.1 bits (144),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  134  EFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  193

Query  508  VMMAK  522
            +M  K
Sbjct  194  MMARK  198



>ref|XP_001248642.1| calmodulin (CaM) [Coccidioides immitis RS]
 ref|XP_001271881.1| calmodulin [Aspergillus clavatus NRRL 1]
 ref|XP_001402062.1| calmodulin [Aspergillus niger CBS 513.88]
 ref|XP_751821.2| calmodulin [Aspergillus fumigatus Af293]
 ref|XP_001544278.1| calmodulin [Histoplasma capsulatum NAm1]
 ref|XP_002149264.1| calmodulin [Talaromyces marneffei ATCC 18224]
 ref|XP_002374112.1| calmodulin [Aspergillus flavus NRRL3357]
 ref|XP_002789810.1| calmodulin [Paracoccidioides sp. 'lutzii' Pb01]
 ref|XP_003070923.1| Calmodulin, putative [Coccidioides posadasii C735 delta SOWgp]
 ref|XP_003171710.1| calmodulin [Microsporum gypseum CBS 118893]
 ref|XP_001820302.2| calmodulin [Aspergillus oryzae RIB40]
 ref|XP_003233403.1| calmodulin [Trichophyton rubrum CBS 118892]
 sp|P60204.2|CALM_EMENI RecName: Full=Calmodulin; Short=CaM [Aspergillus nidulans FGSC 
A4]
 sp|P60205.2|CALM_ASPOR RecName: Full=Calmodulin; Short=CaM [Aspergillus oryzae RIB40]
 sp|P60206.2|CALM_AJECG RecName: Full=Calmodulin; Short=CaM [Histoplasma capsulatum G186AR]
 gb|AAL89686.1|AF481920_1 calmodulin [Paracoccidioides brasiliensis]
 gb|AAA62800.1| calmodulin [Aspergillus nidulans]
 gb|AAB50268.1| calmodulin [Histoplasma capsulatum]
 dbj|BAA07920.1| calmodulin [Aspergillus oryzae]
 gb|AAC27509.1| calmodulin [Histoplasma capsulatum]
 gb|AAX85976.1| calmodulin A [Aspergillus flavus]
 gb|AAX85977.1| calmodulin A [Aspergillus flavus]
 gb|EAW10455.1| calmodulin [Aspergillus clavatus NRRL 1]
 gb|EAL89783.2| calmodulin [Aspergillus fumigatus Af293]
 emb|CAK44701.1| unnamed protein product [Aspergillus niger]
 gb|EDN03460.1| calmodulin [Histoplasma capsulatum NAm1]
 gb|EDP50378.1| calmodulin [Aspergillus fumigatus A1163]
 gb|EEA23097.1| calmodulin [Talaromyces marneffei ATCC 18224]
 gb|EED55330.1| calmodulin [Aspergillus flavus NRRL3357]
 gb|EEH03701.1| calmodulin [Histoplasma capsulatum G186AR]
 gb|EER28778.1| Calmodulin, putative [Coccidioides posadasii C735 delta SOWgp]
 gb|EER37365.1| calmodulin [Histoplasma capsulatum H143]
 tpe|CBF86075.1| TPA: Calmodulin (CaM) [Source:UniProtKB/Swiss-Prot;Acc:P60204] 
[Aspergillus nidulans FGSC A4]
 gb|EFR03256.1| calmodulin [Microsporum gypseum CBS 118893]
 gb|EFW22367.1| calmodulin [Coccidioides posadasii str. Silveira]
 gb|EGC48032.1| calmodulin [Histoplasma capsulatum H88]
 gb|EGD90162.1| calmodulin [Trichophyton rubrum CBS 118892]
 gb|EGD96454.1| calmodulin [Trichophyton tonsurans CBS 112818]
 gb|EGE05677.1| calmodulin A [Trichophyton equinum CBS 127.97]
 dbj|GAA91730.1| calmodulin [Aspergillus kawachii IFO 4308]
 gb|EIT76201.1| calmodulin [Aspergillus oryzae 3.042]
 gb|EKV13104.1| Calmodulin [Penicillium digitatum PHI26]
 gb|EKV18865.1| Calmodulin [Penicillium digitatum Pd1]
 gb|EPS27533.1| hypothetical protein PDE_02476 [Penicillium oxalicum 114-2]
 dbj|GAD95630.1| calmodulin, putative [Byssochlamys spectabilis No. 5]
 emb|CDM35490.1| Recoverin [Penicillium roqueforti FM164]
 gb|EYE99902.1| calmodulin [Aspergillus ruber CBS 135680]
 gb|EZF25009.1| calmodulin [Trichophyton rubrum MR850]
 gb|EZF44008.1| calmodulin [Trichophyton rubrum CBS 100081]
 gb|EZF54670.1| calmodulin [Trichophyton rubrum CBS 288.86]
 gb|EZF65247.1| calmodulin [Trichophyton rubrum CBS 289.86]
 gb|EZF75946.1| calmodulin [Trichophyton soudanense CBS 452.61]
 gb|EZF86568.1| calmodulin [Trichophyton rubrum MR1448]
 gb|EZF97332.1| calmodulin [Trichophyton rubrum MR1459]
 gb|EZG08325.1| calmodulin [Trichophyton rubrum CBS 735.88]
 gb|EZG18876.1| calmodulin [Trichophyton rubrum CBS 202.88]
 gb|KDB35782.1| calmodulin [Trichophyton rubrum D6]
 gb|KDE79155.1| calmodulin [Aspergillus oryzae 100-8]
 gb|KGO40973.1| Recoverin [Penicillium expansum]
 gb|KGO47672.1| Recoverin [Penicillium expansum]
 gb|KGO56914.1| Recoverin [Penicillium expansum]
 gb|KGO67825.1| Recoverin [Penicillium italicum]
 dbj|GAM40736.1| calmodulin [Talaromyces cellulolyticus]
 gb|EAS37059.3| calmodulin [Coccidioides immitis RS]
Length=149

 Score =   140 bits (354),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  62   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  122  VDEMIREADQDGDGRIDYNEFVQLMMQK  149


 Score =   127 bits (320),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LT++Q+SE+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD 
Sbjct  1    MADSLTEEQVSEYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  60

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  61   NGTIDFPEF  69


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  132

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  133  GDGRIDYNEF  142


 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 3/76 (4%)
 Frame = +1

Query  304  MKDTDSEE---ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDG  474
            M D+ +EE   E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D 
Sbjct  1    MADSLTEEQVSEYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  60

Query  475  DGQINYEEFVKVMMAK  522
            +G I++ EF+ +M  K
Sbjct  61   NGTIDFPEFLTMMARK  76



>gb|KIW00695.1| calmodulin [Verruconis gallopava]
Length=149

 Score =   139 bits (351),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NG+ISAAELRHVMT++GEKLTD+E
Sbjct  62   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGYISAAELRHVMTSIGEKLTDDE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  122  VDEMIREADQDGDGRIDYNEFVQLMMQK  149


 Score =   129 bits (323),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LT++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD 
Sbjct  1    MADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  60

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  61   NGTIDFPEF  69


 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEEIREAFKVFDRDNNGYISAAELRHVMTSIGEKLTDDEVDEMIREADQD  132

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  133  GDGRIDYNEF  142


 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 3/76 (4%)
 Frame = +1

Query  304  MKDTDSEE---ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDG  474
            M D+ +EE   E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D 
Sbjct  1    MADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  60

Query  475  DGQINYEEFVKVMMAK  522
            +G I++ EF+ +M  K
Sbjct  61   NGTIDFPEFLTMMARK  76



>ref|XP_006967657.1| regulatory protein calmodulin [Trichoderma reesei QM6a]
 gb|EGR46371.1| regulatory protein calmodulin [Trichoderma reesei QM6a]
 gb|EHK15212.1| regulatory protein calmodulin [Trichoderma virens Gv29-8]
 gb|EHK49720.1| hypothetical protein TRIATDRAFT_297616 [Trichoderma atroviride 
IMI 206040]
 gb|ETR99458.1| calmodulin A [Trichoderma reesei RUT C-30]
Length=149

 Score =   141 bits (355),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  62   GSIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  122  VDEMIREADQDGDGRIDYNEFVQLMMQK  149


 Score =   127 bits (319),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LT++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD 
Sbjct  1    MADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  60

Query  255  NGTIDFPEF  281
            NG+IDFPEF
Sbjct  61   NGSIDFPEF  69


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  132

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  133  GDGRIDYNEF  142


 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 3/76 (4%)
 Frame = +1

Query  304  MKDTDSEE---ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDG  474
            M D+ +EE   E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D 
Sbjct  1    MADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  60

Query  475  DGQINYEEFVKVMMAK  522
            +G I++ EF+ +M  K
Sbjct  61   NGSIDFPEFLTMMARK  76



>gb|KFH43286.1| Calmodulin-like protein [Acremonium chrysogenum ATCC 11550]
Length=157

 Score =   140 bits (354),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  70   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  129

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  130  VDEMIREADQDGDGRIDYNEFVQLMMQK  157


 Score =   127 bits (319),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = +3

Query  69   LTMADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDA  248
            L  AD LT++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDA
Sbjct  7    LLQADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDA  66

Query  249  DGNGTIDFPEF  281
            D NGTIDFPEF
Sbjct  67   DNNGTIDFPEF  77


 Score = 61.6 bits (148),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  81   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  140

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  141  GDGRIDYNEF  150


 Score = 58.9 bits (141),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  20   EFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  79

Query  508  VMMAK  522
            +M  K
Sbjct  80   MMARK  84



>ref|XP_003853858.1| calcium ion binding, calmodulin [Zymoseptoria tritici IPO323]
 gb|EGP88834.1| calcium ion binding, calmodulin [Zymoseptoria tritici IPO323]
Length=149

 Score =   139 bits (351),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFIS+AELRHVMT++GEKLTD+E
Sbjct  62   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISSAELRHVMTSIGEKLTDDE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  122  VDEMIREADQDGDGRIDYNEFVQLMMQK  149


 Score =   128 bits (322),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LT++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD 
Sbjct  1    MADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  60

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  61   NGTIDFPEF  69


 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I++ EL  VM S+G+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEEIREAFKVFDRDNNGFISSAELRHVMTSIGEKLTDDEVDEMIREADQD  132

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  133  GDGRIDYNEF  142


 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 3/76 (4%)
 Frame = +1

Query  304  MKDTDSEE---ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDG  474
            M D+ +EE   E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D 
Sbjct  1    MADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  60

Query  475  DGQINYEEFVKVMMAK  522
            +G I++ EF+ +M  K
Sbjct  61   NGTIDFPEFLTMMARK  76



>ref|XP_009222302.1| calmodulin [Gaeumannomyces graminis var. tritici R3-111a-1]
 gb|EJT76302.1| calmodulin [Gaeumannomyces graminis var. tritici R3-111a-1]
Length=149

 Score =   140 bits (354),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  62   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  122  VDEMIREADQDGDGRIDYNEFVQLMMQK  149


 Score =   127 bits (319),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD L+++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD 
Sbjct  1    MADSLSEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  60

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  61   NGTIDFPEF  69


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  132

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  133  GDGRIDYNEF  142


 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 3/76 (4%)
 Frame = +1

Query  304  MKDTDSEE---ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDG  474
            M D+ SEE   E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D 
Sbjct  1    MADSLSEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  60

Query  475  DGQINYEEFVKVMMAK  522
            +G I++ EF+ +M  K
Sbjct  61   NGTIDFPEFLTMMARK  76



>ref|XP_002484900.1| calmodulin [Talaromyces stipitatus ATCC 10500]
 gb|EED14947.1| calmodulin [Talaromyces stipitatus ATCC 10500]
Length=184

 Score =   142 bits (357),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  97   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  156

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  157  VDEMIREADQDGDGRIDYNEFVQLMMQK  184


 Score =   126 bits (316),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +3

Query  69   LTMADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDA  248
            + +AD LT++Q+SE+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDA
Sbjct  34   VKIADSLTEEQVSEYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDA  93

Query  249  DGNGTIDFPEF  281
            D NGTIDFPEF
Sbjct  94   DNNGTIDFPEF  104


 Score = 61.6 bits (148),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  108  MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  167

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  168  GDGRIDYNEF  177


 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 50/77 (65%), Gaps = 3/77 (4%)
 Frame = +1

Query  301  KMKDTDSEE---ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  471
            K+ D+ +EE   E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D
Sbjct  35   KIADSLTEEQVSEYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDAD  94

Query  472  GDGQINYEEFVKVMMAK  522
             +G I++ EF+ +M  K
Sbjct  95   NNGTIDFPEFLTMMARK  111



>gb|KGQ05861.1| Calmodulin [Beauveria bassiana D1-5]
Length=149

 Score =   139 bits (350),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE+ EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  62   GTIDFPEFLTMMARKMKDTDSEEEIMEAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  122  VDEMIREADQDGDGRIDYNEFVQLMMQK  149


 Score =   129 bits (323),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LT+DQ++EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD 
Sbjct  1    MADSLTEDQVAEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  60

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  61   NGTIDFPEF  69


 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E  EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEEIMEAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  132

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  133  GDGRIDYNEF  142


 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  12   EFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  71

Query  508  VMMAK  522
            +M  K
Sbjct  72   MMARK  76



>ref|XP_007802600.1| Calmodulin [Endocarpon pusillum Z07020]
 gb|ERF71889.1| Calmodulin [Endocarpon pusillum Z07020]
Length=183

 Score =   141 bits (356),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  96   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  155

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  156  VDEMIREADQDGDGRIDYNEFVQLMMQK  183


 Score =   126 bits (317),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +3

Query  78   ADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGN  257
            AD LT++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD N
Sbjct  36   ADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNN  95

Query  258  GTIDFPEF  281
            GTIDFPEF
Sbjct  96   GTIDFPEF  103


 Score = 62.0 bits (149),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  107  MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  166

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  167  GDGRIDYNEF  176


 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  46   EFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  105

Query  508  VMMAK  522
            +M  K
Sbjct  106  MMARK  110



>gb|KHO00914.1| calmodulin [Metarhizium album ARSEF 1941]
Length=172

 Score =   141 bits (356),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  85   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  144

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  145  VDEMIREADQDGDGRIDYNEFVQLMMQK  172


 Score =   126 bits (316),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +3

Query  78   ADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGN  257
            AD LT++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD N
Sbjct  25   ADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNN  84

Query  258  GTIDFPEF  281
            GTIDFPEF
Sbjct  85   GTIDFPEF  92


 Score = 61.2 bits (147),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  96   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  155

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  156  GDGRIDYNEF  165


 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  35   EFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  94

Query  508  VMMAK  522
            +M  K
Sbjct  95   MMARK  99



>ref|XP_007599517.1| calmodulin [Colletotrichum fioriniae PJ7]
 gb|EXF76835.1| calmodulin [Colletotrichum fioriniae PJ7]
Length=169

 Score =   141 bits (356),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  82   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  141

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  142  VDEMIREADQDGDGRIDYNEFVQLMMQK  169


 Score =   126 bits (317),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +3

Query  78   ADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGN  257
            AD LT++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD N
Sbjct  22   ADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNN  81

Query  258  GTIDFPEF  281
            GTIDFPEF
Sbjct  82   GTIDFPEF  89


 Score = 62.0 bits (149),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  93   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  152

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  153  GDGRIDYNEF  162


 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  32   EFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  91

Query  508  VMMAK  522
            +M  K
Sbjct  92   MMARK  96



>gb|KFA46710.1| hypothetical protein S40293_07792 [Stachybotrys chartarum IBT 
40293]
Length=155

 Score =   140 bits (354),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  68   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  127

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  128  VDEMIREADQDGDGRIDYNEFVQLMMQK  155


 Score =   127 bits (318),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            +AD LT++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD 
Sbjct  7    LADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  66

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  67   NGTIDFPEF  75


 Score = 61.6 bits (148),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  79   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  138

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  139  GDGRIDYNEF  148


 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  18   EFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  77

Query  508  VMMAK  522
            +M  K
Sbjct  78   MMARK  82



>gb|KFA64713.1| hypothetical protein S40285_05290 [Stachybotrys chlorohalonata 
IBT 40285]
Length=151

 Score =   140 bits (354),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  64   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  123

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  124  VDEMIREADQDGDGRIDYNEFVQLMMQK  151


 Score =   127 bits (318),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = +3

Query  69   LTMADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDA  248
            +  AD LT++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDA
Sbjct  1    MVRADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDA  60

Query  249  DGNGTIDFPEF  281
            D NGTIDFPEF
Sbjct  61   DNNGTIDFPEF  71


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  75   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  134

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  135  GDGRIDYNEF  144


 Score = 58.9 bits (141),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  14   EFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  73

Query  508  VMMAK  522
            +M  K
Sbjct  74   MMARK  78



>ref|XP_002622905.1| calmodulin A [Blastomyces dermatitidis SLH14081]
 gb|EEQ71683.1| calmodulin A [Blastomyces dermatitidis SLH14081]
Length=183

 Score =   142 bits (357),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  96   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  155

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  156  VDEMIREADQDGDGRIDYNEFVQLMMQK  183


 Score =   125 bits (315),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  66   ALTMADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVD  245
            ++  AD LT++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVD
Sbjct  32   SMFQADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVD  91

Query  246  ADGNGTIDFPEF  281
            AD NGTIDFPEF
Sbjct  92   ADNNGTIDFPEF  103


 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  107  MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  166

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  167  GDGRIDYNEF  176


 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  46   EFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  105

Query  508  VMMAK  522
            +M  K
Sbjct  106  MMARK  110



>gb|AAC96324.1| calmodulin [Magnaporthe grisea]
Length=149

 Score =   140 bits (354),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  62   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  122  VDEMIREADQDGDGRIDYNEFVQLMMQK  149


 Score =   127 bits (318),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LT++Q+SEFK+AFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD 
Sbjct  1    MADSLTEEQVSEFKKAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  60

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  61   NGTIDFPEF  69


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  132

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  133  GDGRIDYNEF  142


 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 49/76 (64%), Gaps = 3/76 (4%)
 Frame = +1

Query  304  MKDTDSEE---ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDG  474
            M D+ +EE   E K+AF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D 
Sbjct  1    MADSLTEEQVSEFKKAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  60

Query  475  DGQINYEEFVKVMMAK  522
            +G I++ EF+ +M  K
Sbjct  61   NGTIDFPEFLTMMARK  76



>ref|XP_009561681.1| PREDICTED: calmodulin, striated muscle [Cuculus canorus]
 gb|KFO78006.1| Calmodulin, striated muscle [Cuculus canorus]
Length=149

 Score =   142 bits (359),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL+LMARKM+DTDSEEE++EAFRVFDKD NG+IS AELRHVMTNLGEKLTDEE
Sbjct  62   GTIDFPEFLSLMARKMRDTDSEEEIREAFRVFDKDGNGYISVAELRHVMTNLGEKLTDEE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMI+EAD + DGQ+NYEEFV++M  K
Sbjct  122  VDEMIKEADCNNDGQVNYEEFVRMMTEK  149


 Score =   125 bits (313),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA++L++++I+EFKEAFSLFD+DGDGCITTKELGTVMRSLGQNPTEAELQDM+ EVDAD 
Sbjct  1    MAERLSEEKIAEFKEAFSLFDRDGDGCITTKELGTVMRSLGQNPTEAELQDMVGEVDADN  60

Query  255  NGTIDFPEF  281
            +GTIDFPEF
Sbjct  61   SGTIDFPEF  69


 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FDKDG+G I+  EL  VM +LG+  T+ E+ +MI E D +
Sbjct  73   MARKMRDTDSEEEIREAFRVFDKDGNGYISVAELRHVMTNLGEKLTDEEVDEMIKEADCN  132

Query  252  GNGTIDFPEF  281
             +G +++ EF
Sbjct  133  NDGQVNYEEF  142


 Score = 58.5 bits (140),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FD+D +G I+  EL  VM +LG+  T+ E+ +M+ E D D  G I++ EF+ 
Sbjct  12   EFKEAFSLFDRDGDGCITTKELGTVMRSLGQNPTEAELQDMVGEVDADNSGTIDFPEFLS  71

Query  508  VMMAK  522
            +M  K
Sbjct  72   LMARK  76



>ref|XP_765284.1| calmodulin [Theileria parva strain Muguga]
 gb|EAN33001.1| calmodulin, putative [Theileria parva]
Length=149

 Score =   142 bits (357),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL LMARKMK+ D+EEEL +AF+VFD+D NGFISA ELRHVMTNLGE+LTDEE
Sbjct  62   GSIDFPEFLTLMARKMKECDTEEELIQAFKVFDRDGNGFISAQELRHVMTNLGERLTDEE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEM+READVDGDG+INYEEFVK+M++K
Sbjct  122  VDEMLREADVDGDGKINYEEFVKLMVSK  149


 Score =   125 bits (315),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQL+++QI+EFKEAF+LFDKDGDG IT+KELGT+MRSLGQNPTEAELQDMINE+DA+ 
Sbjct  1    MADQLSEEQIAEFKEAFALFDKDGDGSITSKELGTIMRSLGQNPTEAELQDMINEIDANS  60

Query  255  NGTIDFPEF  281
            NG+IDFPEF
Sbjct  61   NGSIDFPEF  69


 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 3/76 (4%)
 Frame = +1

Query  304  MKDTDSEE---ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDG  474
            M D  SEE   E KEAF +FDKD +G I++ EL  +M +LG+  T+ E+ +MI E D + 
Sbjct  1    MADQLSEEQIAEFKEAFALFDKDGDGSITSKELGTIMRSLGQNPTEAELQDMINEIDANS  60

Query  475  DGQINYEEFVKVMMAK  522
            +G I++ EF+ +M  K
Sbjct  61   NGSIDFPEFLTLMARK  76


 Score = 58.5 bits (140),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +3

Query  108  EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            E  +AF +FD+DG+G I+ +EL  VM +LG+  T+ E+ +M+ E D DG+G I++ EF
Sbjct  85   ELIQAFKVFDRDGNGFISAQELRHVMTNLGERLTDEEVDEMLREADVDGDGKINYEEF  142



>emb|CEF74092.1| unnamed protein product [Fusarium graminearum]
Length=150

 Score =   140 bits (354),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  63   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  122

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  123  VDEMIREADQDGDGRIDYNEFVQLMMQK  150


 Score =   126 bits (317),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            +AD LT++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD 
Sbjct  2    VADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  61

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  62   NGTIDFPEF  70


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  74   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  133

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  134  GDGRIDYNEF  143


 Score = 58.9 bits (141),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  13   EFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  72

Query  508  VMMAK  522
            +M  K
Sbjct  73   MMARK  77



>gb|ABY87953.1| hypothetical protein [Stachybotrys elegans]
Length=149

 Score =   139 bits (349),  Expect(2) = 8e-63, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLT++E
Sbjct  62   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTEDE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  122  VDEMIREADQDGDGRIDYNEFVQLMMQK  149


 Score =   128 bits (322),  Expect(2) = 8e-63, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LT++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD 
Sbjct  1    MADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  60

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  61   NGTIDFPEF  69


 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  TE E+ +MI E D D
Sbjct  73   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTEDEVDEMIREADQD  132

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  133  GDGRIDYNEF  142


 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 3/76 (4%)
 Frame = +1

Query  304  MKDTDSEE---ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDG  474
            M D+ +EE   E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D 
Sbjct  1    MADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  60

Query  475  DGQINYEEFVKVMMAK  522
            +G I++ EF+ +M  K
Sbjct  61   NGTIDFPEFLTMMARK  76



>ref|XP_007288182.1| calmodulin [Marssonina brunnea f. sp. 'multigermtubi' MB_m1]
 gb|EKD21180.1| calmodulin [Marssonina brunnea f. sp. 'multigermtubi' MB_m1]
Length=154

 Score =   140 bits (354),  Expect(2) = 9e-63, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  67   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  126

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  127  VDEMIREADQDGDGRIDYNEFVQLMMQK  154


 Score =   126 bits (316),  Expect(2) = 9e-63, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +3

Query  78   ADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGN  257
            AD LT++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD N
Sbjct  7    ADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNN  66

Query  258  GTIDFPEF  281
            GTIDFPEF
Sbjct  67   GTIDFPEF  74


 Score = 61.6 bits (148),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  78   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  137

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  138  GDGRIDYNEF  147


 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  17   EFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  76

Query  508  VMMAK  522
            +M  K
Sbjct  77   MMARK  81



>gb|ENH79701.1| calmodulin, partial [Colletotrichum orbiculare MAFF 240422]
Length=148

 Score =   140 bits (354),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  61   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  120

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  121  VDEMIREADQDGDGRIDYNEFVQLMMQK  148


 Score =   126 bits (316),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +3

Query  78   ADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGN  257
            AD LT++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD N
Sbjct  1    ADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNN  60

Query  258  GTIDFPEF  281
            GTIDFPEF
Sbjct  61   GTIDFPEF  68


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  72   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  131

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  132  GDGRIDYNEF  141


 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  11   EFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  70

Query  508  VMMAK  522
            +M  K
Sbjct  71   MMARK  75



>ref|XP_001552123.1| calmodulin [Botrytis cinerea B05.10]
 ref|XP_001589037.1| calmodulin [Sclerotinia sclerotiorum 1980]
 gb|ABK58108.1| calmodulin [Botrytis cinerea]
 gb|EDN93803.1| calmodulin [Sclerotinia sclerotiorum 1980 UF-70]
 emb|CCD55435.1| BC4, calmodulin [Botrytis cinerea T4]
 gb|EMR90205.1| putative calmodulin protein [Botrytis cinerea BcDW1]
 gb|ESZ93235.1| calmodulin [Sclerotinia borealis F-4157]
Length=149

 Score =   140 bits (354),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  62   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  122  VDEMIREADQDGDGRIDYNEFVQLMMQK  149


 Score =   125 bits (315),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LT++Q+SEFKEAFSLFDK+GDG IT+KELGTVMRSLGQNP+E+ELQDMINEVDAD 
Sbjct  1    MADSLTEEQVSEFKEAFSLFDKNGDGQITSKELGTVMRSLGQNPSESELQDMINEVDADN  60

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  61   NGTIDFPEF  69


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  132

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  133  GDGRIDYNEF  142


 Score = 58.5 bits (140),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 50/76 (66%), Gaps = 3/76 (4%)
 Frame = +1

Query  304  MKDTDSEE---ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDG  474
            M D+ +EE   E KEAF +FDK+ +G I++ EL  VM +LG+  ++ E+ +MI E D D 
Sbjct  1    MADSLTEEQVSEFKEAFSLFDKNGDGQITSKELGTVMRSLGQNPSESELQDMINEVDADN  60

Query  475  DGQINYEEFVKVMMAK  522
            +G I++ EF+ +M  K
Sbjct  61   NGTIDFPEFLTMMARK  76



>gb|AAG00262.1|AF089808_1 calmodulin [Magnaporthe grisea]
 gb|AAD25331.1| calmodulin [Magnaporthe grisea]
Length=149

 Score =   138 bits (348),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+ FD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  62   GTIDFPEFLTMMARKMKDTDSEEEIREAFKFFDRDNNGFISAAELRHVMTSIGEKLTDDE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  122  VDEMIREADQDGDGRIDYNEFVQLMMQK  149


 Score =   128 bits (322),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LT++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD 
Sbjct  1    MADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  60

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  61   NGTIDFPEF  69


 Score = 61.2 bits (147),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF  FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEEIREAFKFFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  132

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  133  GDGRIDYNEF  142


 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 3/76 (4%)
 Frame = +1

Query  304  MKDTDSEE---ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDG  474
            M D+ +EE   E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D 
Sbjct  1    MADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  60

Query  475  DGQINYEEFVKVMMAK  522
            +G I++ EF+ +M  K
Sbjct  61   NGTIDFPEFLTMMARK  76



>gb|EPE09638.1| calmodulin [Ophiostoma piceae UAMH 11346]
Length=149

 Score =   140 bits (352),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKM+DTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  62   GTIDFPEFLTMMARKMRDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  122  VDEMIREADQDGDGRIDYNEFVQLMMQK  149


 Score =   127 bits (318),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+ LT++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD 
Sbjct  1    MAESLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  60

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  61   NGTIDFPEF  69


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  73   MARKMRDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  132

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  133  GDGRIDYNEF  142


 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  12   EFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  71

Query  508  VMMAK  522
            +M  K
Sbjct  72   MMARK  76



>ref|XP_006669179.1| calmodulin [Cordyceps militaris CM01]
 gb|EGX92595.1| calmodulin [Cordyceps militaris CM01]
Length=171

 Score =   140 bits (353),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE+ EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  84   GTIDFPEFLTMMARKMKDTDSEEEIMEAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  143

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  144  VDEMIREADQDGDGRIDYNEFVQLMMQK  171


 Score =   126 bits (317),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +3

Query  63   RALTMADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEV  242
            R   +AD LT+DQ++EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEV
Sbjct  19   RDPAVADALTEDQVAEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEV  78

Query  243  DADGNGTIDFPEF  281
            DAD NGTIDFPEF
Sbjct  79   DADNNGTIDFPEF  91


 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E  EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  95   MARKMKDTDSEEEIMEAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  154

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  155  GDGRIDYNEF  164


 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  34   EFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  93

Query  508  VMMAK  522
            +M  K
Sbjct  94   MMARK  98



>ref|XP_006727741.1| PREDICTED: calmodulin-like [Leptonychotes weddellii]
Length=161

 Score =   145 bits (366),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTD EEE+ EAFRVFDKD N ++SAAELRHVMTN+GEKLTDEE
Sbjct  74   GMVGFPEFLTVMARKMKDTDREEEIHEAFRVFDKDGNAYVSAAELRHVMTNVGEKLTDEE  133

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD+DGDGQ+NYEEFV++M AK
Sbjct  134  VDEMIREADIDGDGQVNYEEFVRMMTAK  161


 Score =   120 bits (302),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +3

Query  78   ADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGN  257
            A QLT +QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAE QDMINEVDAD N
Sbjct  14   AAQLTKEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAEWQDMINEVDADRN  73

Query  258  GTIDFPEF  281
            G + FPEF
Sbjct  74   GMVGFPEF  81


 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 46/71 (65%), Gaps = 1/71 (1%)
 Frame = +3

Query  72   TMADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDA  248
             MA ++ D D+  E  EAF +FDKDG+  ++  EL  VM ++G+  T+ E+ +MI E D 
Sbjct  84   VMARKMKDTDREEEIHEAFRVFDKDGNAYVSAAELRHVMTNVGEKLTDEEVDEMIREADI  143

Query  249  DGNGTIDFPEF  281
            DG+G +++ EF
Sbjct  144  DGDGQVNYEEF  154


 Score = 58.9 bits (141),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  T+ E  +MI E D D +G + + EF+ 
Sbjct  24   EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAEWQDMINEVDADRNGMVGFPEFLT  83

Query  508  VMMAK  522
            VM  K
Sbjct  84   VMARK  88



>ref|XP_008600562.1| calmodulin-like protein [Beauveria bassiana ARSEF 2860]
 gb|EJP63919.1| calmodulin-like protein [Beauveria bassiana ARSEF 2860]
Length=162

 Score =   139 bits (351),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE+ EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  75   GTIDFPEFLTMMARKMKDTDSEEEIMEAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  134

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  135  VDEMIREADQDGDGRIDYNEFVQLMMQK  162


 Score =   126 bits (317),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +3

Query  78   ADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGN  257
            AD LT+DQ++EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD N
Sbjct  15   ADSLTEDQVAEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNN  74

Query  258  GTIDFPEF  281
            GTIDFPEF
Sbjct  75   GTIDFPEF  82


 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E  EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  86   MARKMKDTDSEEEIMEAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  145

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  146  GDGRIDYNEF  155


 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  25   EFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  84

Query  508  VMMAK  522
            +M  K
Sbjct  85   MMARK  89



>gb|KHJ31687.1| putative calmodulin [Erysiphe necator]
Length=149

 Score =   137 bits (346),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELR+VMT++GEKLTD+E
Sbjct  62   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRYVMTSIGEKLTDDE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM +
Sbjct  122  VDEMIREADQDGDGRIDYNEFVQLMMQR  149


 Score =   128 bits (322),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LT++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD 
Sbjct  1    MADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  60

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  61   NGTIDFPEF  69


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRYVMTSIGEKLTDDEVDEMIREADQD  132

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  133  GDGRIDYNEF  142


 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 3/76 (4%)
 Frame = +1

Query  304  MKDTDSEE---ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDG  474
            M D+ +EE   E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D 
Sbjct  1    MADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  60

Query  475  DGQINYEEFVKVMMAK  522
            +G I++ EF+ +M  K
Sbjct  61   NGTIDFPEFLTMMARK  76



>gb|AAA33569.1| calmodulin [Neurospora crassa]
Length=149

 Score =   140 bits (354),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  62   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  122  VDEMIREADQDGDGRIDYNEFVQLMMQK  149


 Score =   125 bits (313),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LT++Q+SEFKEAFSLFDKDGDG ITTKELGTVM SLGQNP+E+ELQDMINEVDAD 
Sbjct  1    MADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMLSLGQNPSESELQDMINEVDADN  60

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  61   NGTIDFPEF  69


 Score = 61.6 bits (148),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  132

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  133  GDGRIDYNEF  142


 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 3/76 (4%)
 Frame = +1

Query  304  MKDTDSEE---ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDG  474
            M D+ +EE   E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D 
Sbjct  1    MADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMLSLGQNPSESELQDMINEVDADN  60

Query  475  DGQINYEEFVKVMMAK  522
            +G I++ EF+ +M  K
Sbjct  61   NGTIDFPEFLTMMARK  76



>gb|EKC29242.1| Calmodulin [Crassostrea gigas]
Length=176

 Score =   149 bits (375),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +M++KMKD+DS+EE++EAFRVFDKD NGFISAAELRHVMTNLGEKLTDEE
Sbjct  89   GTIDFPEFLTMMSKKMKDSDSDEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEE  148

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD+DGDGQ+NYEEFVK+M +K
Sbjct  149  VDEMIREADIDGDGQVNYEEFVKMMTSK  176


 Score =   117 bits (292),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 65/88 (74%), Gaps = 20/88 (23%)
 Frame = +3

Query  78   ADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG-  254
            AD L+++QISEF+EAFSLFDKDGDG ITTKELGTVMRSLGQNPTE ELQDMINEVDADG 
Sbjct  9    ADSLSEEQISEFREAFSLFDKDGDGTITTKELGTVMRSLGQNPTETELQDMINEVDADGK  68

Query  255  -------------------NGTIDFPEF  281
                               NGTIDFPEF
Sbjct  69   SSLPSYLPPPPPFSYKGNRNGTIDFPEF  96


 Score = 62.0 bits (149),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            M+ ++ D D   E +EAF +FDKDG+G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  100  MSKKMKDSDSDEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADID  159

Query  252  GNGTIDFPEF  281
            G+G +++ EF
Sbjct  160  GDGQVNYEEF  169


 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 44/85 (52%), Gaps = 20/85 (24%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDG-----------  474
            E +EAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D DG           
Sbjct  19   EFREAFSLFDKDGDGTITTKELGTVMRSLGQNPTETELQDMINEVDADGKSSLPSYLPPP  78

Query  475  ---------DGQINYEEFVKVMMAK  522
                     +G I++ EF+ +M  K
Sbjct  79   PPFSYKGNRNGTIDFPEFLTMMSKK  103



>ref|XP_011119385.1| hypothetical protein AOL_s00043g597 [Arthrobotrys oligospora 
ATCC 24927]
 gb|EGX51863.1| hypothetical protein AOL_s00043g597 [Arthrobotrys oligospora 
ATCC 24927]
Length=288

 Score =   140 bits (353),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NG+ISAAELRHVMT++GEKLTD E
Sbjct  201  GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGYISAAELRHVMTSIGEKLTDAE  260

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  261  VDEMIREADQDGDGRIDYNEFVQLMMQK  288


 Score =   124 bits (311),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +3

Query  78   ADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGN  257
            A+ LT++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD N
Sbjct  141  AEALTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNN  200

Query  258  GTIDFPEF  281
            GTIDFPEF
Sbjct  201  GTIDFPEF  208


 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+AE+ +MI E D D
Sbjct  212  MARKMKDTDSEEEIREAFKVFDRDNNGYISAAELRHVMTSIGEKLTDAEVDEMIREADQD  271

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  272  GDGRIDYNEF  281


 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  151  EFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  210

Query  508  VMMAK  522
            +M  K
Sbjct  211  MMARK  215



>ref|XP_951999.1| calmodulin [Theileria annulata strain Ankara]
 emb|CAI74267.1| calmodulin, putative [Theileria annulata]
Length=149

 Score =   140 bits (353),  Expect(2) = 9e-62, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL LMARKMK+ D+EEEL +AF+VFD+D NGFISA ELRHVMTNLGE+LTDEE
Sbjct  62   GAIDFPEFLILMARKMKECDTEEELIQAFKVFDRDGNGFISAQELRHVMTNLGERLTDEE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEM+READVDGDG+INYEEFVK+M++K
Sbjct  122  VDEMLREADVDGDGKINYEEFVKLMVSK  149


 Score =   123 bits (309),  Expect(2) = 9e-62, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQL+++QI+EFKEAFSLFDKDGDG ITTKELGT+MRSLGQNPTEAELQDMINE+D + 
Sbjct  1    MADQLSEEQIAEFKEAFSLFDKDGDGSITTKELGTIMRSLGQNPTEAELQDMINEIDTNS  60

Query  255  NGTIDFPEF  281
            +G IDFPEF
Sbjct  61   SGAIDFPEF  69


 Score = 58.5 bits (140),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +3

Query  108  EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            E  +AF +FD+DG+G I+ +EL  VM +LG+  T+ E+ +M+ E D DG+G I++ EF
Sbjct  85   ELIQAFKVFDRDGNGFISAQELRHVMTNLGERLTDEEVDEMLREADVDGDGKINYEEF  142


 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 47/76 (62%), Gaps = 3/76 (4%)
 Frame = +1

Query  304  MKDTDSEE---ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDG  474
            M D  SEE   E KEAF +FDKD +G I+  EL  +M +LG+  T+ E+ +MI E D + 
Sbjct  1    MADQLSEEQIAEFKEAFSLFDKDGDGSITTKELGTIMRSLGQNPTEAELQDMINEIDTNS  60

Query  475  DGQINYEEFVKVMMAK  522
             G I++ EF+ +M  K
Sbjct  61   SGAIDFPEFLILMARK  76



>ref|XP_007673454.1| hypothetical protein BAUCODRAFT_22484 [Baudoinia compniacensis 
UAMH 10762]
 gb|EMC99216.1| hypothetical protein BAUCODRAFT_22484 [Baudoinia compniacensis 
UAMH 10762]
Length=155

 Score =   140 bits (354),  Expect(2) = 9e-62, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  68   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  127

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  128  VDEMIREADQDGDGRIDYNEFVQLMMQK  155


 Score =   122 bits (307),  Expect(2) = 9e-62, Method: Compositional matrix adjust.
 Identities = 57/67 (85%), Positives = 65/67 (97%), Gaps = 0/67 (0%)
 Frame = +3

Query  81   DQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNG  260
            ++L+++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NG
Sbjct  9    NELSEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNG  68

Query  261  TIDFPEF  281
            TIDFPEF
Sbjct  69   TIDFPEF  75


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  79   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  138

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  139  GDGRIDYNEF  148


 Score = 58.9 bits (141),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  18   EFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  77

Query  508  VMMAK  522
            +M  K
Sbjct  78   MMARK  82



>ref|XP_009690713.1| calmodulin [Theileria orientalis strain Shintoku]
 dbj|BAM40412.1| calmodulin [Theileria orientalis strain Shintoku]
Length=149

 Score =   138 bits (348),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL LMARKMK+ D+EEEL +AF+VFD+D NGFISA ELRHVMTNLGE+LTD+E
Sbjct  62   GTIDFPEFLLLMARKMKECDTEEELIQAFKVFDRDGNGFISAQELRHVMTNLGERLTDDE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEM+READ+DGDG+INYEEFVK+M++K
Sbjct  122  VDEMLREADIDGDGKINYEEFVKLMVSK  149


 Score =   125 bits (313),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQL+++QI+EFKEAFSLFDKDGDG ITTKELGT+MRSLGQNPTEAELQDMINE+D + 
Sbjct  1    MADQLSEEQIAEFKEAFSLFDKDGDGSITTKELGTIMRSLGQNPTEAELQDMINEIDTNS  60

Query  255  NGTIDFPEF  281
            +GTIDFPEF
Sbjct  61   SGTIDFPEF  69


 Score = 58.2 bits (139),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 48/72 (67%), Gaps = 1/72 (1%)
 Frame = +3

Query  69   LTMADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVD  245
            L MA ++ + D   E  +AF +FD+DG+G I+ +EL  VM +LG+  T+ E+ +M+ E D
Sbjct  71   LLMARKMKECDTEEELIQAFKVFDRDGNGFISAQELRHVMTNLGERLTDDEVDEMLREAD  130

Query  246  ADGNGTIDFPEF  281
             DG+G I++ EF
Sbjct  131  IDGDGKINYEEF  142


 Score = 58.2 bits (139),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 47/76 (62%), Gaps = 3/76 (4%)
 Frame = +1

Query  304  MKDTDSEE---ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDG  474
            M D  SEE   E KEAF +FDKD +G I+  EL  +M +LG+  T+ E+ +MI E D + 
Sbjct  1    MADQLSEEQIAEFKEAFSLFDKDGDGSITTKELGTIMRSLGQNPTEAELQDMINEIDTNS  60

Query  475  DGQINYEEFVKVMMAK  522
             G I++ EF+ +M  K
Sbjct  61   SGTIDFPEFLLLMARK  76



>gb|KFX47024.1| Calmodulin [Talaromyces marneffei PM1]
Length=145

 Score =   135 bits (339),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  62   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  121

Query  439  VDEMIREADVDGDGQINYEEFVKV  510
            VDEMIREAD DGDG+I+Y EFV++
Sbjct  122  VDEMIREADQDGDGRIDYNEFVQL  145


 Score =   127 bits (319),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LT++Q+SE+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD 
Sbjct  1    MADSLTEEQVSEYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  60

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  61   NGTIDFPEF  69


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  132

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  133  GDGRIDYNEF  142


 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 3/76 (4%)
 Frame = +1

Query  304  MKDTDSEE---ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDG  474
            M D+ +EE   E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D 
Sbjct  1    MADSLTEEQVSEYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  60

Query  475  DGQINYEEFVKVMMAK  522
            +G I++ EF+ +M  K
Sbjct  61   NGTIDFPEFLTMMARK  76



>ref|XP_005144642.1| PREDICTED: calmodulin isoform X2 [Melopsittacus undulatus]
 ref|XP_005238736.1| PREDICTED: calmodulin isoform X2 [Falco peregrinus]
 ref|XP_005532764.1| PREDICTED: calmodulin isoform X2 [Pseudopodoces humilis]
 ref|XP_008494744.1| PREDICTED: calmodulin isoform X3 [Calypte anna]
 ref|XP_009089603.1| PREDICTED: calmodulin isoform X3 [Serinus canaria]
 ref|XP_009902681.1| PREDICTED: calmodulin isoform X2 [Picoides pubescens]
 ref|XP_010574815.1| PREDICTED: calmodulin isoform X2 [Haliaeetus leucocephalus]
 gb|ACH46242.1| putative calmodulin variant 1 [Taeniopygia guttata]
Length=141

 Score =   148 bits (373),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +1

Query  280  FLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIRE  459
            FL +MARKMKDTDSEEE++EAFRVFDKD NG+ISAAELRHVMTNLGEKLTDEEVDEMIRE
Sbjct  61   FLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIRE  120

Query  460  ADVDGDGQINYEEFVKVMMAK  522
            AD+DGDGQ+NYEEFV++M AK
Sbjct  121  ADIDGDGQVNYEEFVQMMTAK  141


 Score =   114 bits (285),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 55/59 (93%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MADQLT++QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDAD
Sbjct  1    MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD  59


 Score = 63.9 bits (154),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FDKDG+G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  65   MARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADID  124

Query  252  GNGTIDFPEF  281
            G+G +++ EF
Sbjct  125  GDGQVNYEEF  134


 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD  471
            E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D
Sbjct  12   EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD  59



>ref|XP_659651.1| CALM_EMENI Calmodulin (CaM) [Aspergillus nidulans FGSC A4]
 gb|EAA64879.1| CALM_EMENI Calmodulin (CaM) [Aspergillus nidulans FGSC A4]
Length=145

 Score =   140 bits (354),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  58   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  117

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  118  VDEMIREADQDGDGRIDYNEFVQLMMQK  145


 Score =   121 bits (303),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +3

Query  87   LTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTI  266
            +T++Q+SE+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTI
Sbjct  1    MTEEQVSEYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTI  60

Query  267  DFPEF  281
            DFPEF
Sbjct  61   DFPEF  65


 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  69   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  128

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  129  GDGRIDYNEF  138


 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  8    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  67

Query  508  VMMAK  522
            +M  K
Sbjct  68   MMARK  72



>ref|XP_008787894.1| PREDICTED: calmodulin-like isoform X1 [Phoenix dactylifera]
Length=149

 Score =   141 bits (356),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FLNLMA KMK+TDSEEELKEAF+VFDKD+NGFISA +LR+V+TNLGEKLTDEE
Sbjct  62   GAIDFPEFLNLMACKMKNTDSEEELKEAFKVFDKDRNGFISATDLRNVLTNLGEKLTDEE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
             +EMIREAD+DGDGQ+NYEEFV +M+A+
Sbjct  122  ANEMIREADIDGDGQVNYEEFVIMMLAR  149


 Score =   120 bits (300),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA  LT++QI+EFK  F LFDKDGDGCITTKEL  VMRSLGQNPTEAELQDMINEVDAD 
Sbjct  1    MAQHLTEEQIAEFKALFGLFDKDGDGCITTKELSIVMRSLGQNPTEAELQDMINEVDADQ  60

Query  255  NGTIDFPEF  281
            NG IDFPEF
Sbjct  61   NGAIDFPEF  69


 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E K  F +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D +G I++ EF+ 
Sbjct  12   EFKALFGLFDKDGDGCITTKELSIVMRSLGQNPTEAELQDMINEVDADQNGAIDFPEFLN  71

Query  508  VMMAK  522
            +M  K
Sbjct  72   LMACK  76


 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = +3

Query  96   DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFP  275
            D   E KEAF +FDKD +G I+  +L  V+ +LG+  T+ E  +MI E D DG+G +++ 
Sbjct  81   DSEEELKEAFKVFDKDRNGFISATDLRNVLTNLGEKLTDEEANEMIREADIDGDGQVNYE  140

Query  276  EF  281
            EF
Sbjct  141  EF  142



>ref|XP_006727042.1| PREDICTED: calmodulin-like [Leptonychotes weddellii]
Length=223

 Score =   139 bits (349),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +1

Query  253  GMGQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTD  432
            G G + F   L LMARKMKDTDSEEE++EAFRVFDKD NG++SAAELRHV T+ GEKLT+
Sbjct  134  GNGTIDFPEVLTLMARKMKDTDSEEEIREAFRVFDKDGNGYVSAAELRHVTTHSGEKLTE  193

Query  433  EEVDEMIREADVDGDGQINYEEFVKVMMAK  522
            EEVDE IREA +DGDGQ+NYEEFV++M AK
Sbjct  194  EEVDETIREAVMDGDGQVNYEEFVQMMTAK  223


 Score =   122 bits (306),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +3

Query  72   TMADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            T ADQLT++QI+EFKEAFS FD+ GDG ITTKELGTVMRSLGQNPTEAE+QDMINEV AD
Sbjct  74   TTADQLTEEQIAEFKEAFSPFDQAGDGTITTKELGTVMRSLGQNPTEAEVQDMINEVAAD  133

Query  252  GNGTIDFPE  278
            GNGTIDFPE
Sbjct  134  GNGTIDFPE  142


 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF  FD+  +G I+  EL  VM +LG+  T+ EV +MI E   DG+G I++ E + 
Sbjct  86   EFKEAFSPFDQAGDGTITTKELGTVMRSLGQNPTEAEVQDMINEVAADGNGTIDFPEVLT  145

Query  508  VMMAK  522
            +M  K
Sbjct  146  LMARK  150


 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 42/70 (60%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FDKDG+G ++  EL  V    G+  TE E+ + I E   D
Sbjct  147  MARKMKDTDSEEEIREAFRVFDKDGNGYVSAAELRHVTTHSGEKLTEEEVDETIREAVMD  206

Query  252  GNGTIDFPEF  281
            G+G +++ EF
Sbjct  207  GDGQVNYEEF  216



>gb|KID69826.1| EF-hand-like domain protein, partial [Metarhizium anisopliae 
ARSEF 549]
Length=226

 Score =   131 bits (329),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +3

Query  72   TMADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            TMAD LT++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD
Sbjct  58   TMADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDAD  117

Query  252  GNGTIDFPEF  281
             NGTIDFPEF
Sbjct  118  NNGTIDFPEF  127


 Score =   129 bits (324),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 78/107 (73%), Gaps = 19/107 (18%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  120  GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  179

Query  439  VDEMIREADVDGDGQINY-------------------EEFVKVMMAK  522
            VDEMIREAD DGDG+I+                     EFV++MM K
Sbjct  180  VDEMIREADQDGDGRIDCMEPSSRAFQNVPLLIRLADNEFVQLMMQK  226


 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 3/76 (4%)
 Frame = +1

Query  304  MKDTDSEE---ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDG  474
            M D+ +EE   E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D 
Sbjct  59   MADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  118

Query  475  DGQINYEEFVKVMMAK  522
            +G I++ EF+ +M  K
Sbjct  119  NGTIDFPEFLTMMARK  134


 Score = 56.6 bits (135),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 1/66 (2%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  131  MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  190

Query  252  GNGTID  269
            G+G ID
Sbjct  191  GDGRID  196



>ref|XP_007819860.2| adaptor protein complex gamma-adaptin subunit [Metarhizium robertsii 
ARSEF 23]
 gb|EXV03624.1| calmodulin domain protein [Metarhizium robertsii]
 gb|EFZ01075.2| adaptor protein complex gamma-adaptin subunit [Metarhizium robertsii 
ARSEF 23]
Length=226

 Score =   131 bits (329),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +3

Query  72   TMADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            TMAD LT++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD
Sbjct  58   TMADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDAD  117

Query  252  GNGTIDFPEF  281
             NGTIDFPEF
Sbjct  118  NNGTIDFPEF  127


 Score =   129 bits (324),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 78/107 (73%), Gaps = 19/107 (18%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  120  GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  179

Query  439  VDEMIREADVDGDGQINY-------------------EEFVKVMMAK  522
            VDEMIREAD DGDG+I+                     EFV++MM K
Sbjct  180  VDEMIREADQDGDGRIDCMEPSSRAFRNVPLLIRLADNEFVQLMMQK  226


 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 3/76 (4%)
 Frame = +1

Query  304  MKDTDSEE---ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDG  474
            M D+ +EE   E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D 
Sbjct  59   MADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  118

Query  475  DGQINYEEFVKVMMAK  522
            +G I++ EF+ +M  K
Sbjct  119  NGTIDFPEFLTMMARK  134


 Score = 56.6 bits (135),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 1/66 (2%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  131  MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  190

Query  252  GNGTID  269
            G+G ID
Sbjct  191  GDGRID  196



>ref|XP_007793474.1| putative calmodulin protein [Eutypa lata UCREL1]
 gb|EMR67428.1| putative calmodulin protein [Eutypa lata UCREL1]
Length=157

 Score =   133 bits (335),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 79/96 (82%), Gaps = 8/96 (8%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRV--------FDKDQNGFISAAELRHVMTNL  414
            G + F  FL +MARKMKDTDSEEE++EAF+V        FD+D NGFISAAELRHVMT++
Sbjct  62   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVCCLHWEQVFDRDNNGFISAAELRHVMTSI  121

Query  415  GEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK  522
            GEKLTD+EVDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  122  GEKLTDDEVDEMIREADQDGDGRIDYNEFVQLMMQK  157


 Score =   125 bits (315),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+ LT++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD 
Sbjct  1    MAETLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  60

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  61   NGTIDFPEF  69


 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 3/76 (4%)
 Frame = +1

Query  304  MKDTDSEE---ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDG  474
            M +T +EE   E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D 
Sbjct  1    MAETLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  60

Query  475  DGQINYEEFVKVMMAK  522
            +G I++ EF+ +M  K
Sbjct  61   NGTIDFPEFLTMMARK  76


 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 46/78 (59%), Gaps = 9/78 (12%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSL--------FDKDGDGCITTKELGTVMRSLGQNPTEAELQD  227
            MA ++ D D   E +EAF +        FD+D +G I+  EL  VM S+G+  T+ E+ +
Sbjct  73   MARKMKDTDSEEEIREAFKVCCLHWEQVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDE  132

Query  228  MINEVDADGNGTIDFPEF  281
            MI E D DG+G ID+ EF
Sbjct  133  MIREADQDGDGRIDYNEF  150



>gb|EQB57576.1| hypothetical protein CGLO_02286 [Colletotrichum gloeosporioides 
Cg-14]
Length=197

 Score =   142 bits (357),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  110  GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  169

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  170  VDEMIREADQDGDGRIDYNEFVQLMMQK  197


 Score =   116 bits (291),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 67/89 (75%), Gaps = 18/89 (20%)
 Frame = +3

Query  69   LTMADQLTDDQISEFKEAFSLFDKDGD------------------GCITTKELGTVMRSL  194
            L +AD LT++Q+SEFKEAFSLFDKDGD                  G ITTKELGTVMRSL
Sbjct  29   LLIADSLTEEQVSEFKEAFSLFDKDGDAAFDAAVEACRIGLKSWTGQITTKELGTVMRSL  88

Query  195  GQNPTEAELQDMINEVDADGNGTIDFPEF  281
            GQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  89   GQNPSESELQDMINEVDADNNGTIDFPEF  117


 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  121  MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  180

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  181  GDGRIDYNEF  190


 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 42/83 (51%), Gaps = 18/83 (22%)
 Frame = +1

Query  328  ELKEAFRVFDKD------------------QNGFISAAELRHVMTNLGEKLTDEEVDEMI  453
            E KEAF +FDKD                    G I+  EL  VM +LG+  ++ E+ +MI
Sbjct  42   EFKEAFSLFDKDGDAAFDAAVEACRIGLKSWTGQITTKELGTVMRSLGQNPSESELQDMI  101

Query  454  READVDGDGQINYEEFVKVMMAK  522
             E D D +G I++ EF+ +M  K
Sbjct  102  NEVDADNNGTIDFPEFLTMMARK  124



>ref|XP_007919083.1| putative calmodulin protein [Togninia minima UCRPA7]
 gb|EON96141.1| putative calmodulin protein [Togninia minima UCRPA7]
Length=165

 Score =   140 bits (354),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  78   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  137

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  138  VDEMIREADQDGDGRIDYNEFVQLMMQK  165


 Score =   117 bits (294),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 66/85 (78%), Gaps = 16/85 (19%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLF----------------DKDGDGCITTKELGTVMRSLGQNP  206
            MAD LT++Q+SEFKEAFSLF                DKDGDG ITTKELGTVMRSLGQNP
Sbjct  1    MADSLTEEQVSEFKEAFSLFERRQVFRELTCPLAMQDKDGDGQITTKELGTVMRSLGQNP  60

Query  207  TEAELQDMINEVDADGNGTIDFPEF  281
            +E+ELQDMINEVDAD NGTIDFPEF
Sbjct  61   SESELQDMINEVDADNNGTIDFPEF  85


 Score = 61.6 bits (148),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  89   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  148

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  149  GDGRIDYNEF  158


 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 49/92 (53%), Gaps = 19/92 (21%)
 Frame = +1

Query  304  MKDTDSEE---ELKEAFRVF----------------DKDQNGFISAAELRHVMTNLGEKL  426
            M D+ +EE   E KEAF +F                DKD +G I+  EL  VM +LG+  
Sbjct  1    MADSLTEEQVSEFKEAFSLFERRQVFRELTCPLAMQDKDGDGQITTKELGTVMRSLGQNP  60

Query  427  TDEEVDEMIREADVDGDGQINYEEFVKVMMAK  522
            ++ E+ +MI E D D +G I++ EF+ +M  K
Sbjct  61   SESELQDMINEVDADNNGTIDFPEFLTMMARK  92



>ref|XP_007583009.1| putative calmodulin protein [Neofusicoccum parvum UCRNP2]
 gb|EOD49516.1| putative calmodulin protein [Neofusicoccum parvum UCRNP2]
Length=161

 Score =   136 bits (343),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +1

Query  280  FLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIRE  459
            FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+EVDEMIRE
Sbjct  81   FLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIRE  140

Query  460  ADVDGDGQINYEEFVKVMMAK  522
            AD DGDG+I+Y EFV++MM K
Sbjct  141  ADQDGDGRIDYNEFVQLMMQK  161


 Score =   122 bits (306),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 58/66 (88%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +3

Query  78   ADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGN  257
            AD LT++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD N
Sbjct  11   ADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNN  70

Query  258  GTIDFP  275
            GTIDFP
Sbjct  71   GTIDFP  76


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  85   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  144

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  145  GDGRIDYNEF  154


 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 49/88 (56%), Gaps = 11/88 (13%)
 Frame = +1

Query  292  MARKMKDTDSEE--------ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDE  447
            M R+  DT   +        E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +
Sbjct  1    MVRRSHDTPPADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQD  60

Query  448  MIREADVDGDGQINYE---EFVKVMMAK  522
            MI E D D +G I++    EF+ +M  K
Sbjct  61   MINEVDADNNGTIDFPGLAEFLTMMARK  88



>emb|CCD10980.1| calmodulin, partial [Aspergillus proliferans]
Length=143

 Score =   137 bits (344),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  59   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  118

Query  439  VDEMIREADVDGDGQINYEEFVKVM  513
            VDEMIREAD DGDG+I+Y EFV++M
Sbjct  119  VDEMIREADQDGDGRIDYNEFVQLM  143


 Score =   121 bits (304),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +3

Query  87   LTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTI  266
            LT++Q+SE+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTI
Sbjct  2    LTEEQVSEYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTI  61

Query  267  DFPEF  281
            DFPEF
Sbjct  62   DFPEF  66


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  70   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  129

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  130  GDGRIDYNEF  139


 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  9    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  68

Query  508  VMMAK  522
            +M  K
Sbjct  69   MMARK  73



>ref|XP_006644879.1| PREDICTED: calmodulin-like protein 1-like [Oryza brachyantha]
Length=149

 Score =   137 bits (345),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G +  + FL LMAR + D +SEEEL EAFRVFDKDQNGFISAAELR VM N+GE+LT+EE
Sbjct  62   GNVDLEEFLGLMARTLNDKESEEELMEAFRVFDKDQNGFISAAELRGVMANVGERLTEEE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            V EM+READVDGDGQINYEEFVK MMAK
Sbjct  122  VGEMVREADVDGDGQINYEEFVKCMMAK  149


 Score =   119 bits (298),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+QLTD+QI+EFKEAFSLFDKDGDG ITT+ELGTVMRSLGQNPTEAELQDMI+EVDAD 
Sbjct  1    MANQLTDEQIAEFKEAFSLFDKDGDGSITTRELGTVMRSLGQNPTEAELQDMISEVDADR  60

Query  255  NGTIDFPEF  281
            +G +D  EF
Sbjct  61   SGNVDLEEF  69


 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 44/70 (63%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTDDQISE-FKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA  L D +  E   EAF +FDKD +G I+  EL  VM ++G+  TE E+ +M+ E D D
Sbjct  73   MARTLNDKESEEELMEAFRVFDKDQNGFISAAELRGVMANVGERLTEEEVGEMVREADVD  132

Query  252  GNGTIDFPEF  281
            G+G I++ EF
Sbjct  133  GDGQINYEEF  142


 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D  G ++ EEF+ 
Sbjct  12   EFKEAFSLFDKDGDGSITTRELGTVMRSLGQNPTEAELQDMISEVDADRSGNVDLEEFLG  71

Query  508  VM  513
            +M
Sbjct  72   LM  73



>emb|CCG28539.1| calmodulin, partial [Aspergillus sp. CCF 3996]
Length=141

 Score =   134 bits (338),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  58   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  117

Query  439  VDEMIREADVDGDGQINYEEFVKV  510
            VDEMIREAD DGDG+I+Y EFV++
Sbjct  118  VDEMIREADQDGDGRIDYNEFVQL  141


 Score =   122 bits (305),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +3

Query  87   LTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTI  266
            LT++Q+SE+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTI
Sbjct  1    LTEEQVSEYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTI  60

Query  267  DFPEF  281
            DFPEF
Sbjct  61   DFPEF  65


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  69   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  128

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  129  GDGRIDYNEF  138


 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  8    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  67

Query  508  VMMAK  522
            +M  K
Sbjct  68   MMARK  72



>ref|XP_007719746.1| calmodulin [Capronia coronata CBS 617.96]
 gb|EXJ95517.1| calmodulin [Capronia coronata CBS 617.96]
Length=158

 Score =   128 bits (321),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LT++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD 
Sbjct  1    MADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  60

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  61   NGTIDFPEF  69


 Score =   127 bits (320),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  62   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  121

Query  439  VDEMIREADVDGDGQINYEE  498
            VDEMIREAD DGDG+I++++
Sbjct  122  VDEMIREADQDGDGRIDFDD  141


 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 3/76 (4%)
 Frame = +1

Query  304  MKDTDSEE---ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDG  474
            M D+ +EE   E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D 
Sbjct  1    MADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  60

Query  475  DGQINYEEFVKVMMAK  522
            +G I++ EF+ +M  K
Sbjct  61   NGTIDFPEFLTMMARK  76


 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 44/67 (66%), Gaps = 1/67 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  132

Query  252  GNGTIDF  272
            G+G IDF
Sbjct  133  GDGRIDF  139



>gb|EZF28696.1| calmodulin, partial [Trichophyton interdigitale H6]
 gb|KDB26279.1| calmodulin, partial [Trichophyton interdigitale MR816]
Length=188

 Score =   129 bits (323),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +3

Query  72   TMADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            TMAD LT++Q+SE+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD
Sbjct  49   TMADSLTEEQVSEYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDAD  108

Query  252  GNGTIDFPEF  281
             NGTIDFPEF
Sbjct  109  NNGTIDFPEF  118


 Score =   127 bits (318),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  111  GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  170

Query  439  VDEMIREADVDGDGQIN  489
            VDEMIREAD DGDG+I+
Sbjct  171  VDEMIREADQDGDGRID  187


 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 3/76 (4%)
 Frame = +1

Query  304  MKDTDSEE---ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDG  474
            M D+ +EE   E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D 
Sbjct  50   MADSLTEEQVSEYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  109

Query  475  DGQINYEEFVKVMMAK  522
            +G I++ EF+ +M  K
Sbjct  110  NGTIDFPEFLTMMARK  125


 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 1/66 (2%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  122  MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  181

Query  252  GNGTID  269
            G+G ID
Sbjct  182  GDGRID  187



>ref|XP_007814902.1| calmodulin [Metarhizium acridum CQMa 102]
 gb|EFY85367.1| calmodulin [Metarhizium acridum CQMa 102]
Length=248

 Score =   129 bits (324),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  166  GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  225

Query  439  VDEMIREADVDGDGQINYEE  498
            VDEMIREAD DGDG+I+  E
Sbjct  226  VDEMIREADQDGDGRIDCME  245


 Score =   126 bits (316),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +3

Query  78   ADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGN  257
            AD LT++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD N
Sbjct  106  ADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNN  165

Query  258  GTIDFPEF  281
            GTIDFPEF
Sbjct  166  GTIDFPEF  173


 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  116  EFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  175

Query  508  VMMAK  522
            +M  K
Sbjct  176  MMARK  180


 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 1/66 (2%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  177  MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  236

Query  252  GNGTID  269
            G+G ID
Sbjct  237  GDGRID  242



>gb|KID73029.1| EF-hand-like domain protein, partial [Metarhizium brunneum ARSEF 
3297]
 gb|KID89081.1| EF-hand-like domain protein [Metarhizium guizhouense ARSEF 977]
Length=168

 Score =   128 bits (321),  Expect(2) = 7e-59, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LT++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD 
Sbjct  1    MADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  60

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  61   NGTIDFPEF  69


 Score =   126 bits (316),  Expect(2) = 7e-59, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  62   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  121

Query  439  VDEMIREADVDGDGQINYEE  498
            VDEMIREAD DGDG+I+  E
Sbjct  122  VDEMIREADQDGDGRIDCME  141


 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 3/76 (4%)
 Frame = +1

Query  304  MKDTDSEE---ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDG  474
            M D+ +EE   E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D 
Sbjct  1    MADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  60

Query  475  DGQINYEEFVKVMMAK  522
            +G I++ EF+ +M  K
Sbjct  61   NGTIDFPEFLTMMARK  76


 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 1/66 (2%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  132

Query  252  GNGTID  269
            G+G ID
Sbjct  133  GDGRID  138



>gb|ELQ43648.1| calmodulin [Magnaporthe oryzae Y34]
 gb|ELQ60671.1| calmodulin [Magnaporthe oryzae P131]
Length=158

 Score =   128 bits (321),  Expect(2) = 7e-59, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LT++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD 
Sbjct  1    MADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  60

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  61   NGTIDFPEF  69


 Score =   126 bits (316),  Expect(2) = 7e-59, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  62   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  121

Query  439  VDEMIREADVDGDGQINY  492
            VDEMIREAD DGDG+I+ 
Sbjct  122  VDEMIREADQDGDGRIDC  139


 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 3/76 (4%)
 Frame = +1

Query  304  MKDTDSEE---ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDG  474
            M D+ +EE   E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D 
Sbjct  1    MADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  60

Query  475  DGQINYEEFVKVMMAK  522
            +G I++ EF+ +M  K
Sbjct  61   NGTIDFPEFLTMMARK  76


 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 44/71 (62%), Gaps = 1/71 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  132

Query  252  GNGTIDFPEFP  284
            G+G ID    P
Sbjct  133  GDGRIDCTRTP  143



>emb|CAA10472.1| calmodulin-like protein CaML3 [Branchiostoma lanceolatum]
Length=151

 Score =   136 bits (343),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = +1

Query  253  GMGQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTD  432
            G G + F   L +MAR  KD + EEEL+EAF+VFDKD NG+ISAAELRHVMTNLGEKLTD
Sbjct  62   GNGTIDFPESLTMMARNKKDNNQEEELREAFKVFDKDGNGYISAAELRHVMTNLGEKLTD  121

Query  433  EEVDEMIREADVDGDGQINYEEFVKVMMAK  522
            EEVDEMIREADVDGDGQ+NY+EFV +M  K
Sbjct  122  EEVDEMIREADVDGDGQVNYQEFVSMMTEK  151


 Score =   117 bits (293),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +3

Query  78   ADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGN  257
            A+++T++QI+EFKEAFSLFDK+GDG ITT ELGTVMRSLGQNPTEAEL DM NEVDADGN
Sbjct  4    AERMTEEQIAEFKEAFSLFDKNGDGNITTGELGTVMRSLGQNPTEAELLDMANEVDADGN  63

Query  258  GTIDFPE  278
            GTIDFPE
Sbjct  64   GTIDFPE  70


 Score = 63.9 bits (154),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = +3

Query  93   DDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDF  272
            ++Q  E +EAF +FDKDG+G I+  EL  VM +LG+  T+ E+ +MI E D DG+G +++
Sbjct  82   NNQEEELREAFKVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQVNY  141

Query  273  PEF  281
             EF
Sbjct  142  QEF  144


 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 1/65 (2%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDK+ +G I+  EL  VM +LG+  T+ E+ +M  E D DG+G I++ E + 
Sbjct  14   EFKEAFSLFDKNGDGNITTGELGTVMRSLGQNPTEAELLDMANEVDADGNGTIDFPESL-  72

Query  508  VMMAK  522
             MMA+
Sbjct  73   TMMAR  77



>gb|ADN68241.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|ADN68242.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|ADN68245.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|ADN68247.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|ADN68248.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|ADN68249.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|ADN68251.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|ADN68254.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|ADN68256.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|ADN68257.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|ADN68258.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|ADN68261.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|ADN68262.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|ADN68267.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|ADN68269.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|ADN68271.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|ADN68274.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|ADN68275.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|ADN68276.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|ADN68277.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|ADN68278.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|ADN68279.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|ADN68281.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|ADN68284.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|ADN68285.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|AGI16342.1| calmodulin, partial [Colletotrichum fructicola]
 gb|AGZ20171.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|AIN40636.1| calmodulin, partial [Colletotrichum gigasporum]
 gb|AIN40637.1| calmodulin, partial [Colletotrichum gigasporum]
 gb|AIN40639.1| calmodulin, partial [Colletotrichum pseudomajus]
 gb|AIN40642.1| calmodulin, partial [Colletotrichum gigasporum]
 gb|AIN40643.1| calmodulin, partial [Colletotrichum gigasporum]
 gb|AIN40644.1| calmodulin, partial [Colletotrichum gigasporum]
 gb|AIN40646.1| calmodulin, partial [Colletotrichum gigasporum]
 gb|AIN40647.1| calmodulin, partial [Colletotrichum vietnamense]
 gb|AIN40648.1| calmodulin, partial [Colletotrichum vietnamense]
 gb|AIN40649.1| calmodulin, partial [Colletotrichum gigasporum]
 gb|AIN40650.1| calmodulin, partial [Colletotrichum gigasporum]
Length=138

 Score =   140 bits (353),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  51   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  110

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  111  VDEMIREADQDGDGRIDYNEFVQLMMQK  138


 Score =   113 bits (283),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 54/58 (93%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +3

Query  108  EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    EFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  58


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  62   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  121

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  122  GDGRIDYNEF  131


 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  1    EFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  60

Query  508  VMMAK  522
            +M  K
Sbjct  61   MMARK  65



>gb|KIE00442.1| EF-hand-like domain protein, partial [Metarhizium majus ARSEF 
297]
Length=168

 Score =   127 bits (320),  Expect(2) = 9e-59, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LT++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD 
Sbjct  1    MADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  60

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  61   NGTIDFPEF  69


 Score =   125 bits (315),  Expect(2) = 9e-59, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 78/107 (73%), Gaps = 19/107 (18%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  62   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  121

Query  439  VDEMIREADVDGDGQINY-------------------EEFVKVMMAK  522
            VDEMIREAD DGDG+I+                     EFV++MM K
Sbjct  122  VDEMIREADQDGDGRIDCIEPSSQAFQNVPLLIRLADNEFVQLMMQK  168


 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 3/76 (4%)
 Frame = +1

Query  304  MKDTDSEE---ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDG  474
            M D+ +EE   E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D 
Sbjct  1    MADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  60

Query  475  DGQINYEEFVKVMMAK  522
            +G I++ EF+ +M  K
Sbjct  61   NGTIDFPEFLTMMARK  76


 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 1/66 (2%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  132

Query  252  GNGTID  269
            G+G ID
Sbjct  133  GDGRID  138



>emb|CCD10985.2| calmodulin, partial [Aspergillus aculeatinus]
 emb|CBY85721.2| calmodulin, partial [Aspergillus pragensis]
Length=138

 Score =   134 bits (336),  Expect(2) = 9e-59, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  57   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  116

Query  439  VDEMIREADVDGDGQINYEEFV  504
            VDEMIREAD DGDG+I+Y EFV
Sbjct  117  VDEMIREADQDGDGRIDYNEFV  138


 Score =   120 bits (300),  Expect(2) = 9e-59, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +3

Query  90   TDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTID  269
            T++Q+SE+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTID
Sbjct  1    TEEQVSEYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTID  60

Query  270  FPEF  281
            FPEF
Sbjct  61   FPEF  64


 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  68   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  127

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  128  GDGRIDYNEF  137


 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  7    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  66

Query  508  VMMAK  522
            +M  K
Sbjct  67   MMARK  71



>dbj|BAE58300.1| unnamed protein product [Aspergillus oryzae RIB40]
Length=149

 Score =   141 bits (355),  Expect(2) = 9e-59, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  62   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  122  VDEMIREADQDGDGRIDYNEFVQLMMQK  149


 Score =   112 bits (280),  Expect(2) = 9e-59, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LT++Q+SE+KEAFSLF       ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD 
Sbjct  1    MADSLTEEQVSEYKEAFSLFVSSYRRQITTKELGTVMRSLGQNPSESELQDMINEVDADN  60

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  61   NGTIDFPEF  69


 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  132

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  133  GDGRIDYNEF  142


 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 44/76 (58%), Gaps = 3/76 (4%)
 Frame = +1

Query  304  MKDTDSEE---ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDG  474
            M D+ +EE   E KEAF +F       I+  EL  VM +LG+  ++ E+ +MI E D D 
Sbjct  1    MADSLTEEQVSEYKEAFSLFVSSYRRQITTKELGTVMRSLGQNPSESELQDMINEVDADN  60

Query  475  DGQINYEEFVKVMMAK  522
            +G I++ EF+ +M  K
Sbjct  61   NGTIDFPEFLTMMARK  76



>gb|ADN68243.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|ADN68244.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|ADN68250.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|ADN68252.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|ADN68253.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|ADN68255.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|ADN68260.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|ADN68263.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|ADN68268.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|ADN68270.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|ADN68272.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|ADN68273.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|ADN68280.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|ADN68288.1| calmodulin, partial [Colletotrichum acutatum]
 gb|ADN68289.1| calmodulin, partial [Colletotrichum truncatum]
 gb|AIN40641.1| calmodulin, partial [Colletotrichum gigasporum]
Length=138

 Score =   140 bits (353),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  51   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  110

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  111  VDEMIREADQDGDGRIDYNEFVQLMMQK  138


 Score =   112 bits (281),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 53/58 (91%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +3

Query  108  EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            E+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  58


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  62   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  121

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  122  GDGRIDYNEF  131


 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  1    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  60

Query  508  VMMAK  522
            +M  K
Sbjct  61   MMARK  65



>emb|CCF70746.1| calmodulin, partial [Aspergillus calidoustus]
Length=139

 Score =   134 bits (338),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  56   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  115

Query  439  VDEMIREADVDGDGQINYEEFVKV  510
            VDEMIREAD DGDG+I+Y EFV++
Sbjct  116  VDEMIREADQDGDGRIDYNEFVQL  139


 Score =   118 bits (296),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +3

Query  93   DDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDF  272
            ++Q+SE+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDF
Sbjct  1    EEQVSEYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDF  60

Query  273  PEF  281
            PEF
Sbjct  61   PEF  63


 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  67   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  126

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  127  GDGRIDYNEF  136


 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  6    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  65

Query  508  VMMAK  522
            +M  K
Sbjct  66   MMARK  70



>gb|KIX95728.1| hypothetical protein Z520_08435 [Fonsecaea multimorphosa CBS 
102226]
Length=173

 Score =   127 bits (319),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LT++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD 
Sbjct  1    MADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  60

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  61   NGTIDFPEF  69


 Score =   125 bits (314),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  62   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  121

Query  439  VDEMIREADVDGDGQIN  489
            VDEMIREAD DGDG+I+
Sbjct  122  VDEMIREADQDGDGRID  138


 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 3/76 (4%)
 Frame = +1

Query  304  MKDTDSEE---ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDG  474
            M D+ +EE   E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D 
Sbjct  1    MADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  60

Query  475  DGQINYEEFVKVMMAK  522
            +G I++ EF+ +M  K
Sbjct  61   NGTIDFPEFLTMMARK  76


 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 1/66 (2%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  132

Query  252  GNGTID  269
            G+G ID
Sbjct  133  GDGRID  138



>gb|AAS15749.1| calmodulin, partial [Penicillium rolfsii]
 gb|KFX47023.1| Calmodulin, partial [Talaromyces marneffei PM1]
Length=137

 Score =   135 bits (339),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  54   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  113

Query  439  VDEMIREADVDGDGQINYEEFVKV  510
            VDEMIREAD DGDG+I+Y EFV++
Sbjct  114  VDEMIREADQDGDGRIDYNEFVQL  137


 Score =   117 bits (294),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 55/61 (90%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +3

Query  99   QISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPE  278
            Q+SE+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPE
Sbjct  1    QVSEYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPE  60

Query  279  F  281
            F
Sbjct  61   F  61


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  65   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  124

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  125  GDGRIDYNEF  134


 Score = 58.5 bits (140),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  4    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  63

Query  508  VMMAK  522
            +M  K
Sbjct  64   MMARK  68



>ref|XP_002456511.1| hypothetical protein SORBIDRAFT_03g037630 [Sorghum bicolor]
 gb|EES01631.1| hypothetical protein SORBIDRAFT_03g037630 [Sorghum bicolor]
Length=184

 Score =   131 bits (330),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 76/89 (85%), Gaps = 1/89 (1%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKE-AFRVFDKDQNGFISAAELRHVMTNLGEKLTDE  435
            G +  Q FL LMARKMKDT+SEEE    AFRVFDKDQ+GFISAAELRHVMTNLGEKL++E
Sbjct  62   GTIDLQEFLGLMARKMKDTESEEEELREAFRVFDKDQDGFISAAELRHVMTNLGEKLSNE  121

Query  436  EVDEMIREADVDGDGQINYEEFVKVMMAK  522
            EV EMIREAD DGDG INY EFVKVMMAK
Sbjct  122  EVGEMIREADADGDGDINYAEFVKVMMAK  150


 Score =   121 bits (303),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQL++DQI+EFKEAFSLFDKD DGCITTKELGTVMRSLGQNPTEAELQDMI EVD++ 
Sbjct  1    MADQLSEDQIAEFKEAFSLFDKDDDGCITTKELGTVMRSLGQNPTEAELQDMIAEVDSNN  60

Query  255  NGTIDFPEF  281
            +GTID  EF
Sbjct  61   SGTIDLQEF  69


 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D +  G I+ +EF+ 
Sbjct  12   EFKEAFSLFDKDDDGCITTKELGTVMRSLGQNPTEAELQDMIAEVDSNNSGTIDLQEFLG  71

Query  508  VMMAK  522
            +M  K
Sbjct  72   LMARK  76


 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +3

Query  120  AFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            AF +FDKD DG I+  EL  VM +LG+  +  E+ +MI E DADG+G I++ EF
Sbjct  90   AFRVFDKDQDGFISAAELRHVMTNLGEKLSNEEVGEMIREADADGDGDINYAEF  143



>emb|CCH57529.1| calmodulin, partial [Aspergillus cibarius]
Length=138

 Score =   134 bits (337),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  56   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  115

Query  439  VDEMIREADVDGDGQINYEEFVK  507
            VDEMIREAD DGDG+I+Y EFV+
Sbjct  116  VDEMIREADQDGDGRIDYNEFVQ  138


 Score =   118 bits (295),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +3

Query  93   DDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDF  272
            ++Q+SE+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDF
Sbjct  1    EEQVSEYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDF  60

Query  273  PEF  281
            PEF
Sbjct  61   PEF  63


 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  67   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  126

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  127  GDGRIDYNEF  136


 Score = 58.2 bits (139),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  6    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  65

Query  508  VMMAK  522
            +M  K
Sbjct  66   MMARK  70



>gb|ADN68264.1| calmodulin, partial [Colletotrichum gloeosporioides]
Length=138

 Score =   139 bits (350),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE +EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  51   GTIDFPEFLTMMARKMKDTDSEEETREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  110

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  111  VDEMIREADQDGDGRIDYNEFVQLMMQK  138


 Score =   113 bits (282),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 53/58 (91%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +3

Query  108  EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            E+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  58


 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  62   MARKMKDTDSEEETREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  121

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  122  GDGRIDYNEF  131


 Score = 58.5 bits (140),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  1    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  60

Query  508  VMMAK  522
            +M  K
Sbjct  61   MMARK  65



>gb|ADN68283.1| calmodulin, partial [Colletotrichum gloeosporioides]
Length=138

 Score =   140 bits (353),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  51   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  110

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  111  VDEMIREADQDGDGRIDYNEFVQLMMQK  138


 Score =   112 bits (279),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 53/58 (91%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +3

Query  108  EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            EFKEAFSLFD+DGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    EFKEAFSLFDEDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  58


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  62   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  121

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  122  GDGRIDYNEF  131


 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FD+D +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  1    EFKEAFSLFDEDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  60

Query  508  VMMAK  522
            +M  K
Sbjct  61   MMARK  65



>emb|CCU82138.1| calmodulin [Blumeria graminis f. sp. hordei DH14]
Length=150

 Score =   128 bits (322),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LT++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD 
Sbjct  1    MADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  60

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  61   NGTIDFPEF  69


 Score =   124 bits (310),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELR+VMT++GEKLTD+E
Sbjct  62   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRYVMTSIGEKLTDDE  121

Query  439  VDEMIREADVDGDGQIN  489
            VDEMIREAD DGDG+I+
Sbjct  122  VDEMIREADQDGDGRID  138


 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 3/76 (4%)
 Frame = +1

Query  304  MKDTDSEE---ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDG  474
            M D+ +EE   E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D 
Sbjct  1    MADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN  60

Query  475  DGQINYEEFVKVMMAK  522
            +G I++ EF+ +M  K
Sbjct  61   NGTIDFPEFLTMMARK  76


 Score = 55.8 bits (133),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 1/66 (2%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  73   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRYVMTSIGEKLTDDEVDEMIREADQD  132

Query  252  GNGTID  269
            G+G ID
Sbjct  133  GDGRID  138



>gb|ADN68282.1| calmodulin, partial [Colletotrichum gloeosporioides]
Length=138

 Score =   140 bits (354),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  51   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  110

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  111  VDEMIREADQDGDGRIDYNEFVQLMMQK  138


 Score =   111 bits (278),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 53/58 (91%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +3

Query  108  EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            E+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPPESELQDMINEVDADNNGTIDFPEF  58


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  62   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  121

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  122  GDGRIDYNEF  131


 Score = 58.2 bits (139),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+   + E+ +MI E D D +G I++ EF+ 
Sbjct  1    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPPESELQDMINEVDADNNGTIDFPEFLT  60

Query  508  VMMAK  522
            +M  K
Sbjct  61   MMARK  65



>emb|CCA30569.1| calmodulin, partial [Aspergillus cibarius]
 emb|CCK73186.1| calmodulin, partial [Aspergillus fumigatus]
Length=137

 Score =   134 bits (336),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  56   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  115

Query  439  VDEMIREADVDGDGQINYEEFV  504
            VDEMIREAD DGDG+I+Y EFV
Sbjct  116  VDEMIREADQDGDGRIDYNEFV  137


 Score =   118 bits (295),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +3

Query  93   DDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDF  272
            ++Q+SE+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDF
Sbjct  1    EEQVSEYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDF  60

Query  273  PEF  281
            PEF
Sbjct  61   PEF  63


 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  67   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  126

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  127  GDGRIDYNEF  136


 Score = 58.2 bits (139),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  6    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  65

Query  508  VMMAK  522
            +M  K
Sbjct  66   MMARK  70



>gb|ADN68266.1| calmodulin, partial [Colletotrichum gloeosporioides]
Length=138

 Score =   138 bits (347),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  51   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  110

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD D DG+I+Y EFV++MM K
Sbjct  111  VDEMIREADQDSDGRIDYNEFVQLMMQK  138


 Score =   114 bits (284),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 54/58 (93%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +3

Query  108  EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    EFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  58


 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  62   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  121

Query  252  GNGTIDFPEF  281
             +G ID+ EF
Sbjct  122  SDGRIDYNEF  131


 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  1    EFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  60

Query  508  VMMAK  522
            +M  K
Sbjct  61   MMARK  65



>gb|AIN40651.1| calmodulin, partial [Colletotrichum arxii]
Length=138

 Score =   140 bits (353),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  51   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  110

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  111  VDEMIREADQDGDGRIDYNEFVQLMMQK  138


 Score =   111 bits (278),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 53/58 (91%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +3

Query  108  EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            EFKEAFSLF KDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    EFKEAFSLFHKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  58


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  62   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  121

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  122  GDGRIDYNEF  131


 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +F KD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  1    EFKEAFSLFHKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  60

Query  508  VMMAK  522
            +M  K
Sbjct  61   MMARK  65



>gb|ADN68265.1| calmodulin, partial [Colletotrichum gloeosporioides]
Length=138

 Score =   140 bits (354),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  51   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  110

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  111  VDEMIREADQDGDGRIDYNEFVQLMMQK  138


 Score =   110 bits (276),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 52/58 (90%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +3

Query  108  EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            E+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD +GTIDFPEF
Sbjct  1    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNSGTIDFPEF  58


 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  62   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  121

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  122  GDGRIDYNEF  131


 Score = 57.8 bits (138),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D  G I++ EF+ 
Sbjct  1    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNSGTIDFPEFLT  60

Query  508  VMMAK  522
            +M  K
Sbjct  61   MMARK  65



>gb|KEQ66637.1| EF-hand protein [Aureobasidium melanogenum CBS 110374]
Length=142

 Score =   141 bits (355),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  55   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  114

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  115  VDEMIREADQDGDGRIDYNEFVQLMMQK  142


 Score =   110 bits (275),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 60/69 (87%), Gaps = 7/69 (10%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LT++Q+SEFKEAFSLF       ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD 
Sbjct  1    MADSLTEEQVSEFKEAFSLF-------ITTKELGTVMRSLGQNPSESELQDMINEVDADN  53

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  54   NGTIDFPEF  62


 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  66   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  125

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  126  GDGRIDYNEF  135



>gb|AIB03824.1| calmodulin, partial [Epichloe bromicola]
 gb|AIB03825.1| calmodulin, partial [Epichloe uncinata]
 gb|AIB03826.1| calmodulin, partial [Epichloe festucae]
 gb|AIB03827.1| calmodulin, partial [Epichloe festucae]
 gb|AIB03830.1| calmodulin, partial [Epichloe tembladerae]
 gb|AIB03831.1| calmodulin, partial [Epichloe tembladerae]
 gb|AIB03832.1| calmodulin, partial [Epichloe tembladerae]
 gb|AIB03833.1| calmodulin, partial [Epichloe tembladerae]
 gb|AIB03834.1| calmodulin, partial [Epichloe tembladerae]
 gb|AIB03835.1| calmodulin, partial [Epichloe tembladerae]
 gb|AIB03836.1| calmodulin, partial [Epichloe tembladerae]
 gb|AIB03837.1| calmodulin, partial [Epichloe tembladerae]
 gb|AIB03838.1| calmodulin, partial [Epichloe tembladerae]
 gb|AIB03839.1| calmodulin, partial [Epichloe tembladerae]
 gb|AIB03841.1| calmodulin, partial [Epichloe tembladerae]
 gb|AIB03842.1| calmodulin, partial [Epichloe tembladerae]
 gb|AIB03843.1| calmodulin, partial [Epichloe tembladerae]
 gb|AIB03844.1| calmodulin, partial [Epichloe tembladerae]
 gb|AIB03845.1| calmodulin, partial [Epichloe tembladerae]
 gb|AIB03846.1| calmodulin, partial [Epichloe tembladerae]
 gb|AIB03847.1| calmodulin, partial [Epichloe tembladerae]
 gb|AIB03848.1| calmodulin, partial [Epichloe tembladerae]
 gb|AIB03849.1| calmodulin, partial [Epichloe cabralii]
 gb|AIB03850.1| calmodulin, partial [Epichloe cabralii]
 gb|AIB03851.1| calmodulin, partial [Epichloe cabralii]
 gb|AIB03852.1| calmodulin, partial [Epichloe cabralii]
 gb|AIB03853.1| calmodulin, partial [Epichloe cabralii]
 gb|AIB03854.1| calmodulin, partial [Epichloe cabralii]
 gb|AIB03855.1| calmodulin, partial [Epichloe cabralii]
 gb|AIB03856.1| calmodulin, partial [Epichloe cabralii]
 gb|AIB03857.1| calmodulin, partial [Epichloe cabralii]
 gb|AIB03858.1| calmodulin, partial [Epichloe cabralii]
 gb|AIB03859.1| calmodulin, partial [Epichloe typhina]
 gb|AIB03860.1| calmodulin, partial [Epichloe typhina]
 gb|AIB03861.1| calmodulin, partial [Epichloe coenophiala]
 gb|AIB03862.1| calmodulin, partial [Epichloe coenophiala]
 gb|AIB03863.1| calmodulin, partial [Epichloe coenophiala]
 gb|AIB03864.1| calmodulin, partial [Epichloe sylvatica]
 gb|AIB03866.1| calmodulin, partial [Epichloe typhina]
 gb|AIB03867.1| calmodulin, partial [Epichloe pampeana]
 gb|AIB03868.1| calmodulin, partial [Epichloe pampeana]
 gb|AIB03869.1| calmodulin, partial [Epichloe tembladerae]
 gb|AIB03870.1| calmodulin, partial [Epichloe tembladerae]
 gb|AIB03871.1| calmodulin, partial [Epichloe tembladerae]
 gb|AIB03872.1| calmodulin, partial [Epichloe tembladerae]
 gb|AIB03873.1| calmodulin, partial [Epichloe tembladerae]
 gb|AIB03874.1| calmodulin, partial [Epichloe tembladerae]
 gb|AIB03875.1| calmodulin, partial [Epichloe tembladerae]
 gb|AIB03876.1| calmodulin, partial [Epichloe tembladerae]
 gb|AIB03877.1| calmodulin, partial [Epichloe tembladerae]
 gb|AIB03878.1| calmodulin, partial [Epichloe tembladerae]
 gb|AIB03879.1| calmodulin, partial [Epichloe tembladerae]
 gb|AIB03880.1| calmodulin, partial [Epichloe tembladerae]
 gb|AIB03881.1| calmodulin, partial [Epichloe tembladerae]
 gb|AIB03882.1| calmodulin, partial [Epichloe tembladerae]
 gb|AIB03883.1| calmodulin, partial [Epichloe tembladerae]
 gb|AIB03884.1| calmodulin, partial [Epichloe tembladerae]
 gb|AIB03885.1| calmodulin, partial [Epichloe tembladerae]
 gb|AIB03886.1| calmodulin, partial [Epichloe tembladerae]
 gb|AIB03887.1| calmodulin, partial [Epichloe tembladerae]
 gb|AIB03888.1| calmodulin, partial [Epichloe cabralii]
 gb|AIB03889.1| calmodulin, partial [Epichloe cabralii]
 gb|AIB03890.1| calmodulin, partial [Epichloe cabralii]
 gb|AIB03891.1| calmodulin, partial [Epichloe cabralii]
 gb|AIB03892.1| calmodulin, partial [Epichloe cabralii]
 gb|AIB03893.1| calmodulin, partial [Epichloe cabralii]
 gb|AIB03894.1| calmodulin, partial [Epichloe cabralii]
 gb|AIB03895.1| calmodulin, partial [Epichloe cabralii]
 gb|AIB03896.1| calmodulin, partial [Epichloe cabralii]
 gb|AIB03897.1| calmodulin, partial [Epichloe cabralii]
 gb|AIB03898.1| calmodulin, partial [Epichloe uncinata]
 gb|AIB03899.1| calmodulin, partial [Epichloe amarillans]
 gb|AIB03900.1| calmodulin, partial [Epichloe amarillans]
 gb|AIB03901.1| calmodulin, partial [Epichloe baconii]
 gb|AIB03902.1| calmodulin, partial [Epichloe typhina var. aonikenkana]
 gb|AIB03903.1| calmodulin, partial [Epichloe typhina var. aonikenkana]
 gb|AIB03904.1| calmodulin, partial [Epichloe typhina var. aonikenkana]
 gb|AIB03905.1| calmodulin, partial [Epichloe typhina var. aonikenkana]
 gb|AIB03906.1| calmodulin, partial [Epichloe typhina var. aonikenkana]
 gb|AIB03907.1| calmodulin, partial [Epichloe typhina var. aonikenkana]
 gb|AIB03908.1| calmodulin, partial [Epichloe typhina var. aonikenkana]
 gb|AII23421.1| calmodulin, partial [Epichloe cabralii]
 gb|AII23422.1| calmodulin, partial [Epichloe cabralii]
Length=137

 Score =   125 bits (315),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +3

Query  78   ADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGN  257
            AD LT++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD N
Sbjct  1    ADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNN  60

Query  258  GTIDFPEF  281
            GTIDFPEF
Sbjct  61   GTIDFPEF  68


 Score =   125 bits (314),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  61   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  120

Query  439  VDEMIREADVDGDGQIN  489
            VDEMIREAD DGDG+I+
Sbjct  121  VDEMIREADQDGDGRID  137


 Score = 58.9 bits (141),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  11   EFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  70

Query  508  VMMAK  522
            +M  K
Sbjct  71   MMARK  75


 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 1/66 (2%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  72   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  131

Query  252  GNGTID  269
            G+G ID
Sbjct  132  GDGRID  137



>gb|AAS15750.1| calmodulin, partial [Penicillium manginii]
 gb|AAS15751.1| calmodulin, partial [Penicillium waksmanii]
 gb|AAS15752.1| calmodulin, partial [Penicillium miczynskii]
 gb|AAS15753.1| calmodulin, partial [Penicillium decaturense]
 gb|AAS15754.1| calmodulin, partial [Penicillium decaturense]
 gb|AAS15755.1| calmodulin, partial [Penicillium miczynskii]
 gb|AAS15756.1| calmodulin, partial [Penicillium decaturense]
 gb|AAS15757.1| calmodulin, partial [Penicillium decaturense]
 gb|AAS15758.1| calmodulin, partial [Penicillium sp. 29685]
 gb|AAS15759.1| calmodulin, partial [Penicillium decaturense]
 gb|AAS15760.1| calmodulin, partial [Penicillium sp. 29736]
 gb|AAS15761.1| calmodulin, partial [Penicillium decaturense]
 gb|AAS15762.1| calmodulin, partial [Penicillium decaturense]
 gb|AAS15763.1| calmodulin, partial [Penicillium decaturense]
 gb|AAS15764.1| calmodulin, partial [Penicillium waksmanii]
 gb|AAS15765.1| calmodulin, partial [Penicillium chrzaszczii]
 gb|AAS15766.1| calmodulin, partial [Penicillium rivolii]
Length=137

 Score =   133 bits (335),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKL+D+E
Sbjct  54   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLSDDE  113

Query  439  VDEMIREADVDGDGQINYEEFVKV  510
            VDEMIREAD DGDG+I+Y EFV++
Sbjct  114  VDEMIREADQDGDGRIDYNEFVQL  137


 Score =   117 bits (294),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 55/61 (90%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +3

Query  99   QISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPE  278
            Q+SE+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPE
Sbjct  1    QVSEYKEAFSLFDKDGDGEITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPE  60

Query  279  F  281
            F
Sbjct  61   F  61


 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  ++ E+ +MI E D D
Sbjct  65   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLSDDEVDEMIREADQD  124

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  125  GDGRIDYNEF  134


 Score = 58.2 bits (139),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  4    EYKEAFSLFDKDGDGEITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  63

Query  508  VMMAK  522
            +M  K
Sbjct  64   MMARK  68



>gb|ADN68287.1| calmodulin, partial [Colletotrichum acutatum]
Length=138

 Score =   139 bits (349),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT +GEKLTD+E
Sbjct  51   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTPIGEKLTDDE  110

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIRE D DGDG+I+Y EFV++MM K
Sbjct  111  VDEMIREPDQDGDGRIDYNEFVQLMMQK  138


 Score =   112 bits (280),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 53/58 (91%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +3

Query  108  EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            E+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  58


 Score = 58.5 bits (140),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM  +G+  T+ E+ +MI E D D
Sbjct  62   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTPIGEKLTDDEVDEMIREPDQD  121

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  122  GDGRIDYNEF  131


 Score = 58.5 bits (140),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  1    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  60

Query  508  VMMAK  522
            +M  K
Sbjct  61   MMARK  65



>gb|ABQ00494.1| calmodulin, partial [Geosmithia sp. NRRL 35616]
 gb|ABQ00512.1| calmodulin, partial [Geosmithia sp. NRRL 35677]
 gb|ABQ00513.1| calmodulin, partial [Geosmithia sp. NRRL 35678]
Length=134

 Score =   133 bits (334),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTDEE
Sbjct  54   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDEE  113

Query  439  VDEMIREADVDGDGQINYEEF  501
            VDEMIREAD DGDG+I+Y EF
Sbjct  114  VDEMIREADQDGDGRIDYNEF  134


 Score =   117 bits (294),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 55/61 (90%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +3

Query  99   QISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPE  278
            Q+SE+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPE
Sbjct  1    QVSEYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPE  60

Query  279  F  281
            F
Sbjct  61   F  61


 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  65   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDEEVDEMIREADQD  124

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  125  GDGRIDYNEF  134


 Score = 58.2 bits (139),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  4    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  63

Query  508  VMMAK  522
            +M  K
Sbjct  64   MMARK  68



>gb|AFK30325.1| calmodulin, partial [Colletotrichum brevisporum]
Length=138

 Score =   140 bits (353),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  51   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  110

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  111  VDEMIREADQDGDGRIDYNEFVQLMMQK  138


 Score =   110 bits (275),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 52/58 (90%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +3

Query  108  EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            E+KEAFSLFDKDGDG ITTKE GTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    EYKEAFSLFDKDGDGQITTKEHGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  58


 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  62   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  121

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  122  GDGRIDYNEF  131


 Score = 55.8 bits (133),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  E   VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  1    EYKEAFSLFDKDGDGQITTKEHGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  60

Query  508  VMMAK  522
            +M  K
Sbjct  61   MMARK  65



>gb|AIA77819.1| calmodulin, partial [Aspergillus carbonarius]
Length=137

 Score =   137 bits (346),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  51   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  110

Query  439  VDEMIREADVDGDGQINYEEFVKVMMA  519
            VDEMIREAD DGDG+I+Y EFV++M A
Sbjct  111  VDEMIREADQDGDGRIDYNEFVQLMNA  137


 Score =   112 bits (281),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 53/58 (91%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +3

Query  108  EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            E+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  58


 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  62   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  121

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  122  GDGRIDYNEF  131


 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  1    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  60

Query  508  VMMAK  522
            +M  K
Sbjct  61   MMARK  65



>gb|ADN68259.1| calmodulin, partial [Colletotrichum gloeosporioides]
Length=138

 Score =   140 bits (353),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  51   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  110

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  111  VDEMIREADQDGDGRIDYNEFVQLMMQK  138


 Score =   110 bits (274),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 52/58 (90%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +3

Query  108  EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            E+KEAFSLFDKDGD  ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    EYKEAFSLFDKDGDDQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  58


 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  62   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  121

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  122  GDGRIDYNEF  131


 Score = 55.5 bits (132),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +  I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  1    EYKEAFSLFDKDGDDQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  60

Query  508  VMMAK  522
            +M  K
Sbjct  61   MMARK  65



>ref|XP_005670261.1| PREDICTED: calmodulin-like [Sus scrofa]
Length=196

 Score =   136 bits (342),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G+  F  FL +MARKMKDTDSEEE++EAF VF+KD N +ISAAEL HVMTNLGEKLTDEE
Sbjct  62   GETDFLEFLTMMARKMKDTDSEEEIREAFHVFEKDDNSYISAAELHHVMTNLGEKLTDEE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMI+EAD DGDGQ+++EE VK+M AK
Sbjct  122  VDEMIKEADSDGDGQVDHEELVKMMTAK  149


 Score =   114 bits (285),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 56/69 (81%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLT++QI+EFKEAFSLFDKDGDG ITTKEL TV+RSLGQN TEAELQDMI+EVD D 
Sbjct  1    MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELVTVLRSLGQNLTEAELQDMIHEVDVDS  60

Query  255  NGTIDFPEF  281
            NG  DF EF
Sbjct  61   NGETDFLEF  69


 Score = 61.6 bits (148),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  V+ +LG+ LT+ E+ +MI E DVD +G+ ++ EF+ 
Sbjct  12   EFKEAFSLFDKDGDGTITTKELVTVLRSLGQNLTEAELQDMIHEVDVDSNGETDFLEFLT  71

Query  508  VMMAK  522
            +M  K
Sbjct  72   MMARK  76


 Score = 56.2 bits (134),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 44/70 (63%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +F+KD +  I+  EL  VM +LG+  T+ E+ +MI E D+D
Sbjct  73   MARKMKDTDSEEEIREAFHVFEKDDNSYISAAELHHVMTNLGEKLTDEEVDEMIKEADSD  132

Query  252  GNGTIDFPEF  281
            G+G +D  E 
Sbjct  133  GDGQVDHEEL  142



>gb|ADN68246.1| calmodulin, partial [Colletotrichum gloeosporioides]
Length=138

 Score =   137 bits (346),  Expect(2) = 9e-58, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++G KLTD+E
Sbjct  51   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGGKLTDDE  110

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  111  VDEMIREADQDGDGRIDYNEFVQLMMQK  138


 Score =   112 bits (281),  Expect(2) = 9e-58, Method: Compositional matrix adjust.
 Identities = 53/58 (91%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +3

Query  108  EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            E+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  58


 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G   T+ E+ +MI E D D
Sbjct  62   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGGKLTDDEVDEMIREADQD  121

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  122  GDGRIDYNEF  131


 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  1    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  60

Query  508  VMMAK  522
            +M  K
Sbjct  61   MMARK  65



>emb|CCM43805.1| Calmodulin, partial [Aspergillus sp. ITEM 14783]
Length=135

 Score =   139 bits (349),  Expect(2) = 9e-58, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  50   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  109

Query  439  VDEMIREADVDGDGQINYEEFVKVMM  516
            VDEMIREAD DGDG+I+Y EFV++MM
Sbjct  110  VDEMIREADQDGDGRIDYNEFVQLMM  135


 Score =   112 bits (279),  Expect(2) = 9e-58, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  111  FKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            FKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    FKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  57


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  61   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  120

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  121  GDGRIDYNEF  130


 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = +1

Query  331  LKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKV  510
             KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ +
Sbjct  1    FKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLTM  60

Query  511  MMAK  522
            M  K
Sbjct  61   MARK  64



>gb|ADN68286.1| calmodulin, partial [Colletotrichum acutatum]
Length=138

 Score =   137 bits (346),  Expect(2) = 9e-58, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  51   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  110

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD  GDG+I+Y EFV++MM K
Sbjct  111  VDEMIREADQGGDGRIDYNEFVQLMMQK  138


 Score =   112 bits (281),  Expect(2) = 9e-58, Method: Compositional matrix adjust.
 Identities = 53/58 (91%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +3

Query  108  EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            E+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  58


 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D  
Sbjct  62   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQG  121

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  122  GDGRIDYNEF  131


 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  1    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  60

Query  508  VMMAK  522
            +M  K
Sbjct  61   MMARK  65



>gb|ABS31365.1| calmodulin, partial [Aspergillus peyronelii]
 gb|AEO13254.1| calmodulin [Aspergillus minisclerotigenes]
 gb|AEO13260.1| calmodulin [Aspergillus minisclerotigenes]
Length=134

 Score =   132 bits (331),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  54   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  113

Query  439  VDEMIREADVDGDGQINYEEF  501
            VDEMIREAD DGDG+I+Y EF
Sbjct  114  VDEMIREADQDGDGRIDYNEF  134


 Score =   118 bits (296),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 56/61 (92%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +3

Query  99   QISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPE  278
            Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPE
Sbjct  1    QVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPE  60

Query  279  F  281
            F
Sbjct  61   F  61


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  65   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  124

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  125  GDGRIDYNEF  134


 Score = 58.5 bits (140),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  4    EFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  63

Query  508  VMMAK  522
            +M  K
Sbjct  64   MMARK  68



>gb|AGR66889.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|AGR66890.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|AGR66891.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|AGR66892.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|AGR66893.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|AGR66894.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|AGR66895.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|AGR66897.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|AGR66898.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|AGR66899.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|AGR66900.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|AGR66901.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|AGR66902.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|AGR66903.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|AGR66904.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|AGR66905.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|AGR66906.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|AGR66908.1| calmodulin, partial [Colletotrichum fructicola]
 gb|AGR66909.1| calmodulin, partial [Colletotrichum fructicola]
 gb|AGR66910.1| calmodulin, partial [Colletotrichum fructicola]
 gb|AGR66911.1| calmodulin, partial [Colletotrichum fructicola]
 gb|AGR66912.1| calmodulin, partial [Colletotrichum fructicola]
 gb|AGR66913.1| calmodulin, partial [Colletotrichum karstii]
 gb|AGR66914.1| calmodulin, partial [Colletotrichum karstii]
 gb|AGR66915.1| calmodulin, partial [Colletotrichum karstii]
 gb|AGR66916.1| calmodulin, partial [Colletotrichum karstii]
 gb|AGR66917.1| calmodulin, partial [Colletotrichum karstii]
 gb|AGR66918.1| calmodulin, partial [Colletotrichum karstii]
 gb|AGR66922.1| calmodulin, partial [Colletotrichum truncatum]
 gb|AGR66923.1| calmodulin, partial [Colletotrichum truncatum]
 gb|AGR66926.1| calmodulin, partial [Colletotrichum citri]
 gb|AJE68977.1| calmodulin, partial [Colletotrichum siamense]
 gb|AJE68978.1| calmodulin, partial [Colletotrichum siamense]
Length=136

 Score =   140 bits (353),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  49   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  108

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  109  VDEMIREADQDGDGRIDYNEFVQLMMQK  136


 Score =   109 bits (273),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +3

Query  114  KEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    KEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  56


 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  60   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  119

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  120  GDGRIDYNEF  129


 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +1

Query  334  KEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVM  513
            KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ +M
Sbjct  1    KEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLTMM  60

Query  514  MAK  522
              K
Sbjct  61   ARK  63



>gb|AIB03865.1| calmodulin, partial [Epichloe typhina]
Length=137

 Score =   125 bits (315),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +3

Query  78   ADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGN  257
            AD LT++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD N
Sbjct  1    ADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNN  60

Query  258  GTIDFPEF  281
            GTIDFPEF
Sbjct  61   GTIDFPEF  68


 Score =   124 bits (311),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  61   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  120

Query  439  VDEMIREADVDGDGQIN  489
            VDEMIREAD DGDG I+
Sbjct  121  VDEMIREADQDGDGGID  137


 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  11   EFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  70

Query  508  VMMAK  522
            +M  K
Sbjct  71   MMARK  75


 Score = 55.8 bits (133),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 1/66 (2%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  72   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  131

Query  252  GNGTID  269
            G+G ID
Sbjct  132  GDGGID  137



>emb|CCF55025.1| calmodulin, partial [Aspergillus puniceus]
Length=136

 Score =   132 bits (331),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  56   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  115

Query  439  VDEMIREADVDGDGQINYEEF  501
            VDEMIREAD DGDG+I+Y EF
Sbjct  116  VDEMIREADQDGDGRIDYNEF  136


 Score =   118 bits (295),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +3

Query  93   DDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDF  272
            ++Q+SE+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDF
Sbjct  1    EEQVSEYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDF  60

Query  273  PEF  281
            PEF
Sbjct  61   PEF  63


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  67   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  126

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  127  GDGRIDYNEF  136


 Score = 58.2 bits (139),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  6    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  65

Query  508  VMMAK  522
            +M  K
Sbjct  66   MMARK  70



>gb|AJA71496.1| calmodulin, partial [Colletotrichum sp. BW-2014]
Length=135

 Score =   136 bits (343),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  51   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  110

Query  439  VDEMIREADVDGDGQINYEEFVKVM  513
            VDEMIREAD DGDG+I+Y EFV++M
Sbjct  111  VDEMIREADQDGDGRIDYNEFVQLM  135


 Score =   113 bits (283),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 54/58 (93%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +3

Query  108  EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    EFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  58


 Score = 61.2 bits (147),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  62   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  121

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  122  GDGRIDYNEF  131


 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  1    EFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  60

Query  508  VMMAK  522
            +M  K
Sbjct  61   MMARK  65



>gb|ADE19215.1| calmodulin, partial [Penicillium megasporum]
 gb|ADE19216.1| calmodulin, partial [Penicillium megasporum]
 gb|ADE19217.1| calmodulin, partial [Penicillium giganteum]
Length=134

 Score =   132 bits (331),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  54   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  113

Query  439  VDEMIREADVDGDGQINYEEF  501
            VDEMIREAD DGDG+I+Y EF
Sbjct  114  VDEMIREADQDGDGKIDYNEF  134


 Score =   117 bits (294),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 55/61 (90%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +3

Query  99   QISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPE  278
            Q+SE+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPE
Sbjct  1    QVSEYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPE  60

Query  279  F  281
            F
Sbjct  61   F  61


 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  65   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  124

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  125  GDGKIDYNEF  134


 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  4    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  63

Query  508  VMMAK  522
            +M  K
Sbjct  64   MMARK  68



>gb|ABU62610.1| calmodulin, partial [Penicillium parvulum]
 gb|ABU62611.1| calmodulin, partial [Penicillium parvulum]
 gb|ABU62612.1| calmodulin, partial [Penicillium cinnamopurpureum]
 gb|ABU62613.1| calmodulin, partial [Penicillium cinnamopurpureum]
 gb|ABU62614.1| calmodulin, partial [Penicillium cinnamopurpureum]
 gb|ABU62622.1| calmodulin, partial [Penicillium georgiense]
 dbj|BAP47316.1| calmodulin, partial [Aspergillus tubingensis]
 dbj|BAP47318.1| calmodulin, partial [Aspergillus terreus]
 dbj|BAP47320.1| calmodulin, partial [Aspergillus terreus]
Length=135

 Score =   132 bits (331),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  55   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  114

Query  439  VDEMIREADVDGDGQINYEEF  501
            VDEMIREAD DGDG+I+Y EF
Sbjct  115  VDEMIREADQDGDGRIDYNEF  135


 Score =   117 bits (294),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +3

Query  96   DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFP  275
            +Q+SE+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFP
Sbjct  1    EQVSEYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFP  60

Query  276  EF  281
            EF
Sbjct  61   EF  62


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  66   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  125

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  126  GDGRIDYNEF  135


 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  5    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  64

Query  508  VMMAK  522
            +M  K
Sbjct  65   MMARK  69



>ref|XP_006420057.1| hypothetical protein CICLE_v10006151mg [Citrus clementina]
 ref|XP_006489478.1| PREDICTED: calmodulin-like protein 8-like [Citrus sinensis]
 gb|ESR33297.1| hypothetical protein CICLE_v10006151mg [Citrus clementina]
 gb|KDO53966.1| hypothetical protein CISIN_1g031903mg [Citrus sinensis]
Length=150

 Score =   140 bits (354),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FLNLMA+KMK+TD+EEELKEAF+VFDKDQNG+ISA ELRHVM NLGEKLTD+E
Sbjct  62   GTIEFGEFLNLMAKKMKETDAEEELKEAFKVFDKDQNGYISATELRHVMINLGEKLTDDE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMA  519
            V++MI EAD+DGDGQ+NY+EFVK+MM 
Sbjct  122  VEQMINEADLDGDGQVNYDEFVKMMMT  148


 Score =   108 bits (271),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            M++ LT++QI EFKEAF LFDKDGDGCIT +EL TV+RSL QNPTE ELQDMINEVD+D 
Sbjct  1    MSEVLTNEQIVEFKEAFCLFDKDGDGCITVEELATVIRSLDQNPTEEELQDMINEVDSDR  60

Query  255  NGTIDFPEF  281
            NGTI+F EF
Sbjct  61   NGTIEFGEF  69


 Score = 61.2 bits (147),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +3

Query  108  EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            E KEAF +FDKD +G I+  EL  VM +LG+  T+ E++ MINE D DG+G +++ EF
Sbjct  85   ELKEAFKVFDKDQNGYISATELRHVMINLGEKLTDDEVEQMINEADLDGDGQVNYDEF  142


 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  V+ +L +  T+EE+ +MI E D D +G I + EF+ 
Sbjct  12   EFKEAFCLFDKDGDGCITVEELATVIRSLDQNPTEEELQDMINEVDSDRNGTIEFGEFLN  71

Query  508  VMMAK  522
            +M  K
Sbjct  72   LMAKK  76



>gb|ABG36555.1| calmodulin, partial [Penicillium olsonii]
 gb|ABG36556.1| calmodulin, partial [Penicillium sp. NRRL 35611]
 gb|ABG36557.1| calmodulin, partial [Penicillium neocrassum]
 gb|ABG36558.1| calmodulin, partial [Penicillium sp. NRRL 35648]
 gb|ABQ00446.1| calmodulin, partial [Penicillium meleagrinum var. viridiflavum]
 gb|ABQ00447.1| calmodulin, partial [Penicillium meleagrinum var. viridiflavum]
 gb|ABQ00448.1| calmodulin, partial [Penicillium meleagrinum var. viridiflavum]
 gb|ABQ00449.1| calmodulin, partial [Penicillium meleagrinum var. viridiflavum]
 gb|ABQ00450.1| calmodulin, partial [Penicillium meleagrinum var. viridiflavum]
 gb|ABQ00451.1| calmodulin, partial [Penicillium meleagrinum var. viridiflavum]
 gb|ABQ00452.1| calmodulin, partial [Penicillium meleagrinum var. viridiflavum]
 gb|ABQ00454.1| calmodulin, partial [Penicillium meleagrinum var. viridiflavum]
 gb|ABQ00455.1| calmodulin, partial [Penicillium sumatrense]
 gb|ABQ00493.1| calmodulin, partial [Penicillium sp. NRRL 35613]
 gb|ABQ00495.1| calmodulin, partial [Talaromyces variabilis]
 gb|ABQ00496.1| calmodulin, partial [Penicillium novae-zeelandiae]
 gb|ABQ00497.1| calmodulin, partial [Penicillium fellutanum]
 gb|ABQ00499.1| calmodulin, partial [Penicillium glabrum]
 gb|ABQ00500.1| calmodulin, partial [Penicillium fellutanum]
 gb|ABQ00501.1| calmodulin, partial [Penicillium sp. NRRL 35623]
 gb|ABQ00502.1| calmodulin, partial [Aspergillus bridgeri]
 gb|ABQ00503.1| calmodulin, partial [Penicillium steckii]
 gb|ABQ00504.1| calmodulin, partial [Penicillium glabrum]
 gb|ABQ00505.1| calmodulin, partial [Penicillium citreonigrum]
 gb|ABQ00506.1| calmodulin, partial [Penicillium angulare]
 gb|ABQ00507.1| calmodulin, partial [Penicillium angulare]
 gb|ABQ00508.1| calmodulin, partial [Penicillium janthinellum]
 gb|ABQ00509.1| calmodulin, partial [Penicillium chrysogenum]
 gb|ABQ00511.1| calmodulin, partial [Penicillium sp. NRRL 35637]
 gb|ABQ00549.1| calmodulin, partial [Penicillium citreonigrum]
 gb|ABQ00550.1| calmodulin, partial [Penicillium citreonigrum]
 gb|ABQ00551.1| calmodulin, partial [Penicillium citreonigrum]
 gb|ABQ00552.1| calmodulin, partial [Penicillium citreonigrum]
 gb|ABQ00553.1| calmodulin, partial [Penicillium toxicarium]
 gb|ABQ00554.1| calmodulin, partial [Penicillium toxicarium]
 gb|ABQ00555.1| calmodulin, partial [Penicillium toxicarium]
 gb|ABQ00556.1| calmodulin, partial [Penicillium toxicarium]
 gb|ABQ00557.1| calmodulin, partial [Penicillium toxicarium]
 gb|ABQ00558.1| calmodulin, partial [Penicillium toxicarium]
 gb|ABQ00559.1| calmodulin, partial [Penicillium toxicarium]
 gb|ABQ00560.1| calmodulin, partial [Penicillium toxicarium]
 gb|ABQ00561.1| calmodulin, partial [Penicillium toxicarium]
 gb|ABQ00562.1| calmodulin, partial [Penicillium toxicarium]
 gb|ABQ00563.1| calmodulin, partial [Penicillium toxicarium]
 gb|ABQ00564.1| calmodulin, partial [Penicillium toxicarium]
 gb|ABQ00565.1| calmodulin, partial [Penicillium toxicarium]
 gb|ABQ00566.1| calmodulin, partial [Penicillium toxicarium]
 gb|ABQ00567.1| calmodulin, partial [Penicillium toxicarium]
 gb|ABQ00568.1| calmodulin, partial [Penicillium toxicarium]
 gb|ABS29361.1| calmodulin, partial [Aspergillus campestris]
 gb|ABS29362.1| calmodulin, partial [Aspergillus janus]
 gb|ABS29363.1| calmodulin, partial [Aspergillus terreus]
 gb|ABS29364.1| calmodulin, partial [Aspergillus terreus]
 gb|ABS29365.1| calmodulin, partial [Aspergillus carneus]
 gb|ABS29366.1| calmodulin, partial [Aspergillus brevijanus]
 gb|ABS29368.1| calmodulin, partial [Aspergillus niveus]
 gb|ABS29369.1| calmodulin, partial [Aspergillus terreus]
 gb|ABS29370.1| calmodulin, partial [Aspergillus terreus]
 gb|ABS29371.1| calmodulin, partial [Aspergillus terreus]
 gb|ABS29372.1| calmodulin, partial [Aspergillus flavipes]
 gb|ABS29373.1| calmodulin, partial [Aspergillus alabamensis]
 gb|ABS29374.1| calmodulin, partial [Aspergillus carneus]
 gb|ABS29375.1| calmodulin, partial [Aspergillus flavipes]
 gb|ABS29376.1| calmodulin, partial [Aspergillus candidus]
 gb|ABS29378.1| calmodulin, partial [Aspergillus candidus]
 gb|ABS29379.1| calmodulin, partial [Aspergillus sp. NRRL 32683]
 gb|ABS29380.1| calmodulin, partial [Aspergillus iizukae]
 gb|ABS29381.1| calmodulin, partial [Aspergillus iizukae]
 gb|ABS29382.1| calmodulin, partial [Aspergillus terreus]
 gb|ABS29383.1| calmodulin, partial [Aspergillus allahabadii]
 gb|ABS29384.1| calmodulin, partial [Aspergillus flavipes]
 gb|ABS29385.1| calmodulin, partial [Aspergillus allahabadii]
 gb|ABS29386.1| calmodulin, partial [Aspergillus flavipes]
 gb|ABS29387.1| calmodulin, partial [Aspergillus terreus]
 gb|ABS29388.1| calmodulin, partial [Aspergillus sp. NRRL 4610]
 gb|ABS29389.1| calmodulin, partial [Aspergillus candidus]
 gb|ABS29390.1| calmodulin, partial [Aspergillus ambiguus]
 gb|ABS29391.1| calmodulin, partial [Aspergillus microcysticus]
 gb|ABS29392.1| calmodulin, partial [Aspergillus niveus]
 gb|ABS29393.1| calmodulin, partial [Aspergillus candidus]
 gb|ABS29394.1| calmodulin, partial [Aspergillus niveus]
 gb|ABS29395.1| calmodulin, partial [Aspergillus carneus]
 gb|ABS29396.1| calmodulin, partial [Aspergillus niveus]
 gb|ABS29397.1| calmodulin, partial [Aspergillus niveus]
 gb|ABS29398.1| calmodulin, partial [Aspergillus niveus]
 gb|ABS29399.1| calmodulin, partial [Aspergillus niveus]
 gb|ABS29400.1| calmodulin, partial [Aspergillus niveus]
 gb|ABS29401.1| calmodulin, partial [Aspergillus luppii]
 gb|ABS29402.1| calmodulin, partial [Aspergillus terreus]
 gb|ABS31354.1| calmodulin, partial [Sclerocleista thaxteri]
 gb|ABS31355.1| calmodulin, partial [Sclerocleista thaxteri]
 gb|ABS31356.1| calmodulin, partial [Sclerocleista ornata]
 gb|ABS31357.1| calmodulin, partial [Sclerocleista ornata]
 gb|ABS31358.1| calmodulin, partial [Aspergillus paradoxus]
 gb|ABS31359.1| calmodulin, partial [Hemicarpenteles paradoxus]
 gb|ABS31360.1| calmodulin, partial [Hemicarpenteles paradoxus]
 gb|ABS31361.1| calmodulin, partial [Aspergillus crystallinus]
 gb|ABS31362.1| calmodulin, partial [Aspergillus malodoratus]
 gb|ABS31363.1| calmodulin, partial [Penicilliopsis clavariiformis]
 gb|ABS31364.1| calmodulin, partial [Warcupiella spinulosa]
 gb|ABS31366.1| calmodulin, partial [Aspergillus clavatoflavus]
 gb|ABS31367.1| calmodulin, partial [Aspergillus zonatus]
 gb|ABU62615.1| calmodulin, partial [Penicillium cinnamopurpureum]
 gb|ABU62616.1| calmodulin, partial [Penicillium griseolum]
 gb|ABU62623.1| calmodulin, partial [Penicillium georgiense]
 gb|ABU62624.1| calmodulin, partial [Penicillium georgiense]
 gb|ABU96703.1| calmodulin [Penicillium dierckxii]
 gb|ABV46574.1| calmodulin, partial [Aspergillus coremiiformis]
 gb|ABV46575.1| calmodulin, partial [Aspergillus coremiiformis]
 gb|ABV46576.1| calmodulin, partial [Aspergillus robustus]
 gb|ABV46577.1| calmodulin, partial [Aspergillus sp. NRRL 35102]
 gb|ABV46578.1| calmodulin, partial [Aspergillus ochraceopetaliformis]
 gb|ABV46579.1| calmodulin, partial [Aspergillus sparsus]
 gb|ABV46580.1| calmodulin, partial [Chaetosartorya stromatoides]
 gb|ABV46581.1| calmodulin, partial [Aspergillus dimorphicus]
 gb|ABV46582.1| calmodulin, partial [Neosartorya glabra]
 gb|ABV46583.1| calmodulin, partial [Aspergillus aureolus]
 gb|ABW17531.1| calmodulin [Aspergillus arenarius]
 gb|ABW17533.1| calmodulin [Penicillium brefeldianum]
 gb|ABW17538.1| calmodulin [Byssochlamys nivea]
 gb|ABW17540.1| calmodulin [Aspergillus japonicus]
 gb|ABW17541.1| calmodulin [Penicillium hirayamae]
 gb|ABW72256.1| calmodulin, partial [Aspergillus xerophilus]
 gb|ABW72257.1| calmodulin, partial [Aspergillus xerophilus]
 gb|ABW72258.1| calmodulin, partial [Eurotium carnoyi]
 gb|ABW72259.1| calmodulin, partial [Aspergillus ruber]
 gb|ABW72260.1| calmodulin, partial [Aspergillus glaucus]
 gb|ABW72261.1| calmodulin, partial [Aspergillus proliferans]
 gb|ABW72262.1| calmodulin, partial [Aspergillus glaucus]
 gb|ABW72263.1| calmodulin, partial [Aspergillus glaucus]
 gb|ABW72264.1| calmodulin, partial [Eurotium umbrosum]
 gb|ABW72265.1| calmodulin, partial [Eurotium umbrosum]
 gb|ABW72266.1| calmodulin, partial [Aspergillus niveoglaucus]
 gb|ABW72267.1| calmodulin, partial [Aspergillus niveoglaucus]
 gb|ABW72268.1| calmodulin, partial [Aspergillus niveoglaucus]
 gb|ABW72269.1| calmodulin, partial [Aspergillus niveoglaucus]
 gb|ABW72270.1| calmodulin, partial [Eurotium medium]
 gb|ABW72271.1| calmodulin, partial [Eurotium echinulatum]
 gb|ABW72272.1| calmodulin, partial [Eurotium echinulatum]
 gb|ABW72273.1| calmodulin, partial [Eurotium tonophilum]
 gb|ABW72274.1| calmodulin, partial [Aspergillus cristatus]
 gb|ABW72275.1| calmodulin, partial [Aspergillus chevalieri]
 gb|ABW72276.1| calmodulin, partial [Aspergillus chevalieri]
 gb|ABW72277.1| calmodulin, partial [Aspergillus chevalieri]
 gb|ABW72278.1| calmodulin, partial [Aspergillus pseudoglaucus]
 gb|ABW72279.1| calmodulin, partial [Aspergillus pseudoglaucus]
 gb|ABW72280.1| calmodulin, partial [Aspergillus pseudoglaucus]
 gb|ABW72281.1| calmodulin, partial [Aspergillus pseudoglaucus]
 gb|ABW72283.1| calmodulin, partial [Aspergillus ruber]
 gb|ABW72284.1| calmodulin, partial [Aspergillus ruber]
 gb|ABW72285.1| calmodulin, partial [Aspergillus intermedius]
 gb|ABW72286.1| calmodulin, partial [Aspergillus intermedius]
 gb|ABW72287.1| calmodulin, partial [Aspergillus intermedius]
 gb|ABW72288.1| calmodulin, partial [Aspergillus equitis]
 gb|ABW72296.1| calmodulin, partial [Eurotium leucocarpum]
 gb|ABW72299.1| calmodulin, partial [Aspergillus restrictus]
 gb|ABW72300.1| calmodulin, partial [Aspergillus restrictus]
 gb|ABW72301.1| calmodulin, partial [Aspergillus restrictus]
 gb|ABW72303.1| calmodulin, partial [Aspergillus caesiellus]
 gb|ABW72304.1| calmodulin, partial [Aspergillus gracilis]
 gb|ABW72305.1| calmodulin, partial [Aspergillus sp. NRRL 145]
 gb|ABW72306.1| calmodulin, partial [Aspergillus conicus]
 gb|ABW72307.1| calmodulin, partial [Eurotium halophilicum]
 gb|ABW72308.1| calmodulin, partial [Aspergillus vitricola]
 gb|ABW72344.1| calmodulin, partial [Chaetosartorya cremea]
 gb|ABW72345.1| calmodulin, partial [Chaetosartorya cremea]
 gb|ABW72346.1| calmodulin, partial [Aspergillus gorakhpurensis]
 gb|ABW72347.1| calmodulin, partial [Chaetosartorya stromatoides]
 gb|ABW72348.1| calmodulin, partial [Chaetosartorya stromatoides]
 gb|ABW72349.1| calmodulin, partial [Chaetosartorya stromatoides]
 gb|ABW72350.1| calmodulin, partial [Aspergillus flaschentraegeri]
 gb|ABW72351.1| calmodulin, partial [Aspergillus wentii]
 gb|ABW72352.1| calmodulin, partial [Aspergillus wentii]
 gb|ABW72353.1| calmodulin, partial [Aspergillus wentii]
 gb|ABW72354.1| calmodulin, partial [Aspergillus wentii]
 gb|ABW72355.1| calmodulin, partial [Aspergillus dimorphicus]
 gb|ABW72356.1| calmodulin, partial [Chaetosartorya chrysella]
 gb|ABW72357.1| calmodulin, partial [Chaetosartorya chrysella]
 gb|ABW72358.1| calmodulin, partial [Aspergillus brunneo-uniseriatus]
 gb|ABW72359.1| calmodulin, partial [Aspergillus pulvinus]
 gb|ACC38411.1| calmodulin, partial [Penicillium cinnamopurpureum]
 gb|ACC38412.1| calmodulin, partial [Penicillium cinnamopurpureum]
 gb|ACC38414.1| calmodulin, partial [Penicillium brevissimum]
 gb|ACC38415.1| calmodulin, partial [Penicillium skrjabinii]
 gb|ACC38417.1| calmodulin, partial [Penicillium multicolor]
 gb|ADE19170.1| calmodulin, partial [Penicillium arenicola]
 gb|ADE19171.1| calmodulin, partial [Penicillium arenicola]
 gb|ADE19172.1| calmodulin, partial [Penicillium arenicola]
 gb|ADE19173.1| calmodulin, partial [Penicillium arenicola]
 gb|ADE19174.1| calmodulin, partial [Penicillium humicoloides]
 gb|ADE19175.1| calmodulin, partial [Hamigera terricola]
 gb|ADE19176.1| calmodulin, partial [Hamigera terricola]
 gb|ADE19177.1| calmodulin, partial [Hamigera terricola]
 gb|ADE19178.1| calmodulin, partial [Hamigera fusca]
 gb|ADE19179.1| calmodulin, partial [Hamigera fusca]
 gb|ADE19180.1| calmodulin, partial [Hamigera terricola]
 gb|ADE19181.1| calmodulin, partial [Hamigera terricola]
 gb|ADE19182.1| calmodulin, partial [Hamigera terricola]
 gb|ADE19183.1| calmodulin, partial [Hamigera fusca]
 gb|ADE19184.1| calmodulin, partial [Hamigera terricola]
 gb|ADE19185.1| calmodulin, partial [Hamigera fusca]
 gb|ADE19186.1| calmodulin, partial [Hamigera insecticola]
 gb|ADE19187.1| calmodulin, partial [Hamigera insecticola]
 gb|ADE19188.1| calmodulin, partial [Hamigera insecticola]
 gb|ADE19189.1| calmodulin, partial [Hamigera insecticola]
 gb|ADE19190.1| calmodulin, partial [Hamigera insecticola]
 gb|ADE19191.1| calmodulin, partial [Hamigera insecticola]
 gb|ADE19192.1| calmodulin, partial [Hamigera insecticola]
 gb|ADE19194.1| calmodulin, partial [Hamigera pallida]
 gb|ADE19195.1| calmodulin, partial [Hamigera paravellanea]
 gb|ADE19196.1| calmodulin, partial [Hamigera paravellanea]
 gb|ADE19197.1| calmodulin, partial [Hamigera avellanea]
 gb|ADE19198.1| calmodulin, partial [Hamigera sp. NRRL 2108]
 gb|ADE19201.1| calmodulin, partial [Merimbla ingelheimensis]
 gb|ADE19202.1| calmodulin, partial [Merimbla ingelheimensis]
 gb|ADE19203.1| calmodulin, partial [Merimbla ingelheimensis]
 gb|ADE19204.1| calmodulin, partial [Merimbla ingelheimensis]
 gb|ADE19205.1| calmodulin, partial [Merimbla ingelheimensis]
 gb|ADE19208.1| calmodulin, partial [Hamigera striata]
 gb|ADE19209.1| calmodulin, partial [Hamigera striata]
 gb|ADE19210.1| calmodulin, partial [Hamigera striata]
 gb|ADE19212.1| calmodulin, partial [Hamigera striata]
 gb|ADE19213.1| calmodulin, partial [Hamigera striata]
 gb|ADE19214.1| calmodulin, partial [Hamigera striata]
 gb|ADW23146.1| calmodulin [Eurotium sp. FZ]
 gb|AEO13243.1| calmodulin [Aspergillus sp. 09MAsp200]
 gb|AEQ63016.1| calmodulin, partial [Penicillium erubescens]
 gb|AEQ63017.1| calmodulin, partial [Penicillium pimiteouiense]
 gb|AEQ63018.1| calmodulin, partial [Penicillium parvum]
 gb|AEQ63019.1| calmodulin, partial [Penicillium pimiteouiense]
 gb|AEQ63020.1| calmodulin, partial [Penicillium pimiteouiense]
 gb|AEQ63021.1| calmodulin, partial [Penicillium pimiteouiense]
 gb|AEQ63022.1| calmodulin, partial [Penicillium menonorum]
 gb|AEQ63023.1| calmodulin, partial [Penicillium menonorum]
 gb|AEQ63024.1| calmodulin, partial [Penicillium rubidurum]
 gb|AEV23266.1| calmodulin [Aspergillus effusus]
 gb|AFN93975.1| calmodulin, partial [Aspergillus niger]
 gb|AFN93976.1| calmodulin, partial [Aspergillus awamori]
 gb|AFN93977.1| calmodulin, partial [Aspergillus tubingensis]
 gb|AFN93978.1| calmodulin, partial [Aspergillus niger]
 gb|AFN93979.1| calmodulin, partial [Aspergillus awamori]
 gb|AFN93980.1| calmodulin, partial [Aspergillus awamori]
 gb|AFN93981.1| calmodulin, partial [Aspergillus niger]
 gb|AFN93982.1| calmodulin, partial [Aspergillus niger]
 gb|AFP65863.1| calmodulin, partial [Aspergillus tanneri]
 gb|AFP66084.1| calmodulin, partial [Aspergillus subversicolor]
 gb|AFP66085.1| calmodulin, partial [Aspergillus versicolor]
 gb|AFP66086.1| calmodulin, partial [Aspergillus versicolor]
 gb|AFP66087.1| calmodulin, partial [Aspergillus versicolor]
 gb|AFP66088.1| calmodulin, partial [Aspergillus venenatus]
 gb|AFP66089.1| calmodulin, partial [Aspergillus venenatus]
 gb|AFP66090.1| calmodulin, partial [Aspergillus venenatus]
 gb|AFP66091.1| calmodulin, partial [Aspergillus tennesseensis]
 gb|AFP66092.1| calmodulin, partial [Aspergillus tennesseensis]
 gb|AFP66093.1| calmodulin, partial [Aspergillus tennesseensis]
 gb|AFP66094.1| calmodulin, partial [Aspergillus jensenii]
 gb|AFP66095.1| calmodulin, partial [Aspergillus amoenus]
 gb|AFP66096.1| calmodulin, partial [Aspergillus tennesseensis]
 gb|AFP66097.1| calmodulin, partial [Aspergillus cvjetkovicii]
 gb|AFP66098.1| calmodulin, partial [Aspergillus creber]
 gb|AFP66099.1| calmodulin, partial [Aspergillus austroafricanus]
 gb|AFP66100.1| calmodulin, partial [Aspergillus tennesseensis]
 gb|AFP66101.1| calmodulin, partial [Aspergillus jensenii]
 gb|AFP66103.1| calmodulin, partial [Aspergillus jensenii]
 gb|AFP66104.1| calmodulin, partial [Aspergillus jensenii]
 gb|AFP66105.1| calmodulin, partial [Aspergillus fructus]
 gb|AFP66108.1| calmodulin, partial [Aspergillus puulaauensis]
 gb|AFP66111.1| calmodulin, partial [Aspergillus versicolor]
 gb|AFP66112.1| calmodulin, partial [Aspergillus amoenus]
 gb|AFP66113.1| calmodulin, partial [Aspergillus sydowii]
 gb|AFP66114.1| calmodulin, partial [Aspergillus creber]
 gb|AFP66115.1| calmodulin, partial [Aspergillus creber]
 gb|AFP66116.1| calmodulin, partial [Aspergillus creber]
 gb|AFP66118.1| calmodulin, partial [Aspergillus cvjetkovicii]
 gb|AFP66119.1| calmodulin, partial [Aspergillus creber]
 gb|AFP66120.1| calmodulin, partial [Aspergillus jensenii]
 gb|AFP66121.1| calmodulin, partial [Aspergillus creber]
 gb|AFP66122.1| calmodulin, partial [Aspergillus puulaauensis]
 gb|AFP66124.1| calmodulin, partial [Aspergillus creber]
 gb|AFP66125.1| calmodulin, partial [Aspergillus creber]
 gb|AFP66127.1| calmodulin, partial [Aspergillus creber]
 gb|AFP66128.1| calmodulin, partial [Aspergillus jensenii]
 gb|AFP66129.1| calmodulin, partial [Aspergillus creber]
 gb|AFP66130.1| calmodulin, partial [Aspergillus creber]
 gb|AFP66131.1| calmodulin, partial [Aspergillus jensenii]
 gb|AFP66132.1| calmodulin, partial [Aspergillus creber]
 gb|AFP66133.1| calmodulin, partial [Aspergillus protuberus]
 gb|AFP66134.1| calmodulin, partial [Aspergillus protuberus]
 gb|AFP66135.1| calmodulin, partial [Aspergillus protuberus]
 gb|AFP66136.1| calmodulin, partial [Aspergillus jensenii]
 gb|AFP66137.1| calmodulin, partial [Aspergillus protuberus]
 gb|AFP66138.1| calmodulin, partial [Aspergillus creber]
 gb|AFP66139.1| calmodulin, partial [Aspergillus tabacinus]
 gb|AFP66141.1| calmodulin, partial [Aspergillus amoenus]
 gb|AFP66142.1| calmodulin, partial [Aspergillus jensenii]
 gb|AFS18533.1| calmodulin, partial [Aspergillus cibarius]
 gb|AFS18534.1| calmodulin, partial [Aspergillus cibarius]
 gb|AFS18535.1| calmodulin, partial [Aspergillus cibarius]
 gb|AGV76398.1| calmodulin, partial [Penicillium concavorugulosum]
 gb|AGV76401.1| calmodulin, partial [Talaromyces radicus]
 gb|AGV76402.1| calmodulin, partial [Talaromyces radicus]
 gb|AGV76403.1| calmodulin, partial [Talaromyces atricola]
 gb|AGV76404.1| calmodulin, partial [Talaromyces allahabadensis]
 gb|AGV76405.1| calmodulin, partial [Talaromyces scorteus]
 gb|AGV76406.1| calmodulin, partial [Talaromyces scorteus]
 gb|AGV76407.1| calmodulin, partial [Talaromyces islandicus]
 gb|AGV76408.1| calmodulin, partial [Talaromyces loliensis]
 gb|AGV76409.1| calmodulin, partial [Talaromyces variabilis]
 gb|AGV76410.1| calmodulin, partial [Talaromyces wortmannii]
 gb|AGV76412.1| calmodulin, partial [Talaromyces columbinus]
 gb|AGV76414.1| calmodulin, partial [Talaromyces columbinus]
 gb|AGV76415.1| calmodulin, partial [Talaromyces columbinus]
 gb|AGV76416.1| calmodulin, partial [Talaromyces columbinus]
 gb|AGV76417.1| calmodulin, partial [Talaromyces piceae]
 gb|AGV76418.1| calmodulin, partial [Talaromyces piceae]
 gb|AGV76419.1| calmodulin, partial [Talaromyces piceae]
 gb|AGV76420.1| calmodulin, partial [Talaromyces piceae]
 gb|AGV76421.1| calmodulin, partial [Talaromyces piceae]
 gb|AGV76422.1| calmodulin, partial [Talaromyces sp. NRRL 62223]
 emb|CDM22438.1| calmodulin, partial [Aspergillus frequens]
 emb|CDM22439.1| calmodulin, partial [Aspergillus frequens]
 emb|CDM22440.1| calmodulin, partial [Aspergillus iizukae]
 emb|CDM22441.1| calmodulin, partial [Aspergillus iizukae]
 emb|CDM22442.1| calmodulin, partial [Aspergillus iizukae]
 emb|CDM22443.1| calmodulin, partial [Aspergillus iizukae]
 emb|CDM22445.1| calmodulin, partial [Aspergillus iizukae]
 emb|CDM22446.1| calmodulin, partial [Aspergillus iizukae]
 emb|CDM22447.1| calmodulin, partial [Aspergillus iizukae]
 emb|CDM22448.1| calmodulin, partial [Aspergillus iizukae]
 emb|CDM22449.1| calmodulin, partial [Aspergillus iizukae]
 emb|CDM22450.1| calmodulin, partial [Aspergillus mangaliensis]
 emb|CDM22452.1| calmodulin, partial [Aspergillus movilensis]
 emb|CDM22453.1| calmodulin, partial [Aspergillus spelaeus]
 emb|CDM22454.1| calmodulin, partial [Aspergillus spelaeus]
 emb|CDM22455.1| calmodulin, partial [Aspergillus spelaeus]
 emb|CDM22456.1| calmodulin, partial [Aspergillus spelaeus]
 emb|CDM22457.1| calmodulin, partial [Aspergillus spelaeus]
 emb|CDM22458.1| calmodulin, partial [Aspergillus spelaeus]
 emb|CDM22459.1| calmodulin, partial [Aspergillus spelaeus]
 emb|CDM22460.1| calmodulin, partial [Aspergillus spelaeus]
 emb|CDM22461.1| calmodulin, partial [Aspergillus spelaeus]
 emb|CDM22462.1| calmodulin, partial [Aspergillus spelaeus]
 emb|CDM22463.1| calmodulin, partial [Aspergillus spelaeus]
 emb|CDM22464.1| calmodulin, partial [Aspergillus spelaeus]
 emb|CDM22465.1| calmodulin, partial [Aspergillus spelaeus]
 gb|AHL19868.1| calmodulin, partial [Penicillium pusillum]
 gb|AHL19869.1| calmodulin, partial [Penicillium sp. SW-2014a]
 gb|AHL19870.1| calmodulin, partial [Penicillium sp. SW-2014e]
 gb|AHL19872.1| calmodulin, partial [Penicillium sp. SW-2014g]
 gb|AHL19873.1| calmodulin, partial [Penicillium sp. SW-2014c]
 gb|AHL19874.1| calmodulin, partial [Penicillium sp. SW-2014f]
 gb|AHL19875.1| calmodulin, partial [Penicillium sp. SW-2014b]
 gb|AHL19876.1| calmodulin, partial [Penicillium sp. SW-2014d]
 gb|AHL19877.1| calmodulin, partial [Penicillium sp. SW-2014c]
 gb|AHL19878.1| calmodulin, partial [Penicillium sp. SW-2014c]
 gb|AHL19879.1| calmodulin, partial [Penicillium sp. SW-2014f]
 gb|AHL19880.1| calmodulin, partial [Penicillium sp. SW-2014b]
 gb|AHL19881.1| calmodulin, partial [Penicillium sp. SW-2014g]
 gb|AHL19882.1| calmodulin, partial [Penicillium sp. SW-2014b]
 gb|AHL19883.1| calmodulin, partial [Penicillium sp. SW-2014b]
 gb|AHL19884.1| calmodulin, partial [Penicillium sp. SW-2014f]
 gb|AIA08965.1| calmodulin, partial [Neosartorya udagawae]
 gb|AIA77820.1| calmodulin, partial [Aspergillus niger]
 gb|AIA77821.1| calmodulin, partial [Aspergillus niger]
 gb|AIA77822.1| calmodulin, partial [Aspergillus niger]
 gb|AIA77823.1| calmodulin, partial [Aspergillus niger]
 gb|AIA77824.1| calmodulin, partial [Aspergillus niger]
 gb|AIA77825.1| calmodulin, partial [Aspergillus niger]
 gb|AIA77826.1| calmodulin, partial [Aspergillus niger]
 gb|AIA77827.1| calmodulin, partial [Aspergillus niger]
 gb|AIA77828.1| calmodulin, partial [Aspergillus niger]
 gb|AIA77829.1| calmodulin, partial [Aspergillus niger]
 gb|AIA77830.1| calmodulin, partial [Aspergillus niger]
 gb|AIA77831.1| calmodulin, partial [Aspergillus niger]
 gb|AIA77832.1| calmodulin, partial [Aspergillus niger]
 gb|AIA77833.1| calmodulin, partial [Aspergillus niger]
 gb|AIA77834.1| calmodulin, partial [Aspergillus niger]
 gb|AIA77835.1| calmodulin, partial [Aspergillus niger]
 gb|AIA77836.1| calmodulin, partial [Aspergillus niger]
 gb|AIA77837.1| calmodulin, partial [Aspergillus niger]
 gb|AIA77838.1| calmodulin, partial [Aspergillus niger]
 gb|AIE17052.1| calmodulin, partial [Aspergillus lentulus]
 gb|AIE17054.1| calmodulin, partial [Aspergillus lentulus]
 gb|AIE17055.1| calmodulin, partial [Aspergillus lentulus]
 gb|AIE17060.1| calmodulin, partial [Aspergillus felis]
 gb|AIE17061.1| calmodulin, partial [Aspergillus felis]
 gb|AIE17062.1| calmodulin, partial [Aspergillus sp. SWP-2014c]
 gb|AIE17063.1| calmodulin, partial [Aspergillus sp. SWP-2014c]
 gb|AIE17064.1| calmodulin, partial [Aspergillus wyomingensis]
 gb|AIE17065.1| calmodulin, partial [Aspergillus fumigatus]
 gb|AGN04139.2| calmodulin, partial [Aspergillus awamori]
 gb|AGN04140.2| calmodulin, partial [Aspergillus brasiliensis]
 gb|AGN04141.2| calmodulin, partial [Aspergillus brasiliensis]
 gb|AGN04142.2| calmodulin, partial [Aspergillus awamori]
 gb|AGN04143.2| calmodulin, partial [Aspergillus piperis]
 gb|AGN04144.2| calmodulin, partial [Aspergillus eucalypticola]
 gb|AGN04145.2| calmodulin, partial [Aspergillus neoniger]
 gb|AGN04146.2| calmodulin, partial [Aspergillus niger]
 gb|AGN04148.2| calmodulin, partial [Aspergillus tubingensis]
 gb|AGN04150.2| calmodulin, partial [Aspergillus tubingensis]
 emb|CDW51707.1| calmodulin, partial [Aspergillus flavipes]
 emb|CDW51710.1| calmodulin, partial [Aspergillus iizukae]
 emb|CDW51711.1| calmodulin, partial [Aspergillus iizukae]
 emb|CDW51712.1| calmodulin, partial [Aspergillus sp. 2 VH-2014]
 emb|CDW51713.1| calmodulin, partial [Aspergillus sp. 2 VH-2014]
 emb|CDW51714.1| calmodulin, partial [Aspergillus sp. 2 VH-2014]
 emb|CDW51715.1| calmodulin, partial [Aspergillus sp. 2 VH-2014]
 emb|CDW51716.1| calmodulin, partial [Aspergillus sp. 2 VH-2014]
 emb|CDW51717.1| calmodulin, partial [Aspergillus sp. 2 VH-2014]
 emb|CDW51718.1| calmodulin, partial [Aspergillus polyporicola]
 emb|CDW51719.1| calmodulin, partial [Aspergillus spelaeus]
 gb|AIZ07905.1| calmodulin, partial [Aspergillus cristatus]
 gb|AIZ07906.1| calmodulin, partial [Aspergillus cristatus]
 gb|AIZ07907.1| calmodulin, partial [Aspergillus cristatus]
 gb|AIZ07908.1| calmodulin, partial [Aspergillus cristatus]
 gb|AIZ07909.1| calmodulin, partial [Aspergillus cristatus]
 gb|AIZ07910.1| calmodulin, partial [Aspergillus cristatus]
 gb|AIZ07911.1| calmodulin, partial [Aspergillus cristatus]
 gb|AIZ07912.1| calmodulin, partial [Aspergillus cristatus]
 gb|AIZ07913.1| calmodulin, partial [Aspergillus cristatus]
 gb|AIZ07914.1| calmodulin, partial [Aspergillus cristatus]
 gb|AIZ07915.1| calmodulin, partial [Aspergillus cristatus]
Length=134

 Score =   132 bits (331),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  54   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  113

Query  439  VDEMIREADVDGDGQINYEEF  501
            VDEMIREAD DGDG+I+Y EF
Sbjct  114  VDEMIREADQDGDGRIDYNEF  134


 Score =   117 bits (294),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 55/61 (90%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +3

Query  99   QISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPE  278
            Q+SE+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPE
Sbjct  1    QVSEYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPE  60

Query  279  F  281
            F
Sbjct  61   F  61


 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  65   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  124

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  125  GDGRIDYNEF  134


 Score = 58.2 bits (139),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  4    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  63

Query  508  VMMAK  522
            +M  K
Sbjct  64   MMARK  68



>ref|XP_011030612.1| PREDICTED: calmodulin-like protein 8 [Populus euphratica]
Length=150

 Score =   141 bits (355),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL+LMA+KMK+TD+EEELKEAF+VFDKDQNG+ISA ELRHVM NLGEKLTDEE
Sbjct  62   GTIEFAEFLSLMAKKMKETDAEEELKEAFKVFDKDQNGYISANELRHVMINLGEKLTDEE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMM  516
            V++MI+EAD+DGDGQ+NY+EFVK+MM
Sbjct  122  VEQMIKEADLDGDGQVNYDEFVKMMM  147


 Score =   108 bits (269),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+ LT++QI EF+EAF LFDKDGDGCIT +EL TV+RSL QNPTE ELQDMI+EVD+D 
Sbjct  1    MAEALTEEQIVEFREAFCLFDKDGDGCITLEELATVIRSLDQNPTEEELQDMISEVDSDR  60

Query  255  NGTIDFPEF  281
            NGTI+F EF
Sbjct  61   NGTIEFAEF  69


 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +3

Query  108  EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            E KEAF +FDKD +G I+  EL  VM +LG+  T+ E++ MI E D DG+G +++ EF
Sbjct  85   ELKEAFKVFDKDQNGYISANELRHVMINLGEKLTDEEVEQMIKEADLDGDGQVNYDEF  142


 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E +EAF +FDKD +G I+  EL  V+ +L +  T+EE+ +MI E D D +G I + EF+ 
Sbjct  12   EFREAFCLFDKDGDGCITLEELATVIRSLDQNPTEEELQDMISEVDSDRNGTIEFAEFLS  71

Query  508  VMMAK  522
            +M  K
Sbjct  72   LMAKK  76



>gb|AIB03840.1| calmodulin, partial [Epichloe tembladerae]
Length=137

 Score =   125 bits (315),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +3

Query  78   ADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGN  257
            AD LT++Q+SEFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD N
Sbjct  1    ADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNN  60

Query  258  GTIDFPEF  281
            GTIDFPEF
Sbjct  61   GTIDFPEF  68


 Score =   123 bits (309),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  61   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  120

Query  439  VDEMIREADVDGDGQIN  489
            VDEMIRE D DGDG+I+
Sbjct  121  VDEMIREXDQDGDGRID  137


 Score = 58.9 bits (141),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  11   EFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  70

Query  508  VMMAK  522
            +M  K
Sbjct  71   MMARK  75


 Score = 55.8 bits (133),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 1/66 (2%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  72   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREXDQD  131

Query  252  GNGTID  269
            G+G ID
Sbjct  132  GDGRID  137



>gb|AIN40652.1| calmodulin, partial [Colletotrichum gigasporum]
Length=138

 Score =   138 bits (348),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +1

Query  265  LTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVD  444
            + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+EVD
Sbjct  53   IDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVD  112

Query  445  EMIREADVDGDGQINYEEFVKVMMAK  522
            EMIREAD DGDG+I+Y EFV++MM K
Sbjct  113  EMIREADQDGDGRIDYNEFVQLMMQK  138


 Score =   110 bits (276),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 53/58 (91%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +3

Query  108  EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD N TIDFPEF
Sbjct  1    EFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNRTIDFPEF  58


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  62   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  121

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  122  GDGRIDYNEF  131


 Score = 55.5 bits (132),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +  I++ EF+ 
Sbjct  1    EFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNRTIDFPEFLT  60

Query  508  VMMAK  522
            +M  K
Sbjct  61   MMARK  65



>ref|XP_011427026.1| PREDICTED: calmodulin-A-like [Crassostrea gigas]
 gb|EKC24251.1| Calmodulin [Crassostrea gigas]
Length=157

 Score =   138 bits (348),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKM+DTD+ EELKEAF+VFDKD NGFISA+ELRHVM +LGE+LTDEE
Sbjct  66   GTIDFDEFLQMMARKMRDTDTTEELKEAFKVFDKDGNGFISASELRHVMKSLGERLTDEE  125

Query  439  VDEMIREADVDGDGQINYEEFVKVMMA  519
            VDEMI+EAD+DGDGQ+NYEEFVK+M +
Sbjct  126  VDEMIKEADLDGDGQVNYEEFVKMMAS  152


 Score =   110 bits (276),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = +3

Query  84   QLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGT  263
            +L+D+Q++EF+EAF+LFDKDGDG ITT ELGTVMRSLGQNPTE ELQDMINEVD D +GT
Sbjct  8    KLSDEQVAEFREAFNLFDKDGDGSITTMELGTVMRSLGQNPTEGELQDMINEVDYDESGT  67

Query  264  IDFPEF  281
            IDF EF
Sbjct  68   IDFDEF  73


 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 48/70 (69%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E KEAF +FDKDG+G I+  EL  VM+SLG+  T+ E+ +MI E D D
Sbjct  77   MARKMRDTDTTEELKEAFKVFDKDGNGFISASELRHVMKSLGERLTDEEVDEMIKEADLD  136

Query  252  GNGTIDFPEF  281
            G+G +++ EF
Sbjct  137  GDGQVNYEEF  146


 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E +EAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D D  G I+++EF++
Sbjct  16   EFREAFNLFDKDGDGSITTMELGTVMRSLGQNPTEGELQDMINEVDYDESGTIDFDEFLQ  75

Query  508  VMMAK  522
            +M  K
Sbjct  76   MMARK  80



>gb|AFK43190.1| unknown [Lotus japonicus]
Length=150

 Score =   139 bits (351),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FLNLMA+KMK+TD+E++LKEAF+VFDKDQNG+ISA+ELRHVM NLGEKLTDEE
Sbjct  62   GTIEFVEFLNLMAKKMKETDAEDDLKEAFKVFDKDQNGYISASELRHVMINLGEKLTDEE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMA  519
            VD+MI+EAD+DGDGQ+NY EFVK+M+ 
Sbjct  122  VDQMIQEADLDGDGQVNYGEFVKMMIT  148


 Score =   108 bits (271),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD L+ +QI E KEAF LFDKDGDGCIT +EL TV+RSL QNPTE ELQDMINEVDAD 
Sbjct  1    MADVLSQEQIVEIKEAFGLFDKDGDGCITVEELATVIRSLDQNPTEEELQDMINEVDADD  60

Query  255  NGTIDFPEF  281
            NGTI+F EF
Sbjct  61   NGTIEFVEF  69


 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +3

Query  108  EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            + KEAF +FDKD +G I+  EL  VM +LG+  T+ E+  MI E D DG+G +++ EF
Sbjct  85   DLKEAFKVFDKDQNGYISASELRHVMINLGEKLTDEEVDQMIQEADLDGDGQVNYGEF  142


 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 3/76 (4%)
 Frame = +1

Query  304  MKDTDSEE---ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDG  474
            M D  S+E   E+KEAF +FDKD +G I+  EL  V+ +L +  T+EE+ +MI E D D 
Sbjct  1    MADVLSQEQIVEIKEAFGLFDKDGDGCITVEELATVIRSLDQNPTEEELQDMINEVDADD  60

Query  475  DGQINYEEFVKVMMAK  522
            +G I + EF+ +M  K
Sbjct  61   NGTIEFVEFLNLMAKK  76



>gb|ABU96706.1| calmodulin [Penicillium syriacum]
 gb|ACC38416.1| calmodulin, partial [Penicillium erubescens]
 gb|AEQ63025.1| calmodulin, partial [Penicillium vinaceum]
 gb|AEQ63026.1| calmodulin, partial [Penicillium guttulosum]
Length=134

 Score =   130 bits (328),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFIS+AELRHVMT++GEKLTD+E
Sbjct  54   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISSAELRHVMTSIGEKLTDDE  113

Query  439  VDEMIREADVDGDGQINYEEF  501
            VDEMIREAD DGDG+I+Y EF
Sbjct  114  VDEMIREADQDGDGRIDYNEF  134


 Score =   117 bits (294),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 55/61 (90%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +3

Query  99   QISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPE  278
            Q+SE+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPE
Sbjct  1    QVSEYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPE  60

Query  279  F  281
            F
Sbjct  61   F  61


 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I++ EL  VM S+G+  T+ E+ +MI E D D
Sbjct  65   MARKMKDTDSEEEIREAFKVFDRDNNGFISSAELRHVMTSIGEKLTDDEVDEMIREADQD  124

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  125  GDGRIDYNEF  134


 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  4    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  63

Query  508  VMMAK  522
            +M  K
Sbjct  64   MMARK  68



>gb|AIB03828.1| calmodulin, partial [Epichloe pampeana]
 gb|AIB03829.1| calmodulin, partial [Epichloe pampeana]
Length=137

 Score =   125 bits (314),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  61   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  120

Query  439  VDEMIREADVDGDGQIN  489
            VDEMIREAD DGDG+I+
Sbjct  121  VDEMIREADQDGDGRID  137


 Score =   123 bits (308),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +3

Query  78   ADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGN  257
            AD LT++Q+SEFKEAFSLFDKDGDG ITTKEL TVMRSLGQNP+E+ELQDMINEVDAD N
Sbjct  1    ADSLTEEQVSEFKEAFSLFDKDGDGQITTKELDTVMRSLGQNPSESELQDMINEVDADNN  60

Query  258  GTIDFPEF  281
            GTIDFPEF
Sbjct  61   GTIDFPEF  68


 Score = 58.9 bits (141),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  11   EFKEAFSLFDKDGDGQITTKELDTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  70

Query  508  VMMAK  522
            +M  K
Sbjct  71   MMARK  75


 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 1/66 (2%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  72   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  131

Query  252  GNGTID  269
            G+G ID
Sbjct  132  GDGRID  137



>ref|XP_002314661.1| calmodulin 8 family protein [Populus trichocarpa]
 gb|EEF00832.1| calmodulin 8 family protein [Populus trichocarpa]
Length=150

 Score =   141 bits (355),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL+LMA+KMK+TD+EEELKEAF+VFDKDQNG+ISA ELRHVM NLGEKLTDEE
Sbjct  62   GTIEFAEFLSLMAKKMKETDAEEELKEAFKVFDKDQNGYISANELRHVMINLGEKLTDEE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMM  516
            V++MI+EAD+DGDGQ+NY+EFVK+MM
Sbjct  122  VEQMIKEADLDGDGQVNYDEFVKMMM  147


 Score =   107 bits (267),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+ LT++QI EF+EAF LFDKDGDGCIT +EL TV+RSL QNPTE EL DMI+EVD+D 
Sbjct  1    MAEALTEEQIVEFREAFCLFDKDGDGCITVEELATVIRSLDQNPTEEELHDMISEVDSDR  60

Query  255  NGTIDFPEF  281
            NGTI+F EF
Sbjct  61   NGTIEFAEF  69


 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ + D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E++ MI E D D
Sbjct  73   MAKKMKETDAEEELKEAFKVFDKDQNGYISANELRHVMINLGEKLTDEEVEQMIKEADLD  132

Query  252  GNGTIDFPEF  281
            G+G +++ EF
Sbjct  133  GDGQVNYDEF  142


 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E +EAF +FDKD +G I+  EL  V+ +L +  T+EE+ +MI E D D +G I + EF+ 
Sbjct  12   EFREAFCLFDKDGDGCITVEELATVIRSLDQNPTEEELHDMISEVDSDRNGTIEFAEFLS  71

Query  508  VMMAK  522
            +M  K
Sbjct  72   LMAKK  76



>gb|AGR66907.1| calmodulin, partial [Colletotrichum fructicola]
Length=136

 Score =   139 bits (351),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT +GEKLTD+E
Sbjct  49   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTPIGEKLTDDE  108

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I Y EFV++MM K
Sbjct  109  VDEMIREADQDGDGRIGYNEFVQLMMQK  136


 Score =   108 bits (271),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +3

Query  114  KEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    KEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  56


 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +1

Query  334  KEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVM  513
            KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ +M
Sbjct  1    KEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLTMM  60

Query  514  MAK  522
              K
Sbjct  61   ARK  63


 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 44/70 (63%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM  +G+  T+ E+ +MI E D D
Sbjct  60   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTPIGEKLTDDEVDEMIREADQD  119

Query  252  GNGTIDFPEF  281
            G+G I + EF
Sbjct  120  GDGRIGYNEF  129



>gb|AGN04153.2| calmodulin, partial [Aspergillus tubingensis]
Length=134

 Score =   130 bits (328),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  54   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  113

Query  439  VDEMIREADVDGDGQINYEEF  501
            VDEMIREAD DGDG+I+Y +F
Sbjct  114  VDEMIREADQDGDGRIDYNDF  134


 Score =   117 bits (294),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 55/61 (90%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +3

Query  99   QISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPE  278
            Q+SE+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPE
Sbjct  1    QVSEYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPE  60

Query  279  F  281
            F
Sbjct  61   F  61


 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  65   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  124

Query  252  GNGTIDFPEF  281
            G+G ID+ +F
Sbjct  125  GDGRIDYNDF  134


 Score = 58.2 bits (139),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  4    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  63

Query  508  VMMAK  522
            +M  K
Sbjct  64   MMARK  68



>emb|CCM43807.1| Calmodulin, partial [Aspergillus japonicus]
 emb|CCM43808.1| Calmodulin, partial [Aspergillus japonicus]
Length=134

 Score =   139 bits (349),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  49   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  108

Query  439  VDEMIREADVDGDGQINYEEFVKVMM  516
            VDEMIREAD DGDG+I+Y EFV++MM
Sbjct  109  VDEMIREADQDGDGRIDYNEFVQLMM  134


 Score =   109 bits (273),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +3

Query  114  KEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    KEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  56


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  60   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  119

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  120  GDGRIDYNEF  129


 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +1

Query  334  KEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVM  513
            KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ +M
Sbjct  1    KEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLTMM  60

Query  514  MAK  522
              K
Sbjct  61   ARK  63



>emb|CCM43803.1| calmodulin, partial [Aspergillus fijiensis]
 emb|CCM43804.1| Calmodulin, partial [Aspergillus fijiensis]
Length=135

 Score =   139 bits (349),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  49   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  108

Query  439  VDEMIREADVDGDGQINYEEFVKVMM  516
            VDEMIREAD DGDG+I+Y EFV++MM
Sbjct  109  VDEMIREADQDGDGRIDYNEFVQLMM  134


 Score =   109 bits (273),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +3

Query  114  KEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    KEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  56


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  60   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  119

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  120  GDGRIDYNEF  129


 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +1

Query  334  KEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVM  513
            KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ +M
Sbjct  1    KEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLTMM  60

Query  514  MAK  522
              K
Sbjct  61   ARK  63



>gb|AAK69619.1| calmodulin [Fusarium proliferatum]
 gb|AAL04428.1| calmodulin [Fusarium proliferatum]
Length=135

 Score =   140 bits (353),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  48   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  107

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  108  VDEMIREADQDGDGRIDYNEFVQLMMQK  135


 Score =   107 bits (268),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 51/55 (93%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +3

Query  117  EAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            EAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    EAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  55


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  59   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  118

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  119  GDGRIDYNEF  128


 Score = 55.5 bits (132),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = +1

Query  337  EAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMM  516
            EAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ +M 
Sbjct  1    EAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLTMMA  60

Query  517  AK  522
             K
Sbjct  61   RK  62



>gb|AGR66896.1| calmodulin, partial [Colletotrichum gloeosporioides]
Length=136

 Score =   138 bits (348),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D +GFISAAELRHVMT++GEKLTD+E
Sbjct  49   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNSGFISAAELRHVMTSIGEKLTDDE  108

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  109  VDEMIREADQDGDGRIDYNEFVQLMMQK  136


 Score =   109 bits (273),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +3

Query  114  KEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    KEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  56


 Score = 60.8 bits (146),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D  G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  60   MARKMKDTDSEEEIREAFKVFDRDNSGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  119

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  120  GDGRIDYNEF  129


 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +1

Query  334  KEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVM  513
            KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ +M
Sbjct  1    KEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLTMM  60

Query  514  MAK  522
              K
Sbjct  61   ARK  63



>gb|ABQ00510.1| calmodulin, partial [Penicillium decaturense]
Length=134

 Score =   130 bits (328),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKL+D+E
Sbjct  54   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLSDDE  113

Query  439  VDEMIREADVDGDGQINYEEF  501
            VDEMIREAD DGDG+I+Y EF
Sbjct  114  VDEMIREADQDGDGRIDYNEF  134


 Score =   117 bits (294),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 55/61 (90%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +3

Query  99   QISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPE  278
            Q+SE+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPE
Sbjct  1    QVSEYKEAFSLFDKDGDGEITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPE  60

Query  279  F  281
            F
Sbjct  61   F  61


 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  ++ E+ +MI E D D
Sbjct  65   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLSDDEVDEMIREADQD  124

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  125  GDGRIDYNEF  134


 Score = 58.2 bits (139),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  4    EYKEAFSLFDKDGDGEITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  63

Query  508  VMMAK  522
            +M  K
Sbjct  64   MMARK  68



>gb|ABW72282.1| calmodulin, partial [Aspergillus ruber]
Length=134

 Score =   130 bits (327),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++E F+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  54   GTIDFPEFLTMMARKMKDTDSEEEIRETFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  113

Query  439  VDEMIREADVDGDGQINYEEF  501
            VDEMIREAD DGDG+I+Y EF
Sbjct  114  VDEMIREADQDGDGRIDYNEF  134


 Score =   117 bits (294),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 55/61 (90%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +3

Query  99   QISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPE  278
            Q+SE+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPE
Sbjct  1    QVSEYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPE  60

Query  279  F  281
            F
Sbjct  61   F  61


 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +E F +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  65   MARKMKDTDSEEEIRETFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  124

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  125  GDGRIDYNEF  134


 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  4    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  63

Query  508  VMMAK  522
            +M  K
Sbjct  64   MMARK  68



>gb|ABQ00516.1| calmodulin, partial [Penicillium glabrum]
 gb|ABQ00519.1| calmodulin, partial [Penicillium olsonii]
Length=134

 Score =   131 bits (330),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  54   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  113

Query  439  VDEMIREADVDGDGQINYEEF  501
            VDEMIREAD DGDG+I+Y EF
Sbjct  114  VDEMIREADQDGDGRIDYNEF  134


 Score =   116 bits (290),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 55/61 (90%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +3

Query  99   QISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPE  278
            Q SE+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPE
Sbjct  1    QFSEYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPE  60

Query  279  F  281
            F
Sbjct  61   F  61


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  65   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  124

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  125  GDGRIDYNEF  134


 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  4    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  63

Query  508  VMMAK  522
            +M  K
Sbjct  64   MMARK  68



>ref|XP_504759.1| YALI0E34111p [Yarrowia lipolytica]
 emb|CAG80365.1| YALI0E34111p [Yarrowia lipolytica CLIB122]
Length=152

 Score =   131 bits (329),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISA ELRHVMT++GEKLTDEE
Sbjct  62   GTIDFAEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAQELRHVMTSIGEKLTDEE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMA  519
            VD MI+EAD +GDG+I+Y EFV+++++
Sbjct  122  VDMMIKEADANGDGRIDYNEFVQLLVS  148


 Score =   116 bits (291),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            M+DQLT+DQ++EF+EAFSLFDK+ DG ITTKELGTVMRSLGQNP+E+EL DMINEVDA+ 
Sbjct  1    MSDQLTEDQVAEFREAFSLFDKNNDGKITTKELGTVMRSLGQNPSESELADMINEVDANN  60

Query  255  NGTIDFPEF  281
            +GTIDF EF
Sbjct  61   DGTIDFAEF  69


 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+ +EL  VM S+G+  T+ E+  MI E DA+
Sbjct  73   MARKMKDTDSEEEIREAFKVFDRDNNGFISAQELRHVMTSIGEKLTDEEVDMMIKEADAN  132

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  133  GDGRIDYNEF  142


 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E +EAF +FDK+ +G I+  EL  VM +LG+  ++ E+ +MI E D + DG I++ EF+ 
Sbjct  12   EFREAFSLFDKNNDGKITTKELGTVMRSLGQNPSESELADMINEVDANNDGTIDFAEFLT  71

Query  508  VMMAK  522
            +M  K
Sbjct  72   MMARK  76



>gb|AGR66925.1| calmodulin, partial [Colletotrichum citri]
Length=136

 Score =   139 bits (349),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT +GEKLTD+E
Sbjct  49   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTPIGEKLTDDE  108

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIRE D DGDG+I+Y EFV++MM K
Sbjct  109  VDEMIREPDQDGDGRIDYNEFVQLMMQK  136


 Score =   108 bits (271),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +3

Query  114  KEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    KEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  56


 Score = 58.5 bits (140),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM  +G+  T+ E+ +MI E D D
Sbjct  60   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTPIGEKLTDDEVDEMIREPDQD  119

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  120  GDGRIDYNEF  129


 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +1

Query  334  KEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVM  513
            KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ +M
Sbjct  1    KEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLTMM  60

Query  514  MAK  522
              K
Sbjct  61   ARK  63



>ref|XP_005387595.1| PREDICTED: calmodulin-like [Chinchilla lanigera]
Length=189

 Score =   125 bits (314),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDS+EE++EAF VFDK+ NG+IS AEL  VMTNLGEKLTDEE
Sbjct  62   GTIDFPEFLTMMARKMKDTDSKEEIREAFLVFDKEGNGYISVAELSQVMTNLGEKLTDEE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVM  513
             DEMIREAD DG+ Q+N+EEF+++M
Sbjct  122  ADEMIREADTDGERQVNHEEFIQMM  146


 Score =   122 bits (305),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            M DQL ++Q++EFKEAFSLF KDGDG ITTKELGTVMRSLGQNP EAELQD INEVDAD 
Sbjct  1    MTDQLNEEQVAEFKEAFSLFAKDGDGTITTKELGTVMRSLGQNPAEAELQDAINEVDADD  60

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  61   NGTIDFPEF  69


 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 43/70 (61%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FDK+G+G I+  EL  VM +LG+  T+ E  +MI E D D
Sbjct  73   MARKMKDTDSKEEIREAFLVFDKEGNGYISVAELSQVMTNLGEKLTDEEADEMIREADTD  132

Query  252  GNGTIDFPEF  281
            G   ++  EF
Sbjct  133  GERQVNHEEF  142


 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +F KD +G I+  EL  VM +LG+   + E+ + I E D D +G I++ EF+ 
Sbjct  12   EFKEAFSLFAKDGDGTITTKELGTVMRSLGQNPAEAELQDAINEVDADDNGTIDFPEFLT  71

Query  508  VMMAK  522
            +M  K
Sbjct  72   MMARK  76



>gb|ABW17527.1| calmodulin [Aspergillus ostianus]
 gb|ABW17528.1| calmodulin [Aspergillus ostianus]
 gb|ABW17530.1| calmodulin [Aspergillus ochraceus]
 gb|ABW17532.1| calmodulin [Hamigera avellanea]
 gb|ABW17534.1| calmodulin [Rasamsonia emersonii]
 gb|ABW17535.1| calmodulin [Aspergillus dimorphicus]
 gb|ABW17536.1| calmodulin [Aspergillus tamarii]
 gb|ABW17539.1| calmodulin [Sclerocleista thaxteri]
 gb|ABW17542.1| calmodulin [Aspergillus unilateralis]
 gb|ABW17543.1| calmodulin [Neosartorya quadricincta]
 gb|ABW17544.1| calmodulin [Talaromyces flavus]
 gb|ABW72537.1| calmodulin, partial [Emericella navahoensis]
 gb|ABW72539.1| calmodulin, partial [Aspergillus stellifer]
 gb|ABW72540.1| calmodulin, partial [Aspergillus nidulans]
 gb|ABW72541.1| calmodulin, partial [Aspergillus caespitosus]
 gb|ABW72542.1| calmodulin, partial [Aspergillus granulosus]
 gb|ABW72543.1| calmodulin, partial [Aspergillus granulosus]
 gb|ABW72544.1| calmodulin, partial [Aspergillus stellifer]
 gb|ABW72545.1| calmodulin, partial [Aspergillus keveii]
 gb|ABW72546.1| calmodulin, partial [Aspergillus quadrilineatus]
 gb|ABW72547.1| calmodulin, partial [Aspergillus rugulosus]
 gb|ABW72548.1| calmodulin, partial [Emericella sp. NRRL 212]
 gb|ABW72549.1| calmodulin, partial [Aspergillus unguis]
 gb|ABW72550.1| calmodulin, partial [Aspergillus deflectus]
 gb|ABW72551.1| calmodulin, partial [Emericella violacea]
 gb|ABW72552.1| calmodulin, partial [Emericella sp. NRRL 2241]
 gb|ABW72553.1| calmodulin, partial [Aspergillus sp. NRRL 227]
 gb|ABW72554.1| calmodulin, partial [Aspergillus ivoriensis]
 gb|ABW72555.1| calmodulin, partial [Aspergillus versicolor]
 gb|ABW72556.1| calmodulin, partial [Aspergillus unguis]
 gb|ABW72557.1| calmodulin, partial [Aspergillus quadrilineatus]
 gb|ABW72558.1| calmodulin, partial [Emericella echinulata]
 gb|ABW72559.1| calmodulin, partial [Emericella astellata]
 gb|ABW72560.1| calmodulin, partial [Emericella astellata]
 gb|ABW72561.1| calmodulin, partial [Aspergillus sylvaticus]
 gb|ABW72562.1| calmodulin, partial [Aspergillus versicolor]
 gb|ABW72563.1| calmodulin, partial [Aspergillus sydowii]
 gb|ABW72564.1| calmodulin, partial [Aspergillus sydowii]
 gb|ABW72565.1| calmodulin, partial [Aspergillus calidoustus]
 gb|ABW72566.1| calmodulin, partial [Aspergillus raperi]
 gb|ABW72567.1| calmodulin, partial [Aspergillus raperi]
 gb|ABW72568.1| calmodulin, partial [Aspergillus ustus]
 gb|ABW72569.1| calmodulin, partial [Aspergillus pseudodeflectus]
 gb|ABW72570.1| calmodulin, partial [Aspergillus insuetus]
 gb|ABW72571.1| calmodulin, partial [Aspergillus nidulans]
 gb|ABW72572.1| calmodulin, partial [Aspergillus lucknowensis]
 gb|ABW72573.1| calmodulin, partial [Aspergillus protuberus]
 gb|ABW72574.1| calmodulin, partial [Aspergillus kassunensis]
 gb|ABW72575.1| calmodulin, partial [Emericella violacea]
 gb|ABW72576.1| calmodulin, partial [Aspergillus deflectus]
 gb|ABW72577.1| calmodulin, partial [Aspergillus quadrilineatus]
 gb|ABW72578.1| calmodulin, partial [Aspergillus aurantiobrunneus]
 gb|ABW72579.1| calmodulin, partial [Aspergillus quadrilineatus]
 gb|ABW72580.1| calmodulin, partial [Aspergillus sp. NRRL 4642]
 gb|ABW72581.1| calmodulin, partial [Aspergillus sp. NRRL 4649]
 gb|ABW72582.1| calmodulin, partial [Aspergillus puniceus]
 gb|ABW72583.1| calmodulin, partial [Emericella striata]
 gb|ABW72584.1| calmodulin, partial [Aspergillus stellifer]
 gb|ABW72585.1| calmodulin, partial [Aspergillus asperescens]
 gb|ABW72586.1| calmodulin, partial [Aspergillus sydowii]
 gb|ABW72587.1| calmodulin, partial [Aspergillus aeneus]
 gb|ABW72588.1| calmodulin, partial [Aspergillus asperescens]
 gb|ABW72589.1| calmodulin, partial [Aspergillus eburneocremeus]
 gb|ABW72590.1| calmodulin, partial [Aspergillus multicolor]
 gb|ABW72591.1| calmodulin, partial [Aspergillus tabacinus]
 gb|ABW72592.1| calmodulin, partial [Aspergillus variecolor]
 gb|ABW72593.1| calmodulin, partial [Aspergillus versicolor]
 gb|ABW72594.1| calmodulin, partial [Aspergillus minutus]
 gb|ABW72595.1| calmodulin, partial [Aspergillus recurvatus]
 gb|ABW72596.1| calmodulin, partial [Aspergillus fruticulosus]
 gb|ABW72597.1| calmodulin, partial [Aspergillus quadrilineatus]
 gb|ABW72601.1| calmodulin, partial [Aspergillus nidulans]
 gb|ABW72602.1| calmodulin, partial [Aspergillus crustosus]
 gb|ABW72603.1| calmodulin, partial [Aspergillus spelunceus]
 gb|ABW72604.1| calmodulin, partial [Aspergillus spelunceus]
 gb|ABW72605.1| calmodulin, partial [Aspergillus ustus]
 gb|ABW72606.1| calmodulin, partial [Aspergillus quadrilineatus]
 gb|ABW72607.1| calmodulin, partial [Aspergillus sp. NRRL 4993]
 gb|ABW72608.1| calmodulin, partial [Aspergillus asperescens]
 gb|ABW72609.1| calmodulin, partial [Aspergillus raperi]
 gb|ABW72610.1| calmodulin, partial [Aspergillus unguis]
 gb|ABW72611.1| calmodulin, partial [Aspergillus puniceus]
 gb|ABW72612.1| calmodulin, partial [Aspergillus heterothallicus]
 gb|ABW72613.1| calmodulin, partial [Aspergillus heterothallicus]
 gb|ABW72614.1| calmodulin, partial [Aspergillus aureolatus]
 gb|ABW72615.1| calmodulin, partial [Aspergillus elongatus]
 gb|ABW72616.1| calmodulin, partial [Aspergillus amylovorus]
 gb|ABW72617.1| calmodulin, partial [Aspergillus egyptiacus]
 gb|ABW72618.1| calmodulin, partial [Emericella desertorum]
 gb|ABW72619.1| calmodulin, partial [Emericella purpurea]
 gb|ABW72620.1| calmodulin, partial [Aspergillus pseudodeflectus]
 gb|ABW72621.1| calmodulin, partial [Aspergillus cavernicola]
 gb|ABW72622.1| calmodulin, partial [Aspergillus unguis]
 gb|ABW72623.1| calmodulin, partial [Emericella spectabilis]
 gb|ABW72624.1| calmodulin, partial [Emericella bicolor]
 gb|ADE19199.1| calmodulin, partial [Merimbla ingelheimensis]
 emb|CBY85688.2| calmodulin, partial [Aspergillus persii]
 emb|CBY85689.2| calmodulin, partial [Aspergillus sp. CCF 4008]
 emb|CBY85698.2| calmodulin, partial [Aspergillus sp. CCF 1893]
 emb|CCE25963.2| calmodulin, partial [Aspergillus sp. CCF 4081]
 emb|CCF78824.2| calmodulin, partial [Aspergillus insulicola]
Length=133

 Score =   132 bits (331),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  53   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  112

Query  439  VDEMIREADVDGDGQINYEEF  501
            VDEMIREAD DGDG+I+Y EF
Sbjct  113  VDEMIREADQDGDGRIDYNEF  133


 Score =   115 bits (289),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +3

Query  102  ISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            +SE+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    VSEYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  60


 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  64   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  123

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  124  GDGRIDYNEF  133


 Score = 58.2 bits (139),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  3    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  62

Query  508  VMMAK  522
            +M  K
Sbjct  63   MMARK  67



>gb|AAS15767.1| calmodulin, partial [Penicillium jensenii]
Length=134

 Score =   134 bits (338),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  51   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  110

Query  439  VDEMIREADVDGDGQINYEEFVKV  510
            VDEMIREAD DGDG+I+Y EFV++
Sbjct  111  VDEMIREADQDGDGRIDYNEFVQL  134


 Score =   112 bits (281),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 53/58 (91%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +3

Query  108  EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            E+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  58


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  62   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  121

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  122  GDGRIDYNEF  131


 Score = 58.5 bits (140),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  1    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  60

Query  508  VMMAK  522
            +M  K
Sbjct  61   MMARK  65



>gb|AGR66924.1| calmodulin, partial [Colletotrichum citri]
Length=136

 Score =   137 bits (346),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  49   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  108

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD  GDG+I+Y EFV++MM K
Sbjct  109  VDEMIREADQGGDGRIDYNEFVQLMMQK  136


 Score =   109 bits (273),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +3

Query  114  KEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    KEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  56


 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D  
Sbjct  60   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQG  119

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  120  GDGRIDYNEF  129


 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +1

Query  334  KEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVM  513
            KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ +M
Sbjct  1    KEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLTMM  60

Query  514  MAK  522
              K
Sbjct  61   ARK  63



>gb|ABS29367.1| calmodulin, partial [Aspergillus janus]
Length=134

 Score =   129 bits (324),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  54   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  113

Query  439  VDEMIREADVDGDGQINY  492
            VDEMIREAD DGDG+I+Y
Sbjct  114  VDEMIREADQDGDGRIDY  131


 Score =   118 bits (295),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 55/61 (90%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +3

Query  99   QISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPE  278
            Q+SE+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPE
Sbjct  1    QVSEYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPE  60

Query  279  F  281
            F
Sbjct  61   F  61


 Score = 58.5 bits (140),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  4    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  63

Query  508  VMMAK  522
            +M  K
Sbjct  64   MMARK  68


 Score = 58.2 bits (139),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 44/67 (66%), Gaps = 1/67 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  65   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  124

Query  252  GNGTIDF  272
            G+G ID+
Sbjct  125  GDGRIDY  131



>emb|CCA30568.1| calmodulin, partial [Aspergillus kanagawaensis]
Length=134

 Score =   125 bits (314),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  58   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  117

Query  439  VDEMIREADVDGDGQIN  489
            VDEMIREAD DGDG+I+
Sbjct  118  VDEMIREADQDGDGRID  134


 Score =   121 bits (304),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +3

Query  87   LTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTI  266
            LT++Q+SE+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTI
Sbjct  1    LTEEQVSEYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTI  60

Query  267  DFPEF  281
            DFPEF
Sbjct  61   DFPEF  65


 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  8    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  67

Query  508  VMMAK  522
            +M  K
Sbjct  68   MMARK  72


 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 1/66 (2%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  69   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  128

Query  252  GNGTID  269
            G+G ID
Sbjct  129  GDGRID  134



>gb|ABW17529.1| calmodulin [Aspergillus ostianus]
Length=133

 Score =   130 bits (328),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT+ GEKLTD+E
Sbjct  53   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSSGEKLTDDE  112

Query  439  VDEMIREADVDGDGQINYEEF  501
            VDEMIREAD DGDG+I+Y+EF
Sbjct  113  VDEMIREADQDGDGRIDYKEF  133


 Score =   115 bits (289),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +3

Query  102  ISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            +SE+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    VSEYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  60


 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S G+  T+ E+ +MI E D D
Sbjct  64   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSSGEKLTDDEVDEMIREADQD  123

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  124  GDGRIDYKEF  133


 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  3    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  62

Query  508  VMMAK  522
            +M  K
Sbjct  63   MMARK  67



>gb|AHH28236.1| calmodulin, partial [Penicillium fusisporum]
Length=132

 Score =   128 bits (322),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  54   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  113

Query  439  VDEMIREADVDGDGQINY  492
            VDEMIREAD DGDG+I+Y
Sbjct  114  VDEMIREADQDGDGRIDY  131


 Score =   118 bits (295),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 55/61 (90%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +3

Query  99   QISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPE  278
            Q+SE+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPE
Sbjct  1    QVSEYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPE  60

Query  279  F  281
            F
Sbjct  61   F  61


 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  4    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  63

Query  508  VMMAK  522
            +M  K
Sbjct  64   MMARK  68


 Score = 58.2 bits (139),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 44/67 (66%), Gaps = 1/67 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  65   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  124

Query  252  GNGTIDF  272
            G+G ID+
Sbjct  125  GDGRIDY  131



>gb|ACZ69450.1| calmodulin, partial [Colletotrichum fructicola]
 gb|ACZ69451.1| calmodulin, partial [Colletotrichum boninense]
 gb|ACZ69452.1| calmodulin, partial [Colletotrichum truncatum]
 gb|ACZ69453.1| calmodulin, partial [Colletotrichum boninense]
 gb|ACZ69454.1| calmodulin, partial [Colletotrichum hymenocallidis]
 gb|ACZ69455.1| calmodulin, partial [Colletotrichum cliviae]
 gb|ACZ69457.1| calmodulin, partial [Colletotrichum trichellum]
 gb|ACZ69458.1| calmodulin, partial [Colletotrichum siamense]
 gb|ACZ69459.1| calmodulin, partial [Colletotrichum coccodes]
 gb|ACZ69460.1| calmodulin, partial [Colletotrichum hippeastri]
 gb|ACZ69461.1| calmodulin, partial [Colletotrichum hippeastri]
Length=134

 Score =   140 bits (354),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  47   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  106

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  107  VDEMIREADQDGDGRIDYNEFVQLMMQK  134


 Score =   105 bits (263),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 50/54 (93%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  120  AFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            AFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    AFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  54


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  58   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  117

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  118  GDGRIDYNEF  127


 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +1

Query  340  AFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMA  519
            AF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ +M  
Sbjct  1    AFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLTMMAR  60

Query  520  K  522
            K
Sbjct  61   K  61



>gb|ABW72598.1| calmodulin, partial [Aspergillus subsessilis]
 gb|ABW72599.1| calmodulin, partial [Aspergillus subsessilis]
 gb|ABW72600.1| calmodulin, partial [Aspergillus subsessilis]
Length=133

 Score =   130 bits (328),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFIS+AELRHVMT++GEKLTD+E
Sbjct  53   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISSAELRHVMTSIGEKLTDDE  112

Query  439  VDEMIREADVDGDGQINYEEF  501
            VDEMIREAD DGDG+I+Y EF
Sbjct  113  VDEMIREADQDGDGRIDYNEF  133


 Score =   115 bits (289),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +3

Query  102  ISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            +SE+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    VSEYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  60


 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I++ EL  VM S+G+  T+ E+ +MI E D D
Sbjct  64   MARKMKDTDSEEEIREAFKVFDRDNNGFISSAELRHVMTSIGEKLTDDEVDEMIREADQD  123

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  124  GDGRIDYNEF  133


 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  3    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  62

Query  508  VMMAK  522
            +M  K
Sbjct  63   MMARK  67



>dbj|BAK64559.1| calmodulin, partial [Aspergillus unguis]
Length=135

 Score =   125 bits (314),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  58   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  117

Query  439  VDEMIREADVDGDGQIN  489
            VDEMIREAD DGDG+I+
Sbjct  118  VDEMIREADQDGDGRID  134


 Score =   121 bits (303),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +3

Query  87   LTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTI  266
            LT++Q+SE+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTI
Sbjct  1    LTEEQVSEYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTI  60

Query  267  DFPEF  281
            DFPEF
Sbjct  61   DFPEF  65


 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  8    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  67

Query  508  VMMAK  522
            +M  K
Sbjct  68   MMARK  72


 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 1/66 (2%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  69   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  128

Query  252  GNGTID  269
            G+G ID
Sbjct  129  GDGRID  134



>emb|CCM43800.1| Calmodulin, partial [Aspergillus aculeatus]
Length=133

 Score =   139 bits (349),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  48   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  107

Query  439  VDEMIREADVDGDGQINYEEFVKVMM  516
            VDEMIREAD DGDG+I+Y EFV++MM
Sbjct  108  VDEMIREADQDGDGRIDYNEFVQLMM  133


 Score =   107 bits (267),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 51/55 (93%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +3

Query  117  EAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            EAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    EAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  55


 Score = 61.2 bits (147),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  59   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  118

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  119  GDGRIDYNEF  128


 Score = 55.1 bits (131),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = +1

Query  337  EAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMM  516
            EAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ +M 
Sbjct  1    EAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLTMMA  60

Query  517  AK  522
             K
Sbjct  61   RK  62



>emb|CCD10983.1| calmodulin, partial [Aspergillus aculeatus]
 emb|CCD10987.1| calmodulin, partial [Aspergillus floridensis]
 emb|CCD10993.1| calmodulin, partial [Aspergillus penicillioides]
 dbj|BAK64561.1| calmodulin [Emericella violacea]
Length=133

 Score =   125 bits (314),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  57   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  116

Query  439  VDEMIREADVDGDGQIN  489
            VDEMIREAD DGDG+I+
Sbjct  117  VDEMIREADQDGDGRID  133


 Score =   120 bits (300),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +3

Query  90   TDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTID  269
            T++Q+SE+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTID
Sbjct  1    TEEQVSEYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTID  60

Query  270  FPEF  281
            FPEF
Sbjct  61   FPEF  64


 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  7    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  66

Query  508  VMMAK  522
            +M  K
Sbjct  67   MMARK  71


 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 1/66 (2%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  68   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  127

Query  252  GNGTID  269
            G+G ID
Sbjct  128  GDGRID  133



>ref|XP_009420538.1| PREDICTED: calmodulin-like [Musa acuminata subsp. malaccensis]
Length=189

 Score =   134 bits (337),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 76/88 (86%), Gaps = 1/88 (1%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FLNLMARKM   DSEEELKEAFRVFDKDQNGFISAAEL  VM NLGE+LTDEE
Sbjct  62   GTIDFPEFLNLMARKMH-ADSEEELKEAFRVFDKDQNGFISAAELHDVMVNLGEQLTDEE  120

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            V+EM+READ + DGQI+Y+EFVKVM+AK
Sbjct  121  VNEMMREADSNSDGQIDYKEFVKVMIAK  148


 Score =   110 bits (276),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+ LT +QI+EFKEAFSLFDKDG+G ITTKEL  V+R+ GQNPTEAEL++MINEVDAD 
Sbjct  1    MAELLTREQIAEFKEAFSLFDKDGNGHITTKELENVLRTRGQNPTEAELEEMINEVDADK  60

Query  255  NGTIDFPEF  281
            +GTIDFPEF
Sbjct  61   SGTIDFPEF  69


 Score = 62.4 bits (150),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD NG I+  EL +V+   G+  T+ E++EMI E D D  G I++ EF+ 
Sbjct  12   EFKEAFSLFDKDGNGHITTKELENVLRTRGQNPTEAELEEMINEVDADKSGTIDFPEFLN  71

Query  508  VMMAK  522
            +M  K
Sbjct  72   LMARK  76


 Score = 61.6 bits (148),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA ++  D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +M+ E D++ 
Sbjct  73   MARKMHADSEEELKEAFRVFDKDQNGFISAAELHDVMVNLGEQLTDEEVNEMMREADSNS  132

Query  255  NGTIDFPEF  281
            +G ID+ EF
Sbjct  133  DGQIDYKEF  141



>gb|ADW19791.1| calmodulin, partial [Colletotrichum boninense]
 gb|ADW19793.1| calmodulin, partial [Colletotrichum boninense]
 gb|ADW19798.1| calmodulin, partial [Colletotrichum karstii]
 gb|ADW19800.1| calmodulin, partial [Colletotrichum karstii]
Length=133

 Score =   140 bits (353),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  46   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  105

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  106  VDEMIREADQDGDGRIDYNEFVQLMMQK  133


 Score =   104 bits (259),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +3

Query  123  FSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            FSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    FSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  53


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  57   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  116

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  117  GDGRIDYNEF  126


 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  343  FRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK  522
            F +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ +M  K
Sbjct  1    FSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLTMMARK  60



>gb|AFM38207.1| calmodulin, partial [Aspergillus sp. LW-2012]
 gb|AFM38208.1| calmodulin, partial [Aspergillus sp. LW-2012]
 gb|AGI48635.1| calmodulin, partial [Penicillium bialowiezense]
 gb|AGI48636.1| calmodulin, partial [Penicillium bialowiezense]
 gb|AGI48637.1| calmodulin, partial [Penicillium bialowiezense]
 gb|AGI48638.1| calmodulin, partial [Penicillium bialowiezense]
 gb|AGI48639.1| calmodulin, partial [Penicillium bialowiezense]
 gb|AGI48640.1| calmodulin, partial [Penicillium bialowiezense]
 gb|AGI48641.1| calmodulin, partial [Penicillium bialowiezense]
 gb|AGI48642.1| calmodulin, partial [Penicillium bialowiezense]
 gb|AGI48643.1| calmodulin, partial [Penicillium bialowiezense]
 gb|AGI48644.1| calmodulin, partial [Penicillium brevicompactum]
 gb|AGI48645.1| calmodulin, partial [Penicillium kongii]
 gb|AGI48646.1| calmodulin, partial [Penicillium kongii]
 gb|AGI48647.1| calmodulin, partial [Penicillium kongii]
 gb|AGI48648.1| calmodulin, partial [Penicillium kongii]
 gb|AGI48649.1| calmodulin, partial [Penicillium spathulatum]
 gb|AGI48650.1| calmodulin, partial [Penicillium kongii]
 gb|AGI48651.1| calmodulin, partial [Penicillium spathulatum]
 gb|AGI48652.1| calmodulin, partial [Penicillium spathulatum]
 gb|AGI48653.1| calmodulin, partial [Penicillium kongii]
 gb|AGI48654.1| calmodulin, partial [Penicillium tularense]
 gb|AGM48390.1| calmodulin, partial [Aspergillus fumigatus]
 gb|AGM48391.1| calmodulin, partial [Aspergillus fumigatus]
 gb|AGM48392.1| calmodulin, partial [Aspergillus fumigatus]
 gb|AGM48393.1| calmodulin, partial [Aspergillus fumigatus]
 gb|AGM48394.1| calmodulin, partial [Aspergillus fumigatus]
 gb|AGM48395.1| calmodulin, partial [Aspergillus fumigatus]
 gb|AGM48396.1| calmodulin, partial [Aspergillus fumigatus]
 gb|AGM48397.1| calmodulin, partial [Aspergillus fumigatus]
 gb|AGM48398.1| calmodulin, partial [Aspergillus fumigatus]
 gb|AGM48399.1| calmodulin, partial [Aspergillus fumigatus]
 gb|AGM48400.1| calmodulin, partial [Aspergillus fumigatus]
 gb|AGM48401.1| calmodulin, partial [Aspergillus fumigatus]
 gb|AGM48402.1| calmodulin, partial [Aspergillus fumigatus]
 gb|AGM48403.1| calmodulin, partial [Aspergillus fumigatus]
 gb|AGM48404.1| calmodulin, partial [Aspergillus fumigatus]
 gb|AGM48405.1| calmodulin, partial [Aspergillus fumigatus]
 gb|AGM48406.1| calmodulin, partial [Aspergillus fumigatus]
 gb|AGM48407.1| calmodulin, partial [Aspergillus fumigatus]
 gb|AGM48408.1| calmodulin, partial [Aspergillus fumigatus]
 gb|AGM48409.1| calmodulin, partial [Aspergillus fumigatus]
 gb|AGM48410.1| calmodulin, partial [Aspergillus fumigatus]
 gb|AGM48411.1| calmodulin, partial [Aspergillus fumigatus]
 gb|AGM48412.1| calmodulin, partial [Aspergillus fumigatus]
 gb|AGM48413.1| calmodulin, partial [Aspergillus neoellipticus]
 gb|AGM48414.1| calmodulin, partial [Aspergillus neoellipticus]
 gb|AGM48415.1| calmodulin, partial [Aspergillus neoellipticus]
 gb|AGM48416.1| calmodulin, partial [Aspergillus neoellipticus]
 gb|AGM48417.1| calmodulin, partial [Aspergillus neoellipticus]
 gb|AGM48418.1| calmodulin, partial [Aspergillus neoellipticus]
 gb|AGM48419.1| calmodulin, partial [Aspergillus neoellipticus]
 gb|AGM48420.1| calmodulin, partial [Aspergillus neoellipticus]
 gb|AGM48421.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48422.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48423.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48424.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48425.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48426.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48427.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48428.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48429.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48430.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48431.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48432.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48433.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48434.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48435.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48436.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48437.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48438.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48439.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48440.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48441.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48442.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48443.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48444.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48445.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48446.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48447.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48448.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48449.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48450.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48451.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48452.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48453.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48454.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48455.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48456.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48457.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48458.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48459.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48460.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48461.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48462.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48463.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48464.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48465.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48466.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48467.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48468.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48469.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48470.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48471.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48472.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48473.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48474.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48475.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48476.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48477.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48478.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48479.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGM48480.1| calmodulin, partial [Aspergillus phialiseptatus]
 gb|AGX85589.1| calmodulin, partial [Penicillium glabrum]
 gb|AGX85590.1| calmodulin, partial [Penicillium qii]
 gb|AGX85591.1| calmodulin, partial [Penicillium qii]
 gb|AGX85592.1| calmodulin, partial [Penicillium qii]
 gb|AGX85593.1| calmodulin, partial [Penicillium viticola]
 gb|AGX85594.1| calmodulin, partial [Penicillium glabrum]
 gb|AGX85595.1| calmodulin, partial [Penicillium qii]
 gb|AGX85596.1| calmodulin, partial [Penicillium guanacastense]
 gb|AGX85597.1| calmodulin, partial [Penicillium guanacastense]
 gb|AGX85598.1| calmodulin, partial [Penicillium qii]
 gb|AHH28232.1| calmodulin, partial [Penicillium fusisporum]
 gb|AHH28233.1| calmodulin, partial [Penicillium flavescens]
 gb|AHH28234.1| calmodulin, partial [Penicillium flavescens]
 gb|AHH28235.1| calmodulin, partial [Penicillium flavescens]
 gb|AHH28237.1| calmodulin, partial [Penicillium glabrum]
 gb|AHH28238.1| calmodulin, partial [Penicillium glabrum]
 gb|AHH28239.1| calmodulin, partial [Penicillium lividum]
 gb|AHH28240.1| calmodulin, partial [Penicillium sp. AS3.15349]
 gb|AHH28241.1| calmodulin, partial [Penicillium zhuangii]
 gb|AHH28242.1| calmodulin, partial [Penicillium zhuangii]
 gb|AIJ50599.1| CaM, partial [Aspergillus fumigatus]
 gb|AIJ50600.1| CaM, partial [Aspergillus fumigatus]
 gb|AFD94170.3| calmodulin, partial [Aspergillus ustus]
 gb|AFD94171.3| calmodulin, partial [Aspergillus calidoustus]
 gb|AFD94173.3| calmodulin, partial [Aspergillus heterothallicus]
 gb|AFD94174.3| calmodulin, partial [Aspergillus pseudodeflectus]
 gb|AFD94179.3| calmodulin, partial [Aspergillus keveii]
 gb|AJI02610.1| CaM, partial [Penicillium daejeonium]
Length=131

 Score =   129 bits (323),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  53   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  112

Query  439  VDEMIREADVDGDGQINY  492
            VDEMIREAD DGDG+I+Y
Sbjct  113  VDEMIREADQDGDGRIDY  130


 Score =   115 bits (289),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +3

Query  102  ISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            +SE+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    VSEYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  60


 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  3    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  62

Query  508  VMMAK  522
            +M  K
Sbjct  63   MMARK  67


 Score = 58.2 bits (139),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 44/67 (66%), Gaps = 1/67 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  64   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  123

Query  252  GNGTIDF  272
            G+G ID+
Sbjct  124  GDGRIDY  130



>ref|XP_009420537.1| PREDICTED: calmodulin-2-like [Musa acuminata subsp. malaccensis]
Length=188

 Score =   128 bits (321),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 75/88 (85%), Gaps = 1/88 (1%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F+ FLNLMA KM +  SEEELKEAFRVFDKDQNGFISA ELR+V+ NLGEKLTDEE
Sbjct  62   GTIDFKEFLNLMAHKM-NAGSEEELKEAFRVFDKDQNGFISAVELRNVLVNLGEKLTDEE  120

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            ++EM+ EAD + DGQI+Y+EF+KVM AK
Sbjct  121  INEMMHEADTNNDGQIDYKEFIKVMNAK  148


 Score =   116 bits (290),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD L  +QI+EFKEAFSLFDKDG+G ITTKELG VMR+LGQNPTEAELQDMINEVDAD 
Sbjct  1    MADLLAPEQIAEFKEAFSLFDKDGNGHITTKELGNVMRTLGQNPTEAELQDMINEVDADR  60

Query  255  NGTIDFPEF  281
            +GTIDF EF
Sbjct  61   SGTIDFKEF  69


 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD NG I+  EL +VM  LG+  T+ E+ +MI E D D  G I+++EF+ 
Sbjct  12   EFKEAFSLFDKDGNGHITTKELGNVMRTLGQNPTEAELQDMINEVDADRSGTIDFKEFLN  71

Query  508  VMMAK  522
            +M  K
Sbjct  72   LMAHK  76


 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA ++      E KEAF +FDKD +G I+  EL  V+ +LG+  T+ E+ +M++E D + 
Sbjct  73   MAHKMNAGSEEELKEAFRVFDKDQNGFISAVELRNVLVNLGEKLTDEEINEMMHEADTNN  132

Query  255  NGTIDFPEF  281
            +G ID+ EF
Sbjct  133  DGQIDYKEF  141



>emb|CCM43802.1| calmodulin, partial [Aspergillus fijiensis]
Length=132

 Score =   139 bits (349),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  47   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  106

Query  439  VDEMIREADVDGDGQINYEEFVKVMM  516
            VDEMIREAD DGDG+I+Y EFV++MM
Sbjct  107  VDEMIREADQDGDGRIDYNEFVQLMM  132


 Score =   105 bits (263),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 50/54 (93%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  120  AFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            AFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    AFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  54


 Score = 61.2 bits (147),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  58   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  117

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  118  GDGRIDYNEF  127


 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +1

Query  340  AFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMA  519
            AF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ +M  
Sbjct  1    AFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLTMMAR  60

Query  520  K  522
            K
Sbjct  61   K  61



>gb|ABQ00515.1| calmodulin, partial [Penicillium angulare]
 gb|ABQ00517.1| calmodulin, partial [Penicillium glandicola]
 gb|ABQ00518.1| calmodulin, partial [Penicillium commune]
 gb|ABV82900.1| calmodulin, partial [Aspergillus robustus]
 gb|ABV82901.1| calmodulin, partial [Aspergillus diversus]
 gb|ABV82902.1| calmodulin, partial [Aspergillus diversus]
 gb|ABV82903.1| calmodulin, partial [Aspergillus biplanus]
 gb|ABV82904.1| calmodulin, partial [Aspergillus biplanus]
 gb|ABV82905.1| calmodulin, partial [Aspergillus biplanus]
 gb|ABV82906.1| calmodulin, partial [Aspergillus conjunctus]
 gb|ABV82907.1| calmodulin, partial [Aspergillus anthodesmis]
 gb|ABV82908.1| calmodulin, partial [Aspergillus panamensis]
 gb|ABV82909.1| calmodulin, partial [Aspergillus panamensis]
 gb|ABV82910.1| calmodulin, partial [Aspergillus ochraceoroseus]
 gb|ABV82911.1| calmodulin, partial [Aspergillus bisporus]
 gb|ABV82912.1| calmodulin, partial [Aspergillus bisporus]
 gb|ABV82913.1| calmodulin, partial [Aspergillus bisporus]
 gb|ABV82914.1| calmodulin, partial [Aspergillus japonicus]
 gb|ABV82915.1| calmodulin, partial [Aspergillus japonicus]
 gb|ABV82916.1| calmodulin, partial [Aspergillus japonicus]
 gb|ABV82917.1| calmodulin, partial [Aspergillus japonicus]
 gb|ABV82918.1| calmodulin, partial [Aspergillus aculeatus]
 gb|ABV82919.1| calmodulin, partial [Aspergillus aculeatus]
 gb|ABV82920.1| calmodulin, partial [Aspergillus aculeatus]
 gb|ABV82921.1| calmodulin, partial [Aspergillus aculeatus]
 gb|ABV82922.1| calmodulin, partial [Aspergillus tubingensis]
 gb|ABV82923.1| calmodulin, partial [Aspergillus tubingensis]
 gb|ABV82925.1| calmodulin, partial [Aspergillus tubingensis]
 gb|ABV82926.1| calmodulin, partial [Aspergillus niger]
 gb|ABV82927.1| calmodulin, partial [Aspergillus niger]
 gb|ABV82928.1| calmodulin, partial [Aspergillus niger]
 gb|ABV82929.1| calmodulin, partial [Aspergillus niger]
 gb|ABV82930.1| calmodulin, partial [Aspergillus niger]
 gb|ABV82931.1| calmodulin, partial [Aspergillus niger]
 gb|ABV82932.1| calmodulin, partial [Aspergillus brasiliensis]
 gb|ABV82933.1| calmodulin, partial [Aspergillus brasiliensis]
 gb|ABV82934.1| calmodulin, partial [Aspergillus brasiliensis]
 gb|ABV82935.1| calmodulin, partial [Aspergillus brasiliensis]
 gb|ABV82936.1| calmodulin, partial [Aspergillus ibericus]
 gb|ABV82937.1| calmodulin, partial [Aspergillus ibericus]
 gb|ABV82938.1| calmodulin, partial [Aspergillus carbonarius]
 gb|ABV82939.1| calmodulin, partial [Aspergillus carbonarius]
 gb|ABV82940.1| calmodulin, partial [Aspergillus carbonarius]
 gb|ABV82941.1| calmodulin, partial [Aspergillus carbonarius]
 gb|ABV82942.1| calmodulin, partial [Aspergillus heteromorphus]
 gb|ABV82943.1| calmodulin, partial [Aspergillus ellipticus]
 gb|ABV82944.1| calmodulin, partial [Aspergillus sparsus]
 gb|ABV82945.1| calmodulin, partial [Aspergillus sparsus]
 gb|ABV82946.1| calmodulin, partial [Aspergillus sparsus]
 gb|ABV82947.1| calmodulin, partial [Aspergillus sparsus]
 gb|ABV82948.1| calmodulin, partial [Aspergillus funiculosus]
 gb|ABW04760.1| calmodulin, partial [Aspergillus robustus]
 gb|ABW04761.1| calmodulin, partial [Aspergillus bridgeri]
 gb|ABW04762.1| calmodulin, partial [Aspergillus neobridgeri]
 gb|ABW04763.1| calmodulin, partial [Aspergillus westerdijkiae]
 gb|ABW04764.1| calmodulin, partial [Aspergillus sclerotiorum]
 gb|ABW04765.1| calmodulin, partial [Aspergillus sp. NRRL 35028]
 gb|ABW04766.1| calmodulin, partial [Aspergillus ochraceus]
 gb|ABW04767.1| calmodulin, partial [Aspergillus sp. NRRL 35056]
 gb|ABW04768.1| calmodulin, partial [Aspergillus muricatus]
 gb|ABW04769.1| calmodulin, partial [Aspergillus bridgeri]
 gb|ABW04770.1| calmodulin, partial [Aspergillus sulphureus]
 gb|ABW04771.1| calmodulin, partial [Aspergillus robustus]
 gb|ABW04772.1| calmodulin, partial [Aspergillus steynii]
 gb|ABW04773.1| calmodulin, partial [Aspergillus melleus]
 gb|ABW04774.1| calmodulin, partial [Aspergillus ochraceopetaliformis]
 gb|ABW04775.1| calmodulin, partial [Aspergillus persii]
 gb|ABW04776.1| calmodulin, partial [Aspergillus pseudoelegans]
 gb|ABW04777.1| calmodulin, partial [Aspergillus pseudoelegans]
 gb|ABW04778.1| calmodulin, partial [Aspergillus cretensis]
 gb|ABW04779.1| calmodulin, partial [Aspergillus cretensis]
 gb|ABW04780.1| calmodulin, partial [Aspergillus muricatus]
 gb|ABW04781.1| calmodulin, partial [Aspergillus steynii]
 gb|ABW04782.1| calmodulin, partial [Aspergillus auricomus]
 gb|ABW04783.1| calmodulin, partial [Aspergillus auricomus]
 gb|ABW04784.1| calmodulin, partial [Aspergillus ochraceus]
 gb|ABW04785.1| calmodulin, partial [Aspergillus sulphureus]
 gb|ABW04786.1| calmodulin, partial [Aspergillus elegans]
 gb|ABW04787.1| calmodulin, partial [Aspergillus sclerotiorum]
 gb|ABW04788.1| calmodulin, partial [Aspergillus ostianus]
 gb|ABW04789.1| calmodulin, partial [Aspergillus roseoglobosus]
 gb|ABW04790.1| calmodulin, partial [Aspergillus sp. NRRL 4748]
 gb|ABW04791.1| calmodulin, partial [Aspergillus ochraceopetaliformis]
 gb|ABW04792.1| calmodulin, partial [Aspergillus sp. NRRL 4789]
 gb|ABW04793.1| calmodulin, partial [Aspergillus elegans]
 gb|ABW04794.1| calmodulin, partial [Aspergillus melleus]
 gb|ABW04795.1| calmodulin, partial [Aspergillus subramanianii]
 gb|ABW04796.1| calmodulin, partial [Aspergillus westerdijkiae]
 gb|ABW04797.1| calmodulin, partial [Aspergillus ochraceopetaliformis]
 gb|ABW04799.1| calmodulin, partial [Aspergillus insulicola]
 gb|ABW04800.1| calmodulin, partial [Aspergillus subramanianii]
 gb|ABW69694.1| calmodulin, partial [Aspergillus avenaceus]
 gb|ABW69695.1| calmodulin, partial [Aspergillus avenaceus]
 gb|ABW69696.1| calmodulin, partial [Aspergillus flavus]
 gb|ABW69697.1| calmodulin, partial [Aspergillus oryzae]
 gb|ABW69698.1| calmodulin, partial [Aspergillus flavus]
 gb|ABW69699.1| calmodulin, partial [Aspergillus flavus]
 gb|ABW69700.1| calmodulin, partial [Aspergillus flavus]
 gb|ABW69701.1| calmodulin, partial [Aspergillus flavus]
 gb|ABW69702.1| calmodulin, partial [Aspergillus flavus]
 gb|ABW69703.1| calmodulin, partial [Aspergillus flavus]
 gb|ABW69704.1| calmodulin, partial [Aspergillus flavus]
 gb|ABW69705.1| calmodulin, partial [Aspergillus flavus]
 gb|ABW69706.1| calmodulin, partial [Aspergillus parasiticus]
 gb|ABW69707.1| calmodulin, partial [Aspergillus parasiticus]
 gb|ABW69708.1| calmodulin, partial [Aspergillus parasiticus]
 gb|ABW69709.1| calmodulin, partial [Aspergillus parasiticus]
 gb|ABW69710.1| calmodulin, partial [Aspergillus parasiticus]
 gb|ABW69711.1| calmodulin, partial [Aspergillus pseudotamarii]
 gb|ABW69712.1| calmodulin, partial [Aspergillus pseudotamarii]
 gb|ABW69713.1| calmodulin, partial [Aspergillus caelatus]
 gb|ABW69715.1| calmodulin, partial [Aspergillus tamarii]
 gb|ABW69716.1| calmodulin, partial [Aspergillus tamarii]
 gb|ABW69717.1| calmodulin, partial [Aspergillus tamarii]
 gb|ABW69718.1| calmodulin, partial [Aspergillus tamarii]
 gb|ABW69720.1| calmodulin, partial [Aspergillus nomius]
 gb|ABW69721.1| calmodulin, partial [Aspergillus nomius]
 gb|ABW69722.1| calmodulin, partial [Aspergillus nomius]
 gb|ABW69723.1| calmodulin, partial [Aspergillus bombycis]
 gb|ABW69724.1| calmodulin, partial [Aspergillus bombycis]
 gb|ABW69725.1| calmodulin, partial [Aspergillus alliaceus]
 gb|ABW69726.1| calmodulin, partial [Aspergillus alliaceus]
 gb|ABW69727.1| calmodulin, partial [Aspergillus alliaceus]
 gb|ABW69729.1| calmodulin, partial [Aspergillus alliaceus]
 gb|ABW69730.1| calmodulin, partial [Aspergillus lanosus]
 gb|ABW69732.1| calmodulin, partial [Aspergillus leporis]
 gb|ABW69733.1| calmodulin, partial [Aspergillus leporis]
 gb|ABW72538.1| calmodulin, partial [Aspergillus puniceus]
 gb|AFP66106.1| calmodulin, partial [Aspergillus creber]
 gb|AFP66107.1| calmodulin, partial [Aspergillus amoenus]
Length=131

 Score =   132 bits (331),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  51   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  110

Query  439  VDEMIREADVDGDGQINYEEF  501
            VDEMIREAD DGDG+I+Y EF
Sbjct  111  VDEMIREADQDGDGRIDYNEF  131


 Score =   112 bits (280),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 53/58 (91%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +3

Query  108  EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            E+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  58


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  62   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  121

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  122  GDGRIDYNEF  131


 Score = 58.2 bits (139),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  1    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  60

Query  508  VMMAK  522
            +M  K
Sbjct  61   MMARK  65



>gb|ACZ69456.1| calmodulin, partial [Colletotrichum siamense]
Length=134

 Score =   138 bits (348),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKD DSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  47   GTIDFPEFLTMMARKMKDIDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  106

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  107  VDEMIREADQDGDGRIDYNEFVQLMMQK  134


 Score =   106 bits (264),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 50/54 (93%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  120  AFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            AFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    AFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  54


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  58   MARKMKDIDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  117

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  118  GDGRIDYNEF  127


 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +1

Query  340  AFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMA  519
            AF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ +M  
Sbjct  1    AFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLTMMAR  60

Query  520  K  522
            K
Sbjct  61   K  61



>gb|ABQ00498.1| calmodulin, partial [Penicillium sp. NRRL 35620]
Length=134

 Score =   130 bits (326),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKL D+E
Sbjct  54   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLNDDE  113

Query  439  VDEMIREADVDGDGQINYEEF  501
            VDEMIREAD DGDG+I+Y EF
Sbjct  114  VDEMIREADQDGDGRIDYNEF  134


 Score =   114 bits (285),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 52/61 (85%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +3

Query  99   QISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPE  278
            Q+SE+KEAF+LFDKDGDG IT KELGTVMRSLGQNP+E+ELQDMINEVD+D NGTIDFPE
Sbjct  1    QVSEYKEAFALFDKDGDGSITVKELGTVMRSLGQNPSESELQDMINEVDSDQNGTIDFPE  60

Query  279  F  281
            F
Sbjct  61   F  61


 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+   + E+ +MI E D D
Sbjct  65   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLNDDEVDEMIREADQD  124

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  125  GDGRIDYNEF  134


 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  4    EYKEAFALFDKDGDGSITVKELGTVMRSLGQNPSESELQDMINEVDSDQNGTIDFPEFLT  63

Query  508  VMMAK  522
            +M  K
Sbjct  64   MMARK  68



>gb|ACT80139.1| calmodulin, partial [Aspergillus ruber]
Length=137

 Score =   137 bits (346),  Expect(2) = 8e-56, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  50   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  109

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            V EMIREAD DGDG+I+Y EFV++MM K
Sbjct  110  VGEMIREADQDGDGRIDYNEFVQLMMQK  137


 Score =   106 bits (264),  Expect(2) = 8e-56, Method: Compositional matrix adjust.
 Identities = 52/58 (90%), Positives = 55/58 (95%), Gaps = 1/58 (2%)
 Frame = +3

Query  108  EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            E+KEAFSLFDKDGDG IT KELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    EYKEAFSLFDKDGDGQIT-KELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  57


 Score = 61.2 bits (147),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  61   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVGEMIREADQD  120

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  121  GDGRIDYNEF  130


 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 1/65 (2%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  1    EYKEAFSLFDKDGDGQITK-ELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  59

Query  508  VMMAK  522
            +M  K
Sbjct  60   MMARK  64



>emb|CCA30570.1| calmodulin, partial [Aspergillus costiformis]
 emb|CCA30571.1| calmodulin, partial [Neosartorya hiratsukae]
 emb|CCA41208.1| calmodulin, partial [Aspergillus stellifer]
 emb|CCA41209.1| calmodulin, partial [Aspergillus novofumigatus]
 emb|CCD10992.1| calmodulin, partial [Aspergillus penicillioides]
 emb|CCF55026.1| calmodulin, partial [Aspergillus carbonarius]
 emb|CCH63975.1| calmodulin, partial [Aspergillus brunneoviolaceus]
 emb|CCH63976.1| calmodulin, partial [Aspergillus brunneoviolaceus]
 emb|CCH63977.1| calmodulin, partial [Aspergillus brunneoviolaceus]
 emb|CCH63978.1| calmodulin, partial [Aspergillus brunneoviolaceus]
 emb|CCH63979.1| calmodulin, partial [Aspergillus floridensis]
 emb|CCH63980.1| calmodulin, partial [Aspergillus aculeatinus]
 emb|CCK33770.1| calmodulin, partial [Aspergillus unilateralis]
 emb|CCK33771.1| calmodulin, partial [Aspergillus marvanovae]
 emb|CCK33772.1| calmodulin, partial [Neosartorya multiplicata]
 emb|CCK33773.1| calmodulin, partial [Neosartorya nishimurae]
 emb|CCK33774.1| calmodulin, partial [Neosartorya nishimurae]
 dbj|BAM68214.1| calmodulin, partial [Penicillium brasilianum]
Length=132

 Score =   125 bits (314),  Expect(2) = 9e-56, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  56   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  115

Query  439  VDEMIREADVDGDGQIN  489
            VDEMIREAD DGDG+I+
Sbjct  116  VDEMIREADQDGDGRID  132


 Score =   118 bits (295),  Expect(2) = 9e-56, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +3

Query  93   DDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDF  272
            ++Q+SE+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDF
Sbjct  1    EEQVSEYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDF  60

Query  273  PEF  281
            PEF
Sbjct  61   PEF  63


 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  6    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  65

Query  508  VMMAK  522
            +M  K
Sbjct  66   MMARK  70


 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 1/66 (2%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  67   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  126

Query  252  GNGTID  269
            G+G ID
Sbjct  127  GDGRID  132



>gb|AFN53720.1| calmodulin, partial [Aspergillus terreus]
Length=144

 Score =   125 bits (315),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  57   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  116

Query  439  VDEMIREADVDGDGQIN  489
            VDEMIREAD DGDG+I+
Sbjct  117  VDEMIREADQDGDGRID  133


 Score =   117 bits (293),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +3

Query  93   DDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDF  272
            ++Q+SE+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDF
Sbjct  2    EEQVSEYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDF  61

Query  273  PEF  281
            PEF
Sbjct  62   PEF  64


 Score = 58.9 bits (141),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  7    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  66

Query  508  VMMAK  522
            +M  K
Sbjct  67   MMARK  71


 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 1/66 (2%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  68   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  127

Query  252  GNGTID  269
            G+G ID
Sbjct  128  GDGRID  133



>gb|ABU62609.1| calmodulin, partial [Penicillium parvulum]
Length=131

 Score =   125 bits (314),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  55   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  114

Query  439  VDEMIREADVDGDGQIN  489
            VDEMIREAD DGDG+I+
Sbjct  115  VDEMIREADQDGDGRID  131


 Score =   118 bits (295),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +3

Query  96   DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFP  275
            +Q+SE+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFP
Sbjct  1    EQVSEYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFP  60

Query  276  EF  281
            EF
Sbjct  61   EF  62


 Score = 58.2 bits (139),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  5    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  64

Query  508  VMMAK  522
            +M  K
Sbjct  65   MMARK  69


 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 1/66 (2%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  66   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  125

Query  252  GNGTID  269
            G+G ID
Sbjct  126  GDGRID  131



>gb|ABQ00453.1| calmodulin, partial [Penicillium meleagrinum var. viridiflavum]
 gb|ABQ00514.1| calmodulin, partial [Penicillium sp. NRRL 35682]
 gb|ADE19200.1| calmodulin, partial [Merimbla ingelheimensis]
 gb|ADE19206.1| calmodulin, partial [Merimbla ingelheimensis]
 gb|ADE19207.1| calmodulin, partial [Talaromyces leycettanus]
 emb|CCF78820.1| calmodulin, partial [Aspergillus terreus]
 gb|AFP66102.1| calmodulin, partial [Aspergillus amoenus]
 emb|CDG86169.1| calmodulin, partial [Aspergillus felis]
 emb|CDG86170.1| calmodulin, partial [Neosartorya udagawae]
 emb|CDG86171.1| calmodulin, partial [Aspergillus aureolus]
 emb|CDG86172.1| calmodulin, partial [Aspergillus aureolus]
 emb|CDG86173.1| calmodulin, partial [Aspergillus aureolus]
 emb|CDG86174.1| calmodulin, partial [Aspergillus wyomingensis]
 gb|AHF18206.1| calmodulin, partial [Aspergillus cristatus]
 emb|CDM22388.1| calmodulin, partial [Aspergillus tritici]
 emb|CDM22390.1| calmodulin, partial [Aspergillus tritici]
 emb|CDM22392.1| calmodulin, partial [Aspergillus pragensis]
 emb|CDM22393.1| calmodulin, partial [Aspergillus candidus]
 emb|CDM22437.1| calmodulin, partial [Aspergillus ardalensis]
 emb|CDM22444.1| calmodulin, partial [Aspergillus iizukae]
 emb|CDM22451.1| calmodulin, partial [Aspergillus mangaliensis]
 gb|AGN04149.2| calmodulin, partial [Aspergillus tubingensis]
 gb|AGN04151.2| calmodulin, partial [Aspergillus tubingensis]
 gb|AGN04152.2| calmodulin, partial [Aspergillus tubingensis]
 emb|CDW51708.1| calmodulin, partial [Aspergillus sp. 3 VH-2014]
 emb|CDW51709.1| calmodulin, partial [Aspergillus iizukae]
Length=130

 Score =   125 bits (314),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  54   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  113

Query  439  VDEMIREADVDGDGQIN  489
            VDEMIREAD DGDG+I+
Sbjct  114  VDEMIREADQDGDGRID  130


 Score =   118 bits (295),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 55/61 (90%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +3

Query  99   QISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPE  278
            Q+SE+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPE
Sbjct  1    QVSEYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPE  60

Query  279  F  281
            F
Sbjct  61   F  61


 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  4    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  63

Query  508  VMMAK  522
            +M  K
Sbjct  64   MMARK  68


 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 1/66 (2%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  65   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  124

Query  252  GNGTID  269
            G+G ID
Sbjct  125  GDGRID  130



>emb|CCE46006.2| calmodulin, partial [Aspergillus brunneoviolaceus]
 emb|CDM22394.1| calmodulin, partial [Aspergillus flavus]
Length=130

 Score =   134 bits (336),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  49   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  108

Query  439  VDEMIREADVDGDGQINYEEFV  504
            VDEMIREAD DGDG+I+Y EFV
Sbjct  109  VDEMIREADQDGDGRIDYNEFV  130


 Score =   109 bits (272),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +3

Query  114  KEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    KEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  56


 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  60   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  119

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  120  GDGRIDYNEF  129


 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +1

Query  334  KEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVM  513
            KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ +M
Sbjct  1    KEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLTMM  60

Query  514  MAK  522
              K
Sbjct  61   ARK  63



>ref|XP_002870301.1| hypothetical protein ARALYDRAFT_330049 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46560.1| hypothetical protein ARALYDRAFT_330049 [Arabidopsis lyrata subsp. 
lyrata]
Length=154

 Score =   137 bits (345),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FLNLMA+K++++D+EEELKEAF+VFDKDQNG+ISA+EL HVM NLGEKLTDEE
Sbjct  66   GTIEFAEFLNLMAKKLQESDAEEELKEAFKVFDKDQNGYISASELSHVMINLGEKLTDEE  125

Query  439  VDEMIREADVDGDGQINYEEFVKVMM  516
            V++MI+EAD+DGDGQ+NY+EFVK+M+
Sbjct  126  VEQMIKEADLDGDGQVNYDEFVKMMI  151


 Score =   105 bits (263),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +3

Query  87   LTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTI  266
            LT DQI+EFKEAF LFDKDGDGCIT +EL TV+RSL QNPTE ELQD+I E+D+D NGTI
Sbjct  9    LTKDQITEFKEAFCLFDKDGDGCITVEELATVIRSLDQNPTEQELQDIITEIDSDSNGTI  68

Query  267  DFPEF  281
            +F EF
Sbjct  69   EFAEF  73


 Score = 61.2 bits (147),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA +L + D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E++ MI E D D
Sbjct  77   MAKKLQESDAEEELKEAFKVFDKDQNGYISASELSHVMINLGEKLTDEEVEQMIKEADLD  136

Query  252  GNGTIDFPEF  281
            G+G +++ EF
Sbjct  137  GDGQVNYDEF  146


 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  V+ +L +  T++E+ ++I E D D +G I + EF+ 
Sbjct  16   EFKEAFCLFDKDGDGCITVEELATVIRSLDQNPTEQELQDIITEIDSDSNGTIEFAEFLN  75

Query  508  VMMAK  522
            +M  K
Sbjct  76   LMAKK  80



>gb|ABU55280.2| calmodulin, partial [Aspergillus fumigatus]
Length=130

 Score =   132 bits (331),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  50   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  109

Query  439  VDEMIREADVDGDGQINYEEF  501
            VDEMIREAD DGDG+I+Y EF
Sbjct  110  VDEMIREADQDGDGRIDYHEF  130


 Score =   110 bits (276),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  111  FKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            +KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    YKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  57


 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  61   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  120

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  121  GDGRIDYHEF  130


 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +1

Query  334  KEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVM  513
            KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ +M
Sbjct  2    KEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLTMM  61

Query  514  MAK  522
              K
Sbjct  62   ARK  64



>gb|ABU55241.1| calmodulin, partial [Dichotomomyces cejpii]
 gb|ABU55242.1| calmodulin, partial [Dichotomomyces cejpii]
 gb|ADE19211.1| calmodulin, partial [Hamigera striata]
 gb|ABU55215.2| calmodulin, partial [Aspergillus giganteus]
 gb|ABU55216.2| calmodulin, partial [Neosartorya sp. NRRL 1283]
 gb|ABU55217.2| calmodulin, partial [Monascus purpureus]
 gb|ABU55218.2| calmodulin, partial [Aspergillus fumigatus]
 gb|ABU55220.2| calmodulin, partial [Aspergillus fumigatus]
 gb|ABU55221.2| calmodulin, partial [Aspergillus waksmanii]
 gb|ABU55222.2| calmodulin, partial [Neosartorya pseudofischeri]
 gb|ABU55223.2| calmodulin, partial [Neosartorya fischeri]
 gb|ABU55224.2| calmodulin, partial [Neosartorya pseudofischeri]
 gb|ABU55225.2| calmodulin, partial [Neosartorya glabra]
 gb|ABU55226.2| calmodulin, partial [Neosartorya pseudofischeri]
 gb|ABU55227.2| calmodulin, partial [Neosartorya spinosa]
 gb|ABU55228.2| calmodulin, partial [Neosartorya pseudofischeri]
 gb|ABU55229.2| calmodulin, partial [Aspergillus clavatus]
 gb|ABU55230.2| calmodulin, partial [Neosartorya spathulata]
 gb|ABU55231.2| calmodulin, partial [Neosartorya spathulata]
 gb|ABU55232.2| calmodulin, partial [Neosartorya pseudofischeri]
 gb|ABU55233.2| calmodulin, partial [Neosartorya quadricincta]
 gb|ABU55234.2| calmodulin, partial [Neosartorya quadricincta]
 gb|ABU55235.2| calmodulin, partial [Aspergillus aureolus]
 gb|ABU55236.2| calmodulin, partial [Aspergillus clavatus]
 gb|ABU55237.2| calmodulin, partial [Aspergillus aureolus]
 gb|ABU55238.2| calmodulin, partial [Neosartorya sp. NRRL 2392]
 gb|ABU55239.2| calmodulin, partial [Aspergillus brevipes]
 gb|ABU55240.2| calmodulin, partial [Neosartorya spinosa]
 gb|ABU55243.2| calmodulin, partial [Aspergillus clavatus]
 gb|ABU55244.2| calmodulin, partial [Neosartorya spinosa]
 gb|ABU55245.2| calmodulin, partial [Neosartorya fennelliae]
 gb|ABU55246.2| calmodulin, partial [Neosartorya otanii]
 gb|ABU55247.2| calmodulin, partial [Neosartorya otanii]
 gb|ABU55248.2| calmodulin, partial [Neosartorya quadricincta]
 gb|ABU55249.2| calmodulin, partial [Neosartorya glabra]
 gb|ABU55250.2| calmodulin, partial [Neosartorya spinosa]
 gb|ABU55251.2| calmodulin, partial [Neosartorya pseudofischeri]
 gb|ABU55254.2| calmodulin, partial [Aspergillus lentulus]
 gb|ABU55255.2| calmodulin, partial [Aspergillus duricaulis]
 gb|ABU55256.2| calmodulin, partial [Neosartorya fischeri]
 gb|ABU55257.2| calmodulin, partial [Neosartorya spinosa]
 gb|ABU55258.2| calmodulin, partial [Aspergillus clavatus]
 gb|ABU55259.2| calmodulin, partial [Neosartorya fischeri]
 gb|ABU55260.2| calmodulin, partial [Neosartorya quadricincta]
 gb|ABU55261.2| calmodulin, partial [Neosartorya sp. NRRL 4179]
 gb|ABU55262.2| calmodulin, partial [Aspergillus viridinutans]
 gb|ABU55263.2| calmodulin, partial [Neosartorya aurata]
 gb|ABU55264.2| calmodulin, partial [Neosartorya aurata]
 gb|ABU55265.2| calmodulin, partial [Aspergillus giganteus]
 gb|ABU55266.2| calmodulin, partial [Neosartorya tatenoi]
 gb|ABU55267.2| calmodulin, partial [Neosartorya fischeri]
 gb|ABU55268.2| calmodulin, partial [Neosartorya stramenia]
 gb|ABU55269.2| calmodulin, partial [Aspergillus fumigatus]
 gb|ABU55270.2| calmodulin, partial [Aspergillus clavatonanicus]
 gb|ABU55271.2| calmodulin, partial [Aspergillus giganteus]
 gb|ABU55272.2| calmodulin, partial [Neosartorya spinosa]
 gb|ABU55273.2| calmodulin, partial [Aspergillus fumigatus]
 gb|ABU55275.2| calmodulin, partial [Aspergillus longivesica]
 gb|ABU55276.2| calmodulin, partial [Neocarpenteles acanthosporus]
 gb|ABU55277.2| calmodulin, partial [Aspergillus fumigatus]
 gb|ABU55278.2| calmodulin, partial [Neosartorya fennelliae]
 gb|ABU55279.2| calmodulin, partial [Neosartorya fennelliae]
 gb|ABU55281.2| calmodulin, partial [Aspergillus unilateralis]
 gb|ABU55282.2| calmodulin, partial [Aspergillus clavatus]
 gb|ABU55283.2| calmodulin, partial [Aspergillus fumigatus]
 gb|ABU55284.2| calmodulin, partial [Aspergillus giganteus]
 gb|ABU55285.2| calmodulin, partial [Aspergillus clavatus]
 gb|AIA77839.1| calmodulin, partial [Aspergillus niger]
 gb|AIA77840.1| calmodulin, partial [Aspergillus niger]
 gb|AIA77841.1| calmodulin, partial [Aspergillus niger]
 gb|AIA77842.1| calmodulin, partial [Aspergillus niger]
 gb|AIA77843.1| calmodulin, partial [Aspergillus niger]
Length=130

 Score =   132 bits (331),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  50   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  109

Query  439  VDEMIREADVDGDGQINYEEF  501
            VDEMIREAD DGDG+I+Y EF
Sbjct  110  VDEMIREADQDGDGRIDYNEF  130


 Score =   110 bits (276),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  111  FKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            +KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    YKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  57


 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  61   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  120

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  121  GDGRIDYNEF  130


 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +1

Query  334  KEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVM  513
            KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ +M
Sbjct  2    KEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLTMM  61

Query  514  MAK  522
              K
Sbjct  62   ARK  64



>gb|ABV82924.1| calmodulin, partial [Aspergillus tubingensis]
Length=131

 Score =   131 bits (330),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  51   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  110

Query  439  VDEMIREADVDGDGQINYEEF  501
            VDEMIREAD DGDG+I+Y EF
Sbjct  111  VDEMIREADQDGDGRIDYNEF  131


 Score =   110 bits (276),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 52/58 (90%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +3

Query  108  EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            E+KEAFS FDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    EYKEAFSFFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  58


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  62   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  121

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  122  GDGRIDYNEF  131


 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF  FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  1    EYKEAFSFFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  60

Query  508  VMMAK  522
            +M  K
Sbjct  61   MMARK  65



>gb|AGK30434.1| calmodulin, partial [Colletotrichum hymenocallidis]
Length=131

 Score =   137 bits (344),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  47   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  106

Query  439  VDEMIREADVDGDGQINYEEFVKVM  513
            VDEMIREAD DGDG+I+Y EFV++M
Sbjct  107  VDEMIREADQDGDGRIDYNEFVQLM  131


 Score =   105 bits (263),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 50/54 (93%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  120  AFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            AFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    AFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  54


 Score = 61.2 bits (147),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  58   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  117

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  118  GDGRIDYNEF  127


 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +1

Query  340  AFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMA  519
            AF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ +M  
Sbjct  1    AFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLTMMAR  60

Query  520  K  522
            K
Sbjct  61   K  61



>gb|ABU55219.2| calmodulin, partial [Aspergillus fumigatus]
Length=130

 Score =   131 bits (330),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  50   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  109

Query  439  VDEMIREADVDGDGQINYEEF  501
            VDEMIREAD DGDG+I+Y EF
Sbjct  110  VDEMIREADQDGDGRIDYTEF  130


 Score =   110 bits (276),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  111  FKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            +KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    YKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  57


 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  61   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  120

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  121  GDGRIDYTEF  130


 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +1

Query  334  KEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVM  513
            KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ +M
Sbjct  2    KEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLTMM  61

Query  514  MAK  522
              K
Sbjct  62   ARK  64



>gb|AGR66927.1| calmodulin, partial [Colletotrichum sp. zzgmzg1]
Length=132

 Score =   140 bits (354),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  45   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  104

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  105  VDEMIREADQDGDGRIDYNEFVQLMMQK  132


 Score =   101 bits (252),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +3

Query  126  SLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            SLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    SLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  52


 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  56   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  115

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  116  GDGRIDYNEF  125


 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +1

Query  349  VFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK  522
            +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ +M  K
Sbjct  2    LFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLTMMARK  59



>gb|ABW69728.1| calmodulin, partial [Aspergillus alliaceus]
Length=131

 Score =   132 bits (331),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  51   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  110

Query  439  VDEMIREADVDGDGQINYEEF  501
            VDEMIREAD DGDG+I+Y EF
Sbjct  111  VDEMIREADQDGDGRIDYNEF  131


 Score =   110 bits (275),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 52/58 (90%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +3

Query  108  EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            E+KE FSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    EYKEPFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  58


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  62   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  121

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  122  GDGRIDYNEF  131


 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KE F +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  1    EYKEPFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  60

Query  508  VMMAK  522
            +M  K
Sbjct  61   MMARK  65



>gb|ABW69714.1| calmodulin, partial [Aspergillus caelatus]
Length=131

 Score =   129 bits (323),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  51   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  110

Query  439  VDEMIREADVDGDGQINY  492
            VDEMIREAD DGDG+I+Y
Sbjct  111  VDEMIREADQDGDGRIDY  128


 Score =   113 bits (282),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 53/58 (91%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +3

Query  108  EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            E+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  58


 Score = 58.5 bits (140),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  1    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  60

Query  508  VMMAK  522
            +M  K
Sbjct  61   MMARK  65


 Score = 58.2 bits (139),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 44/67 (66%), Gaps = 1/67 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  62   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  121

Query  252  GNGTIDF  272
            G+G ID+
Sbjct  122  GDGRIDY  128



>emb|CDM22389.1| calmodulin, partial [Aspergillus tritici]
Length=130

 Score =   124 bits (310),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD++
Sbjct  54   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDD  113

Query  439  VDEMIREADVDGDGQIN  489
            VDEMIREAD DGDG+I+
Sbjct  114  VDEMIREADQDGDGRID  130


 Score =   117 bits (294),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 55/61 (90%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +3

Query  99   QISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPE  278
            Q+SE+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPE
Sbjct  1    QVSEYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPE  60

Query  279  F  281
            F
Sbjct  61   F  61


 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  4    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  63

Query  508  VMMAK  522
            +M  K
Sbjct  64   MMARK  68


 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 43/66 (65%), Gaps = 1/66 (2%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ ++ +MI E D D
Sbjct  65   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDDVDEMIREADQD  124

Query  252  GNGTID  269
            G+G ID
Sbjct  125  GDGRID  130



>gb|ABW69731.1| calmodulin, partial [Aspergillus alliaceus]
Length=131

 Score =   132 bits (331),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  51   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  110

Query  439  VDEMIREADVDGDGQINYEEF  501
            VDEMIREAD DGDG+I+Y EF
Sbjct  111  VDEMIREADQDGDGRIDYNEF  131


 Score =   109 bits (273),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 52/58 (90%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +3

Query  108  EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            E+K AFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    EYKVAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  58


 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  62   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  121

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  122  GDGRIDYNEF  131


 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E K AF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  1    EYKVAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  60

Query  508  VMMAK  522
            +M  K
Sbjct  61   MMARK  65



>gb|AID49853.1| calmodulin, partial [Aspergillus creber]
Length=131

 Score =   132 bits (331),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  51   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  110

Query  439  VDEMIREADVDGDGQINYEEF  501
            VDEMIREAD DGDG+I+Y EF
Sbjct  111  VDEMIREADQDGDGRIDYNEF  131


 Score =   109 bits (273),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +3

Query  114  KEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  3    KEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  58


 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  62   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  121

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  122  GDGRIDYNEF  131


 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +1

Query  334  KEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVM  513
            KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ +M
Sbjct  3    KEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLTMM  62

Query  514  MAK  522
              K
Sbjct  63   ARK  65



>ref|NP_193200.1| calmodulin-like protein 8 [Arabidopsis thaliana]
 sp|O23320.1|CML8_ARATH RecName: Full=Calmodulin-like protein 8; Short=AtCaM-8 [Arabidopsis 
thaliana]
 gb|AAD53314.1|AF178074_1 calmodulin 8 [Arabidopsis thaliana]
 emb|CAB10243.1| calmodulin [Arabidopsis thaliana]
 emb|CAB78506.1| calmodulin [Arabidopsis thaliana]
 gb|ABD57513.1| At4g14640 [Arabidopsis thaliana]
 gb|AEE83470.1| calmodulin-like protein 8 [Arabidopsis thaliana]
Length=151

 Score =   137 bits (345),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FLNLMA+K++++D+EEELKEAF+VFDKDQNG+ISA+EL HVM NLGEKLTDEE
Sbjct  63   GTIEFAEFLNLMAKKLQESDAEEELKEAFKVFDKDQNGYISASELSHVMINLGEKLTDEE  122

Query  439  VDEMIREADVDGDGQINYEEFVKVMM  516
            V++MI+EAD+DGDGQ+NY+EFVK+M+
Sbjct  123  VEQMIKEADLDGDGQVNYDEFVKMMI  148


 Score =   104 bits (259),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +3

Query  87   LTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTI  266
            LT DQI+EFKEAF LFDKDGDGCIT +EL TV+RSL QNPTE EL D+I E+D+D NGTI
Sbjct  6    LTKDQITEFKEAFCLFDKDGDGCITVEELATVIRSLDQNPTEQELHDIITEIDSDSNGTI  65

Query  267  DFPEF  281
            +F EF
Sbjct  66   EFAEF  70


 Score = 61.2 bits (147),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA +L + D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E++ MI E D D
Sbjct  74   MAKKLQESDAEEELKEAFKVFDKDQNGYISASELSHVMINLGEKLTDEEVEQMIKEADLD  133

Query  252  GNGTIDFPEF  281
            G+G +++ EF
Sbjct  134  GDGQVNYDEF  143


 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  V+ +L +  T++E+ ++I E D D +G I + EF+ 
Sbjct  13   EFKEAFCLFDKDGDGCITVEELATVIRSLDQNPTEQELHDIITEIDSDSNGTIEFAEFLN  72

Query  508  VMMAK  522
            +M  K
Sbjct  73   LMAKK  77



>ref|XP_010613677.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104856148 
[Fukomys damarensis]
Length=594

 Score =   131 bits (329),  Expect(2) = 5e-55, Method: Composition-based stats.
 Identities = 60/90 (67%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +1

Query  253  GMGQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTD  432
            G G + F     +MARKMK TDSEEE+ EAF+VF ++ NG+IS AEL HVMTNLGEKLTD
Sbjct  505  GNGTIDFPEVFTMMARKMKHTDSEEEICEAFQVFHQNGNGYISVAELHHVMTNLGEKLTD  564

Query  433  EEVDEMIREADVDGDGQINYEEFVKVMMAK  522
            +EVDEMIREA  DGDGQ+NY EF+++M AK
Sbjct  565  DEVDEMIREAHTDGDGQVNYVEFIQMMTAK  594


 Score =   110 bits (274),  Expect(2) = 5e-55, Method: Composition-based stats.
 Identities = 51/63 (81%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +3

Query  90   TDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTID  269
            T++QI+EFK+ FSLFDK GDG  T KELG VMRSLGQNPTE ELQDMINEVDA+GNGTID
Sbjct  451  TEEQIAEFKDTFSLFDKYGDGTTTAKELGIVMRSLGQNPTETELQDMINEVDANGNGTID  510

Query  270  FPE  278
            FPE
Sbjct  511  FPE  513


 Score = 56.2 bits (134),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 32/92 (35%), Positives = 54/92 (59%), Gaps = 2/92 (2%)
 Frame = +1

Query  250  MGMGQLTFQSFLNLMARKMKDTDSE-EELKEAFRVFDKDQNGFISAAELRHVMTNLGEKL  426
            + +GQ      L+++   +  T+ +  E K+ F +FDK  +G  +A EL  VM +LG+  
Sbjct  430  LTLGQNLTVQILHVVLELLNTTEEQIAEFKDTFSLFDKYGDGTTTAKELGIVMRSLGQNP  489

Query  427  TDEEVDEMIREADVDGDGQINYEEFVKVMMAK  522
            T+ E+ +MI E D +G+G I++ E V  MMA+
Sbjct  490  TETELQDMINEVDANGNGTIDFPE-VFTMMAR  520


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/62 (40%), Positives = 39/62 (63%), Gaps = 0/62 (0%)
 Frame = +3

Query  96   DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFP  275
            D   E  EAF +F ++G+G I+  EL  VM +LG+  T+ E+ +MI E   DG+G +++ 
Sbjct  526  DSEEEICEAFQVFHQNGNGYISVAELHHVMTNLGEKLTDDEVDEMIREAHTDGDGQVNYV  585

Query  276  EF  281
            EF
Sbjct  586  EF  587



>ref|XP_001210822.1| calmodulin [Aspergillus terreus NIH2624]
 gb|EAU39382.1| calmodulin [Aspergillus terreus NIH2624]
Length=142

 Score =   126 bits (316),  Expect(2) = 5e-55, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  54   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  113

Query  439  VDEMIREADVDGDGQIN  489
            VDEMIREAD DGDG+I+
Sbjct  114  VDEMIREADQDGDGRID  130


 Score =   115 bits (287),  Expect(2) = 5e-55, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +3

Query  102  ISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            +SE+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  2    VSEYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  61


 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  4    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  63

Query  508  VMMAK  522
            +M  K
Sbjct  64   MMARK  68


 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 1/66 (2%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  65   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  124

Query  252  GNGTID  269
            G+G ID
Sbjct  125  GDGRID  130



>gb|AII72224.1| calmodulin, partial [Aspergillus terreus]
Length=130

 Score =   132 bits (331),  Expect(2) = 5e-55, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  50   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  109

Query  439  VDEMIREADVDGDGQINYEEF  501
            VDEMIREAD DGDG+I+Y EF
Sbjct  110  VDEMIREADQDGDGRIDYNEF  130


 Score =   109 bits (272),  Expect(2) = 5e-55, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +3

Query  114  KEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  2    KEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  57


 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  61   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  120

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  121  GDGRIDYNEF  130


 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +1

Query  334  KEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVM  513
            KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ +M
Sbjct  2    KEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLTMM  61

Query  514  MAK  522
              K
Sbjct  62   ARK  64



>gb|ABW04746.1| calmodulin, partial [Aspergillus sp. NRRL 2161]
 gb|ABW04747.1| calmodulin, partial [Aspergillus sp. NRRL 5027]
 gb|ABW04748.1| calmodulin, partial [Aspergillus parvulus]
 gb|ABW04749.1| calmodulin, partial [Aspergillus parvulus]
 gb|ABW04750.1| calmodulin, partial [Aspergillus parvulus]
 gb|ABW04751.1| calmodulin, partial [Aspergillus parvulus]
 gb|ABW04752.1| calmodulin, partial [Aspergillus parvulus]
 gb|ABW04753.1| calmodulin, partial [Aspergillus cervinus]
 gb|ABW04754.1| calmodulin, partial [Aspergillus cervinus]
 gb|ABW04755.1| calmodulin, partial [Aspergillus nutans]
 gb|ABW04756.1| calmodulin, partial [Aspergillus kanagawaensis]
 gb|ABW04757.1| calmodulin, partial [Aspergillus kanagawaensis]
 gb|ABW04758.1| calmodulin, partial [Aspergillus sp. NRRL 4897]
 gb|ABW04759.1| calmodulin, partial [Aspergillus viridinutans]
 gb|AID49856.1| calmodulin, partial [Aspergillus tennesseensis]
 gb|AIE17059.1| calmodulin, partial [Aspergillus sp. SWP-2014a]
 gb|AII72227.1| calmodulin, partial [Aspergillus tamarii]
Length=129

 Score =   132 bits (331),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  49   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  108

Query  439  VDEMIREADVDGDGQINYEEF  501
            VDEMIREAD DGDG+I+Y EF
Sbjct  109  VDEMIREADQDGDGRIDYNEF  129


 Score =   109 bits (272),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +3

Query  114  KEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    KEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  56


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  60   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  119

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  120  GDGRIDYNEF  129


 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +1

Query  334  KEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVM  513
            KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ +M
Sbjct  1    KEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLTMM  60

Query  514  MAK  522
              K
Sbjct  61   ARK  63



>emb|CCF78823.2| calmodulin, partial [Aspergillus westerdijkiae]
 emb|CDM22391.1| calmodulin, partial [Aspergillus taichungensis]
Length=129

 Score =   125 bits (314),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  53   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  112

Query  439  VDEMIREADVDGDGQIN  489
            VDEMIREAD DGDG+I+
Sbjct  113  VDEMIREADQDGDGRID  129


 Score =   115 bits (289),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +3

Query  102  ISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            +SE+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    VSEYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  60


 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  3    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  62

Query  508  VMMAK  522
            +M  K
Sbjct  63   MMARK  67


 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 1/66 (2%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  64   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  123

Query  252  GNGTID  269
            G+G ID
Sbjct  124  GDGRID  129



>gb|AHB34581.1| calmodulin, partial [Colletotrichum truncatum]
 gb|AGQ57183.2| calmodulin, partial [Colletotrichum kahawae subsp. ciggaro]
 gb|AGQ57184.2| calmodulin, partial [Colletotrichum kahawae subsp. ciggaro]
 gb|AGQ57185.2| calmodulin, partial [Colletotrichum kahawae subsp. ciggaro]
 gb|AGQ57186.2| calmodulin, partial [Colletotrichum kahawae subsp. ciggaro]
 gb|AGQ57187.2| calmodulin, partial [Colletotrichum aotearoa]
 gb|AGQ57188.2| calmodulin, partial [Colletotrichum aotearoa]
 gb|AGQ57189.2| calmodulin, partial [Colletotrichum aotearoa]
 gb|AGQ57190.2| calmodulin, partial [Colletotrichum aotearoa]
 gb|AGQ57191.2| calmodulin, partial [Colletotrichum aotearoa]
 gb|AGQ57192.2| calmodulin, partial [Colletotrichum aotearoa]
 gb|AGQ57193.2| calmodulin, partial [Colletotrichum alienum]
 gb|AGQ57194.2| calmodulin, partial [Colletotrichum alienum]
 gb|AGQ57195.2| calmodulin, partial [Colletotrichum alienum]
 gb|AGQ57196.2| calmodulin, partial [Colletotrichum alienum]
 gb|AGQ57197.2| calmodulin, partial [Colletotrichum alienum]
 gb|AGQ57198.2| calmodulin, partial [Colletotrichum alienum]
 gb|AGQ57199.2| calmodulin, partial [Colletotrichum alienum]
 gb|AGQ57200.2| calmodulin, partial [Colletotrichum alienum]
 gb|AGQ57201.2| calmodulin, partial [Colletotrichum proteae]
 gb|AGQ57202.2| calmodulin, partial [Colletotrichum siamense]
 gb|AGQ57203.2| calmodulin, partial [Colletotrichum siamense]
 gb|AGQ57204.2| calmodulin, partial [Colletotrichum grevilleae]
 gb|AGQ57150.2| calmodulin, partial [Colletotrichum proteae]
 gb|AGQ57151.2| calmodulin, partial [Colletotrichum proteae]
Length=130

 Score =   134 bits (338),  Expect(2) = 9e-55, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  47   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  106

Query  439  VDEMIREADVDGDGQINYEEFVKV  510
            VDEMIREAD DGDG+I+Y EFV++
Sbjct  107  VDEMIREADQDGDGRIDYNEFVQL  130


 Score =   105 bits (263),  Expect(2) = 9e-55, Method: Compositional matrix adjust.
 Identities = 50/54 (93%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  120  AFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            AFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    AFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  54


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  58   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  117

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  118  GDGRIDYNEF  127


 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +1

Query  340  AFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMA  519
            AF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ +M  
Sbjct  1    AFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLTMMAR  60

Query  520  K  522
            K
Sbjct  61   K  61



>ref|XP_790786.3| PREDICTED: calmodulin-like protein 12-like [Strongylocentrotus 
purpuratus]
Length=332

 Score =   125 bits (314),  Expect(2) = 9e-55, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 74/88 (84%), Gaps = 1/88 (1%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL  + RKMK+T SE E++EAFRVFD D NGFIS AELRHVMT+LGEKLTD+E
Sbjct  246  GIIDFPEFLTKV-RKMKETQSEVEMREAFRVFDMDGNGFISFAELRHVMTHLGEKLTDDE  304

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD+DGDGQ+NYEEFV +M +K
Sbjct  305  VDEMIREADIDGDGQVNYEEFVSMMTSK  332


 Score =   115 bits (287),  Expect(2) = 9e-55, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +3

Query  78   ADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGN  257
            ADQLT++QI+EFKEAFS+FDKDG+G ITT ELGTVMRSLG  P EAELQDMINEVDA+ N
Sbjct  186  ADQLTEEQIAEFKEAFSVFDKDGNGTITTNELGTVMRSLGLKPNEAELQDMINEVDAEWN  245

Query  258  GTIDFPEF  281
            G IDFPEF
Sbjct  246  GIIDFPEF  253


 Score =   135 bits (341),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +1

Query  253  GMGQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTD  432
            G G +    FL +MA+KMKDTDSEE+++EAFRVFDKD NG+ISAAELRHVMTN+GE LT 
Sbjct  92   GNGTIDSPEFLAMMAKKMKDTDSEEDIREAFRVFDKDGNGYISAAELRHVMTNIGENLTI  151

Query  433  EEVDEMIREADVDGDGQINYEEFVKVMMAK  522
            EEVDEMIREADVDGDGQ++YEEFV +M  K
Sbjct  152  EEVDEMIREADVDGDGQVDYEEFVTMMTFK  181


 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/68 (93%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +3

Query  78   ADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGN  257
            ADQLT++QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDADGN
Sbjct  34   ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGN  93

Query  258  GTIDFPEF  281
            GTID PEF
Sbjct  94   GTIDSPEF  101


 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   + +EAF +FDKDG+G I+  EL  VM ++G+N T  E+ +MI E D D
Sbjct  105  MAKKMKDTDSEEDIREAFRVFDKDGNGYISAAELRHVMTNIGENLTIEEVDEMIREADVD  164

Query  252  GNGTIDFPEF  281
            G+G +D+ EF
Sbjct  165  GDGQVDYEEF  174


 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 55/90 (61%), Gaps = 6/90 (7%)
 Frame = +1

Query  253  GMGQLTFQSFLNLMARKMK---DTDSEE---ELKEAFRVFDKDQNGFISAAELRHVMTNL  414
            G GQ+ ++ F+ +M  K+    D  +EE   E KEAF VFDKD NG I+  EL  VM +L
Sbjct  165  GDGQVDYEEFVTMMTFKLPINADQLTEEQIAEFKEAFSVFDKDGNGTITTNELGTVMRSL  224

Query  415  GEKLTDEEVDEMIREADVDGDGQINYEEFV  504
            G K  + E+ +MI E D + +G I++ EF+
Sbjct  225  GLKPNEAELQDMINEVDAEWNGIIDFPEFL  254


 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 44/65 (68%), Gaps = 1/65 (2%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D DG+G I+  EF+ 
Sbjct  44   EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDSPEFL-  102

Query  508  VMMAK  522
             MMAK
Sbjct  103  AMMAK  107


 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +3

Query  108  EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            E +EAF +FD DG+G I+  EL  VM  LG+  T+ E+ +MI E D DG+G +++ EF
Sbjct  268  EMREAFRVFDMDGNGFISFAELRHVMTHLGEKLTDDEVDEMIREADIDGDGQVNYEEF  325



>gb|AEO13244.1| calmodulin [Aspergillus minisclerotigenes]
Length=130

 Score =   125 bits (313),  Expect(2) = 9e-55, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  54   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  113

Query  439  VDEMIREADVDGDGQIN  489
            VDEMIREAD DGDG+I+
Sbjct  114  VDEMIREADQDGDGRID  130


 Score =   115 bits (288),  Expect(2) = 9e-55, Method: Compositional matrix adjust.
 Identities = 55/61 (90%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +3

Query  99   QISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPE  278
            Q+ EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPE
Sbjct  1    QVFEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPE  60

Query  279  F  281
            F
Sbjct  61   F  61


 Score = 58.5 bits (140),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  4    EFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  63

Query  508  VMMAK  522
            +M  K
Sbjct  64   MMARK  68


 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 1/66 (2%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  65   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  124

Query  252  GNGTID  269
            G+G ID
Sbjct  125  GDGRID  130



>gb|ABU55274.2| calmodulin, partial [Dichotomomyces cejpii]
Length=129

 Score =   125 bits (314),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  53   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  112

Query  439  VDEMIREADVDGDGQIN  489
            VDEMIREAD DGDG+I+
Sbjct  113  VDEMIREADQDGDGRID  129


 Score =   114 bits (286),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 54/59 (92%), Positives = 57/59 (97%), Gaps = 0/59 (0%)
 Frame = +3

Query  105  SEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            SE+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  2    SEYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  60


 Score = 58.5 bits (140),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  3    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  62

Query  508  VMMAK  522
            +M  K
Sbjct  63   MMARK  67


 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 1/66 (2%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  64   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  123

Query  252  GNGTID  269
            G+G ID
Sbjct  124  GDGRID  129



>gb|ADW19797.1| calmodulin, partial [Colletotrichum karstii]
Length=132

 Score =   135 bits (341),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 78/88 (89%), Gaps = 1/88 (1%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD E
Sbjct  46   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTD-E  104

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  105  VDEMIREADQDGDGRIDYNEFVQLMMQK  132


 Score =   104 bits (259),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +3

Query  123  FSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            FSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    FSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  53


 Score = 57.8 bits (138),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 2/70 (3%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  57   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTD-EVDEMIREADQD  115

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  116  GDGRIDYNEF  125


 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  343  FRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK  522
            F +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ +M  K
Sbjct  1    FSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLTMMARK  60



>ref|XP_006838912.1| hypothetical protein AMTR_s00002p00269730 [Amborella trichopoda]
 gb|ERN01481.1| hypothetical protein AMTR_s00002p00269730 [Amborella trichopoda]
Length=149

 Score =   140 bits (354),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL+LMARKM++TD+EEEL EAF+VFDKDQNG+ISA ELRHVM NLGEKLTDEE
Sbjct  62   GSIEFGEFLHLMARKMQETDAEEELLEAFKVFDKDQNGYISATELRHVMINLGEKLTDEE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVMMA  519
            V +MIREAD+DGDGQ+N+EEFV++MMA
Sbjct  122  VAQMIREADMDGDGQVNFEEFVRIMMA  148


 Score = 99.0 bits (245),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MA+ LT +QI+EFKEAF LFDKDGDG IT +EL TV+ SLGQNPTE EL DMI+EVD + 
Sbjct  1    MAEPLTQEQITEFKEAFCLFDKDGDGRITLEELKTVIVSLGQNPTEEELHDMISEVDVNA  60

Query  255  NGTIDFPEF  281
            NG+I+F EF
Sbjct  61   NGSIEFGEF  69


 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL+ V+ +LG+  T+EE+ +MI E DV+ +G I + EF+ 
Sbjct  12   EFKEAFCLFDKDGDGRITLEELKTVIVSLGQNPTEEELHDMISEVDVNANGSIEFGEFLH  71

Query  508  VMMAK  522
            +M  K
Sbjct  72   LMARK  76


 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +3

Query  108  EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            E  EAF +FDKD +G I+  EL  VM +LG+  T+ E+  MI E D DG+G ++F EF
Sbjct  85   ELLEAFKVFDKDQNGYISATELRHVMINLGEKLTDEEVAQMIREADMDGDGQVNFEEF  142



>emb|CBY85697.1| calmodulin [Neosartorya quadricincta]
 gb|AHA35765.2| calmodulin, partial [Colletotrichum karstii]
 gb|AHA35766.2| calmodulin, partial [Colletotrichum sp. GM52-L01]
Length=128

 Score =   134 bits (336),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  47   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  106

Query  439  VDEMIREADVDGDGQINYEEFV  504
            VDEMIREAD DGDG+I+Y EFV
Sbjct  107  VDEMIREADQDGDGRIDYNEFV  128


 Score =   105 bits (263),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 50/54 (93%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  120  AFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            AFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    AFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  54


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  58   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  117

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  118  GDGRIDYNEF  127


 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +1

Query  340  AFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMA  519
            AF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ +M  
Sbjct  1    AFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLTMMAR  60

Query  520  K  522
            K
Sbjct  61   K  61



>ref|XP_004054725.1| PREDICTED: calmodulin-like, partial [Gorilla gorilla gorilla]
Length=155

 Score =   129 bits (323),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G++ F  F+ + ARKMKD  SEEE++EAFRVFDKD NG+ISAAEL H MTNLGEKLTDE 
Sbjct  62   GRVGFPEFVTMRARKMKDAGSEEEMREAFRVFDKDGNGYISAAELHHAMTNLGEKLTDEA  121

Query  439  VDEMIREADVDGDGQINYEEFVKV  510
            VDEMIREAD+DGDGQ+N EEF + 
Sbjct  122  VDEMIREADIDGDGQVNCEEFAQA  145


 Score =   110 bits (275),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLT +QI EFK+A+ LFDKDGDG ITTKELGT MRSL Q+PTEAELQDMI EVDAD 
Sbjct  1    MADQLTGEQIVEFKKAYLLFDKDGDGTITTKELGTEMRSLRQHPTEAELQDMIYEVDADS  60

Query  255  NGTIDFPEF  281
            NG + FPEF
Sbjct  61   NGRVGFPEF  69


 Score = 58.2 bits (139),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 49/80 (61%), Gaps = 4/80 (5%)
 Frame = +3

Query  63   RALTMADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEV  242
            RA  M D  +++   E +EAF +FDKDG+G I+  EL   M +LG+  T+  + +MI E 
Sbjct  73   RARKMKDAGSEE---EMREAFRVFDKDGNGYISAAELHHAMTNLGEKLTDEAVDEMIREA  129

Query  243  DADGNGTIDFPEFP*S-HGT  299
            D DG+G ++  EF  + HGT
Sbjct  130  DIDGDGQVNCEEFAQAGHGT  149


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E K+A+ +FDKD +G I+  EL   M +L +  T+ E+ +MI E D D +G++ + EFV 
Sbjct  12   EFKKAYLLFDKDGDGTITTKELGTEMRSLRQHPTEAELQDMIYEVDADSNGRVGFPEFVT  71

Query  508  VMMAK  522
            +   K
Sbjct  72   MRARK  76



>ref|XP_005065475.1| PREDICTED: calmodulin-like [Mesocricetus auratus]
Length=142

 Score =   120 bits (302),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 71/86 (83%), Gaps = 7/86 (8%)
 Frame = +1

Query  265  LTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVD  444
            + F  FL +MARKMKDTD EEE++EAFRVFDKD NG+I+AA+LR       EKLTDEEVD
Sbjct  64   IDFPEFLTMMARKMKDTDGEEEIREAFRVFDKDGNGYINAADLR-------EKLTDEEVD  116

Query  445  EMIREADVDGDGQINYEEFVKVMMAK  522
            EMIREAD+DGD Q+NYEEFV++M AK
Sbjct  117  EMIREADIDGDSQVNYEEFVQMMTAK  142


 Score =   118 bits (296),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLT++QI+EFKEAFSL  KDGDG I TKELG VMRSLGQNPTEAELQDM NEVDAD 
Sbjct  1    MADQLTEEQIAEFKEAFSLLAKDGDGTIITKELGAVMRSLGQNPTEAELQDMTNEVDADD  60

Query  255  NGTIDFPEF  281
            N TIDFPEF
Sbjct  61   NDTIDFPEF  69


 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +  KD +G I   EL  VM +LG+  T+ E+ +M  E D D +  I++ EF+ 
Sbjct  12   EFKEAFSLLAKDGDGTIITKELGAVMRSLGQNPTEAELQDMTNEVDADDNDTIDFPEFLT  71

Query  508  VMMAK  522
            +M  K
Sbjct  72   MMARK  76



>gb|AAW67156.1| calmodulin, partial [Penicillium thiersii]
 gb|AAW67157.1| calmodulin, partial [Penicillium charlesii]
 gb|AAW67158.1| calmodulin, partial [Penicillium chermesinum]
 gb|AAW67159.1| calmodulin, partial [Penicillium phoeniceum]
 gb|AAW67160.1| calmodulin, partial [Penicillium fellutanum]
 gb|AAW67161.1| calmodulin, partial [Penicillium fellutanum]
 gb|AAW67162.1| calmodulin, partial [Penicillium brocae]
 gb|AAW67163.1| calmodulin, partial [Penicillium brocae]
 gb|AAW67164.1| calmodulin, partial [Penicillium brocae]
 gb|AAW67165.1| calmodulin, partial [Penicillium brocae]
 gb|AAW67166.1| calmodulin, partial [Penicillium brocae]
 gb|AAW67167.1| calmodulin, partial [Penicillium brocae]
 gb|AAW67168.1| calmodulin, partial [Penicillium brocae]
 gb|AAW67169.1| calmodulin, partial [Penicillium brocae]
 gb|AAW67170.1| calmodulin, partial [Penicillium brocae]
 gb|AAW67171.1| calmodulin, partial [Penicillium thiersii]
 gb|AAW67172.1| calmodulin, partial [Penicillium thiersii]
 gb|AAW67173.1| calmodulin, partial [Penicillium brocae]
 gb|AAW67174.1| calmodulin, partial [Penicillium indicum]
 gb|AAW67175.1| calmodulin, partial [Penicillium charlesii]
 gb|AAW67176.1| calmodulin, partial [Penicillium brocae]
 gb|AAW67177.1| calmodulin, partial [Penicillium coffeae]
 gb|AAW67178.1| calmodulin, partial [Penicillium coffeae]
 gb|AAW67179.1| calmodulin, partial [Penicillium coffeae]
 gb|AAW67180.1| calmodulin, partial [Penicillium coffeae]
 gb|AAW67181.1| calmodulin, partial [Penicillium fellutanum]
 gb|AAW67182.1| calmodulin, partial [Penicillium charlesii]
 gb|AAW67183.1| calmodulin, partial [Penicillium fellutanum]
 gb|AAW67184.1| calmodulin, partial [Penicillium charlesii]
 gb|ABU62617.1| calmodulin, partial [Penicillium sp. NRRL 735]
 gb|ABU62618.1| calmodulin, partial [Penicillium ochrosalmoneum]
 gb|ABU62619.1| calmodulin, partial [Penicillium ochrosalmoneum]
 gb|ABU62620.1| calmodulin, partial [Penicillium ochrosalmoneum]
 gb|ABU62621.1| calmodulin, partial [Penicillium ochrosalmoneum]
 gb|AID49857.1| calmodulin, partial [Aspergillus tennesseensis]
 gb|ABV25626.2| calmodulin, partial [Penicillium cinnamopurpureum]
 gb|ABV25629.2| calmodulin, partial [Eupenicillium idahoense]
Length=128

 Score =   132 bits (331),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  48   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  107

Query  439  VDEMIREADVDGDGQINYEEF  501
            VDEMIREAD DGDG+I+Y EF
Sbjct  108  VDEMIREADQDGDGRIDYNEF  128


 Score =   107 bits (267),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 51/55 (93%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +3

Query  117  EAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            EAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    EAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  55


 Score = 61.2 bits (147),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  59   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  118

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  119  GDGRIDYNEF  128


 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = +1

Query  337  EAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMM  516
            EAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ +M 
Sbjct  1    EAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLTMMA  60

Query  517  AK  522
             K
Sbjct  61   RK  62



>dbj|BAK64535.1| calmodulin [Emericella echinulata]
Length=128

 Score =   122 bits (306),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +3

Query  87   LTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTI  266
            LT++Q+SE+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTI
Sbjct  1    LTEEQVSEYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTI  60

Query  267  DFPEF  281
            DFPEF
Sbjct  61   DFPEF  65


 Score =   116 bits (291),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  58   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  117

Query  439  VDEMIREADVD  471
            VDEMIREAD D
Sbjct  118  VDEMIREADQD  128


 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  8    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  67

Query  508  VMMAK  522
            +M  K
Sbjct  68   MMARK  72


 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 38/60 (63%), Gaps = 1/60 (2%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  69   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  128



>gb|AGQ57205.2| calmodulin, partial [Colletotrichum alienum]
Length=130

 Score =   134 bits (338),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  47   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  106

Query  439  VDEMIREADVDGDGQINYEEFVKV  510
            VDEMIREAD DGDG+I+Y EFV++
Sbjct  107  VDEMIREADQDGDGRIDYNEFVQL  130


 Score =   104 bits (259),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  120  AFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            AFSLFDKDGDG ITTKELGTVMRSLG+NP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    AFSLFDKDGDGQITTKELGTVMRSLGRNPSESELQDMINEVDADNNGTIDFPEF  54


 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  58   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  117

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  118  GDGRIDYNEF  127


 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +1

Query  340  AFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMA  519
            AF +FDKD +G I+  EL  VM +LG   ++ E+ +MI E D D +G I++ EF+ +M  
Sbjct  1    AFSLFDKDGDGQITTKELGTVMRSLGRNPSESELQDMINEVDADNNGTIDFPEFLTMMAR  60

Query  520  K  522
            K
Sbjct  61   K  61



>emb|CCF72068.1| calmodulin, partial [Aspergillus insuetus]
Length=128

 Score =   120 bits (301),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  56   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  115

Query  439  VDEMIREADVDGD  477
            VDEMIREAD DGD
Sbjct  116  VDEMIREADQDGD  128


 Score =   118 bits (296),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +3

Query  93   DDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDF  272
            ++Q+SE+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDF
Sbjct  1    EEQVSEYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDF  60

Query  273  PEF  281
            PEF
Sbjct  61   PEF  63


 Score = 58.5 bits (140),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  6    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  65

Query  508  VMMAK  522
            +M  K
Sbjct  66   MMARK  70


 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 40/62 (65%), Gaps = 1/62 (2%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  67   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  126

Query  252  GN  257
            G+
Sbjct  127  GD  128



>emb|CBY85701.1| calmodulin [Aspergillus terreus]
 gb|AEC48412.1| calmodulin, partial [Aspergillus flavus]
 gb|AEC48413.1| calmodulin, partial [Aspergillus flavus]
 gb|AEC48414.1| calmodulin, partial [Aspergillus parasiticus]
 gb|AEC48415.1| calmodulin, partial [Aspergillus flavus]
 gb|AEC48416.1| calmodulin, partial [Aspergillus flavus]
 gb|AEC48417.1| calmodulin, partial [Aspergillus flavus]
 gb|AEC48418.1| calmodulin, partial [Aspergillus transmontanensis]
 gb|AEC48419.1| calmodulin, partial [Aspergillus flavus]
 gb|AEC48420.1| calmodulin, partial [Aspergillus flavus]
 gb|AEC48421.1| calmodulin, partial [Aspergillus sergii]
 gb|AEC48422.1| calmodulin, partial [Aspergillus flavus]
 gb|AEC48423.1| calmodulin, partial [Aspergillus parasiticus]
 gb|AEC48424.1| calmodulin, partial [Aspergillus transmontanensis]
 gb|AEC48425.1| calmodulin, partial [Aspergillus parasiticus]
 gb|AEC48426.1| calmodulin, partial [Aspergillus parasiticus]
 gb|AEC48427.1| calmodulin, partial [Aspergillus transmontanensis]
 gb|AEC48428.1| calmodulin, partial [Aspergillus parasiticus]
 gb|AEC48429.1| calmodulin, partial [Aspergillus parasiticus]
 gb|AEC48430.1| calmodulin, partial [Aspergillus tamarii]
 gb|AEC48431.1| calmodulin, partial [Aspergillus flavus]
 gb|AEC48432.1| calmodulin, partial [Aspergillus sergii]
 gb|AEC48433.1| calmodulin, partial [Aspergillus flavus]
 gb|AEC48434.1| calmodulin, partial [Aspergillus parasiticus]
 gb|AEC48435.1| calmodulin, partial [Aspergillus tamarii]
 gb|AFK30327.1| calmodulin, partial [Colletotrichum tropicicola]
Length=129

 Score =   134 bits (338),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  46   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  105

Query  439  VDEMIREADVDGDGQINYEEFVKV  510
            VDEMIREAD DGDG+I+Y EFV++
Sbjct  106  VDEMIREADQDGDGRIDYNEFVQL  129


 Score =   103 bits (258),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +3

Query  123  FSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            FSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    FSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  53


 Score = 61.2 bits (147),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  57   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  116

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  117  GDGRIDYNEF  126


 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  343  FRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK  522
            F +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ +M  K
Sbjct  1    FSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLTMMARK  60



>gb|AEO13242.1| calmodulin [Aspergillus minisclerotigenes]
 gb|AEO13253.1| calmodulin [Aspergillus minisclerotigenes]
 gb|AEO13259.1| calmodulin [Aspergillus minisclerotigenes]
 gb|AID49854.1| calmodulin, partial [Aspergillus tabacinus]
 gb|AIN40653.1| calmodulin, partial [Colletotrichum gigasporum]
Length=127

 Score =   125 bits (313),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  51   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  110

Query  439  VDEMIREADVDGDGQIN  489
            VDEMIREAD DGDG+I+
Sbjct  111  VDEMIREADQDGDGRID  127


 Score =   113 bits (283),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 54/58 (93%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +3

Query  108  EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    EFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  58


 Score = 58.5 bits (140),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  1    EFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  60

Query  508  VMMAK  522
            +M  K
Sbjct  61   MMARK  65


 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 1/66 (2%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  62   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  121

Query  252  GNGTID  269
            G+G ID
Sbjct  122  GDGRID  127



>gb|ABW04798.1| calmodulin, partial [Aspergillus ostianus]
 gb|ACC38413.1| calmodulin, partial [Penicillium ramusculum]
 gb|AEO13240.1| calmodulin [Aspergillus parasiticus]
 gb|AEO13245.1| calmodulin [Aspergillus sp. 08AAsp183]
 gb|AEO13246.1| calmodulin [Aspergillus flavus]
 gb|AEO13247.1| calmodulin [Aspergillus flavus]
 gb|AEO13250.1| calmodulin [Aspergillus parasiticus]
 gb|AEO13251.1| calmodulin [Aspergillus sp. 09AAsp146]
 gb|AEO13256.1| calmodulin [Aspergillus sp. 09AAsp152]
 gb|AEO13257.1| calmodulin [Aspergillus sp. 09AAsp494]
Length=127

 Score =   125 bits (314),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  51   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  110

Query  439  VDEMIREADVDGDGQIN  489
            VDEMIREAD DGDG+I+
Sbjct  111  VDEMIREADQDGDGRID  127


 Score =   112 bits (281),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 53/58 (91%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +3

Query  108  EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            E+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  58


 Score = 58.2 bits (139),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  1    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  60

Query  508  VMMAK  522
            +M  K
Sbjct  61   MMARK  65


 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 1/66 (2%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  62   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  121

Query  252  GNGTID  269
            G+G ID
Sbjct  122  GDGRID  127



>gb|EYU23698.1| hypothetical protein MIMGU_mgv1a023732mg [Erythranthe guttata]
Length=150

 Score =   130 bits (328),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FLNLM+RKMK+ D+ EELKEAF+VFDKDQNG+ISA ELR V+ NLGEKLTDEE
Sbjct  62   GTIEFAEFLNLMSRKMKEIDAGEELKEAFKVFDKDQNGYISANELRQVLMNLGEKLTDEE  121

Query  439  VDEMIREADVDGDGQINYEEFVKVM  513
            V +MIREAD+DGDGQ+N++EFVK+M
Sbjct  122  VQQMIREADLDGDGQVNFDEFVKMM  146


 Score =   107 bits (266),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD L ++QI EF+EAFSLFDKDGDGCIT +EL TV+RSL QNPTE EL +M+NEVD+D 
Sbjct  1    MADALNEEQIVEFQEAFSLFDKDGDGCITIEELATVIRSLDQNPTEEELHEMMNEVDSDR  60

Query  255  NGTIDFPEF  281
            NGTI+F EF
Sbjct  61   NGTIEFAEF  69


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +3

Query  108  EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            E KEAF +FDKD +G I+  EL  V+ +LG+  T+ E+Q MI E D DG+G ++F EF
Sbjct  85   ELKEAFKVFDKDQNGYISANELRQVLMNLGEKLTDEEVQQMIREADLDGDGQVNFDEF  142


 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 47/76 (62%), Gaps = 3/76 (4%)
 Frame = +1

Query  304  MKDTDSEE---ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDG  474
            M D  +EE   E +EAF +FDKD +G I+  EL  V+ +L +  T+EE+ EM+ E D D 
Sbjct  1    MADALNEEQIVEFQEAFSLFDKDGDGCITIEELATVIRSLDQNPTEEELHEMMNEVDSDR  60

Query  475  DGQINYEEFVKVMMAK  522
            +G I + EF+ +M  K
Sbjct  61   NGTIEFAEFLNLMSRK  76



>gb|AFP66109.1| calmodulin, partial [Aspergillus amoenus]
 gb|AFP66117.1| calmodulin, partial [Aspergillus creber]
 gb|ABU55252.2| calmodulin, partial [Aspergillus lentulus]
 gb|ABU55253.2| calmodulin, partial [Aspergillus lentulus]
 gb|AGN04147.2| calmodulin, partial [Aspergillus tubingensis]
Length=127

 Score =   132 bits (331),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  47   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  106

Query  439  VDEMIREADVDGDGQINYEEF  501
            VDEMIREAD DGDG+I+Y EF
Sbjct  107  VDEMIREADQDGDGRIDYNEF  127


 Score =   105 bits (263),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 50/54 (93%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  120  AFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            AFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    AFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  54


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  58   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  117

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  118  GDGRIDYNEF  127


 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +1

Query  340  AFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMA  519
            AF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ +M  
Sbjct  1    AFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLTMMAR  60

Query  520  K  522
            K
Sbjct  61   K  61



>emb|CBY85685.1| calmodulin, partial [Aspergillus tubingensis]
 emb|CBY85686.1| calmodulin [Aspergillus niger]
 emb|CBY85690.1| calmodulin, partial [Aspergillus niger]
 emb|CCF78818.1| calmodulin, partial [Aspergillus fumigatus]
 gb|AHA35760.2| calmodulin, partial [Colletotrichum sp. GM77]
Length=127

 Score =   133 bits (335),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  46   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  105

Query  439  VDEMIREADVDGDGQINYEEFV  504
            VDEMIREAD DGDG+I+Y EFV
Sbjct  106  VDEMIREADQDGDGRIDYNEFV  127


 Score =   103 bits (258),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +3

Query  123  FSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            FSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    FSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  53


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  57   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  116

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  117  GDGRIDYNEF  126


 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  343  FRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK  522
            F +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ +M  K
Sbjct  1    FSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLTMMARK  60



>dbj|BAK64557.1| calmodulin [Emericella striata]
Length=127

 Score =   120 bits (301),  Expect(2) = 9e-54, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +3

Query  90   TDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTID  269
            T++Q+SE+KEAFSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTID
Sbjct  1    TEEQVSEYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTID  60

Query  270  FPEF  281
            FPEF
Sbjct  61   FPEF  64


 Score =   116 bits (291),  Expect(2) = 9e-54, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  57   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  116

Query  439  VDEMIREADVD  471
            VDEMIREAD D
Sbjct  117  VDEMIREADQD  127


 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            E KEAF +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ 
Sbjct  7    EYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLT  66

Query  508  VMMAK  522
            +M  K
Sbjct  67   MMARK  71


 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 38/60 (63%), Gaps = 1/60 (2%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  68   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  127



>gb|KEF60247.1| calmodulin [Exophiala aquamarina CBS 119918]
Length=166

 Score =   141 bits (356),  Expect(2) = 9e-54, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  79   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  138

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  139  VDEMIREADQDGDGRIDYNEFVQLMMQK  166


 Score = 95.9 bits (237),  Expect(2) = 9e-54, Method: Compositional matrix adjust.
 Identities = 45/49 (92%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +3

Query  135  DKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            DKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  38   DKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  86


 Score = 61.2 bits (147),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  90   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  149

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  150  GDGRIDYNEF  159



>ref|XP_004391302.1| PREDICTED: LOW QUALITY PROTEIN: calmodulin-like 3 [Trichechus 
manatus latirostris]
Length=148

 Score =   126 bits (317),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTD E+EL+EAF VFDK+++GF+SAAELRHVMT  GE+L+D  
Sbjct  61   GTIDFPEFLGMMARKMKDTDREKELREAFLVFDKNRDGFLSAAELRHVMTTSGERLSDAA  120

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIR  D DGDGQ+NYEEFV+++++K
Sbjct  121  VDEMIRAVDTDGDGQVNYEEFVRMLISK  148


 Score =   110 bits (275),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 60/69 (87%), Gaps = 1/69 (1%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MADQLT++QI+E KEAF   DKDG+G I T+ELGTVMRSLGQNPTEAELQ M+NE+D D 
Sbjct  1    MADQLTEEQIAELKEAFX-SDKDGNGTIITRELGTVMRSLGQNPTEAELQGMVNEIDGDA  59

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  60   NGTIDFPEF  68


 Score = 55.5 bits (132),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D+  E +EAF +FDK+ DG ++  EL  VM + G+  ++A + +MI  VD D
Sbjct  72   MARKMKDTDREKELREAFLVFDKNRDGFLSAAELRHVMTTSGERLSDAAVDEMIRAVDTD  131

Query  252  GNGTIDFPEF  281
            G+G +++ EF
Sbjct  132  GDGQVNYEEF  141


 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 40/65 (62%), Gaps = 1/65 (2%)
 Frame = +1

Query  328  ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVK  507
            ELKEAF   DKD NG I   EL  VM +LG+  T+ E+  M+ E D D +G I++ EF+ 
Sbjct  12   ELKEAFXS-DKDGNGTIITRELGTVMRSLGQNPTEAELQGMVNEIDGDANGTIDFPEFLG  70

Query  508  VMMAK  522
            +M  K
Sbjct  71   MMARK  75



>ref|XP_002565163.1| Pc22g12180 [Penicillium rubens Wisconsin 54-1255]
 emb|CAP98506.1| Pc22g12180 [Penicillium rubens Wisconsin 54-1255]
Length=158

 Score =   126 bits (317),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  58   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  117

Query  439  VDEMIREADVDGDGQIN  489
            VDEMIREAD DGDG+I+
Sbjct  118  VDEMIREADQDGDGRID  134


 Score =   110 bits (275),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 61/69 (88%), Gaps = 4/69 (6%)
 Frame = +3

Query  75   MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG  254
            MAD LT++Q+SE+KEAFSLF +     ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD 
Sbjct  1    MADSLTEEQVSEYKEAFSLFVRQ----ITTKELGTVMRSLGQNPSESELQDMINEVDADN  56

Query  255  NGTIDFPEF  281
            NGTIDFPEF
Sbjct  57   NGTIDFPEF  65


 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 1/66 (2%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  69   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  128

Query  252  GNGTID  269
            G+G ID
Sbjct  129  GDGRID  134



>gb|AGR66928.1| calmodulin, partial [Colletotrichum sp. gnqczg15]
 gb|AIG13032.1| calmodulin, partial [Aspergillus tubingensis]
 gb|AIL29876.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|AIL29877.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|AIL29878.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|AIL29879.1| calmodulin, partial [Colletotrichum gloeosporioides]
 gb|AIN40640.1| calmodulin, partial [Colletotrichum gigasporum]
Length=129

 Score =   140 bits (354),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  42   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  101

Query  439  VDEMIREADVDGDGQINYEEFVKVMMAK  522
            VDEMIREAD DGDG+I+Y EFV++MM K
Sbjct  102  VDEMIREADQDGDGRIDYNEFVQLMMQK  129


 Score = 95.9 bits (237),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 45/49 (92%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +3

Query  135  DKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            DKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    DKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  49


 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  53   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  112

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  113  GDGRIDYNEF  122



>gb|AIZ66412.1| calmodulin, partial [Embellisia astragali]
Length=127

 Score =   134 bits (337),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  45   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  104

Query  439  VDEMIREADVDGDGQINYEEFVK  507
            VDEMIREAD DGDG+I+Y EFV+
Sbjct  105  VDEMIREADQDGDGRIDYNEFVQ  127


 Score =   101 bits (252),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +3

Query  126  SLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            SLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    SLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  52


 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  56   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  115

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  116  GDGRIDYNEF  125


 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +1

Query  349  VFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK  522
            +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ +M  K
Sbjct  2    LFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLTMMARK  59



>gb|ABW72302.1| calmodulin, partial [Aspergillus restrictus]
 gb|AGF85789.1| calmodulin, partial [Aspergillus carbonarius]
 gb|AGF85790.1| calmodulin, partial [Aspergillus carbonarius]
 gb|AIE17053.1| calmodulin, partial [Aspergillus lentulus]
Length=126

 Score =   132 bits (331),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +1

Query  259  GQLTFQSFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEE  438
            G + F  FL +MARKMKDTDSEEE++EAF+VFD+D NGFISAAELRHVMT++GEKLTD+E
Sbjct  46   GTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDE  105

Query  439  VDEMIREADVDGDGQINYEEF  501
            VDEMIREAD DGDG+I+Y EF
Sbjct  106  VDEMIREADQDGDGRIDYNEF  126


 Score =   103 bits (258),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +3

Query  123  FSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF  281
            FSLFDKDGDG ITTKELGTVMRSLGQNP+E+ELQDMINEVDAD NGTIDFPEF
Sbjct  1    FSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEF  53


 Score = 61.2 bits (147),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +3

Query  75   MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD  251
            MA ++ D D   E +EAF +FD+D +G I+  EL  VM S+G+  T+ E+ +MI E D D
Sbjct  57   MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD  116

Query  252  GNGTIDFPEF  281
            G+G ID+ EF
Sbjct  117  GDGRIDYNEF  126


 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  343  FRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK  522
            F +FDKD +G I+  EL  VM +LG+  ++ E+ +MI E D D +G I++ EF+ +M  K
Sbjct  1    FSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLTMMARK  60



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 631248065840