BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001E17

Length=578
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP07421.1|  unnamed protein product                                249   3e-77   Coffea canephora [robusta coffee]
ref|XP_010271414.1|  PREDICTED: uncharacterized protein LOC104607476    243   4e-75   Nelumbo nucifera [Indian lotus]
ref|XP_002306913.1|  hypothetical protein POPTR_0005s25790g             243   7e-75   Populus trichocarpa [western balsam poplar]
ref|XP_011045126.1|  PREDICTED: uncharacterized protein LOC105140124    242   1e-74   Populus euphratica
gb|ACU21328.1|  unknown                                                 234   3e-74   Glycine max [soybeans]
ref|XP_002510507.1|  ATRAD3, putative                                   243   4e-74   Ricinus communis
ref|XP_009337662.1|  PREDICTED: uncharacterized protein LOC103930096    241   5e-74   Pyrus x bretschneideri [bai li]
gb|AAO14627.1|AF467900_4  hypothetical protein                          239   1e-73   Prunus persica
ref|XP_007017750.1|  S-adenosyl-L-methionine-dependent methyltran...    239   2e-73   
emb|CBI19830.3|  unnamed protein product                                239   2e-73   Vitis vinifera
ref|XP_008221299.1|  PREDICTED: uncharacterized protein LOC103321276    239   2e-73   Prunus mume [ume]
ref|XP_002277626.1|  PREDICTED: uncharacterized protein LOC100259190    239   2e-73   Vitis vinifera
gb|KDP36948.1|  hypothetical protein JCGZ_08239                         239   3e-73   Jatropha curcas
ref|XP_008357136.1|  PREDICTED: uncharacterized protein LOC103420870    238   3e-73   Malus domestica [apple tree]
ref|XP_011074653.1|  PREDICTED: uncharacterized protein LOC105159331    238   3e-73   Sesamum indicum [beniseed]
gb|KJB14424.1|  hypothetical protein B456_002G124500                    238   4e-73   Gossypium raimondii
ref|XP_011028977.1|  PREDICTED: uncharacterized protein LOC105128842    238   4e-73   Populus euphratica
ref|XP_009335270.1|  PREDICTED: uncharacterized protein LOC103927...    238   5e-73   
ref|XP_009350044.1|  PREDICTED: uncharacterized protein LOC103941557    238   5e-73   Pyrus x bretschneideri [bai li]
ref|XP_011083506.1|  PREDICTED: uncharacterized protein LOC105166016    237   7e-73   Sesamum indicum [beniseed]
ref|XP_006473627.1|  PREDICTED: uncharacterized protein LOC102620145    237   1e-72   Citrus sinensis [apfelsine]
ref|XP_006435145.1|  hypothetical protein CICLE_v10001297mg             236   2e-72   Citrus clementina [clementine]
ref|XP_004499234.1|  PREDICTED: uncharacterized protein LOC101508990    236   3e-72   Cicer arietinum [garbanzo]
ref|XP_009803492.1|  PREDICTED: uncharacterized protein LOC104248856    236   3e-72   Nicotiana sylvestris
ref|XP_002301989.1|  hypothetical protein POPTR_0002s02640g             235   6e-72   
ref|XP_009335275.1|  PREDICTED: uncharacterized protein LOC103927...    235   7e-72   Pyrus x bretschneideri [bai li]
gb|AFK39036.1|  unknown                                                 227   9e-72   Medicago truncatula
gb|EYU38830.1|  hypothetical protein MIMGU_mgv1a007054mg                234   1e-71   Erythranthe guttata [common monkey flower]
ref|XP_009598077.1|  PREDICTED: uncharacterized protein LOC104093936    234   1e-71   Nicotiana tomentosiformis
ref|XP_004136545.1|  PREDICTED: uncharacterized protein LOC101215265    234   2e-71   Cucumis sativus [cucumbers]
ref|XP_003545042.1|  PREDICTED: uncharacterized protein LOC100786...    234   2e-71   Glycine max [soybeans]
ref|XP_008387957.1|  PREDICTED: uncharacterized protein LOC103450397    233   3e-71   Malus domestica [apple tree]
ref|XP_008442993.1|  PREDICTED: uncharacterized protein LOC103486724    233   3e-71   Cucumis melo [Oriental melon]
gb|ACJ84820.1|  unknown                                                 224   4e-70   Medicago truncatula
ref|XP_006353174.1|  PREDICTED: uncharacterized protein LOC102605433    229   8e-70   Solanum tuberosum [potatoes]
ref|XP_003550415.1|  PREDICTED: uncharacterized protein LOC100812467    229   1e-69   Glycine max [soybeans]
ref|XP_010692715.1|  PREDICTED: uncharacterized protein LOC104905778    228   2e-69   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010095168.1|  putative methyltransferase PMT28                   229   3e-69   Morus notabilis
ref|XP_004291387.1|  PREDICTED: uncharacterized protein LOC101314531    228   5e-69   Fragaria vesca subsp. vesca
ref|XP_010061033.1|  PREDICTED: uncharacterized protein LOC104448821    226   1e-68   Eucalyptus grandis [rose gum]
gb|KEH36237.1|  ATRAD3-like protein                                     224   2e-67   Medicago truncatula
gb|AFK44341.1|  unknown                                                 224   2e-67   Medicago truncatula
ref|XP_003523577.1|  PREDICTED: uncharacterized protein LOC100798510    223   2e-67   Glycine max [soybeans]
ref|XP_004250146.1|  PREDICTED: uncharacterized protein LOC101246201    223   4e-67   Solanum lycopersicum
gb|KEH40211.1|  ATRAD3-like protein                                     222   8e-67   Medicago truncatula
ref|XP_002875365.1|  hypothetical protein ARALYDRAFT_904944             219   1e-65   Arabidopsis lyrata subsp. lyrata
ref|XP_010507038.1|  PREDICTED: uncharacterized protein LOC104783598    216   2e-65   
ref|XP_006291222.1|  hypothetical protein CARUB_v10017354mg             218   2e-65   Capsella rubella
ref|XP_007136075.1|  hypothetical protein PHAVU_009G015500g             217   4e-65   Phaseolus vulgaris [French bean]
ref|XP_007136074.1|  hypothetical protein PHAVU_009G015500g             218   4e-65   Phaseolus vulgaris [French bean]
gb|AAM63602.1|  unknown                                                 217   4e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010514415.1|  PREDICTED: uncharacterized protein LOC104790374    216   7e-65   Camelina sativa [gold-of-pleasure]
ref|XP_010557488.1|  PREDICTED: uncharacterized protein LOC104826476    216   9e-65   Tarenaya hassleriana [spider flower]
ref|XP_007160685.1|  hypothetical protein PHAVU_001G008400g             216   1e-64   Phaseolus vulgaris [French bean]
gb|AAL77659.1|  AT3g27230/K17E12_5                                      216   1e-64   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566813.1|  S-adenosyl-L-methionine-dependent methyltransfe...    216   1e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010425464.1|  PREDICTED: uncharacterized protein LOC104710544    216   2e-64   Camelina sativa [gold-of-pleasure]
ref|XP_006395469.1|  hypothetical protein EUTSA_v10004321mg             213   1e-63   Eutrema salsugineum [saltwater cress]
ref|XP_003600934.1|  hypothetical protein MTR_3g071050                  210   3e-62   
ref|XP_009111558.1|  PREDICTED: uncharacterized protein LOC103836982    207   3e-61   Brassica rapa
emb|CDY20059.1|  BnaA09g01920D                                          203   5e-60   Brassica napus [oilseed rape]
gb|EPS57421.1|  hypothetical protein M569_17397                         202   2e-59   Genlisea aurea
dbj|BAH57084.1|  AT5G40830                                              197   1e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006282947.1|  hypothetical protein CARUB_v10007544mg             197   1e-57   Capsella rubella
ref|NP_198899.1|  S-adenosyl-L-methionine-dependent methyltransfe...    196   4e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010441242.1|  PREDICTED: uncharacterized protein LOC104724...    194   9e-57   Camelina sativa [gold-of-pleasure]
ref|XP_010441241.1|  PREDICTED: uncharacterized protein LOC104724...    194   3e-56   Camelina sativa [gold-of-pleasure]
ref|XP_010450613.1|  PREDICTED: uncharacterized protein LOC104732...    192   1e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010450612.1|  PREDICTED: uncharacterized protein LOC104732...    192   1e-55   Camelina sativa [gold-of-pleasure]
ref|XP_002868627.1|  ATRAD3                                             192   2e-55   
ref|XP_002868633.1|  ATRAD3                                             192   2e-55   Arabidopsis lyrata subsp. lyrata
ref|XP_010450611.1|  PREDICTED: uncharacterized protein LOC104732...    191   4e-55   Camelina sativa [gold-of-pleasure]
emb|CDY00165.1|  BnaC09g01360D                                          186   7e-54   
gb|KJB63557.1|  hypothetical protein B456_010G005600                    186   3e-53   Gossypium raimondii
gb|AES71185.2|  ATRAD3-like protein                                     179   9e-52   Medicago truncatula
ref|XP_008776887.1|  PREDICTED: uncharacterized protein LOC103696936    182   1e-51   Phoenix dactylifera
ref|XP_009399468.1|  PREDICTED: uncharacterized protein LOC103983867    180   7e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010934529.1|  PREDICTED: uncharacterized protein LOC105054654    176   2e-48   Elaeis guineensis
ref|XP_009411357.1|  PREDICTED: uncharacterized protein LOC103993126    166   1e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006840653.1|  hypothetical protein AMTR_s00211p00024510          147   1e-39   Amborella trichopoda
gb|AAK84481.1|  unknown                                                 122   9e-30   Solanum lycopersicum
ref|XP_006849633.1|  hypothetical protein AMTR_s00024p00220290          112   1e-27   Amborella trichopoda
ref|XP_006854792.1|  hypothetical protein AMTR_s00063p00150900        85.5    6e-18   
ref|XP_003561200.1|  PREDICTED: uncharacterized protein LOC100825782  73.6    4e-12   Brachypodium distachyon [annual false brome]
gb|ABL85035.1|  expressed protein                                     72.4    1e-11   Brachypodium sylvaticum
ref|XP_006857792.1|  hypothetical protein AMTR_s00061p00214420        64.7    2e-10   
ref|XP_006655770.1|  PREDICTED: uncharacterized protein LOC102722126  65.9    2e-09   Oryza brachyantha
ref|XP_002992478.1|  hypothetical protein SELMODRAFT_135385           62.8    2e-08   
ref|XP_004964486.1|  PREDICTED: uncharacterized protein LOC101778925  62.0    4e-08   Setaria italica
ref|NP_001174590.1|  Os06g0138500                                     61.6    5e-08   
dbj|BAJ84801.1|  predicted protein                                    60.8    7e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011028455.1|  PREDICTED: uncharacterized protein LOC105128...  57.8    1e-06   Populus euphratica
ref|XP_011028454.1|  PREDICTED: uncharacterized protein LOC105128...  57.4    1e-06   Populus euphratica
gb|EEE56914.1|  hypothetical protein OsJ_06590                        57.0    2e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006360379.1|  PREDICTED: uncharacterized protein LOC102594943  56.6    2e-06   Solanum tuberosum [potatoes]
ref|NP_001144838.1|  uncharacterized protein LOC100277923             56.6    2e-06   
ref|XP_004240038.1|  PREDICTED: probable methyltransferase PMT19      56.2    3e-06   Solanum lycopersicum
ref|XP_004986277.1|  PREDICTED: uncharacterized protein LOC101771363  56.2    3e-06   Setaria italica
ref|XP_002437791.1|  hypothetical protein SORBIDRAFT_10g002660        56.2    3e-06   
gb|ACF83461.1|  unknown                                               56.2    3e-06   Zea mays [maize]
ref|XP_009619701.1|  PREDICTED: uncharacterized protein LOC104111663  55.1    7e-06   Nicotiana tomentosiformis
ref|XP_010252251.1|  PREDICTED: uncharacterized protein LOC104593885  54.7    1e-05   Nelumbo nucifera [Indian lotus]
ref|XP_009774313.1|  PREDICTED: probable methyltransferase PMT19      53.9    2e-05   Nicotiana sylvestris
ref|XP_008644572.1|  PREDICTED: uncharacterized protein LOC103625944  53.5    3e-05   Zea mays [maize]
ref|XP_002993215.1|  hypothetical protein SELMODRAFT_431315           52.8    4e-05   Selaginella moellendorffii
gb|KJB67513.1|  hypothetical protein B456_010G194500                  52.8    4e-05   Gossypium raimondii
ref|XP_010924091.1|  PREDICTED: uncharacterized protein LOC105047017  52.4    7e-05   
ref|XP_011087590.1|  PREDICTED: uncharacterized protein LOC105169030  52.4    7e-05   Sesamum indicum [beniseed]
ref|XP_002519380.1|  ATRAD3, putative                                 51.6    1e-04   Ricinus communis
gb|KDO40688.1|  hypothetical protein CISIN_1g043503mg                 51.6    1e-04   Citrus sinensis [apfelsine]
ref|XP_006431374.1|  hypothetical protein CICLE_v10003316mg           51.6    1e-04   Citrus clementina [clementine]
ref|XP_006836952.1|  hypothetical protein AMTR_s00099p00160150        51.2    1e-04   Amborella trichopoda
ref|XP_002965799.1|  hypothetical protein SELMODRAFT_84529            51.2    1e-04   
ref|XP_009762652.1|  PREDICTED: uncharacterized protein LOC104214650  51.2    1e-04   Nicotiana sylvestris
gb|AFW56218.1|  hypothetical protein ZEAMMB73_835727                  50.4    2e-04   
ref|XP_008801541.1|  PREDICTED: uncharacterized protein LOC103715629  50.8    2e-04   
gb|EMT18502.1|  hypothetical protein F775_00868                       49.3    5e-04   
gb|EYU33234.1|  hypothetical protein MIMGU_mgv1a026970mg              49.7    5e-04   Erythranthe guttata [common monkey flower]
ref|XP_006470793.1|  PREDICTED: uncharacterized protein LOC102607511  49.3    7e-04   Citrus sinensis [apfelsine]



>emb|CDP07421.1| unnamed protein product [Coffea canephora]
Length=420

 Score =   249 bits (635),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 137/160 (86%), Gaps = 7/160 (4%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPK-------IHDA  277
            MG+VSLK G+G+ARFKRAS CSSA+NV MLFSV+TTN+FAL+AFTYSPK       IH  
Sbjct  1    MGSVSLKIGDGTARFKRASLCSSAVNVLMLFSVITTNLFALYAFTYSPKDPLTTHSIHHT  60

Query  278  HENIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPL  457
             +NI ++SEQVSLIL EIESSQKKL Q+EKELLGYESIDLSRPN A ELK FL HH LPL
Sbjct  61   QKNISLISEQVSLILREIESSQKKLAQMEKELLGYESIDLSRPNTASELKVFLQHHLLPL  120

Query  458  GKDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            GKDSRTGITEMVAS+GHSC+KS+DLLSQ+M YKV+G CPD
Sbjct  121  GKDSRTGITEMVASVGHSCEKSVDLLSQYMNYKVSGPCPD  160



>ref|XP_010271414.1| PREDICTED: uncharacterized protein LOC104607476 [Nelumbo nucifera]
Length=417

 Score =   243 bits (621),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 139/156 (89%), Gaps = 3/156 (2%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPK---IHDAHENI  289
            MG+VSLK G+G+ARFKRAS CSSA+NV MLFSV+TTN+FAL+AFT SP+   +H AH+NI
Sbjct  1    MGSVSLKIGDGTARFKRASLCSSALNVIMLFSVLTTNLFALYAFTSSPQNQTVHHAHKNI  60

Query  290  FVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLGKDS  469
             ++SEQVSLIL EI+SSQ+KL Q+EKELLGYE+ID+SRPN+A+ELK FL HH LPLGKDS
Sbjct  61   SLISEQVSLILREIDSSQRKLAQMEKELLGYENIDISRPNIANELKLFLQHHSLPLGKDS  120

Query  470  RTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            RTGITEMVAS+GHSC+KS+D+LSQ+M YK+ G CPD
Sbjct  121  RTGITEMVASVGHSCEKSIDVLSQYMSYKLGGACPD  156



>ref|XP_002306913.1| hypothetical protein POPTR_0005s25790g [Populus trichocarpa]
 gb|EEE93909.1| hypothetical protein POPTR_0005s25790g [Populus trichocarpa]
Length=420

 Score =   243 bits (619),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 138/159 (87%), Gaps = 6/159 (4%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPK------IHDAH  280
            MG+VSLK G+G+ARFKRASFCSSA+N+ MLFSV+TTN+FAL+AFT SPK      IH+ H
Sbjct  1    MGSVSLKIGDGTARFKRASFCSSAVNILMLFSVITTNLFALYAFTSSPKDHQAHLIHNPH  60

Query  281  ENIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLG  460
            +NI ++SE VSLIL EI SSQKKL ++EKELLGYE++D+SRPN+A ELK FL HHQLPLG
Sbjct  61   KNISLISEHVSLILREIASSQKKLARMEKELLGYETMDISRPNIASELKLFLQHHQLPLG  120

Query  461  KDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            KDSRTGITEMVAS+GHSC+KS DLLSQ+M YK++G CPD
Sbjct  121  KDSRTGITEMVASVGHSCEKSPDLLSQYMVYKISGPCPD  159



>ref|XP_011045126.1| PREDICTED: uncharacterized protein LOC105140124 [Populus euphratica]
Length=420

 Score =   242 bits (617),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 138/159 (87%), Gaps = 6/159 (4%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPK------IHDAH  280
            MG+VSLK G+G+ARF+RASFCSSA+N+ MLFSVVTTN+FAL+AFT SPK      +H+ H
Sbjct  1    MGSVSLKIGDGTARFRRASFCSSAVNILMLFSVVTTNLFALYAFTSSPKDHQAHLVHNPH  60

Query  281  ENIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLG  460
            +NI ++SE VSLIL EI SSQKKL ++EKELLGYE++D+SRPN+A ELK FL HHQLPLG
Sbjct  61   KNISLISEHVSLILREIASSQKKLARMEKELLGYETMDISRPNIASELKLFLQHHQLPLG  120

Query  461  KDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            KDSRTGITEMVAS+GHSC+KS DLLSQ+M YK++G CPD
Sbjct  121  KDSRTGITEMVASVGHSCEKSPDLLSQYMVYKISGPCPD  159



>gb|ACU21328.1| unknown [Glycine max]
Length=215

 Score =   234 bits (597),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 134/160 (84%), Gaps = 7/160 (4%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPKI-------HDA  277
            MG+VSLK G+G+ARF RA+ CSSA+N+ M+FSV+TTN+FAL+AFT SPK        H+A
Sbjct  1    MGSVSLKVGDGTARFHRATLCSSAVNILMIFSVITTNLFALYAFTASPKHPHHSLLHHNA  60

Query  278  HENIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPL  457
            H+NI ++SEQVSLIL EI+ SQKKL Q+E+ELLGYESIDLSRPN+A ELK FL  HQLPL
Sbjct  61   HKNISLISEQVSLILREIDLSQKKLAQMERELLGYESIDLSRPNIASELKLFLQRHQLPL  120

Query  458  GKDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            GKDSRTGITEMV S+GH+C+K+ DLLSQFM YKV G CPD
Sbjct  121  GKDSRTGITEMVPSVGHTCEKNSDLLSQFMNYKVFGACPD  160



>ref|XP_002510507.1| ATRAD3, putative [Ricinus communis]
 gb|EEF52694.1| ATRAD3, putative [Ricinus communis]
Length=490

 Score =   243 bits (619),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 146/176 (83%), Gaps = 8/176 (5%)
 Frame = +2

Query  74   SPTHNTFPCRFSRV-KMGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAF  250
            +P  N+   R  R+ KMG+VSLK G+G+ARFKRA+ CSSA+N+ MLFSV++TN+FAL+AF
Sbjct  54   TPNLNSSLYRSHRLQKMGSVSLKIGDGTARFKRATICSSAVNILMLFSVISTNLFALYAF  113

Query  251  TYSPK-------IHDAHENIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPN  409
            T SPK        H  H+NI ++SEQVSLIL EI+SSQKKL ++EKELLGYE+ID+SRPN
Sbjct  114  TSSPKDQHQAHIFHHPHKNISLISEQVSLILKEIDSSQKKLAKMEKELLGYETIDISRPN  173

Query  410  VADELKTFLLHHQLPLGKDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            +A+ELK FL HHQLPLGKDSRTGITEMVAS+GHSC+KS DLLSQ+M YKV+G CPD
Sbjct  174  IANELKLFLQHHQLPLGKDSRTGITEMVASVGHSCEKSADLLSQYMTYKVSGPCPD  229



>ref|XP_009337662.1| PREDICTED: uncharacterized protein LOC103930096 [Pyrus x bretschneideri]
Length=421

 Score =   241 bits (614),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 137/160 (86%), Gaps = 7/160 (4%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPK-------IHDA  277
            MG+VSLK G+GSARF+RAS CSSA+N+ MLFSV+TTN+FAL+AFTYSPK       +H  
Sbjct  1    MGSVSLKIGDGSARFRRASLCSSAVNLLMLFSVITTNLFALYAFTYSPKDHQTYHLLHHT  60

Query  278  HENIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPL  457
             +NI ++SEQV+LIL EI+SSQKKL Q+EKELLGYESIDLS PN+A+ELK FL HHQLPL
Sbjct  61   QKNISLISEQVALILREIDSSQKKLAQMEKELLGYESIDLSNPNIANELKVFLQHHQLPL  120

Query  458  GKDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            GKDS+TGITEMVAS+GHSC+KS  LLSQ+M YKV+G CPD
Sbjct  121  GKDSKTGITEMVASVGHSCEKSAGLLSQYMNYKVSGPCPD  160



>gb|AAO14627.1|AF467900_4 hypothetical protein [Prunus persica]
Length=421

 Score =   239 bits (611),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 136/160 (85%), Gaps = 7/160 (4%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPK-------IHDA  277
            MG+VSLK G+G+ARFKRA+ CSSA+N+ MLFSV+TTN+FAL+AFT SPK       +H  
Sbjct  1    MGSVSLKIGDGTARFKRATLCSSAVNLLMLFSVITTNLFALYAFTSSPKDQQTYHLLHHT  60

Query  278  HENIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPL  457
             +NI ++SEQVSLIL EI+SSQKKL Q+EKELLGYESIDLSR NVA ELK FL HHQLPL
Sbjct  61   QKNISLISEQVSLILREIDSSQKKLAQMEKELLGYESIDLSRSNVAHELKLFLQHHQLPL  120

Query  458  GKDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            GKDSRTGITEMVAS+GHSC+KS DLLSQ+M YKV+G CPD
Sbjct  121  GKDSRTGITEMVASVGHSCEKSADLLSQYMNYKVSGPCPD  160



>ref|XP_007017750.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOY14975.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=420

 Score =   239 bits (609),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 136/159 (86%), Gaps = 6/159 (4%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPKIH------DAH  280
            MG+VSLK G+G+ARFKRA+ CSSA+N+ MLFSV+TTN+FAL+AFTYSPK H         
Sbjct  1    MGSVSLKIGDGTARFKRATLCSSAVNILMLFSVLTTNLFALYAFTYSPKQHISNPLNHPQ  60

Query  281  ENIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLG  460
            +NI ++SEQVSLI+ EI+SSQ+KL Q+EKELLGY+++DLSRPN+A ELK FL HHQLPLG
Sbjct  61   KNISLISEQVSLIIREIDSSQRKLAQMEKELLGYDTLDLSRPNLASELKLFLQHHQLPLG  120

Query  461  KDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            KDSRTGITEMVAS+GHSC+KS DLLSQ+M YKV G CPD
Sbjct  121  KDSRTGITEMVASVGHSCEKSADLLSQYMSYKVYGPCPD  159



>emb|CBI19830.3| unnamed protein product [Vitis vinifera]
Length=446

 Score =   239 bits (611),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 134/160 (84%), Gaps = 5/160 (3%)
 Frame = +2

Query  113  VKMGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPK-----IHDA  277
             +MG+VSLK G+G+ARF+RAS CSSA+NV MLFSV+TTN+FAL+AFT SPK         
Sbjct  37   AEMGSVSLKIGDGTARFRRASLCSSAVNVLMLFSVITTNLFALYAFTSSPKDQAHPTQHT  96

Query  278  HENIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPL  457
            H+NI  +SEQVSLI+ EIESSQKKL Q+EKELLGYESIDLSRPN A ELK FL  HQLPL
Sbjct  97   HKNISFISEQVSLIIREIESSQKKLAQMEKELLGYESIDLSRPNTASELKLFLQRHQLPL  156

Query  458  GKDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            GKDS+TGITEMVAS+GHSC KS+DLLSQ+M YKV+G CPD
Sbjct  157  GKDSKTGITEMVASVGHSCDKSVDLLSQYMTYKVSGACPD  196



>ref|XP_008221299.1| PREDICTED: uncharacterized protein LOC103321276 [Prunus mume]
Length=421

 Score =   239 bits (609),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 136/160 (85%), Gaps = 7/160 (4%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPK-------IHDA  277
            MG+VSLK G+G+ARFKRA+ CSSA+N+ MLFSV+TTN+FAL+AFT SPK       +H  
Sbjct  1    MGSVSLKIGDGTARFKRATLCSSAVNLLMLFSVITTNLFALYAFTSSPKDQQTYHLLHHT  60

Query  278  HENIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPL  457
             +NI ++SEQVSLIL EI+SSQKKL Q+EKELLGYESIDLSR NVA ELK FL HHQLPL
Sbjct  61   QKNISLISEQVSLILREIDSSQKKLAQMEKELLGYESIDLSRSNVAHELKLFLQHHQLPL  120

Query  458  GKDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            GKDSRTGITEMVAS+GHSC+KS DLLSQ+M YKV+G CPD
Sbjct  121  GKDSRTGITEMVASVGHSCEKSADLLSQYMNYKVSGPCPD  160



>ref|XP_002277626.1| PREDICTED: uncharacterized protein LOC100259190 [Vitis vinifera]
Length=419

 Score =   239 bits (609),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 133/158 (84%), Gaps = 5/158 (3%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPK-----IHDAHE  283
            MG+VSLK G+G+ARF+RAS CSSA+NV MLFSV+TTN+FAL+AFT SPK         H+
Sbjct  1    MGSVSLKIGDGTARFRRASLCSSAVNVLMLFSVITTNLFALYAFTSSPKDQAHPTQHTHK  60

Query  284  NIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLGK  463
            NI  +SEQVSLI+ EIESSQKKL Q+EKELLGYESIDLSRPN A ELK FL  HQLPLGK
Sbjct  61   NISFISEQVSLIIREIESSQKKLAQMEKELLGYESIDLSRPNTASELKLFLQRHQLPLGK  120

Query  464  DSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            DS+TGITEMVAS+GHSC KS+DLLSQ+M YKV+G CPD
Sbjct  121  DSKTGITEMVASVGHSCDKSVDLLSQYMTYKVSGACPD  158



>gb|KDP36948.1| hypothetical protein JCGZ_08239 [Jatropha curcas]
Length=420

 Score =   239 bits (609),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 137/159 (86%), Gaps = 6/159 (4%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPK------IHDAH  280
            MG+VSLK G+G+ARFKRA+ CSSA+NV M+FSV++TN+FAL+AFT S K       H+ H
Sbjct  1    MGSVSLKIGDGTARFKRATVCSSAVNVLMIFSVISTNLFALYAFTSSSKHHQNHLFHNTH  60

Query  281  ENIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLG  460
            +NI ++SEQVSLIL EI+SSQKKL ++EKELLGYE+ID+SRPN+A+ELK FL HHQLPLG
Sbjct  61   KNISLISEQVSLILREIDSSQKKLAKMEKELLGYETIDISRPNIANELKLFLQHHQLPLG  120

Query  461  KDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            KDSRTGITEMVAS+GHSC KS DLLSQFM YKV+G CPD
Sbjct  121  KDSRTGITEMVASVGHSCDKSADLLSQFMTYKVSGPCPD  159



>ref|XP_008357136.1| PREDICTED: uncharacterized protein LOC103420870 [Malus domestica]
Length=421

 Score =   238 bits (608),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 136/160 (85%), Gaps = 7/160 (4%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPK-------IHDA  277
            MG+VSLK G+GSARF+RAS CSSA+N+ MLFSV+TTN+FAL+AFTYSPK       +H  
Sbjct  1    MGSVSLKIGDGSARFRRASLCSSAVNLLMLFSVITTNLFALYAFTYSPKDHQTYRLLHHT  60

Query  278  HENIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPL  457
             +NI ++SEQV+LIL EI+SSQKKL Q+EKELLGYESIDLS PN+A+ELK FL HH LPL
Sbjct  61   QKNISLISEQVALILREIDSSQKKLAQMEKELLGYESIDLSNPNIANELKVFLQHHSLPL  120

Query  458  GKDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            GKDS+TGITEMVAS+GHSC+KS  LLSQ+M YKV+G CPD
Sbjct  121  GKDSKTGITEMVASVGHSCEKSAGLLSQYMNYKVSGPCPD  160



>ref|XP_011074653.1| PREDICTED: uncharacterized protein LOC105159331 [Sesamum indicum]
Length=415

 Score =   238 bits (608),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 136/156 (87%), Gaps = 3/156 (2%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPK-IHDAH--ENI  289
            MG+VSLK G G+ARFKR S CSSA+N+ MLFSV+TTN+FA +AF+Y PK +H+ H  ENI
Sbjct  1    MGSVSLKIGEGTARFKRVSVCSSAVNLLMLFSVITTNLFAWYAFSYHPKTLHNHHYPENI  60

Query  290  FVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLGKDS  469
             ++SE+VSLIL EIESSQKKL Q+EK++LGYESIDLSRPN+A+ELK FL  HQLPLGKDS
Sbjct  61   SLISERVSLILREIESSQKKLAQMEKQILGYESIDLSRPNIANELKEFLNSHQLPLGKDS  120

Query  470  RTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            RTGITEMVAS+GHSC+KS DLLSQ+M YKVNG CPD
Sbjct  121  RTGITEMVASVGHSCEKSADLLSQYMSYKVNGLCPD  156



>gb|KJB14424.1| hypothetical protein B456_002G124500 [Gossypium raimondii]
Length=420

 Score =   238 bits (607),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 136/159 (86%), Gaps = 6/159 (4%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPK------IHDAH  280
            MG+VSLK G+G+ARFKRA+ CSSA+N+ MLFSV+TTN+FAL+AFT+SPK       H  H
Sbjct  1    MGSVSLKIGDGTARFKRATLCSSAVNILMLFSVITTNLFALYAFTFSPKQHLDNPFHHPH  60

Query  281  ENIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLG  460
             NI ++S+ VSLI+ EI+SSQ+KL Q+EKELLGY+++DLSRPN+A ELK FL HHQLPLG
Sbjct  61   RNISLISQHVSLIIKEIDSSQRKLAQMEKELLGYDTLDLSRPNLATELKLFLQHHQLPLG  120

Query  461  KDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            KDSRTGITEMVAS+GHSC+KS DLLSQ+M YKV+G CPD
Sbjct  121  KDSRTGITEMVASVGHSCEKSADLLSQYMSYKVSGPCPD  159



>ref|XP_011028977.1| PREDICTED: uncharacterized protein LOC105128842 [Populus euphratica]
 ref|XP_011028978.1| PREDICTED: uncharacterized protein LOC105128842 [Populus euphratica]
 ref|XP_011028979.1| PREDICTED: uncharacterized protein LOC105128842 [Populus euphratica]
 ref|XP_011028980.1| PREDICTED: uncharacterized protein LOC105128842 [Populus euphratica]
Length=420

 Score =   238 bits (607),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 136/158 (86%), Gaps = 6/158 (4%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPK------IHDAH  280
            MG+VSLK G+G+ARFKRASFCSSA+N+ MLFSV+TTN+FAL+AFT SPK       H+ H
Sbjct  1    MGSVSLKIGDGTARFKRASFCSSAVNILMLFSVLTTNLFALYAFTSSPKDHQTHLFHNPH  60

Query  281  ENIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLG  460
            +NI ++SE+VSLIL EI +SQKKL  +EKELLGYE++D+SRPN+A ELK FL HHQLPLG
Sbjct  61   KNISLISERVSLILREIAASQKKLAGMEKELLGYETMDISRPNIASELKLFLQHHQLPLG  120

Query  461  KDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCP  574
            KDSRTGITEMVAS+GHSC+KS DLLSQ+M YKV+G CP
Sbjct  121  KDSRTGITEMVASVGHSCEKSADLLSQYMAYKVSGPCP  158



>ref|XP_009335270.1| PREDICTED: uncharacterized protein LOC103927992 isoform X1 [Pyrus 
x bretschneideri]
Length=421

 Score =   238 bits (607),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 137/160 (86%), Gaps = 7/160 (4%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPK-------IHDA  277
            MG+VSLK G+G+ARF+RAS CSSA+N+ MLFSV+TTN+FAL+AFT +PK       +H  
Sbjct  1    MGSVSLKIGDGTARFRRASLCSSAVNLLMLFSVITTNLFALYAFTSAPKDHQTYHLLHHT  60

Query  278  HENIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPL  457
             +NI ++SEQV LIL EI+SSQKKL Q+EKELLGY+SIDLS+PNVA+ELK FL HHQLPL
Sbjct  61   QKNISLISEQVGLILREIDSSQKKLAQMEKELLGYKSIDLSKPNVANELKVFLQHHQLPL  120

Query  458  GKDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            GKDS+TGITEMVAS+GHSC+KS DLLSQ+M YKV+G CPD
Sbjct  121  GKDSKTGITEMVASVGHSCEKSADLLSQYMNYKVSGPCPD  160



>ref|XP_009350044.1| PREDICTED: uncharacterized protein LOC103941557 [Pyrus x bretschneideri]
Length=421

 Score =   238 bits (607),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 137/160 (86%), Gaps = 7/160 (4%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPK-------IHDA  277
            MG+VSLK G+G+ARF+RAS CSSA+N+ MLFSV+TTN+FAL+AFT +PK       +H  
Sbjct  1    MGSVSLKIGDGTARFRRASLCSSAVNLLMLFSVITTNLFALYAFTSAPKDHQTYHLLHHT  60

Query  278  HENIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPL  457
             +NI ++SEQV LIL EI+SSQKKL Q+EKELLGY+SIDLS+PNVA+ELK FL HHQLPL
Sbjct  61   QKNISLISEQVGLILREIDSSQKKLAQMEKELLGYKSIDLSKPNVANELKVFLQHHQLPL  120

Query  458  GKDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            GKDS+TGITEMVAS+GHSC+KS DLLSQ+M YKV+G CPD
Sbjct  121  GKDSKTGITEMVASVGHSCEKSADLLSQYMNYKVSGPCPD  160



>ref|XP_011083506.1| PREDICTED: uncharacterized protein LOC105166016 [Sesamum indicum]
Length=415

 Score =   237 bits (605),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 135/156 (87%), Gaps = 3/156 (2%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPKI---HDAHENI  289
            MG+VSLK G+G+ARFKRAS CSSA+N  MLFSV+TTN+FAL+AFTY P     H+  +NI
Sbjct  1    MGSVSLKIGDGTARFKRASMCSSAVNFLMLFSVITTNLFALYAFTYRPTTLHHHNYPKNI  60

Query  290  FVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLGKDS  469
             ++SE+VSLIL +IESSQ KL+Q+EKELLGY+SIDLS PN+A+ELK FL  HQLPLGKDS
Sbjct  61   SLISEKVSLILRQIESSQNKLSQMEKELLGYKSIDLSGPNIANELKEFLNRHQLPLGKDS  120

Query  470  RTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            RTGITEMVAS+GHSC+KS+DLLSQFM YKVNG CPD
Sbjct  121  RTGITEMVASVGHSCEKSVDLLSQFMSYKVNGPCPD  156



>ref|XP_006473627.1| PREDICTED: uncharacterized protein LOC102620145 [Citrus sinensis]
 gb|KDO84792.1| hypothetical protein CISIN_1g037675mg [Citrus sinensis]
Length=418

 Score =   237 bits (604),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 138/160 (86%), Gaps = 8/160 (5%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPK-------IHDA  277
            MG+VSLK G+G+ARFKRA+ CSSA+N+ MLFSVVTTN+FAL+AFT SPK       IH+ 
Sbjct  1    MGSVSLKIGDGTARFKRATICSSALNILMLFSVVTTNLFALYAFTSSPKDGQIHSLIHN-  59

Query  278  HENIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPL  457
            H+NI ++SE VSLIL EI+SSQKKL ++EKELLGY+SIDLSRPN+A ELK FL HHQLPL
Sbjct  60   HKNISLISEHVSLILKEIDSSQKKLAKMEKELLGYQSIDLSRPNIASELKLFLQHHQLPL  119

Query  458  GKDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            GKDSRTGITEMVAS+GHSC+KS DLL+Q+M YK++G CPD
Sbjct  120  GKDSRTGITEMVASVGHSCEKSADLLTQYMTYKLSGPCPD  159



>ref|XP_006435145.1| hypothetical protein CICLE_v10001297mg [Citrus clementina]
 gb|ESR48385.1| hypothetical protein CICLE_v10001297mg [Citrus clementina]
Length=418

 Score =   236 bits (603),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 138/160 (86%), Gaps = 8/160 (5%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPK-------IHDA  277
            MG+VSLK G+G+ARFKRA+ CSSA+N+ MLFSVVTTN+FAL+AFT SPK       IH+ 
Sbjct  1    MGSVSLKIGDGTARFKRATICSSALNILMLFSVVTTNLFALYAFTSSPKDGQIHSLIHN-  59

Query  278  HENIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPL  457
            H+NI ++SE VSLIL EI+SSQKKL ++EKELLGY+SIDLSRPN+A ELK FL HHQLPL
Sbjct  60   HKNISLISEHVSLILKEIDSSQKKLAKMEKELLGYQSIDLSRPNIASELKLFLQHHQLPL  119

Query  458  GKDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            GKDSRTGITEMVAS+GHSC+KS DLL+Q+M YK++G CPD
Sbjct  120  GKDSRTGITEMVASVGHSCEKSADLLTQYMTYKLSGPCPD  159



>ref|XP_004499234.1| PREDICTED: uncharacterized protein LOC101508990 [Cicer arietinum]
Length=423

 Score =   236 bits (602),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 136/159 (86%), Gaps = 6/159 (4%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPKIHD------AH  280
            MG+VSLK G+G+ARFKRAS CSSA+N+ M+F V+TTN+FAL+AFT SPK ++       H
Sbjct  1    MGSVSLKIGDGTARFKRASLCSSAVNILMIFCVITTNLFALYAFTSSPKNNNNNLLHHVH  60

Query  281  ENIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLG  460
            +NI +VSEQVSLIL EI+ SQKKL Q+EKE+LGYESIDLSRPN+A+ELK FLL HQLPL 
Sbjct  61   KNISLVSEQVSLILREIDLSQKKLAQMEKEILGYESIDLSRPNIANELKIFLLRHQLPLW  120

Query  461  KDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            KDSRTGITEMVAS+GHSC K+ DLLSQFM YKV+G+CPD
Sbjct  121  KDSRTGITEMVASVGHSCDKASDLLSQFMSYKVSGNCPD  159



>ref|XP_009803492.1| PREDICTED: uncharacterized protein LOC104248856 [Nicotiana sylvestris]
Length=420

 Score =   236 bits (602),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 135/161 (84%), Gaps = 8/161 (5%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPKIHD--------  274
            MG+VSLK G+G+ARFKRAS+CSSA+N+ MLFSVVTTN+FAL+AFT SPK H         
Sbjct  1    MGSVSLKIGDGTARFKRASYCSSALNLLMLFSVVTTNLFALYAFTSSPKNHHNASHLLLH  60

Query  275  AHENIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLP  454
             H+NI ++SEQVSLIL EI+SSQKKL Q+EKELLGYESIDLS   +A EL+TFL HH LP
Sbjct  61   THKNISLISEQVSLILREIDSSQKKLAQMEKELLGYESIDLSNSKIATELRTFLQHHLLP  120

Query  455  LGKDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            LGKDSRTGITEMVAS+GHSC KS+DLLSQFM YKV+G CPD
Sbjct  121  LGKDSRTGITEMVASVGHSCVKSMDLLSQFMNYKVSGPCPD  161



>ref|XP_002301989.1| hypothetical protein POPTR_0002s02640g [Populus trichocarpa]
 gb|EEE81262.1| hypothetical protein POPTR_0002s02640g [Populus trichocarpa]
Length=420

 Score =   235 bits (599),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 134/158 (85%), Gaps = 6/158 (4%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPK------IHDAH  280
            MG+VSLK G+G+ARFKRASFCSSA+N+ MLFSV+TTN+FAL+AFT SPK       H+ H
Sbjct  1    MGSVSLKIGDGTARFKRASFCSSAVNILMLFSVLTTNLFALYAFTSSPKDHQTHLFHNPH  60

Query  281  ENIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLG  460
            +NI ++SE VSLIL EI +SQKKL  +EKELLGYE++D+SRPN+A ELK FL HHQLPLG
Sbjct  61   KNISLISEHVSLILREIAASQKKLAGMEKELLGYETMDISRPNIASELKLFLQHHQLPLG  120

Query  461  KDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCP  574
            KDSRTGITEMVAS+GHSC+KS DLL Q+M YKV+G CP
Sbjct  121  KDSRTGITEMVASVGHSCEKSADLLYQYMAYKVSGPCP  158



>ref|XP_009335275.1| PREDICTED: uncharacterized protein LOC103927992 isoform X2 [Pyrus 
x bretschneideri]
Length=421

 Score =   235 bits (599),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 136/160 (85%), Gaps = 7/160 (4%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPK-------IHDA  277
            MG+VSLK G+G+A F+RAS CSSA+N+ MLFSV+TTN+FAL+AFT +PK       +H  
Sbjct  1    MGSVSLKIGDGTATFRRASLCSSAVNLLMLFSVITTNLFALYAFTSAPKDHQTYHLLHHT  60

Query  278  HENIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPL  457
             +NI ++SEQV LIL EI+SSQKKL Q+EKELLGY+SIDLS+PNVA+ELK FL HHQLPL
Sbjct  61   QKNISLISEQVGLILREIDSSQKKLAQMEKELLGYKSIDLSKPNVANELKVFLQHHQLPL  120

Query  458  GKDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            GKDS+TGITEMVAS+GHSC+KS DLLSQ+M YKV+G CPD
Sbjct  121  GKDSKTGITEMVASVGHSCEKSADLLSQYMNYKVSGPCPD  160



>gb|AFK39036.1| unknown [Medicago truncatula]
Length=177

 Score =   227 bits (578),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 132/164 (80%), Gaps = 11/164 (7%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPK-----------  265
            MG+VSLK G+G+ARFKRA+ CSSA+N+ M+F V+TTN+FAL+AFT S             
Sbjct  1    MGSVSLKIGDGTARFKRATLCSSAVNILMIFCVITTNLFALYAFTSSSSKNHTTTNTNNS  60

Query  266  IHDAHENIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHH  445
              + H+NI +VSEQVSLIL EI+ SQKKL Q+EK+LLGYESIDLSRPN+A+ELK FL  H
Sbjct  61   NLNLHKNISLVSEQVSLILREIDLSQKKLAQMEKQLLGYESIDLSRPNIANELKIFLQRH  120

Query  446  QLPLGKDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            QLPLGKDSRTGITEMV+S+GHSC+KS DLLSQFM YK +G CPD
Sbjct  121  QLPLGKDSRTGITEMVSSVGHSCEKSADLLSQFMSYKASGACPD  164



>gb|EYU38830.1| hypothetical protein MIMGU_mgv1a007054mg [Erythranthe guttata]
Length=421

 Score =   234 bits (598),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 136/160 (85%), Gaps = 7/160 (4%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTY-SPKIH------DA  277
            MGAVSLK G+G+ARFKRA+  SSA+N  MLFSV+TTN+FAL+AFTY +P IH        
Sbjct  1    MGAVSLKIGDGTARFKRATMYSSAVNFLMLFSVITTNLFALYAFTYHTPTIHHYSNNNSY  60

Query  278  HENIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPL  457
             +NI ++SE+VSLIL EIESSQKKLTQ+EK+LLGYESIDLSRPN+A ELK FL HH LPL
Sbjct  61   PKNISLISEKVSLILREIESSQKKLTQMEKQLLGYESIDLSRPNIAIELKQFLNHHLLPL  120

Query  458  GKDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            GKDSRTGITEMVAS+GHSC+KS+DLLS+FM YKVNG CPD
Sbjct  121  GKDSRTGITEMVASVGHSCEKSVDLLSEFMNYKVNGLCPD  160



>ref|XP_009598077.1| PREDICTED: uncharacterized protein LOC104093936 [Nicotiana tomentosiformis]
Length=420

 Score =   234 bits (597),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 134/161 (83%), Gaps = 8/161 (5%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPKIHD--------  274
            MG+VSLK G+G+ARFKRAS+CSSA+N+ MLFSVVTTN+FAL+AFT SPK H         
Sbjct  1    MGSVSLKIGDGTARFKRASYCSSALNLLMLFSVVTTNLFALYAFTSSPKNHHNAHLLLPH  60

Query  275  AHENIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLP  454
             H+NI ++SEQVSLIL EI+SSQKKL Q+EKELLGYESIDLS   +A EL+TFL HH LP
Sbjct  61   THKNISLISEQVSLILREIDSSQKKLAQMEKELLGYESIDLSNSKIATELRTFLQHHLLP  120

Query  455  LGKDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            LGKDSRTGITEMVAS+GHSC  S+DLLSQFM YKV+G CPD
Sbjct  121  LGKDSRTGITEMVASVGHSCVNSMDLLSQFMNYKVSGPCPD  161



>ref|XP_004136545.1| PREDICTED: uncharacterized protein LOC101215265 [Cucumis sativus]
 ref|XP_004161281.1| PREDICTED: uncharacterized LOC101215265 [Cucumis sativus]
 gb|KGN59257.1| hypothetical protein Csa_3G791480 [Cucumis sativus]
Length=417

 Score =   234 bits (596),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 136/159 (86%), Gaps = 6/159 (4%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPK------IHDAH  280
            MG+VSLK G+G+ARFKRA+ CSSA+N+ ML SVVTTN+FAL+AFTYSPK      ++  H
Sbjct  1    MGSVSLKIGDGTARFKRATLCSSALNILMLISVVTTNLFALYAFTYSPKDREIHTLNRTH  60

Query  281  ENIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLG  460
            +NI ++SEQVSLIL EI+ SQKKL Q+EKE+LGYESIDLSR NVA+ELK FL  H LPLG
Sbjct  61   KNISLISEQVSLILREIDVSQKKLAQMEKEILGYESIDLSRSNVANELKLFLQRHPLPLG  120

Query  461  KDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            KDS++GITEMVAS+GHSC+KS+DLLSQ+M YKV+G CPD
Sbjct  121  KDSKSGITEMVASVGHSCEKSMDLLSQYMNYKVSGPCPD  159



>ref|XP_003545042.1| PREDICTED: uncharacterized protein LOC100786204 isoform 1 [Glycine 
max]
 gb|KHN39440.1| Putative methyltransferase PMT16 [Glycine soja]
Length=421

 Score =   234 bits (596),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 134/160 (84%), Gaps = 7/160 (4%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPKI-------HDA  277
            MG+VSLK G+G+ARF RA+ CSSA+N+ M+FSV+TTN+FAL+AFT SPK        H+A
Sbjct  1    MGSVSLKVGDGTARFHRATLCSSAVNILMIFSVITTNLFALYAFTASPKHPHHSLLHHNA  60

Query  278  HENIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPL  457
            H+NI ++SEQVSLIL EI+ SQKKL Q+EKELLGYESIDLSRPN+A ELK FL  HQLPL
Sbjct  61   HKNISLISEQVSLILREIDLSQKKLAQMEKELLGYESIDLSRPNIASELKLFLQRHQLPL  120

Query  458  GKDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            GKDSRTGITEMV S+GH+C+K+ DLLSQFM YKV G CPD
Sbjct  121  GKDSRTGITEMVPSVGHTCEKNSDLLSQFMNYKVFGACPD  160



>ref|XP_008387957.1| PREDICTED: uncharacterized protein LOC103450397 [Malus domestica]
Length=421

 Score =   233 bits (595),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 136/160 (85%), Gaps = 7/160 (4%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPK-------IHDA  277
            MG+VSLK G+G+ARF+RAS CSSA+N+ MLFSV+TTN+FAL+AFT +PK       +H  
Sbjct  1    MGSVSLKIGDGTARFRRASLCSSAVNLLMLFSVITTNLFALYAFTSAPKDHQTYHLLHHT  60

Query  278  HENIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPL  457
             +NI ++SEQV LIL EI+SSQKKL Q+EKELLGY+SIDLS+ NVA+ELK FL HHQLPL
Sbjct  61   QKNISLISEQVGLILREIDSSQKKLAQMEKELLGYKSIDLSKRNVANELKVFLQHHQLPL  120

Query  458  GKDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            GKDS+TGITEMVAS+GHSC+KS DLLSQ+M Y+V+G CPD
Sbjct  121  GKDSKTGITEMVASVGHSCEKSADLLSQYMNYRVSGPCPD  160



>ref|XP_008442993.1| PREDICTED: uncharacterized protein LOC103486724 [Cucumis melo]
Length=417

 Score =   233 bits (594),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 136/159 (86%), Gaps = 6/159 (4%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPK---IHD---AH  280
            MG+VSLK G+G+ARFKRA+ CSSA+N+ ML SVVTTN+FAL+AFTYSPK   IH     H
Sbjct  1    MGSVSLKIGDGTARFKRATLCSSALNILMLISVVTTNLFALYAFTYSPKDREIHTLDRTH  60

Query  281  ENIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLG  460
            +NI ++SEQVSLIL EI+ SQKKL Q+EKE+LGYESIDLSR NVA+ELK FL  H LPLG
Sbjct  61   KNISLISEQVSLILREIDVSQKKLAQMEKEILGYESIDLSRSNVANELKLFLQRHPLPLG  120

Query  461  KDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            KDS++GITEMVAS+GHSC+KS+DLLSQ+M YKV+G CPD
Sbjct  121  KDSKSGITEMVASVGHSCEKSMDLLSQYMNYKVSGPCPD  159



>gb|ACJ84820.1| unknown [Medicago truncatula]
Length=218

 Score =   224 bits (571),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 132/164 (80%), Gaps = 11/164 (7%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPK-----------  265
            MG+VSLK G+G+ARFKRA+ CSSA+N+ M+F V+TTN+FAL+AFT S             
Sbjct  1    MGSVSLKIGDGTARFKRATLCSSAVNILMIFCVITTNLFALYAFTSSSSKNHTTTNTNNS  60

Query  266  IHDAHENIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHH  445
              + H+NI +VSEQVSLIL EI+ SQKKL Q+EK+LLGYESIDLSRPN+A+ELK FL  H
Sbjct  61   NLNLHKNISLVSEQVSLILREIDLSQKKLAQMEKQLLGYESIDLSRPNIANELKIFLQRH  120

Query  446  QLPLGKDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            QLPLGKDSRTGITEMV+S+GHSC+KS DLLSQFM YK +G CPD
Sbjct  121  QLPLGKDSRTGITEMVSSVGHSCEKSADLLSQFMSYKASGACPD  164



>ref|XP_006353174.1| PREDICTED: uncharacterized protein LOC102605433 [Solanum tuberosum]
Length=423

 Score =   229 bits (585),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 133/160 (83%), Gaps = 7/160 (4%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPK-------IHDA  277
            MG+VSLK G+G+ARFK+A++CSSA+N+ MLFSVVTTN+FAL+AFT SPK       +   
Sbjct  1    MGSVSLKIGDGTARFKKATYCSSALNLLMLFSVVTTNLFALYAFTSSPKNPHYHLLLPHT  60

Query  278  HENIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPL  457
            H+NI ++SEQVSLIL EI+SSQKKL Q+EKELLGYES DLS P V +E++ FL  H LPL
Sbjct  61   HKNISLISEQVSLILREIDSSQKKLAQMEKELLGYESFDLSSPKVPNEVRNFLQPHLLPL  120

Query  458  GKDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            GKDSRTGITEMVASIGHSC KSLDLLSQFM YKVNG CPD
Sbjct  121  GKDSRTGITEMVASIGHSCVKSLDLLSQFMNYKVNGLCPD  160



>ref|XP_003550415.1| PREDICTED: uncharacterized protein LOC100812467 [Glycine max]
 gb|KHN12655.1| hypothetical protein glysoja_008618 [Glycine soja]
Length=422

 Score =   229 bits (584),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 134/161 (83%), Gaps = 8/161 (5%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPK------IH--D  274
            MG+VSLK G+G+ARF+RA+ CSSA+N+ M+FSV+TTN+FAL+AFT SP       +H  +
Sbjct  1    MGSVSLKIGDGTARFQRATLCSSAVNILMIFSVITTNLFALYAFTASPNQPQHSLLHHNN  60

Query  275  AHENIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLP  454
            AH+NI ++SEQVSLIL EI+ SQKKL Q+EKELLGYESIDLSRPN+A ELK FL  HQLP
Sbjct  61   AHKNISLISEQVSLILREIDLSQKKLAQMEKELLGYESIDLSRPNIASELKLFLQRHQLP  120

Query  455  LGKDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            LGKDSRTGITEMV S+GH+C+K+ D LSQFM YKV G CPD
Sbjct  121  LGKDSRTGITEMVPSVGHTCEKNSDFLSQFMNYKVFGACPD  161



>ref|XP_010692715.1| PREDICTED: uncharacterized protein LOC104905778 [Beta vulgaris 
subsp. vulgaris]
Length=421

 Score =   228 bits (582),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 134/162 (83%), Gaps = 9/162 (6%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPK---------IH  271
            MGAVSLK G+G+ARF+RA+  +SA+N  MLFSV+TTN+FAL+AFTY+P          +H
Sbjct  1    MGAVSLKIGDGTARFRRATMWTSAVNGLMLFSVLTTNLFALYAFTYNPNKSNENHQNPLH  60

Query  272  DAHENIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQL  451
             + +N+ ++SEQVSLI+ EIESSQKKLTQ+EKELLGYE+ID+S+PN  +ELK FL  H L
Sbjct  61   QSQKNMSLISEQVSLIMKEIESSQKKLTQMEKELLGYETIDVSKPNTPNELKLFLQRHSL  120

Query  452  PLGKDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            PLGKDS+TGIT+MVAS+GH+C KS+D+LSQFM YKVNG CPD
Sbjct  121  PLGKDSKTGITQMVASVGHTCSKSMDMLSQFMNYKVNGQCPD  162



>ref|XP_010095168.1| putative methyltransferase PMT28 [Morus notabilis]
 gb|EXB58398.1| putative methyltransferase PMT28 [Morus notabilis]
Length=456

 Score =   229 bits (584),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 135/162 (83%), Gaps = 5/162 (3%)
 Frame = +2

Query  107  SRVKMGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPK-----IH  271
            ++ KMG+VSLK G+G+ARF+RA+  SSA+N+ ML SVVTTN+FAL+AFTYSPK       
Sbjct  33   NKKKMGSVSLKIGDGTARFRRATLWSSAVNILMLASVVTTNLFALYAFTYSPKHNQTTTP  92

Query  272  DAHENIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQL  451
               +NI ++S+QV+LI+ EI+SSQKKL  +EKELLGYES DLSRPN+A ELK FL HHQL
Sbjct  93   TTRKNISLISDQVALIMREIDSSQKKLALMEKELLGYESFDLSRPNMAAELKLFLYHHQL  152

Query  452  PLGKDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            PLGKDSRTGITEMV+S+GH+C+KS DLLSQ+M YKV+G CPD
Sbjct  153  PLGKDSRTGITEMVSSVGHTCEKSADLLSQYMSYKVSGPCPD  194



>ref|XP_004291387.1| PREDICTED: uncharacterized protein LOC101314531 [Fragaria vesca 
subsp. vesca]
Length=418

 Score =   228 bits (580),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 110/162 (68%), Positives = 134/162 (83%), Gaps = 9/162 (6%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYS---PK------IH  271
            MG+VSLK G+G+ARF+RA+ CSSA+N+ MLFSVVTTN+FAL+AFT S   PK      +H
Sbjct  1    MGSVSLKIGDGTARFRRATLCSSAVNILMLFSVVTTNLFALYAFTSSSNSPKDQHRLLLH  60

Query  272  DAHENIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQL  451
              H+NI ++SEQVSLIL EI+SSQKKL Q+EK+LLGY+SIDL+RPN   ELK FL HH L
Sbjct  61   QTHKNISLISEQVSLILREIDSSQKKLAQMEKDLLGYDSIDLTRPNTPTELKAFLNHHTL  120

Query  452  PLGKDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            PLGKDSRTGITEM+AS+GHSC+KS +LLSQ+M YK +G CPD
Sbjct  121  PLGKDSRTGITEMLASVGHSCEKSAELLSQYMSYKPSGPCPD  162



>ref|XP_010061033.1| PREDICTED: uncharacterized protein LOC104448821 [Eucalyptus grandis]
 ref|XP_010061034.1| PREDICTED: uncharacterized protein LOC104448821 [Eucalyptus grandis]
 gb|KCW67935.1| hypothetical protein EUGRSUZ_F01633 [Eucalyptus grandis]
Length=421

 Score =   226 bits (577),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 132/160 (83%), Gaps = 7/160 (4%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYS-PKIHDAH-----  280
            MG+VSLK G+G+ARF+RA+ CSSA+N+ ML SVV TN+FAL+AFT S P   D H     
Sbjct  1    MGSVSLKIGDGTARFRRATICSSALNLLMLLSVVATNVFALYAFTNSGPAAADRHLLRHH  60

Query  281  -ENIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPL  457
             +NI ++SEQVSLIL EI SSQKKL ++EKELLGY+SIDLSRPN+A ELKTFL  H LPL
Sbjct  61   SKNISLISEQVSLILREIASSQKKLAKMEKELLGYDSIDLSRPNIAAELKTFLRPHSLPL  120

Query  458  GKDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            GKDSRTGITEMVAS+GHSC+KS+DLL+Q+M YKV G CPD
Sbjct  121  GKDSRTGITEMVASVGHSCEKSVDLLTQYMSYKVTGPCPD  160



>gb|KEH36237.1| ATRAD3-like protein [Medicago truncatula]
Length=421

 Score =   224 bits (570),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 133/159 (84%), Gaps = 6/159 (4%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPK------IHDAH  280
            MG+VSLK G+G+ARFK+++ CSSA+N+ M+ SV+TTN+FAL+AFT SPK      +H  H
Sbjct  1    MGSVSLKIGDGTARFKKSTLCSSAVNILMILSVITTNLFALYAFTSSPKNNQTEQLHQVH  60

Query  281  ENIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLG  460
            +N  ++SEQVSLIL EI+ SQKKLTQIEK+LLGYES DLSRPN+A ELK FL  H+LPLG
Sbjct  61   KNFSLISEQVSLILREIDQSQKKLTQIEKQLLGYESFDLSRPNIAKELKLFLNPHKLPLG  120

Query  461  KDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            KDS+TG+TEMV+S+GHSC+KS DLLSQ+M YKV G+C D
Sbjct  121  KDSKTGMTEMVSSVGHSCEKSSDLLSQYMNYKVFGNCQD  159



>gb|AFK44341.1| unknown [Medicago truncatula]
Length=421

 Score =   224 bits (570),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 133/159 (84%), Gaps = 6/159 (4%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPK------IHDAH  280
            MG+VSLK G+G+ARFK+++ CSSA+N+ M+ SV+TTN+FAL+AFT SPK      +H  H
Sbjct  1    MGSVSLKIGDGTARFKKSTLCSSAVNILMILSVITTNLFALYAFTSSPKNNQTEQLHQVH  60

Query  281  ENIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLG  460
            +N  ++SEQVSLIL EI+ SQKKLTQIEK+LLGYES DLSRPN+A ELK FL  H+LPLG
Sbjct  61   KNFSLISEQVSLILREIDQSQKKLTQIEKQLLGYESFDLSRPNIAKELKLFLNPHKLPLG  120

Query  461  KDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            KDS+TG+TEMV+S+GHSC+KS DLLSQ+M YKV G+C D
Sbjct  121  KDSKTGMTEMVSSVGHSCEKSSDLLSQYMNYKVFGNCQD  159



>ref|XP_003523577.1| PREDICTED: uncharacterized protein LOC100798510 [Glycine max]
 gb|KHN45912.1| hypothetical protein glysoja_023135 [Glycine soja]
Length=420

 Score =   223 bits (569),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 134/158 (85%), Gaps = 5/158 (3%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPK-----IHDAHE  283
            MG+VSLK G+G+ARF+RA+ CSSA+N+ M+FSV+TTN+FAL+AF+ SPK     +H   +
Sbjct  1    MGSVSLKIGDGTARFRRATVCSSAVNILMIFSVITTNLFALYAFSSSPKDPHSHLHLLDK  60

Query  284  NIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLGK  463
            N  ++SEQV+LIL EI+ SQKKL QIEK+LLGYES+DLSRPN+A+ELK FL HHQLPLGK
Sbjct  61   NFSLISEQVTLILREIDMSQKKLAQIEKDLLGYESLDLSRPNIANELKLFLHHHQLPLGK  120

Query  464  DSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            DS++GITEMV+S+GHSC+KS DLLSQ+M YK  G CP+
Sbjct  121  DSKSGITEMVSSVGHSCEKSSDLLSQYMSYKAFGPCPN  158



>ref|XP_004250146.1| PREDICTED: uncharacterized protein LOC101246201 [Solanum lycopersicum]
Length=423

 Score =   223 bits (568),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 132/160 (83%), Gaps = 7/160 (4%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPK-------IHDA  277
            MG+VSLK G+G+ARFK+A++CSS +N+ MLFSVVTTN+FAL+AFT SPK       +   
Sbjct  1    MGSVSLKIGDGTARFKKATYCSSVLNLLMLFSVVTTNLFALYAFTSSPKNPHHHLLLPHT  60

Query  278  HENIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPL  457
            H+NI ++SEQVSLIL +I+SSQKKL Q+EKELLGYES DLS P V +E++ FL  H LPL
Sbjct  61   HKNISLISEQVSLILRQIDSSQKKLAQMEKELLGYESFDLSSPKVPNEVRNFLQPHLLPL  120

Query  458  GKDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            GKDSRTGITEMVASIGHSC KSLDLLSQFM YKVNG CPD
Sbjct  121  GKDSRTGITEMVASIGHSCVKSLDLLSQFMSYKVNGLCPD  160



>gb|KEH40211.1| ATRAD3-like protein [Medicago truncatula]
Length=426

 Score =   222 bits (565),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 132/164 (80%), Gaps = 11/164 (7%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPK-----------  265
            MG+VSLK G+G+ARFKRA+ CSSA+N+ M+F V+TTN+FAL+AFT S             
Sbjct  1    MGSVSLKIGDGTARFKRATLCSSAVNILMIFCVITTNLFALYAFTSSSSKNHTTTNTNNS  60

Query  266  IHDAHENIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHH  445
              + H+NI +VSEQVSLIL EI+ SQKKL Q+EK+LLGYESIDLSRPN+A+ELK FL  H
Sbjct  61   NLNLHKNISLVSEQVSLILREIDLSQKKLAQMEKQLLGYESIDLSRPNIANELKIFLQRH  120

Query  446  QLPLGKDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            QLPLGKDSRTGITEMV+S+GHSC+KS DLLSQFM YK +G CPD
Sbjct  121  QLPLGKDSRTGITEMVSSVGHSCEKSADLLSQFMSYKASGACPD  164



>ref|XP_002875365.1| hypothetical protein ARALYDRAFT_904944 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51624.1| hypothetical protein ARALYDRAFT_904944 [Arabidopsis lyrata subsp. 
lyrata]
Length=410

 Score =   219 bits (557),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/158 (67%), Positives = 132/158 (84%), Gaps = 6/158 (4%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFT-----YSPKIHDAHE  283
            MG+VSLK G+G+ARF+R S CSSA+N+ MLFSVVTTN+FAL+AF+      SP +H+++ 
Sbjct  1    MGSVSLKIGDGTARFRRTSICSSAVNLLMLFSVVTTNLFALYAFSSHSQANSPLLHNSN-  59

Query  284  NIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLGK  463
            NI +VS+ +SLIL EI+SSQ+KL Q+EK++LGYESIDLSRPN+  ELK FL  HQLPLGK
Sbjct  60   NISLVSQHLSLILREIDSSQRKLAQMEKQMLGYESIDLSRPNIVPELKLFLQRHQLPLGK  119

Query  464  DSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            DSRTGITEMV+S+GHSC+KS DLLSQ+M YKV   CPD
Sbjct  120  DSRTGITEMVSSVGHSCEKSADLLSQYMSYKVFDRCPD  157



>ref|XP_010507038.1| PREDICTED: uncharacterized protein LOC104783598 [Camelina sativa]
Length=336

 Score =   216 bits (550),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 131/158 (83%), Gaps = 6/158 (4%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTY-----SPKIHDAHE  283
            MG+VSLK G+G+ARF+R + CSSA+N+ MLFSVVTTN+FAL+AF+      SP +H ++ 
Sbjct  1    MGSVSLKIGDGTARFQRTTICSSAVNLLMLFSVVTTNLFALYAFSSHSQANSPLVHHSN-  59

Query  284  NIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLGK  463
            NI +VS+ +SLIL EI+SSQ+KL Q+EK++LGYESIDLSRPN+  ELK FL  HQLPLGK
Sbjct  60   NISLVSQHLSLILREIDSSQRKLAQMEKQMLGYESIDLSRPNIVPELKLFLQRHQLPLGK  119

Query  464  DSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            DSRTGITEMV+S+GHSC+KS DLLSQ+M YKV   CPD
Sbjct  120  DSRTGITEMVSSVGHSCEKSADLLSQYMSYKVFDRCPD  157



>ref|XP_006291222.1| hypothetical protein CARUB_v10017354mg [Capsella rubella]
 gb|EOA24120.1| hypothetical protein CARUB_v10017354mg [Capsella rubella]
Length=410

 Score =   218 bits (555),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/158 (67%), Positives = 131/158 (83%), Gaps = 6/158 (4%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTY-----SPKIHDAHE  283
            MG+VSLK G+G+ARF+R S CSSA+N+ MLFSVVTTN+FAL+AF+      SP +H ++ 
Sbjct  1    MGSVSLKIGDGTARFRRTSVCSSAVNLLMLFSVVTTNLFALYAFSSHSQANSPLVHQSN-  59

Query  284  NIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLGK  463
            NI +VS+ +SLIL EI+SSQ+KL Q+EK++LGYESIDLSRPN+  ELK FL  HQLPLGK
Sbjct  60   NISLVSQHLSLILREIDSSQRKLAQMEKQMLGYESIDLSRPNIVPELKLFLQRHQLPLGK  119

Query  464  DSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            DSRTGITEMV+S+GHSC+KS DLLSQ+M YKV   CPD
Sbjct  120  DSRTGITEMVSSVGHSCEKSADLLSQYMSYKVFDRCPD  157



>ref|XP_007136075.1| hypothetical protein PHAVU_009G015500g [Phaseolus vulgaris]
 gb|ESW08069.1| hypothetical protein PHAVU_009G015500g [Phaseolus vulgaris]
Length=396

 Score =   217 bits (552),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 129/155 (83%), Gaps = 4/155 (3%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPKI----HDAHEN  286
            MG+VSLK G+G+ARF+RA+ CSSA+N+ M+FSV+TTN+FALFAFT SPK     H  H+N
Sbjct  1    MGSVSLKIGDGTARFRRATVCSSAVNILMIFSVITTNLFALFAFTSSPKDLHTHHLLHKN  60

Query  287  IFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLGKD  466
              ++SEQV+LIL EI+ SQKKL QIEK+LLGYESIDLSR N A+ELK FL  H LPLGKD
Sbjct  61   FSLISEQVTLILREIDLSQKKLAQIEKDLLGYESIDLSRNNTANELKLFLHRHHLPLGKD  120

Query  467  SRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHC  571
            S+TGITEMV+S+GHSC KS DLLSQ+M YKV+G C
Sbjct  121  SKTGITEMVSSVGHSCDKSSDLLSQYMSYKVSGPC  155



>ref|XP_007136074.1| hypothetical protein PHAVU_009G015500g [Phaseolus vulgaris]
 gb|ESW08068.1| hypothetical protein PHAVU_009G015500g [Phaseolus vulgaris]
Length=419

 Score =   218 bits (554),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 129/155 (83%), Gaps = 4/155 (3%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPKI----HDAHEN  286
            MG+VSLK G+G+ARF+RA+ CSSA+N+ M+FSV+TTN+FALFAFT SPK     H  H+N
Sbjct  1    MGSVSLKIGDGTARFRRATVCSSAVNILMIFSVITTNLFALFAFTSSPKDLHTHHLLHKN  60

Query  287  IFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLGKD  466
              ++SEQV+LIL EI+ SQKKL QIEK+LLGYESIDLSR N A+ELK FL  H LPLGKD
Sbjct  61   FSLISEQVTLILREIDLSQKKLAQIEKDLLGYESIDLSRNNTANELKLFLHRHHLPLGKD  120

Query  467  SRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHC  571
            S+TGITEMV+S+GHSC KS DLLSQ+M YKV+G C
Sbjct  121  SKTGITEMVSSVGHSCDKSSDLLSQYMSYKVSGPC  155



>gb|AAM63602.1| unknown [Arabidopsis thaliana]
Length=410

 Score =   217 bits (553),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 131/158 (83%), Gaps = 6/158 (4%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTY-----SPKIHDAHE  283
            MG+VSLK G+G+ARF+R S CSSA+N+ MLFSVVTTN+FAL+AF+      SP +H ++ 
Sbjct  1    MGSVSLKIGDGTARFRRTSICSSAVNLLMLFSVVTTNLFALYAFSSHSQANSPLLHSSN-  59

Query  284  NIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLGK  463
            NI +VS+ +SLIL EI+SSQ+KL Q+EK++LGYESID+SRPN+  ELK FL  HQLPLGK
Sbjct  60   NISLVSQHLSLILREIDSSQRKLAQMEKQMLGYESIDISRPNIVPELKLFLQRHQLPLGK  119

Query  464  DSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            DSRTGITEMV+S+GHSC+KS DLLSQ+M YKV   CPD
Sbjct  120  DSRTGITEMVSSVGHSCEKSTDLLSQYMSYKVFDRCPD  157



>ref|XP_010514415.1| PREDICTED: uncharacterized protein LOC104790374 [Camelina sativa]
Length=410

 Score =   216 bits (551),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 131/158 (83%), Gaps = 6/158 (4%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTY-----SPKIHDAHE  283
            MG+VSLK G+G+ARF+R + CSSA+N+ MLFSVVTTN+FAL+AF+      SP +H ++ 
Sbjct  1    MGSVSLKIGDGTARFRRTTICSSAVNLLMLFSVVTTNLFALYAFSSHSQANSPLVHHSN-  59

Query  284  NIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLGK  463
            NI +VS+ +SLIL EI+SSQ+KL Q+EK++LGYESIDLSRPN+  ELK FL  HQLPLGK
Sbjct  60   NISLVSQHLSLILREIDSSQRKLAQMEKQMLGYESIDLSRPNIVPELKLFLQRHQLPLGK  119

Query  464  DSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            DSRTGITEMV+S+GHSC+KS DLLSQ+M YKV   CPD
Sbjct  120  DSRTGITEMVSSVGHSCEKSADLLSQYMSYKVFDRCPD  157



>ref|XP_010557488.1| PREDICTED: uncharacterized protein LOC104826476 [Tarenaya hassleriana]
 ref|XP_010557489.1| PREDICTED: uncharacterized protein LOC104826476 [Tarenaya hassleriana]
 ref|XP_010557490.1| PREDICTED: uncharacterized protein LOC104826476 [Tarenaya hassleriana]
Length=419

 Score =   216 bits (551),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 108/158 (68%), Positives = 130/158 (82%), Gaps = 5/158 (3%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPKIH-DAH----E  283
            MG+VSLK G G+ARF+R++ CSSA+N+ MLFSVVTTN+FAL+AF+   + H  +H     
Sbjct  1    MGSVSLKIGEGTARFRRSTVCSSAVNLLMLFSVVTTNLFALYAFSSHSQSHAPSHLLNSN  60

Query  284  NIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLGK  463
            NI +VS+ +SLIL EI+SSQ+KL Q+EK+LLGYESIDLSRPN+A ELK FL HHQLPLGK
Sbjct  61   NISLVSQHLSLILREIDSSQRKLAQMEKQLLGYESIDLSRPNIAQELKLFLQHHQLPLGK  120

Query  464  DSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            DSRTGITEMVAS+GHSC KS DLLSQ+M YKV   CPD
Sbjct  121  DSRTGITEMVASVGHSCLKSSDLLSQYMAYKVFDRCPD  158



>ref|XP_007160685.1| hypothetical protein PHAVU_001G008400g [Phaseolus vulgaris]
 gb|ESW32679.1| hypothetical protein PHAVU_001G008400g [Phaseolus vulgaris]
Length=420

 Score =   216 bits (551),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 129/159 (81%), Gaps = 6/159 (4%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPKIHDAHE-----  283
            MG+VSLK G+G+ARF+RA+ CSSA+N+ M+FSV+TTN+FAL+AFT SPK           
Sbjct  1    MGSVSLKIGDGTARFQRATLCSSAVNILMIFSVITTNLFALYAFTASPKHPHHLLHHHAH  60

Query  284  -NIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLG  460
             NI ++SEQVSLIL EI+ SQKKL Q+EKELLGYESIDLSRPN+A ELK FL   +LPLG
Sbjct  61   KNISLISEQVSLILREIDLSQKKLAQMEKELLGYESIDLSRPNIASELKVFLQRQELPLG  120

Query  461  KDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            KDSRTGITEMV S+GH+C+K+ DLLSQFM YKV G CPD
Sbjct  121  KDSRTGITEMVPSVGHTCEKNSDLLSQFMSYKVFGACPD  159



>gb|AAL77659.1| AT3g27230/K17E12_5 [Arabidopsis thaliana]
Length=410

 Score =   216 bits (550),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 130/158 (82%), Gaps = 6/158 (4%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTY-----SPKIHDAHE  283
            MG+VSLK G+G+ARF+R S CSSA+N+ MLFSVVTTN+FAL+AF+      SP +H ++ 
Sbjct  1    MGSVSLKIGDGTARFRRTSICSSAVNLLMLFSVVTTNLFALYAFSSHSQANSPLLHSSN-  59

Query  284  NIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLGK  463
            NI +VS+ +SLIL EI+SSQ+KL Q+EK++LGYESID+SRPN+  ELK FL  HQLPLGK
Sbjct  60   NISLVSQHLSLILREIDSSQRKLAQMEKQMLGYESIDISRPNIVPELKLFLQRHQLPLGK  119

Query  464  DSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            DSRTGITEMV+S+GHSC KS DLLSQ+M YKV   CPD
Sbjct  120  DSRTGITEMVSSVGHSCGKSTDLLSQYMSYKVFDRCPD  157



>ref|NP_566813.1| S-adenosyl-L-methionine-dependent methyltransferase-like protein 
[Arabidopsis thaliana]
 dbj|BAB02118.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAW39023.1| At3g27230 [Arabidopsis thaliana]
 gb|AAY25408.1| At3g27230 [Arabidopsis thaliana]
 gb|AEE77281.1| S-adenosyl-L-methionine-dependent methyltransferase-like protein 
[Arabidopsis thaliana]
Length=410

 Score =   216 bits (549),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 130/158 (82%), Gaps = 6/158 (4%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTY-----SPKIHDAHE  283
            MG+VSLK G+G+ARF+R S CSSA+N+ MLFSVVTTN+FAL+AF+      SP +H ++ 
Sbjct  1    MGSVSLKIGDGTARFRRTSICSSAVNLLMLFSVVTTNLFALYAFSSHSQANSPLLHSSN-  59

Query  284  NIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLGK  463
            NI +VS+ +SLIL EI+SSQ+KL Q+EK++LGYESID+SRPN+  ELK FL  HQLPLGK
Sbjct  60   NISLVSQHLSLILREIDSSQRKLAQMEKQMLGYESIDISRPNIVPELKLFLQRHQLPLGK  119

Query  464  DSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            DSRTGITEMV+S+GHSC KS DLLSQ+M YKV   CPD
Sbjct  120  DSRTGITEMVSSVGHSCGKSTDLLSQYMSYKVFDRCPD  157



>ref|XP_010425464.1| PREDICTED: uncharacterized protein LOC104710544 [Camelina sativa]
 ref|XP_010425466.1| PREDICTED: uncharacterized protein LOC104710544 [Camelina sativa]
Length=410

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 130/158 (82%), Gaps = 6/158 (4%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFT-----YSPKIHDAHE  283
            MG+VSLK G+G+ARF+R + CSSA+N+ MLFSVVTTN+FAL+AF+      SP +H ++ 
Sbjct  1    MGSVSLKIGDGTARFRRTTVCSSAVNLLMLFSVVTTNLFALYAFSSHSQANSPLVHHSN-  59

Query  284  NIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLGK  463
            NI +VS  +SLIL EI+SSQ+KL Q+EK++LGYESIDLSRPN+  ELK FL  HQLPLGK
Sbjct  60   NISLVSHHLSLILREIDSSQRKLAQMEKQMLGYESIDLSRPNIVPELKLFLQRHQLPLGK  119

Query  464  DSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            DSRTGITEMV+S+GHSC+KS DLLSQ+M YKV   CPD
Sbjct  120  DSRTGITEMVSSVGHSCEKSADLLSQYMSYKVFDRCPD  157



>ref|XP_006395469.1| hypothetical protein EUTSA_v10004321mg [Eutrema salsugineum]
 ref|XP_006395470.1| hypothetical protein EUTSA_v10004321mg [Eutrema salsugineum]
 gb|ESQ32755.1| hypothetical protein EUTSA_v10004321mg [Eutrema salsugineum]
 gb|ESQ32756.1| hypothetical protein EUTSA_v10004321mg [Eutrema salsugineum]
Length=409

 Score =   213 bits (543),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 129/158 (82%), Gaps = 7/158 (4%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTY-----SPKIHDAHE  283
            MG+VSLK G+G+ARF+R++ CSSA+N+ MLFSVVTTN+FAL+AF+      SP  H    
Sbjct  1    MGSVSLKIGDGTARFRRSTICSSAVNLLMLFSVVTTNLFALYAFSSHSQADSPLHH--SN  58

Query  284  NIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLGK  463
            NI +VS+ +SLIL EI+SSQ+KL Q+EK++LGYESIDLSRPN+  ELK FL  HQLPLGK
Sbjct  59   NISLVSQHLSLILREIDSSQRKLAQMEKQILGYESIDLSRPNIGPELKLFLQRHQLPLGK  118

Query  464  DSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            DSRTGITEMV+S+GHSC+KS DLLSQ+M YKV   CPD
Sbjct  119  DSRTGITEMVSSVGHSCEKSADLLSQYMSYKVFDRCPD  156



>ref|XP_003600934.1| hypothetical protein MTR_3g071050 [Medicago truncatula]
Length=418

 Score =   210 bits (534),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/157 (64%), Positives = 128/157 (82%), Gaps = 6/157 (4%)
 Frame = +2

Query  125  AVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPK------IHDAHEN  286
            +VSLK G+G+ARFK ++ CSS +N+ M+ SV+TTN+FAL+AFT SPK      +H  H+N
Sbjct  72   SVSLKIGDGTARFKNSTLCSSVVNILMILSVITTNLFALYAFTSSPKNNQTEQLHQVHKN  131

Query  287  IFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLGKD  466
              ++SEQVSLIL EI+ SQKKL QIEK+LLGYES DLSRPN+A ELK FL  H+LPLGKD
Sbjct  132  FSLISEQVSLILREIDQSQKKLAQIEKQLLGYESFDLSRPNIAKELKLFLNPHKLPLGKD  191

Query  467  SRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            S+TG+TEMV+S+G+SC+KS DL+SQ+M YKV G+C D
Sbjct  192  SKTGMTEMVSSMGYSCEKSSDLMSQYMNYKVFGNCQD  228



>ref|XP_009111558.1| PREDICTED: uncharacterized protein LOC103836982 [Brassica rapa]
Length=412

 Score =   207 bits (527),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 129/160 (81%), Gaps = 8/160 (5%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSP-------KIHDA  277
            MG+VSLK G+G+ARF+R S CSSA+N+ MLFSVVTTN+FAL+AF+           +H +
Sbjct  1    MGSVSLKIGDGTARFRRTSVCSSAVNLLMLFSVVTTNLFALYAFSSHSQSQSSSHPLHHS  60

Query  278  HENIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPL  457
            + NI +VS+ +SLIL EI+SSQ+KL Q+EK++LGYESIDLSRPN+  ELK FL  HQLPL
Sbjct  61   N-NISLVSQHLSLILREIDSSQRKLAQMEKQILGYESIDLSRPNIVPELKLFLHRHQLPL  119

Query  458  GKDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            GKDSRTGITEMV+++GHSC++S DLLSQ+M YKV   CPD
Sbjct  120  GKDSRTGITEMVSAVGHSCERSPDLLSQYMSYKVFDRCPD  159



>emb|CDY20059.1| BnaA09g01920D [Brassica napus]
Length=371

 Score =   203 bits (516),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 100/157 (64%), Positives = 125/157 (80%), Gaps = 4/157 (3%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPKIHDAH----EN  286
            MG+VSLK G+G+ARF+R S  SSA+N+ MLFSVVTTN+FAL+AF+   +          N
Sbjct  1    MGSVSLKIGDGTARFRRTSVYSSAVNLLMLFSVVTTNLFALYAFSSHSQSSSHPLHHSNN  60

Query  287  IFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLGKD  466
            I +VS+ +SLIL EI+SSQ+KL Q+EK++LGYESIDLSRPN+  ELK FL  HQLPLGKD
Sbjct  61   ISLVSQHLSLILREIDSSQRKLAQMEKQILGYESIDLSRPNIVPELKLFLHRHQLPLGKD  120

Query  467  SRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            SRTGITEMV+++GHSC++S DLLSQ+M YKV   CPD
Sbjct  121  SRTGITEMVSAVGHSCERSPDLLSQYMSYKVFDRCPD  157



>gb|EPS57421.1| hypothetical protein M569_17397 [Genlisea aurea]
Length=422

 Score =   202 bits (515),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/156 (63%), Positives = 123/156 (79%), Gaps = 3/156 (2%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTY---SPKIHDAHENI  289
            MG+V+LK G+G+ARF+R +  SSA N  MLFSV+TTN+FAL+AFTY   S     A  ++
Sbjct  1    MGSVNLKIGDGTARFRRRTAFSSAANFLMLFSVITTNVFALYAFTYHHRSTTARGAGGDL  60

Query  290  FVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLGKDS  469
             ++SE+V  IL EIESSQKKL QIEKE+LGYE IDLS PN+A EL+ FL    LPLG+DS
Sbjct  61   SLISEKVKSILREIESSQKKLNQIEKEVLGYEVIDLSSPNIAAELREFLKPQTLPLGRDS  120

Query  470  RTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            +TGITEMV+S+GHSC+KS+DLLSQFM Y+VN  CPD
Sbjct  121  KTGITEMVSSVGHSCRKSMDLLSQFMSYRVNAPCPD  156



>dbj|BAH57084.1| AT5G40830 [Arabidopsis thaliana]
Length=374

 Score =   197 bits (501),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 123/157 (78%), Gaps = 4/157 (3%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPKIHDAH----EN  286
            MG+VSLK G+G+ARFKR++  SSAIN+ MLFS+VTTN+FAL+AF+   + H  H     N
Sbjct  1    MGSVSLKIGDGTARFKRSTLFSSAINLLMLFSIVTTNLFALYAFSSRSQSHTPHPLHSNN  60

Query  287  IFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLGKD  466
            + +VS+ +SLIL EI+SS   LTQ+EK+++GYES+DLS+  V  ELK FL  HQLPLGKD
Sbjct  61   VSLVSQHLSLILREIDSSHHTLTQMEKQIIGYESLDLSQQEVPQELKLFLQQHQLPLGKD  120

Query  467  SRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            SRTGIT+MVAS+GHSC+ SLDLLSQ+M Y V   CPD
Sbjct  121  SRTGITQMVASVGHSCEMSLDLLSQYMSYNVFEKCPD  157



>ref|XP_006282947.1| hypothetical protein CARUB_v10007544mg [Capsella rubella]
 gb|EOA15845.1| hypothetical protein CARUB_v10007544mg [Capsella rubella]
Length=414

 Score =   197 bits (502),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 125/157 (80%), Gaps = 4/157 (3%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPKIHDAH----EN  286
            MG+VSLK G+G+ARFKR++  SSAIN+ MLFSVVTTN+FAL+AF+   + +  H     N
Sbjct  1    MGSVSLKIGDGTARFKRSTLFSSAINLLMLFSVVTTNLFALYAFSSRSQSNTPHPLHSNN  60

Query  287  IFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLGKD  466
            + +VS+ +SLIL EI+SS + L+Q+EK+++GYES+DLS P V +ELK FL  HQLPLGKD
Sbjct  61   VSLVSQHLSLILREIDSSHRTLSQMEKQMVGYESLDLSHPEVPEELKLFLQQHQLPLGKD  120

Query  467  SRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            SRTGIT+MVAS+GH+C+ SLDLLSQ+M Y V   CPD
Sbjct  121  SRTGITQMVASVGHTCELSLDLLSQYMSYNVFDKCPD  157



>ref|NP_198899.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Arabidopsis thaliana]
 ref|NP_001031989.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Arabidopsis thaliana]
 dbj|BAB11345.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAO00836.1| putative protein [Arabidopsis thaliana]
 gb|AAP37857.1| At5g40830 [Arabidopsis thaliana]
 gb|AED94600.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Arabidopsis thaliana]
 gb|AED94601.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Arabidopsis thaliana]
Length=414

 Score =   196 bits (499),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 123/157 (78%), Gaps = 4/157 (3%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPKIHDAH----EN  286
            MG+VSLK G+G+ARFKR++  SSAIN+ MLFS+VTTN+FAL+AF+   + H  H     N
Sbjct  1    MGSVSLKIGDGTARFKRSTLFSSAINLLMLFSIVTTNLFALYAFSSRSQSHTPHPLHSNN  60

Query  287  IFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLGKD  466
            + +VS+ +SLIL EI+SS   LTQ+EK+++GYES+DLS+  V  ELK FL  HQLPLGKD
Sbjct  61   VSLVSQHLSLILREIDSSHHTLTQMEKQIIGYESLDLSQQEVPQELKLFLQQHQLPLGKD  120

Query  467  SRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            SRTGIT+MVAS+GHSC+ SLDLLSQ+M Y V   CPD
Sbjct  121  SRTGITQMVASVGHSCEMSLDLLSQYMSYNVFEKCPD  157



>ref|XP_010441242.1| PREDICTED: uncharacterized protein LOC104724452 isoform X2 [Camelina 
sativa]
Length=376

 Score =   194 bits (494),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 124/158 (78%), Gaps = 5/158 (3%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPKIHDAH-----E  283
            MG+VSLK G+G+ARF+R++  SSAIN+ MLFSVV+TN+FAL+AF+   + ++ H      
Sbjct  1    MGSVSLKIGDGTARFRRSTLFSSAINLLMLFSVVSTNLFALYAFSSRSQSNNTHHPLHSN  60

Query  284  NIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLGK  463
            N+ +VS+ +SLIL EI+SS + L+Q+E +++GYES+DLS P V  ELK FL  HQLPLGK
Sbjct  61   NVSLVSQHLSLILREIDSSHRTLSQMETKMVGYESLDLSHPEVPQELKLFLQQHQLPLGK  120

Query  464  DSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            DSRTGIT+MVAS+GHSC+ SLDLLSQ+M Y V   CPD
Sbjct  121  DSRTGITQMVASVGHSCETSLDLLSQYMSYNVFDKCPD  158



>ref|XP_010441241.1| PREDICTED: uncharacterized protein LOC104724452 isoform X1 [Camelina 
sativa]
Length=417

 Score =   194 bits (494),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 124/158 (78%), Gaps = 5/158 (3%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPKIHDAH-----E  283
            MG+VSLK G+G+ARF+R++  SSAIN+ MLFSVV+TN+FAL+AF+   + ++ H      
Sbjct  1    MGSVSLKIGDGTARFRRSTLFSSAINLLMLFSVVSTNLFALYAFSSRSQSNNTHHPLHSN  60

Query  284  NIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLGK  463
            N+ +VS+ +SLIL EI+SS + L+Q+E +++GYES+DLS P V  ELK FL  HQLPLGK
Sbjct  61   NVSLVSQHLSLILREIDSSHRTLSQMETKMVGYESLDLSHPEVPQELKLFLQQHQLPLGK  120

Query  464  DSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            DSRTGIT+MVAS+GHSC+ SLDLLSQ+M Y V   CPD
Sbjct  121  DSRTGITQMVASVGHSCETSLDLLSQYMSYNVFDKCPD  158



>ref|XP_010450613.1| PREDICTED: uncharacterized protein LOC104732730 isoform X3 [Camelina 
sativa]
Length=377

 Score =   192 bits (487),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 122/158 (77%), Gaps = 5/158 (3%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPKI----HDAH-E  283
            MG+VSLK G+G+ARF R++  SSAIN+ MLFSVVTTN+FAL+AF+   +     H  H  
Sbjct  1    MGSVSLKIGDGTARFSRSTLFSSAINLLMLFSVVTTNLFALYAFSSHSQSNTTQHPLHSN  60

Query  284  NIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLGK  463
            N+ +VS+ +SLIL EI+SS + L+Q+E +++GYES+DLS P V  ELK FL  HQLPLGK
Sbjct  61   NVSLVSQHLSLILREIDSSHRTLSQMETKMVGYESLDLSHPEVPQELKLFLQQHQLPLGK  120

Query  464  DSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            DSRTGIT+MVAS+GHSC+ SLDLLSQ+M Y V   CPD
Sbjct  121  DSRTGITQMVASVGHSCETSLDLLSQYMSYNVFDKCPD  158



>ref|XP_010450612.1| PREDICTED: uncharacterized protein LOC104732730 isoform X2 [Camelina 
sativa]
Length=383

 Score =   192 bits (487),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 122/158 (77%), Gaps = 5/158 (3%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPKI----HDAH-E  283
            MG+VSLK G+G+ARF R++  SSAIN+ MLFSVVTTN+FAL+AF+   +     H  H  
Sbjct  1    MGSVSLKIGDGTARFSRSTLFSSAINLLMLFSVVTTNLFALYAFSSHSQSNTTQHPLHSN  60

Query  284  NIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLGK  463
            N+ +VS+ +SLIL EI+SS + L+Q+E +++GYES+DLS P V  ELK FL  HQLPLGK
Sbjct  61   NVSLVSQHLSLILREIDSSHRTLSQMETKMVGYESLDLSHPEVPQELKLFLQQHQLPLGK  120

Query  464  DSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            DSRTGIT+MVAS+GHSC+ SLDLLSQ+M Y V   CPD
Sbjct  121  DSRTGITQMVASVGHSCETSLDLLSQYMSYNVFDKCPD  158



>ref|XP_002868627.1| ATRAD3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44886.1| ATRAD3 [Arabidopsis lyrata subsp. lyrata]
Length=414

 Score =   192 bits (487),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 121/157 (77%), Gaps = 4/157 (3%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPKIHDAH----EN  286
            MG+VSLK G+GSARFKR++  SSAIN+ MLFS+VTTN+FAL+AF+   + H  H     N
Sbjct  1    MGSVSLKIGDGSARFKRSTLFSSAINLLMLFSIVTTNLFALYAFSSRSQSHTPHPLHSNN  60

Query  287  IFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLGKD  466
            + +VS+ +SLIL EI+SS + L+ +EK+++G+ES+DLS   V  ELK FL  HQLPLGKD
Sbjct  61   VSLVSQHLSLILREIDSSHRTLSLMEKQMIGFESLDLSHQEVPQELKLFLQQHQLPLGKD  120

Query  467  SRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            SRTGIT MVAS+GHSC+ SLDLLSQ+M Y V   CPD
Sbjct  121  SRTGITHMVASVGHSCEMSLDLLSQYMSYNVFEKCPD  157



>ref|XP_002868633.1| ATRAD3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44892.1| ATRAD3 [Arabidopsis lyrata subsp. lyrata]
Length=414

 Score =   192 bits (487),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 121/157 (77%), Gaps = 4/157 (3%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPKIHDAH----EN  286
            MG+VSLK G+GSARFKR++  SSAIN+ MLFS+VTTN+FAL+AF+   + H  H     N
Sbjct  1    MGSVSLKIGDGSARFKRSTLFSSAINLLMLFSIVTTNLFALYAFSSRSQSHTPHPLHSNN  60

Query  287  IFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLGKD  466
            + +VS+ +SLIL EI+SS + L+ +EK+++G+ES+DLS   V  ELK FL  HQLPLGKD
Sbjct  61   VSLVSQHLSLILREIDSSHRTLSLMEKQMIGFESLDLSHQEVPQELKLFLQQHQLPLGKD  120

Query  467  SRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            SRTGIT MVAS+GHSC+ SLDLLSQ+M Y V   CPD
Sbjct  121  SRTGITHMVASVGHSCEMSLDLLSQYMSYNVFEKCPD  157



>ref|XP_010450611.1| PREDICTED: uncharacterized protein LOC104732730 isoform X1 [Camelina 
sativa]
Length=418

 Score =   191 bits (486),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 122/158 (77%), Gaps = 5/158 (3%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPKI----HDAH-E  283
            MG+VSLK G+G+ARF R++  SSAIN+ MLFSVVTTN+FAL+AF+   +     H  H  
Sbjct  1    MGSVSLKIGDGTARFSRSTLFSSAINLLMLFSVVTTNLFALYAFSSHSQSNTTQHPLHSN  60

Query  284  NIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLGK  463
            N+ +VS+ +SLIL EI+SS + L+Q+E +++GYES+DLS P V  ELK FL  HQLPLGK
Sbjct  61   NVSLVSQHLSLILREIDSSHRTLSQMETKMVGYESLDLSHPEVPQELKLFLQQHQLPLGK  120

Query  464  DSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            DSRTGIT+MVAS+GHSC+ SLDLLSQ+M Y V   CPD
Sbjct  121  DSRTGITQMVASVGHSCETSLDLLSQYMSYNVFDKCPD  158



>emb|CDY00165.1| BnaC09g01360D [Brassica napus]
Length=359

 Score =   186 bits (473),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 119/157 (76%), Gaps = 16/157 (10%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPKIHDAH----EN  286
            MG+VSLK G+G+ARF+R S CSSA+N+ MLFSVVTTN+FAL+AF+   +          N
Sbjct  1    MGSVSLKIGDGTARFRRTSVCSSAVNLLMLFSVVTTNLFALYAFSSHSQSSSHPLHHSNN  60

Query  287  IFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLGKD  466
            I +VS+ +SLIL EI++SQ+KL Q+EK++LGYESIDLSRPN+            LPLGKD
Sbjct  61   ISLVSQHLSLILREIDTSQRKLAQMEKQILGYESIDLSRPNI------------LPLGKD  108

Query  467  SRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            SRTGITEMV+S+GHSC++S DLLSQ+M YKV   CPD
Sbjct  109  SRTGITEMVSSVGHSCERSPDLLSQYMSYKVFDRCPD  145



>gb|KJB63557.1| hypothetical protein B456_010G005600 [Gossypium raimondii]
Length=382

 Score =   186 bits (471),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 121/157 (77%), Gaps = 18/157 (11%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPKIHDA----HEN  286
            MG+VSLK G+G+AR KR++ CSSA+N+ MLFSV+ TN+FAL+AFTYSPK H      H+N
Sbjct  1    MGSVSLKLGDGTARSKRSTLCSSAVNILMLFSVLATNLFALYAFTYSPKHHTITPFHHKN  60

Query  287  IFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLGKD  466
            I ++S+ VSLI+ +I+SSQKKL +IE +LLGY+++++SRPN+A+ELK             
Sbjct  61   ITLISQHVSLIIKQIDSSQKKLARIENQLLGYQTLNVSRPNLANELKL------------  108

Query  467  SRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
              TGITEMVAS+GHSC+KS  LLSQ+M YKV+G CPD
Sbjct  109  --TGITEMVASVGHSCEKSAGLLSQYMTYKVSGPCPD  143



>gb|AES71185.2| ATRAD3-like protein [Medicago truncatula]
Length=278

 Score =   179 bits (453),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 86/131 (66%), Positives = 107/131 (82%), Gaps = 6/131 (5%)
 Frame = +2

Query  203  MLFSVVTTNIFALFAFTYSPK------IHDAHENIFVVSEQVSLILGEIESSQKKLTQIE  364
            M+ SV+TTN+FAL+AFT SPK      +H  H+N  ++SEQVSLIL EI+ SQKKL QIE
Sbjct  1    MILSVITTNLFALYAFTSSPKNNQTEQLHQVHKNFSLISEQVSLILREIDQSQKKLAQIE  60

Query  365  KELLGYESIDLSRPNVADELKTFLLHHQLPLGKDSRTGITEMVASIGHSCQKSLDLLSQF  544
            K+LLGYES DLSRPN+A ELK FL  H+LPLGKDS+TG+TEMV+S+G+SC+KS DL+SQ+
Sbjct  61   KQLLGYESFDLSRPNIAKELKLFLNPHKLPLGKDSKTGMTEMVSSMGYSCEKSSDLMSQY  120

Query  545  MQYKVNGHCPD  577
            M YKV G+C D
Sbjct  121  MNYKVFGNCQD  131



>ref|XP_008776887.1| PREDICTED: uncharacterized protein LOC103696936 [Phoenix dactylifera]
Length=403

 Score =   182 bits (461),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 118/157 (75%), Gaps = 5/157 (3%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPK---IHDAHENI  289
            MG+VSLK G+G+ARF+RA+ CSSA+++ ML SVV+TN+FAL+ FTYSP        H+N+
Sbjct  1    MGSVSLKIGDGTARFRRATLCSSALHLLMLASVVSTNLFALYVFTYSPSATATGGGHKNL  60

Query  290  FVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLGKDS  469
             V+SE VSLIL EIE+S+++L QIE+EL GY+++D ++P +  ELK FL  H LPLG+D+
Sbjct  61   SVISEHVSLILREIEASERRLHQIERELAGYDTLDPAKPGLPSELKLFLGRHPLPLGRDA  120

Query  470  RTGITEMVASIGHSCQK--SLDLLSQFMQYKVNGHCP  574
            R+GIT MV+S+ HSC +  +  LLS FM Y+    CP
Sbjct  121  RSGITAMVSSVAHSCARPAAAALLSDFMSYRPAAPCP  157



>ref|XP_009399468.1| PREDICTED: uncharacterized protein LOC103983867 [Musa acuminata 
subsp. malaccensis]
Length=420

 Score =   180 bits (457),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 122/170 (72%), Gaps = 18/170 (11%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTY--------------  256
            MG+VSLK G+G+ARF+RA+ CSSA+++ ML SV+TTN+FAL+AFT               
Sbjct  1    MGSVSLKIGDGTARFRRATLCSSAVHLLMLASVITTNLFALYAFTAAPSPSFSSAPSTVP  60

Query  257  --SPKIHDAHENIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKT  430
                 +   H N+ V+SE V+LI+ EIE+S+++L QIE+EL GY+++D ++P++  EL+ 
Sbjct  61   HPGAGVGGGHRNLSVISEHVALIVREIEASERRLHQIERELAGYDTLDPAKPSLPPELRL  120

Query  431  FLLHHQLPLGKDSRTGITEMVASIGHSCQKS--LDLLSQFMQYKVNGHCP  574
            FL HH+LPLG+D+R+GITEMVAS+ HSC +S   DLL+++M YK    CP
Sbjct  121  FLAHHRLPLGRDARSGITEMVASVAHSCSRSPAADLLARYMSYKPAALCP  170



>ref|XP_010934529.1| PREDICTED: uncharacterized protein LOC105054654 [Elaeis guineensis]
Length=502

 Score =   176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 117/166 (70%), Gaps = 9/166 (5%)
 Frame = +2

Query  104  FSRVKMGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTYSPK------  265
             S   MG+VSLK G+G+ARF+RA+ CSSA+++ ML SVV+TN+FAL+ FTYSP       
Sbjct  91   LSSAPMGSVSLKIGDGTARFRRATLCSSALHLLMLASVVSTNLFALYVFTYSPSPSAGGG  150

Query  266  -IHDAHENIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLH  442
                 H  + V+S+ VSLIL EIE+S+++L QIE+EL GY++++ ++P +  ELK FL  
Sbjct  151  GGGGGHNGLSVISQHVSLILREIEASERRLHQIERELAGYDTLNPAKPGLPSELKLFLAR  210

Query  443  HQLPLGKDSRTGITEMVASIGHSCQK--SLDLLSQFMQYKVNGHCP  574
            H LPLG+DSR+GIT MV+S+ HSC +  +  LLS+FM Y     CP
Sbjct  211  HPLPLGRDSRSGITAMVSSVSHSCARPAATALLSEFMNYHPAAPCP  256



>ref|XP_009411357.1| PREDICTED: uncharacterized protein LOC103993126 [Musa acuminata 
subsp. malaccensis]
Length=426

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 117/167 (70%), Gaps = 15/167 (9%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFT-------------YS  259
            MG+VSL   +G+ARF+RA+ CSSA+++ ML SV+TTN+FAL+AFT             + 
Sbjct  1    MGSVSLNIRDGTARFRRATLCSSAVHLLMLASVLTTNLFALYAFTSAPSPSAAPAFFRHH  60

Query  260  PKIHDAHENIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLL  439
            P +     N+ V+S+ VSLI+ EIE+S+++L  IE+EL GY+ +D S+ ++  ELK FL 
Sbjct  61   PGVGGGRGNVSVISDHVSLIVREIEASERRLHMIERELAGYDILDTSKHSLPSELKLFLA  120

Query  440  HHQLPLGKDSRTGITEMVASIGHSCQKS--LDLLSQFMQYKVNGHCP  574
            HH LPLG+D+R+GITEMVAS+ HSC +S   +LL+++M Y+    CP
Sbjct  121  HHPLPLGRDARSGITEMVASVAHSCARSPAAELLARYMSYRPAAPCP  167



>ref|XP_006840653.1| hypothetical protein AMTR_s00211p00024510 [Amborella trichopoda]
 gb|ERN02328.1| hypothetical protein AMTR_s00211p00024510 [Amborella trichopoda]
Length=276

 Score =   147 bits (371),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 114/159 (72%), Gaps = 6/159 (4%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTY----SPKIHDAH--  280
            MG+VSLK G+G+ARF+  +  S+ +N  MLFS++ TN+ AL+ F++    +P +  AH  
Sbjct  1    MGSVSLKIGDGTARFRATTIYSTILNAIMLFSLLLTNLLALYTFSFPANQTPSLSTAHHQ  60

Query  281  ENIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLG  460
            +N  ++S +VSLIL EI SSQ KL Q++KEL+G+E++DLS P +  ELK ++    LPLG
Sbjct  61   KNFSLISHEVSLILSEINSSQHKLAQMQKELIGFETLDLSVPGLPSELKLYMEAQPLPLG  120

Query  461  KDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            KDSR GITEMV+++GH+C  S+DLLS +M YK    CPD
Sbjct  121  KDSRMGITEMVSAVGHACVNSIDLLSLYMNYKPGHQCPD  159



>gb|AAK84481.1| unknown [Solanum lycopersicum]
Length=340

 Score =   122 bits (307),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +2

Query  359  IEKELLGYESIDLSRPNVADELKTFLLHHQLPLGKDSRTGITEMVASIGHSCQKSLDLLS  538
            +EKELLGYES DLS P V +E++ FL  H LPLGKDSRTGITEMVASIGHSC KSLDLLS
Sbjct  1    MEKELLGYESFDLSSPKVPNEVRNFLQPHLLPLGKDSRTGITEMVASIGHSCVKSLDLLS  60

Query  539  QFMQYKVNGHCPD  577
            QFM YKVNG CPD
Sbjct  61   QFMSYKVNGLCPD  73



>ref|XP_006849633.1| hypothetical protein AMTR_s00024p00220290 [Amborella trichopoda]
 gb|ERN11214.1| hypothetical protein AMTR_s00024p00220290 [Amborella trichopoda]
Length=146

 Score =   112 bits (280),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 100/146 (68%), Gaps = 10/146 (7%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVVTTNIFALFAFTY----SPKIHDAH--  280
            MG+VSL  G+G+ARF+     ++ +N  MLFS++ T + AL+ F++    +P +  AH  
Sbjct  1    MGSVSLTIGDGTARFR----ATTILNAIMLFSLLLTYLLALYNFSFPANQTPSLSAAHHQ  56

Query  281  ENIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLG  460
            +N  ++S QVSL L EI S+Q KL Q++K+L+G+ ++ LS P +  E+K ++     PLG
Sbjct  57   KNFSLISRQVSLFLSEINSAQHKLAQMQKKLIGFATLYLSAPGLPSEIKLYMEAQPWPLG  116

Query  461  KDSRTGITEMVASIGHSCQKSLDLLS  538
            KDSR GITEMV+++GH+C  S+DLLS
Sbjct  117  KDSRMGITEMVSAVGHACVNSIDLLS  142



>ref|XP_006854792.1| hypothetical protein AMTR_s00063p00150900 [Amborella trichopoda]
 gb|ERN16259.1| hypothetical protein AMTR_s00063p00150900 [Amborella trichopoda]
Length=95

 Score = 85.5 bits (210),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = +2

Query  359  IEKELLGYESIDLSRPNVADELKTFLLHHQLPLGKDSRTGITEMVASIGHSCQKSLDLLS  538
            ++KEL+G+E++DLS P +  +LK ++    L LGKDSR GI EMV+++GH+C  S+DLLS
Sbjct  1    MQKELIGFETLDLSAPGLPPKLKLYMEAEPLLLGKDSRMGIREMVSAVGHACVNSIDLLS  60

Query  539  QFMQYKVNGHCPD  577
            Q++ YK    CPD
Sbjct  61   QYINYKPGHQCPD  73



>ref|XP_003561200.1| PREDICTED: uncharacterized protein LOC100825782 [Brachypodium 
distachyon]
Length=385

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 81/162 (50%), Gaps = 23/162 (14%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKR--ASFCSSA-INVFMLFSVVTTNIFALFAFTYSPKIHDAHENI  289
            MG+VSLK      R  R  A  CS A +N+ ML S+V+TN+ AL AF  +P +    +  
Sbjct  1    MGSVSLKLPATRRRHGRVLACLCSPAPLNLLMLLSLVSTNLLALLAFFSTPGVPPTTQTP  60

Query  290  FV--VSEQVSLILGEIESSQKKL--TQIEKELLGYESIDLSRPNVADELKTFLLHHQLPL  457
                +S  V+ I  EI +       T +  +L               EL  FL  H LPL
Sbjct  61   SSSDLSAHVAAIAREIGTGASSSSSTPLPADL-------------PPELLLFLTPHALPL  107

Query  458  GKDSRTGITEMVASIGHSCQKS---LDLLSQFMQYKVNGHCP  574
            G+D+R+G+T M AS+G  C +S   L LLSQFM Y  +  CP
Sbjct  108  GRDARSGLTHMPASVGSVCLRSPSALSLLSQFMSYAPHAACP  149



>gb|ABL85035.1| expressed protein [Brachypodium sylvaticum]
Length=418

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 80/161 (50%), Gaps = 23/161 (14%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKR---ASFCSSA-INVFMLFSVVTTNIFALFAFTYSPKIHDAHEN  286
            MG+VSLK      R      +  CS A +N+ ML S+V+TN+ AL AF  +P +  A + 
Sbjct  1    MGSVSLKLPASRRRQGPRVLSCLCSPAPLNLLMLLSLVSTNLLALLAFFSTPGVPPATQT  60

Query  287  I--FVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLG  460
               + +S  V+ I  EI +       +              P    EL  FL  H LPLG
Sbjct  61   PSSYNLSAHVAAIAREIGTGASPSPNL--------------PADPPELFLFLTPHALPLG  106

Query  461  KDSRTGITEMVASIGHSCQKS---LDLLSQFMQYKVNGHCP  574
            +D+R+G+T M AS+G  C +S   L LLSQFM Y  +  CP
Sbjct  107  RDARSGLTHMPASVGSVCLRSPSALSLLSQFMSYAPHAACP  147



>ref|XP_006857792.1| hypothetical protein AMTR_s00061p00214420 [Amborella trichopoda]
 gb|ERN19259.1| hypothetical protein AMTR_s00061p00214420 [Amborella trichopoda]
Length=76

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 37/53 (70%), Gaps = 2/53 (4%)
 Frame = +2

Query  419  ELKTFLLHHQLPLGKDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            ELK ++     PLGKD R GI EMV+++GH+C  S+DLLSQ+M YK    CPD
Sbjct  4    ELKLYM--EAQPLGKDLRIGIIEMVSAVGHACVNSIDLLSQYMNYKAGHQCPD  54



>ref|XP_006655770.1| PREDICTED: uncharacterized protein LOC102722126 [Oryza brachyantha]
Length=387

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 56/173 (32%), Positives = 80/173 (46%), Gaps = 36/173 (21%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKRASFCSSAINVFMLFSVV-TTNIFALFAF-----------TYSP  262
            MG+VSL         + +  CS A+   ++F  + +TN+ AL AF            + P
Sbjct  1    MGSVSLNVPAPRRGRRFSCACSPALLNLLMFLALLSTNVLALLAFFSSSSSSSSSAVHDP  60

Query  263  KIHDAHENIFV------VSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADEL  424
                A   + V      +S+ V+ I  EI+SS   L  +   L               EL
Sbjct  61   SAVSAAAGVDVSAAASAISDHVAAIAREIDSSH--LLHLPDGL-------------PPEL  105

Query  425  KTFLLHHQLPLGKDSRTGITEMVASIGHSCQKS---LDLLSQFMQYKVNGHCP  574
              FL  H LPLG+D+RTG+T M AS+ HSC +S   L LL+ FM Y+ +  CP
Sbjct  106  LLFLSPHALPLGRDARTGLTHMPASVAHSCFRSPSTLALLAAFMSYEPHAACP  158



>ref|XP_002992478.1| hypothetical protein SELMODRAFT_135385 [Selaginella moellendorffii]
 gb|EFJ06416.1| hypothetical protein SELMODRAFT_135385 [Selaginella moellendorffii]
Length=401

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/132 (30%), Positives = 68/132 (52%), Gaps = 4/132 (3%)
 Frame = +2

Query  182  SSAINVFMLFSVVTTNIFALFAFTYSPKIHDAHENIFVVSEQVSLILGEIESSQKKLTQI  361
            S A N+ ++ S+V+TN+ AL++ + S  +    +N+  +S   + +L EI S ++++ Q 
Sbjct  3    SVAWNLLLVASIVSTNLMALYSLSVSRGVR--QDNL--LSPSSTPLLAEIASLREEIRQA  58

Query  362  EKELLGYESIDLSRPNVADELKTFLLHHQLPLGKDSRTGITEMVASIGHSCQKSLDLLSQ  541
                    S       ++ EL  +     LPLG++   G   MV+ IGH+C + + LL  
Sbjct  59   LTAARTRPSAGSRSLLMSSELLEYTEERSLPLGRNPTHGGETMVSPIGHACFQHMALLDT  118

Query  542  FMQYKVNGHCPD  577
            +M Y V   CPD
Sbjct  119  YMNYTVGSLCPD  130



>ref|XP_004964486.1| PREDICTED: uncharacterized protein LOC101778925 [Setaria italica]
Length=385

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 75/163 (46%), Gaps = 21/163 (13%)
 Frame = +2

Query  119  MGAVSLKTGNGSARFKR--ASFCSSAINVFMLFSVVTTNIFALFAFTYSPKIHD------  274
            MG+VSL   +     +R  A  CS A+   ++   + +          SP+ H       
Sbjct  1    MGSVSLNVASSRRGGRRGLACLCSPALLNLLVLLSLLSTNLLALLAFLSPRAHPLPAAAT  60

Query  275  AHENIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLP  454
            A+ +   +S QV+ I  EI++     T +       +   L       EL  FL  H LP
Sbjct  61   ANLSASAISMQVAAIAREIDA-----THLVPHRAAADGAALP-----PELLLFLSPHALP  110

Query  455  LGKDSRTGITEMVASIGHSCQKS---LDLLSQFMQYKVNGHCP  574
            LG+D+RTG+T M AS+ H+C +S   L LLS F  Y+  G CP
Sbjct  111  LGRDARTGLTHMPASVAHACFRSPSTLALLSAFASYEPRGVCP  153



>ref|NP_001174590.1| Os06g0138500 [Oryza sativa Japonica Group]
 dbj|BAD68661.1| unknown protein [Oryza sativa Japonica Group]
 gb|EAY99580.1| hypothetical protein OsI_21556 [Oryza sativa Indica Group]
 dbj|BAG89993.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91478.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH93318.1| Os06g0138500 [Oryza sativa Japonica Group]
Length=383

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 51/96 (53%), Gaps = 15/96 (16%)
 Frame = +2

Query  296  VSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLGKDSRT  475
            +S+ V+ I  EI++S           L Y +  L       EL  FL  H LPLG+D+RT
Sbjct  70   ISDHVAAIAREIDTSSS-------SHLPYRADGLP-----PELLLFLSPHALPLGRDART  117

Query  476  GITEMVASIGHSCQKS---LDLLSQFMQYKVNGHCP  574
            G+T M AS+ HSC +S   L LL+ FM Y  +  CP
Sbjct  118  GLTHMPASVAHSCFRSPATLSLLAAFMSYDPHAACP  153



>dbj|BAJ84801.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=379

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 58/119 (49%), Gaps = 16/119 (13%)
 Frame = +2

Query  236  ALFAFTYSPKIHD-AHENIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSR-PN  409
            A FAF     +HD A    F  S  +S            +  I  E+ G  S   +R P+
Sbjct  43   AFFAFFAPSPLHDPATTAPFSSSSNLS----------AHVAAIALEIGGASSSPGARLPD  92

Query  410  -VADELKTFLLHHQLPLGKDSRTGITEMVASIGHSCQKS---LDLLSQFMQYKVNGHCP  574
             +  EL  FL  H LPLG+D+RTG+T M AS+  SC +S   L LLS FM Y  +  CP
Sbjct  93   GLPPELLLFLTPHALPLGRDARTGLTHMPASVAASCLRSPSALALLSAFMSYAPHSACP  151



>ref|XP_011028455.1| PREDICTED: uncharacterized protein LOC105128463 isoform X2 [Populus 
euphratica]
Length=425

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 55/103 (53%), Gaps = 3/103 (3%)
 Frame = +2

Query  266  IHDAHENIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHH  445
            I + H+ +   +  V  +L E+ S  + LT+ EK   G + + L    ++DE+   +  H
Sbjct  62   IAEFHKKLNSTNLFVEALLTELRSRHEGLTEKEK---GSDPMKLLNVAMSDEVMLVIGPH  118

Query  446  QLPLGKDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCP  574
            +LPLG   R G  E+   +G +C +  + L+Q+M Y+V G CP
Sbjct  119  KLPLGYSPRMGSDEVYPPVGGACLRYQEELAQYMTYEVGGECP  161



>ref|XP_011028454.1| PREDICTED: uncharacterized protein LOC105128463 isoform X1 [Populus 
euphratica]
Length=450

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 55/103 (53%), Gaps = 3/103 (3%)
 Frame = +2

Query  266  IHDAHENIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHH  445
            I + H+ +   +  V  +L E+ S  + LT+ EK   G + + L    ++DE+   +  H
Sbjct  87   IAEFHKKLNSTNLFVEALLTELRSRHEGLTEKEK---GSDPMKLLNVAMSDEVMLVIGPH  143

Query  446  QLPLGKDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCP  574
            +LPLG   R G  E+   +G +C +  + L+Q+M Y+V G CP
Sbjct  144  KLPLGYSPRMGSDEVYPPVGGACLRYQEELAQYMTYEVGGECP  186



>gb|EEE56914.1| hypothetical protein OsJ_06590 [Oryza sativa Japonica Group]
Length=494

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 51/97 (53%), Gaps = 15/97 (15%)
 Frame = +2

Query  293  VVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLGKDSR  472
             +S+ V+ I  EI++S    +Q+     G          +  EL  FL    +PLG+D+R
Sbjct  180  TISDNVAAIAREIDTSSS--SQLPYRADG----------LPPELLLFLSPDGVPLGRDAR  227

Query  473  TGITEMVASIGHSCQKS---LDLLSQFMQYKVNGHCP  574
            TG+T M AS+ HSC +S   L LL+ FM Y  +  CP
Sbjct  228  TGLTHMPASVAHSCFRSPATLSLLAAFMSYDPHAACP  264



>ref|XP_006360379.1| PREDICTED: uncharacterized protein LOC102594943 [Solanum tuberosum]
Length=403

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 67/140 (48%), Gaps = 21/140 (15%)
 Frame = +2

Query  182  SSAINVFMLFSVVTTNIFALF---AFTYSP-----KIHDAHENIFVVSEQVSLILGEIES  337
            S + N+F  F +V++N+   F    F +S      + +++ +    ++  + L++   E+
Sbjct  9    SFSPNLFFFFLLVSSNLLTFFISNTFKHSSCYLYQQTYNSIDTDSSLNTDIPLVVQPAET  68

Query  338  SQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLGKDSRTGITEMVASIGHSCQ  517
                +          ++ DL  P+   EL+ F   H+LP G  +      ++  +GH C 
Sbjct  69   RDDDI----------QASDLDLPS---ELRAFASPHKLPFGFSTNFDSDSIIPPVGHPCT  115

Query  518  KSLDLLSQFMQYKVNGHCPD  577
            +  DLL ++M Y+VNG CPD
Sbjct  116  RFPDLLRRYMSYRVNGSCPD  135



>ref|NP_001144838.1| uncharacterized protein LOC100277923 [Zea mays]
 gb|ACG43323.1| hypothetical protein [Zea mays]
Length=383

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 36/58 (62%), Gaps = 3/58 (5%)
 Frame = +2

Query  410  VADELKTFLLHHQLPLGKDSRTGITEMVASIGHSCQKS---LDLLSQFMQYKVNGHCP  574
            +  EL  FL  H LPLG+D+RTG+T M AS+ H+C +S   L LL+ F  Y  +  CP
Sbjct  94   LPPELLLFLSPHALPLGRDARTGLTHMPASVAHACFRSPPTLALLAAFATYTPHAACP  151



>ref|XP_004240038.1| PREDICTED: probable methyltransferase PMT19 [Solanum lycopersicum]
Length=403

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/140 (26%), Positives = 67/140 (48%), Gaps = 21/140 (15%)
 Frame = +2

Query  182  SSAINVFMLFSVVTTNIFALF---AFTYSP-----KIHDAHENIFVVSEQVSLILGEIES  337
            S + N+F  F +V++N+   F    F +S      + ++A      ++  + L+   +E 
Sbjct  9    SFSPNLFFFFLLVSSNLLTFFISNTFKHSSCYLYQQTYNAISTASSLNTDIPLV---VEP  65

Query  338  SQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLGKDSRTGITEMVASIGHSCQ  517
            ++ +   I++        DL  P+   E + F   H+LP G  +      ++  +GH C 
Sbjct  66   AETRDDDIQES-------DLDLPS---EFRAFASPHKLPFGFSTNFDSDNIIPPVGHPCT  115

Query  518  KSLDLLSQFMQYKVNGHCPD  577
            +  DLL ++M Y+VNG CPD
Sbjct  116  RFPDLLRRYMSYRVNGSCPD  135



>ref|XP_004986277.1| PREDICTED: uncharacterized protein LOC101771363 [Setaria italica]
Length=429

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 29/56 (52%), Gaps = 0/56 (0%)
 Frame = +2

Query  410  VADELKTFLLHHQLPLGKDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            +  E   F   H LP G++   G  E+    GH C    DLL+ FM Y+VNG CPD
Sbjct  81   LPPEFHAFAGPHALPYGRNPNWGTAELRPPAGHPCLAFPDLLAAFMSYRVNGSCPD  136



>ref|XP_002437791.1| hypothetical protein SORBIDRAFT_10g002660 [Sorghum bicolor]
 gb|EER89158.1| hypothetical protein SORBIDRAFT_10g002660 [Sorghum bicolor]
Length=386

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 36/59 (61%), Gaps = 3/59 (5%)
 Frame = +2

Query  407  NVADELKTFLLHHQLPLGKDSRTGITEMVASIGHSCQKS---LDLLSQFMQYKVNGHCP  574
            ++  EL  FL  H LPLG+D+RTG+T M AS+ H+C +S   L LLS F  Y     CP
Sbjct  96   SLPPELLLFLSPHALPLGRDARTGLTHMPASVAHACFRSPSTLALLSAFASYAPYAVCP  154



>gb|ACF83461.1| unknown [Zea mays]
 gb|AFW75454.1| hypothetical protein ZEAMMB73_969790 [Zea mays]
Length=382

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 51/97 (53%), Gaps = 16/97 (16%)
 Frame = +2

Query  293  VVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLGKDSR  472
             +S QV+ I  EI++++     + +   G          +  EL  FL  H LPLG+D+R
Sbjct  67   AISAQVAAIAREIDATR----LVPRHGGG---------ALPPELLLFLSPHALPLGRDAR  113

Query  473  TGITEMVASIGHSCQKS---LDLLSQFMQYKVNGHCP  574
            TG+T M AS+ H+C +S   L LL+ F  Y  +  CP
Sbjct  114  TGLTHMPASVAHACFRSPPTLALLAAFATYTPHTACP  150



>ref|XP_009619701.1| PREDICTED: uncharacterized protein LOC104111663 [Nicotiana tomentosiformis]
Length=396

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 64/139 (46%), Gaps = 16/139 (12%)
 Frame = +2

Query  164  KRASFCSSAINVFMLFSVVTTNIFALFAFTYSPKIHDAHENIFVVSEQVSLILGEIESSQ  343
            K+  F SS  N+F  F +V++N+  LF  T        ++ I + S  +S +  + E+ Q
Sbjct  5    KKHKFLSS--NLFFAFLLVSSNLLTLFISTSFNTSCSLNQQIDIASPVLSKVAPKYEAVQ  62

Query  344  -KKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLGKDSRTGITEMVASIGHSCQK  520
                TQ ++             N+  E  TF    +LPLG        E++  +G  C  
Sbjct  63   VSDNTQSDQ-------------NLPSEFLTFTSPQKLPLGFSKNFDSNEIMPPVGSPCTL  109

Query  521  SLDLLSQFMQYKVNGHCPD  577
              DLL+++M Y VNG CPD
Sbjct  110  FRDLLNRYMSYNVNGSCPD  128



>ref|XP_010252251.1| PREDICTED: uncharacterized protein LOC104593885 [Nelumbo nucifera]
Length=445

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 74/169 (44%), Gaps = 48/169 (28%)
 Frame = +2

Query  185  SAINVFMLFSVVTTNIFALFAFTYSP-----KIHDAHENIFVVSEQVSLILGEIESSQK-  346
            + + +F+L  V+ TN+  ++ FT S        H  H +++ +  +   +L E+ S+Q  
Sbjct  22   TRLKIFLL--VIFTNLLTIYIFTGSSFNLSLSDHTHHPSLWELDPKA--LLQELNSTQAH  77

Query  347  ------KLTQIEKELL---------------------------GYESIDLSRPNVADELK  427
                  ++ Q+ ++L+                           G+ S+ LS      ELK
Sbjct  78   LASSNTRIAQLHRQLISANSLLETLLSELGGRLQEPTEPVKPSGFSSVQLS-----GELK  132

Query  428  TFLLHHQLPLGKDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCP  574
              +  H+LPLG   R G  E+   +G +C + LD L Q+M Y V G CP
Sbjct  133  LAISPHKLPLGYAPRVGSDEVFPPVGAACLQFLDELKQYMTYDVGGECP  181



>ref|XP_009774313.1| PREDICTED: probable methyltransferase PMT19 [Nicotiana sylvestris]
Length=396

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 62/138 (45%), Gaps = 14/138 (10%)
 Frame = +2

Query  164  KRASFCSSAINVFMLFSVVTTNIFALFAFTYSPKIHDAHENIFVVSEQVSLILGEIESSQ  343
            K+  F SS  N+F  F +V++N+  LF  T        ++ I + S  V+ +  + E+ Q
Sbjct  5    KKNKFLSS--NLFFAFLLVSSNLLTLFISTSFNTSCSLNQQIDIASPVVAKVAPKYEAVQ  62

Query  344  KKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLGKDSRTGITEMVASIGHSCQKS  523
                    + L  E + L+ P             +LPLG        E++  +G  C   
Sbjct  63   VSDNTQSDQNLPSEFLSLTSP------------QKLPLGFSKNFDSNEIMPPVGSPCTLF  110

Query  524  LDLLSQFMQYKVNGHCPD  577
             DLL+++M Y VNG CPD
Sbjct  111  RDLLNRYMSYNVNGSCPD  128



>ref|XP_008644572.1| PREDICTED: uncharacterized protein LOC103625944 [Zea mays]
 gb|AFW67815.1| hypothetical protein ZEAMMB73_756974 [Zea mays]
Length=407

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 27/53 (51%), Gaps = 0/53 (0%)
 Frame = +2

Query  419  ELKTFLLHHQLPLGKDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            E   F   H LP G++   G  E+   +GH C     LL+ FM Y VNG CPD
Sbjct  75   EFHAFAGPHALPYGRNPNWGTAELRPPVGHPCLAFPHLLAAFMSYPVNGSCPD  127



>ref|XP_002993215.1| hypothetical protein SELMODRAFT_431315 [Selaginella moellendorffii]
 gb|EFJ05735.1| hypothetical protein SELMODRAFT_431315 [Selaginella moellendorffii]
Length=458

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 83/196 (42%), Gaps = 54/196 (28%)
 Frame = +2

Query  152  SARFKRASFCSS-AINVF---MLFSVVTTNIFALFAFTYSPKIHD----AHENIFV----  295
            +A  K++S+C+   I ++   +L  ++ TN   L++ T +   HD    ++ + F     
Sbjct  6    AADEKKSSYCTRICIGIWKCVILLCLLGTNFVMLYSLTATSSQHDHGSKSYSSFFSRLAG  65

Query  296  ----------VSEQVSLILGEIESSQKKLTQIEKELLGY---------------------  382
                      ++  +S +  E+E +Q +L  I  +L  +                     
Sbjct  66   ERSSKLQATKITSHISRVHHELELAQIQLVGIRNDLSSFLGRLDQQRDPKPRSQREENED  125

Query  383  ---------ESIDLSRPNVADELKTFLLHHQLPLGKDSRTGITEMVASIGHSC--QKSLD  529
                     ++++L  P  + EL+ F+    LPLGK     I+ + + +GH+C    S D
Sbjct  126  QSMHPENVNDNLNLLDPIPSSELQEFIALRDLPLGKHKLFQISRVASPVGHACAGSSSKD  185

Query  530  LLSQFMQYKVNGHCPD  577
            LL  FM Y V G CPD
Sbjct  186  LLQTFMDYPVGGLCPD  201



>gb|KJB67513.1| hypothetical protein B456_010G194500 [Gossypium raimondii]
Length=449

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 51/103 (50%), Gaps = 1/103 (1%)
 Frame = +2

Query  266  IHDAHENIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHH  445
            I D H  I   +  V  ++ EI   +K    +++E   +  I     +++DELK  +L H
Sbjct  85   IADLHHKINSTNFLVRDLVIEITRERKPSLPVDEETNVF-GIPPPTASLSDELKLAILPH  143

Query  446  QLPLGKDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCP  574
            +LPLG   R    E+   +G +C +    L+Q+M Y + G CP
Sbjct  144  KLPLGYSPRMASDEIYPPVGAACLRFQKELAQYMTYDIGGECP  186



>ref|XP_010924091.1| PREDICTED: uncharacterized protein LOC105047017 [Elaeis guineensis]
Length=538

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 35/58 (60%), Gaps = 2/58 (3%)
 Frame = +2

Query  407  NVADELKTFLLHHQLPLGKDSRTGITEMVASIGHSCQKS--LDLLSQFMQYKVNGHCP  574
             +  +LK FL  H LPL +DSR+ IT MV+S+ HSC  S     LS+FM Y +   CP
Sbjct  423  GLPSKLKLFLARHPLPLDRDSRSSITIMVSSVSHSCAHSTATAFLSEFMSYHLATPCP  480



>ref|XP_011087590.1| PREDICTED: uncharacterized protein LOC105169030 [Sesamum indicum]
Length=449

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/104 (30%), Positives = 51/104 (49%), Gaps = 9/104 (9%)
 Frame = +2

Query  263  KIHDAHENIFVVSEQVSLILGEIESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLH  442
            ++  AH  +  +  Q+S + G I+ +         +LL          +V+DE K  +  
Sbjct  91   ELRSAHSLVEELVVQLSRLNGAIDQASNPTKFTYNDLLD---------DVSDEAKLAIGP  141

Query  443  HQLPLGKDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCP  574
            H+LPLG   R G  E+ +S+G  C K  + L ++M Y+V G CP
Sbjct  142  HKLPLGYTPRMGSDEVYSSVGGGCLKHKEDLRKYMSYQVGGECP  185



>ref|XP_002519380.1| ATRAD3, putative [Ricinus communis]
 gb|EEF42997.1| ATRAD3, putative [Ricinus communis]
Length=449

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 54/105 (51%), Gaps = 7/105 (7%)
 Frame = +2

Query  266  IHDAHENIFVVSEQVSLILGEIESSQK--KLTQIEKELLGYESIDLSRPNVADELKTFLL  439
            I D H+ +   +  V  +L E+ S+Q+  KL Q+  +      +D S     DE+   + 
Sbjct  86   ISDLHQKLNSTNLLVEALLIELTSAQQHEKLAQLPVKYPDVSGVDFS-----DEVTLSIG  140

Query  440  HHQLPLGKDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCP  574
             H+LPLG   R G  E+ A  G +C +  + L+++M Y+V G CP
Sbjct  141  PHKLPLGYSPRMGSDEVHAPAGAACLRYQEDLTKYMTYEVGGVCP  185



>gb|KDO40688.1| hypothetical protein CISIN_1g043503mg [Citrus sinensis]
Length=430

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 32/55 (58%), Gaps = 0/55 (0%)
 Frame = +2

Query  410  VADELKTFLLHHQLPLGKDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCP  574
            + DE+K  +  H+LPLG   R G  E++A +G  C K  D L ++M Y + G CP
Sbjct  112  LPDEVKLAVGPHKLPLGYSPRMGSDEVIAPVGAGCSKFHDELLKYMTYDIGGECP  166



>ref|XP_006431374.1| hypothetical protein CICLE_v10003316mg [Citrus clementina]
 gb|ESR44614.1| hypothetical protein CICLE_v10003316mg [Citrus clementina]
Length=451

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 32/55 (58%), Gaps = 0/55 (0%)
 Frame = +2

Query  410  VADELKTFLLHHQLPLGKDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCP  574
            + DE+K  +  H+LPLG   R G  E++A +G  C K  D L ++M Y + G CP
Sbjct  133  LPDEVKLAVGPHKLPLGYSPRMGSDEVIAPVGAGCSKFHDELLKYMTYDIGGECP  187



>ref|XP_006836952.1| hypothetical protein AMTR_s00099p00160150 [Amborella trichopoda]
 gb|ERM99805.1| hypothetical protein AMTR_s00099p00160150 [Amborella trichopoda]
Length=453

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 30/52 (58%), Gaps = 0/52 (0%)
 Frame = +2

Query  419  ELKTFLLHHQLPLGKDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCP  574
            E+K  +  H+LPLG     G  E+V  IGH+C+     L Q+M YKV G CP
Sbjct  137  EMKVVVAPHKLPLGYSHAFGTDEIVPPIGHACRLFKSELRQYMSYKVGGECP  188



>ref|XP_002965799.1| hypothetical protein SELMODRAFT_84529 [Selaginella moellendorffii]
 gb|EFJ33219.1| hypothetical protein SELMODRAFT_84529 [Selaginella moellendorffii]
Length=331

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 38/67 (57%), Gaps = 2/67 (3%)
 Frame = +2

Query  383  ESIDLSRPNVADELKTFLLHHQLPLGKDSRTGITEMVASIGHSC--QKSLDLLSQFMQYK  556
            ++++L  P  + EL+ F+    LPLGK     I+ + + +GH+C    S DLL  FM Y 
Sbjct  8    DNLNLLDPIPSSELQEFIALRDLPLGKHKLFQISRVASPVGHACAGSSSKDLLQTFMDYP  67

Query  557  VNGHCPD  577
            V G CPD
Sbjct  68   VGGLCPD  74



>ref|XP_009762652.1| PREDICTED: uncharacterized protein LOC104214650 [Nicotiana sylvestris]
Length=405

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 30/57 (53%), Gaps = 0/57 (0%)
 Frame = +2

Query  407  NVADELKTFLLHHQLPLGKDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            ++  E   F   HQLP G +      +++  +G  C    DLL ++M YK+NG CPD
Sbjct  81   DLPSEFLAFTSPHQLPFGVNPSFNSDKLIPPVGRPCTMFPDLLRRYMSYKINGSCPD  137



>gb|AFW56218.1| hypothetical protein ZEAMMB73_835727 [Zea mays]
Length=279

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 33/59 (56%), Gaps = 3/59 (5%)
 Frame = +2

Query  407  NVADELKTFLLHHQLPLGKDSRTGITEMVASIGHSCQKS---LDLLSQFMQYKVNGHCP  574
             +  EL  FL  H LPLG+D+R G T M  S+ H+C +S   L LL+ F  Y  +  CP
Sbjct  74   TLPSELLLFLSPHALPLGRDARMGHTHMPTSVAHACFRSPSTLALLAAFATYAPHAACP  132



>ref|XP_008801541.1| PREDICTED: uncharacterized protein LOC103715629 [Phoenix dactylifera]
Length=433

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 69/150 (46%), Gaps = 28/150 (19%)
 Frame = +2

Query  203  MLFSVVTTNIFALFAFTYS-----PKIHDAHENIFVVSEQVSLILGEIESSQKKLTQIEK  367
            +L  V++TNI +++ F+ S     P+IH       +   ++S    ++ +S+K+L  + +
Sbjct  22   ILLLVISTNIVSIYLFSASSLESAPRIHLWDSEALL--RELSSTRHKLSASEKQLADLHR  79

Query  368  EL-------------LGYESIDLSRPNVAD--------ELKTFLLHHQLPLGKDSRTGIT  484
             L             LG    D + P   D        ELK  +  H+LPLG  +  G  
Sbjct  80   RLSTSNTLLEALLDELGKAHGDKTPPEDLDGWQNVLSGELKLAVGPHKLPLGFTANLGTD  139

Query  485  EMVASIGHSCQKSLDLLSQFMQYKVNGHCP  574
            E+  ++G  C++    L+++M Y+V   CP
Sbjct  140  ELYPALGSPCRRFQAELTEYMSYEVGKDCP  169



>gb|EMT18502.1| hypothetical protein F775_00868 [Aegilops tauschii]
Length=308

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/154 (22%), Positives = 65/154 (42%), Gaps = 29/154 (19%)
 Frame = +2

Query  203  MLFSVVTTNIFALFAFT----------YSPKIH------------DAHENIFVVSEQVSL  316
            MLF V+ TN+ +++ F+           +P IH               + + +   +++ 
Sbjct  24   MLFVVIATNLVSVYLFSGASLSLNMPASAPSIHLWDSTALLRDLNATRDALSLARAELAF  83

Query  317  ILGE-------IESSQKKLTQIEKELLGYESIDLSRPNVADELKTFLLHHQLPLGKDSRT  475
            + G+       +ES   KL  +  +    +  +      + ELK  +  H+LPLG     
Sbjct  84   LRGQCGTSSLLLESVLAKLGAVHGDTPAVQDFNGWPEEPSGELKMAIEPHRLPLGYSVNF  143

Query  476  GITEMVASIGHSCQKSLDLLSQFMQYKVNGHCPD  577
            G  E+   +G +C+   + L+Q+M Y  +  CPD
Sbjct  144  GTDELFPGLGFACRNFQEELTQYMTYNASAECPD  177



>gb|EYU33234.1| hypothetical protein MIMGU_mgv1a026970mg [Erythranthe guttata]
Length=458

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 33/56 (59%), Gaps = 0/56 (0%)
 Frame = +2

Query  407  NVADELKTFLLHHQLPLGKDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCP  574
            +V+DE K  +  H+LPLG + R G  E+  S+G  C    + L ++M Y+V G CP
Sbjct  139  DVSDEAKFAVGPHKLPLGYNPRMGSDEIYFSVGGGCLNHKEDLEKYMSYQVGGECP  194



>ref|XP_006470793.1| PREDICTED: uncharacterized protein LOC102607511 [Citrus sinensis]
Length=451

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 30/55 (55%), Gaps = 0/55 (0%)
 Frame = +2

Query  410  VADELKTFLLHHQLPLGKDSRTGITEMVASIGHSCQKSLDLLSQFMQYKVNGHCP  574
            + DE+K  +  H+LP G   R G  E++A +G  C K  D L ++M Y   G CP
Sbjct  133  LPDEVKLAVGPHKLPFGYSPRMGSDELIAPVGAGCLKFHDELVKYMTYDTGGECP  187



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 696633491985