BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001E16

Length=551
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009596867.1|  PREDICTED: cell division cycle protein 48 ho...    283   8e-87   Nicotiana tomentosiformis
ref|XP_009786785.1|  PREDICTED: cell division cycle protein 48 ho...    283   8e-87   Nicotiana sylvestris
gb|EYU36158.1|  hypothetical protein MIMGU_mgv1a001501mg                280   9e-86   Erythranthe guttata [common monkey flower]
ref|XP_011089245.1|  PREDICTED: cell division cycle protein 48 ho...    279   2e-85   Sesamum indicum [beniseed]
emb|CDP07060.1|  unnamed protein product                                279   3e-85   Coffea canephora [robusta coffee]
ref|XP_009787355.1|  PREDICTED: cell division cycle protein 48 ho...    278   5e-85   Nicotiana sylvestris
ref|XP_009593345.1|  PREDICTED: cell division cycle protein 48 ho...    277   1e-84   Nicotiana tomentosiformis
ref|XP_006347195.1|  PREDICTED: cell division cycle protein 48 ho...    277   1e-84   Solanum tuberosum [potatoes]
ref|XP_004241286.1|  PREDICTED: cell division cycle protein 48 ho...    277   1e-84   
gb|KJB36551.1|  hypothetical protein B456_006G164800                    272   1e-84   Gossypium raimondii
ref|XP_011089945.1|  PREDICTED: cell division cycle protein 48 ho...    276   2e-84   Sesamum indicum [beniseed]
ref|XP_004251158.1|  PREDICTED: cell division cycle protein 48 ho...    276   2e-84   
ref|XP_006340221.1|  PREDICTED: cell division cycle protein 48 ho...    276   2e-84   Solanum tuberosum [potatoes]
ref|XP_010241862.1|  PREDICTED: cell division cycle protein 48 ho...    272   6e-84   
ref|XP_007027382.1|  ATPase, AAA-type, CDC48 protein isoform 2          271   1e-83   
ref|XP_008344880.1|  PREDICTED: uncharacterized protein LOC103407783    266   1e-83   
sp|Q96372.1|CDC48_CAPAN  RecName: Full=Cell division cycle protei...    274   2e-83   Capsicum annuum
gb|KJB46512.1|  hypothetical protein B456_007G373300                    269   2e-83   Gossypium raimondii
gb|KJB36552.1|  hypothetical protein B456_006G164800                    272   3e-83   Gossypium raimondii
gb|KJB36554.1|  hypothetical protein B456_006G164800                    273   6e-83   Gossypium raimondii
gb|KJB36550.1|  hypothetical protein B456_006G164800                    273   6e-83   Gossypium raimondii
ref|XP_010241832.1|  PREDICTED: cell division cycle protein 48 ho...    273   6e-83   Nelumbo nucifera [Indian lotus]
ref|XP_011010444.1|  PREDICTED: cell division cycle protein 48 ho...    271   1e-82   Populus euphratica
gb|AHA83580.1|  cell division cycle protein 48                          271   2e-82   Hevea brasiliensis [jebe]
ref|XP_007027381.1|  ATPase, AAA-type, CDC48 protein isoform 1          271   2e-82   
gb|KJB62399.1|  hypothetical protein B456_009G415000                    268   2e-82   Gossypium raimondii
ref|XP_010558169.1|  PREDICTED: cell division control protein 48 ...    271   2e-82   Tarenaya hassleriana [spider flower]
ref|XP_010553361.1|  PREDICTED: cell division cycle protein 48 ho...    271   2e-82   Tarenaya hassleriana [spider flower]
ref|XP_010543406.1|  PREDICTED: cell division control protein 48 ...    271   2e-82   Tarenaya hassleriana [spider flower]
emb|CDP06763.1|  unnamed protein product                                271   3e-82   Coffea canephora [robusta coffee]
gb|KJB15127.1|  hypothetical protein B456_002G162100                    270   3e-82   Gossypium raimondii
gb|KHG10269.1|  Cell division cycle 48                                  270   4e-82   Gossypium arboreum [tree cotton]
ref|XP_002323472.1|  Cell division cycle protein 48                     270   4e-82   Populus trichocarpa [western balsam poplar]
gb|KJB46511.1|  hypothetical protein B456_007G373300                    270   5e-82   Gossypium raimondii
ref|XP_002519500.1|  Transitional endoplasmic reticulum ATPase, p...    270   5e-82   Ricinus communis
ref|XP_010107503.1|  Cell division cycle protein 48-like protein        270   6e-82   
gb|EPS65359.1|  hypothetical protein M569_09417                         269   6e-82   Genlisea aurea
ref|XP_002282146.1|  PREDICTED: cell division cycle protein 48 ho...    270   6e-82   Vitis vinifera
gb|KJB15126.1|  hypothetical protein B456_002G162100                    270   7e-82   Gossypium raimondii
gb|KDP29157.1|  hypothetical protein JCGZ_16546                         270   7e-82   Jatropha curcas
ref|XP_009376080.1|  PREDICTED: uncharacterized protein LOC103964...    261   7e-82   Pyrus x bretschneideri [bai li]
ref|XP_009376079.1|  PREDICTED: uncharacterized protein LOC103964...    261   7e-82   Pyrus x bretschneideri [bai li]
gb|KHG03955.1|  Cell division cycle 48                                  270   7e-82   Gossypium arboreum [tree cotton]
ref|XP_010426961.1|  PREDICTED: cell division control protein 48 ...    266   8e-82   Camelina sativa [gold-of-pleasure]
gb|EYU18799.1|  hypothetical protein MIMGU_mgv1a001503mg                269   1e-81   Erythranthe guttata [common monkey flower]
gb|AFW89667.1|  hypothetical protein ZEAMMB73_027527                    259   1e-81   
ref|XP_010553004.1|  PREDICTED: cell division control protein 48 ...    269   1e-81   Tarenaya hassleriana [spider flower]
ref|XP_010253965.1|  PREDICTED: cell division cycle protein 48 ho...    269   1e-81   Nelumbo nucifera [Indian lotus]
ref|XP_009761319.1|  PREDICTED: cell division cycle protein 48 ho...    269   2e-81   Nicotiana sylvestris
gb|KJB62400.1|  hypothetical protein B456_009G415000                    268   2e-81   Gossypium raimondii
ref|XP_004497529.1|  PREDICTED: cell division cycle protein 48 ho...    268   2e-81   Cicer arietinum [garbanzo]
ref|XP_003538151.1|  PREDICTED: cell division cycle protein 48 ho...    268   2e-81   Glycine max [soybeans]
gb|KEH42206.1|  ATPase, AAA-type, CDC48 protein                         268   2e-81   Medicago truncatula
gb|KHG08181.1|  Cell division cycle 48                                  268   2e-81   Gossypium arboreum [tree cotton]
gb|KJB62398.1|  hypothetical protein B456_009G415000                    268   3e-81   Gossypium raimondii
gb|KHG13688.1|  Cell division cycle 48                                  268   3e-81   Gossypium arboreum [tree cotton]
gb|KHN38724.1|  Cell division cycle protein 48 like                     268   3e-81   Glycine soja [wild soybean]
ref|XP_006381424.1|  Cell division cycle protein 48                     268   3e-81   Populus trichocarpa [western balsam poplar]
ref|XP_003521403.1|  PREDICTED: cell division cycle protein 48 ho...    268   3e-81   Glycine max [soybeans]
ref|XP_009627589.1|  PREDICTED: cell division cycle protein 48 ho...    268   3e-81   Nicotiana tomentosiformis
ref|XP_009628175.1|  PREDICTED: cell division cycle protein 48 ho...    268   3e-81   Nicotiana tomentosiformis
ref|XP_004137832.1|  PREDICTED: cell division cycle protein 48 ho...    268   4e-81   Cucumis sativus [cucumbers]
ref|XP_008442694.1|  PREDICTED: cell division control protein 48 ...    268   4e-81   Cucumis melo [Oriental melon]
ref|XP_010477783.1|  PREDICTED: cell division control protein 48 ...    266   5e-81   Camelina sativa [gold-of-pleasure]
ref|XP_011094628.1|  PREDICTED: cell division cycle protein 48 ho...    267   6e-81   Sesamum indicum [beniseed]
gb|ACN31280.1|  unknown                                                 254   6e-81   Zea mays [maize]
ref|XP_009376083.1|  PREDICTED: cell division cycle protein 48 ho...    267   7e-81   Pyrus x bretschneideri [bai li]
ref|XP_008359586.1|  PREDICTED: cell division cycle protein 48 ho...    266   1e-80   Malus domestica [apple tree]
ref|XP_006833149.1|  hypothetical protein AMTR_s00072p00117380          266   1e-80   Amborella trichopoda
ref|XP_010477638.1|  PREDICTED: cell division control protein 48 ...    266   1e-80   Camelina sativa [gold-of-pleasure]
ref|XP_010486558.1|  PREDICTED: cell division control protein 48 ...    266   1e-80   Camelina sativa [gold-of-pleasure]
ref|NP_187595.1|  cell division control protein 48-A                    266   1e-80   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010464643.1|  PREDICTED: cell division control protein 48 ...    266   1e-80   Camelina sativa [gold-of-pleasure]
ref|XP_010687252.1|  PREDICTED: cell division cycle protein 48 ho...    266   1e-80   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004493989.1|  PREDICTED: cell division control protein 48 ...    266   1e-80   Cicer arietinum [garbanzo]
ref|XP_006292238.1|  hypothetical protein CARUB_v10018445mg             266   2e-80   
ref|XP_002876195.1|  hypothetical protein ARALYDRAFT_485698             266   2e-80   
ref|XP_010426959.1|  PREDICTED: cell division control protein 48 ...    266   2e-80   Camelina sativa [gold-of-pleasure]
ref|XP_006493028.1|  PREDICTED: cell division cycle protein 48 ho...    266   2e-80   Citrus sinensis [apfelsine]
ref|XP_010687253.1|  PREDICTED: cell division cycle protein 48 ho...    266   2e-80   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP43995.1|  hypothetical protein JCGZ_05462                         266   2e-80   Jatropha curcas
gb|KHN06869.1|  Cell division cycle protein 48 like                     266   2e-80   Glycine soja [wild soybean]
ref|XP_006428410.1|  hypothetical protein CICLE_v10011046mg             266   2e-80   
ref|XP_002519502.1|  Transitional endoplasmic reticulum ATPase, p...    266   2e-80   Ricinus communis
ref|XP_003540195.1|  PREDICTED: cell division cycle protein 48 ho...    266   2e-80   Glycine max [soybeans]
ref|XP_007207288.1|  hypothetical protein PRUPE_ppa001607m2g            262   2e-80   
ref|NP_001235099.1|  cell division cycle protein 48 homolog             265   3e-80   Glycine max [soybeans]
ref|XP_004493988.1|  PREDICTED: cell division control protein 48 ...    266   3e-80   
ref|XP_011077329.1|  PREDICTED: LOW QUALITY PROTEIN: cell divisio...    265   3e-80   Sesamum indicum [beniseed]
ref|XP_002882640.1|  hypothetical protein ARALYDRAFT_478309             265   3e-80   
ref|XP_002873087.1|  hypothetical protein ARALYDRAFT_908201             265   4e-80   Arabidopsis lyrata subsp. lyrata
emb|CDY41316.1|  BnaA01g32030D                                          265   4e-80   Brassica napus [oilseed rape]
ref|XP_010515813.1|  PREDICTED: cell division control protein 48 ...    265   4e-80   Camelina sativa [gold-of-pleasure]
ref|XP_006297006.1|  hypothetical protein CARUB_v10012997mg             265   4e-80   Capsella rubella
ref|XP_006407632.1|  hypothetical protein EUTSA_v10020085mg             265   4e-80   Eutrema salsugineum [saltwater cress]
ref|XP_006287085.1|  hypothetical protein CARUB_v10000247mg             265   5e-80   Capsella rubella
ref|XP_006398779.1|  hypothetical protein EUTSA_v10012714mg             265   5e-80   Eutrema salsugineum [saltwater cress]
ref|XP_007144357.1|  hypothetical protein PHAVU_007G149400g             265   5e-80   Phaseolus vulgaris [French bean]
ref|NP_568114.1|  cell division control protein 48C                     265   5e-80   Arabidopsis thaliana [mouse-ear cress]
gb|KDO60204.1|  hypothetical protein CISIN_1g003620mg                   264   6e-80   Citrus sinensis [apfelsine]
emb|CDY41581.1|  BnaC05g43180D                                          265   6e-80   Brassica napus [oilseed rape]
ref|XP_008784494.1|  PREDICTED: cell division cycle protein 48 ho...    265   7e-80   Phoenix dactylifera
ref|XP_007016834.1|  ATPase, AAA-type, CDC48 protein                    265   7e-80   Theobroma cacao [chocolate]
ref|XP_010035967.1|  PREDICTED: cell division cycle protein 48 ho...    265   7e-80   Eucalyptus grandis [rose gum]
ref|XP_006424506.1|  hypothetical protein CICLE_v10027840mg             265   7e-80   Citrus clementina [clementine]
ref|XP_006488039.1|  PREDICTED: cell division cycle protein 48 ho...    265   7e-80   Citrus sinensis [apfelsine]
ref|XP_010933081.1|  PREDICTED: cell division cycle protein 48 ho...    264   8e-80   Elaeis guineensis
tpg|DAA43414.1|  TPA: hypothetical protein ZEAMMB73_941156              256   9e-80   
pir||T48355  transitional endoplasmic reticulum ATPase - Arabidop...    265   1e-79
ref|XP_003554388.1|  PREDICTED: cell division cycle protein 48 ho...    264   1e-79   Glycine max [soybeans]
ref|XP_010035969.1|  PREDICTED: cell division cycle protein 48 ho...    264   1e-79   Eucalyptus grandis [rose gum]
gb|AES81894.2|  ATPase, AAA-type, CDC48 protein                         264   1e-79   Medicago truncatula
ref|XP_009123155.1|  PREDICTED: cell division control protein 48 ...    264   1e-79   Brassica rapa
gb|KFK24784.1|  hypothetical protein AALP_AA8G024500                    263   1e-79   Arabis alpina [alpine rockcress]
gb|AFF59215.1|  cell division cycle protein 48                          263   2e-79   Camellia sinensis [black tea]
emb|CDY54618.1|  BnaA05g28710D                                          263   2e-79   Brassica napus [oilseed rape]
gb|KFK38374.1|  hypothetical protein AALP_AA3G105700                    263   2e-79   Arabis alpina [alpine rockcress]
emb|CDY07941.1|  BnaC03g35820D                                          263   2e-79   Brassica napus [oilseed rape]
ref|XP_007208079.1|  hypothetical protein PRUPE_ppa001552mg             263   2e-79   Prunus persica
ref|XP_008350361.1|  PREDICTED: cell division control protein 48 ...    263   2e-79   
gb|EYU34476.1|  hypothetical protein MIMGU_mgv1a0021281mg               261   2e-79   Erythranthe guttata [common monkey flower]
ref|XP_008226257.1|  PREDICTED: cell division cycle protein 48 ho...    263   2e-79   Prunus mume [ume]
ref|XP_008385356.1|  PREDICTED: cell division cycle protein 48 ho...    263   2e-79   
ref|XP_004487074.1|  PREDICTED: cell division cycle protein 48 ho...    263   2e-79   Cicer arietinum [garbanzo]
ref|XP_004249485.1|  PREDICTED: cell division cycle protein 48 ho...    263   2e-79   Solanum lycopersicum
ref|XP_010935717.1|  PREDICTED: cell division cycle protein 48 ho...    263   2e-79   Elaeis guineensis
ref|XP_010490810.1|  PREDICTED: cell division control protein 48 ...    263   3e-79   Camelina sativa [gold-of-pleasure]
ref|XP_009356903.1|  PREDICTED: cell division cycle protein 48 ho...    263   3e-79   Pyrus x bretschneideri [bai li]
ref|XP_009418624.1|  PREDICTED: cell division cycle protein 48 ho...    263   3e-79   
ref|XP_009376078.1|  PREDICTED: uncharacterized protein LOC103964...    254   3e-79   
ref|XP_006339079.1|  PREDICTED: cell division cycle protein 48 ho...    263   3e-79   Solanum tuberosum [potatoes]
emb|CAN61919.1|  hypothetical protein VITISV_038729                     263   3e-79   Vitis vinifera
ref|XP_008359643.1|  PREDICTED: cell division control protein 48 ...    263   3e-79   Malus domestica [apple tree]
ref|XP_009135040.1|  PREDICTED: cell division control protein 48 ...    263   3e-79   Brassica rapa
ref|XP_009334653.1|  PREDICTED: cell division control protein 48 ...    263   4e-79   Pyrus x bretschneideri [bai li]
ref|XP_002281671.1|  PREDICTED: cell division cycle protein 48 ho...    263   4e-79   Vitis vinifera
ref|XP_004143268.1|  PREDICTED: cell division cycle protein 48 ho...    262   4e-79   Cucumis sativus [cucumbers]
ref|XP_010684066.1|  PREDICTED: cell division cycle protein 48 ho...    262   4e-79   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN48262.1|  Cell division cycle protein 48 like                     262   4e-79   Glycine soja [wild soybean]
ref|XP_009146894.1|  PREDICTED: cell division control protein 48 ...    262   4e-79   Brassica rapa
ref|XP_004304451.1|  PREDICTED: cell division cycle protein 48 ho...    262   5e-79   Fragaria vesca subsp. vesca
ref|XP_003535161.1|  PREDICTED: cell division cycle protein 48 ho...    262   5e-79   Glycine max [soybeans]
gb|KHN39040.1|  Cell division cycle protein 48 like                     262   5e-79   Glycine soja [wild soybean]
ref|XP_003542533.1|  PREDICTED: cell division cycle protein 48 ho...    262   5e-79   Glycine max [soybeans]
ref|XP_008462466.1|  PREDICTED: cell division cycle protein 48 ho...    262   6e-79   Cucumis melo [Oriental melon]
ref|XP_010423732.1|  PREDICTED: cell division control protein 48 ...    262   6e-79   Camelina sativa [gold-of-pleasure]
ref|XP_011018733.1|  PREDICTED: cell division cycle protein 48 ho...    261   8e-79   Populus euphratica
gb|KFK34571.1|  hypothetical protein AALP_AA5G163100                    261   9e-79   Arabis alpina [alpine rockcress]
ref|XP_004156282.1|  PREDICTED: LOW QUALITY PROTEIN: cell divisio...    261   1e-78   
ref|XP_006840975.1|  hypothetical protein AMTR_s00085p00052820          261   1e-78   Amborella trichopoda
gb|ACC66148.3|  cell division cycle protein                             261   1e-78   Dimocarpus longan [longan]
emb|CDY22207.1|  BnaC01g38940D                                          261   1e-78   Brassica napus [oilseed rape]
ref|XP_010940629.1|  PREDICTED: cell division cycle protein 48 ho...    261   1e-78   Elaeis guineensis
ref|XP_009130717.1|  PREDICTED: cell division control protein 48 ...    261   2e-78   Brassica rapa
emb|CDY11249.1|  BnaA03g00850D                                          261   2e-78   Brassica napus [oilseed rape]
ref|XP_002465842.1|  hypothetical protein SORBIDRAFT_01g046840          261   2e-78   Sorghum bicolor [broomcorn]
ref|XP_008776881.1|  PREDICTED: cell division cycle protein 48 ho...    261   2e-78   Phoenix dactylifera
ref|XP_008800539.1|  PREDICTED: cell division cycle protein 48 ho...    261   2e-78   Phoenix dactylifera
ref|XP_010452210.1|  PREDICTED: cell division control protein 48 ...    261   2e-78   Camelina sativa [gold-of-pleasure]
ref|XP_011040486.1|  PREDICTED: cell division cycle protein 48 ho...    260   2e-78   Populus euphratica
ref|XP_011040485.1|  PREDICTED: cell division cycle protein 48 ho...    260   2e-78   Populus euphratica
ref|XP_008660526.1|  PREDICTED: cell division control protein 48 ...    260   2e-78   Zea mays [maize]
ref|XP_002318682.2|  hypothetical protein POPTR_0012s09000g             260   2e-78   Populus trichocarpa [western balsam poplar]
ref|XP_011046194.1|  PREDICTED: cell division cycle protein 48 ho...    259   3e-78   Populus euphratica
ref|XP_004493990.1|  PREDICTED: cell division control protein 48 ...    260   3e-78   
ref|XP_009400914.1|  PREDICTED: cell division cycle protein 48 ho...    260   3e-78   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006354354.1|  PREDICTED: cell division cycle protein 48 ho...    260   4e-78   Solanum tuberosum [potatoes]
dbj|BAK08045.1|  predicted protein                                      259   4e-78   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001048987.1|  Os03g0151800                                       259   4e-78   
ref|NP_190891.1|  cell division control protein 48-B                    259   4e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010248585.1|  PREDICTED: cell division control protein 48 ...    258   5e-78   Nelumbo nucifera [Indian lotus]
emb|CDY13308.1|  BnaC06g14490D                                          259   5e-78   Brassica napus [oilseed rape]
ref|XP_011046193.1|  PREDICTED: cell division cycle protein 48 ho...    259   6e-78   Populus euphratica
ref|XP_008789550.1|  PREDICTED: cell division cycle protein 48 ho...    259   8e-78   Phoenix dactylifera
ref|XP_009103848.1|  PREDICTED: cell division control protein 48 ...    259   8e-78   Brassica rapa
ref|XP_001781154.1|  predicted protein                                  259   8e-78   
ref|XP_003558792.1|  PREDICTED: cell division control protein 48 ...    259   9e-78   Brachypodium distachyon [annual false brome]
gb|KDP31060.1|  hypothetical protein JCGZ_11436                         259   9e-78   Jatropha curcas
ref|XP_010102514.1|  Cell division cycle protein 48-like protein        259   9e-78   
gb|EMS63012.1|  Cell division cycle protein 48-like protein             259   9e-78   Triticum urartu
emb|CDX80862.1|  BnaC03g01160D                                          259   1e-77   
ref|XP_009397889.1|  PREDICTED: cell division cycle protein 48 ho...    258   1e-77   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009376815.1|  PREDICTED: cell division control protein 48 ...    258   1e-77   Pyrus x bretschneideri [bai li]
ref|XP_009376076.1|  PREDICTED: uncharacterized protein LOC103964...    250   1e-77   
ref|XP_001771056.1|  predicted protein                                  258   1e-77   
emb|CDX73571.1|  BnaC08g24320D                                          257   1e-77   
ref|XP_002989888.1|  hypothetical protein SELMODRAFT_269585             258   2e-77   
ref|XP_002968637.1|  hypothetical protein SELMODRAFT_145748             258   2e-77   Selaginella moellendorffii
gb|EMS47029.1|  Cell division cycle protein 48-like protein             258   3e-77   Triticum urartu
ref|XP_010248584.1|  PREDICTED: cell division cycle protein 48 ho...    257   3e-77   Nelumbo nucifera [Indian lotus]
dbj|BAL14440.1|  cell division cycle protein 48 homolog                 257   4e-77   Allium cepa
ref|XP_003558791.1|  PREDICTED: cell division control protein 48 ...    257   4e-77   Brachypodium distachyon [annual false brome]
ref|XP_008671992.1|  PREDICTED: uncharacterized protein LOC100278...    257   4e-77   
ref|XP_002511356.1|  Transitional endoplasmic reticulum ATPase, p...    257   5e-77   
ref|XP_008464542.1|  PREDICTED: cell division cycle protein 48 ho...    257   5e-77   Cucumis melo [Oriental melon]
ref|XP_004985671.1|  PREDICTED: cell division control protein 48 ...    257   5e-77   
ref|XP_004985670.1|  PREDICTED: cell division control protein 48 ...    256   5e-77   Setaria italica
ref|XP_001769513.1|  predicted protein                                  257   5e-77   
ref|XP_004298972.1|  PREDICTED: cell division cycle protein 48 ho...    257   6e-77   Fragaria vesca subsp. vesca
gb|EMT10596.1|  Cell division control 48-E-like protein                 258   7e-77   
ref|XP_006649413.1|  PREDICTED: cell division control protein 48 ...    256   7e-77   Oryza brachyantha
ref|XP_009408125.1|  PREDICTED: cell division cycle protein 48 ho...    256   9e-77   Musa acuminata subsp. malaccensis [pisang utan]
gb|AEI01159.1|  cell division cycle protein 48                          255   9e-77   Zea mays [maize]
ref|XP_002467173.1|  hypothetical protein SORBIDRAFT_01g020910          256   1e-76   Sorghum bicolor [broomcorn]
ref|XP_001777213.1|  predicted protein                                  256   1e-76   
ref|XP_004155087.1|  PREDICTED: cell division cycle protein 48 ho...    254   1e-76   
ref|XP_008644026.1|  PREDICTED: uncharacterized protein LOC100382...    255   2e-76   
gb|EEC67044.1|  hypothetical protein OsI_33786                          254   2e-76   Oryza sativa Indica Group [Indian rice]
ref|XP_008668346.1|  PREDICTED: uncharacterized protein LOC100274...    255   2e-76   
gb|AAP53974.2|  Cell division cycle protein 48, putative, expressed     255   3e-76   Oryza sativa Japonica Group [Japonica rice]
gb|AFW68686.1|  hypothetical protein ZEAMMB73_070374                    255   3e-76   
ref|XP_004138100.1|  PREDICTED: cell division cycle protein 48 ho...    255   3e-76   Cucumis sativus [cucumbers]
ref|XP_006662392.1|  PREDICTED: cell division cycle protein 48 ho...    255   3e-76   Oryza brachyantha
gb|KHN30934.1|  Cell division cycle protein 48 like                     255   3e-76   Glycine soja [wild soybean]
ref|XP_003523092.1|  PREDICTED: cell division cycle protein 48 ho...    255   3e-76   Glycine max [soybeans]
gb|KEH39372.1|  ATPase, AAA-type, CDC48 protein                         253   3e-76   Medicago truncatula
ref|XP_004983011.1|  PREDICTED: cell division cycle protein 48 ho...    254   4e-76   Setaria italica
ref|XP_004983010.1|  PREDICTED: cell division cycle protein 48 ho...    254   5e-76   
ref|XP_010907037.1|  PREDICTED: cell division cycle protein 48 ho...    254   5e-76   Elaeis guineensis
ref|XP_002321618.1|  hypothetical protein POPTR_0015s09220g             254   6e-76   Populus trichocarpa [western balsam poplar]
emb|CDX78154.1|  BnaA09g33490D                                          253   8e-76   
ref|XP_003638042.1|  Cell division control protein-like protein         253   8e-76   
ref|XP_001768037.1|  predicted protein                                  253   1e-75   
gb|KHN19275.1|  Cell division cycle protein 48 like                     253   1e-75   Glycine soja [wild soybean]
ref|XP_003528141.1|  PREDICTED: cell division cycle protein 48 ho...    253   2e-75   Glycine max [soybeans]
ref|XP_001776943.1|  predicted protein                                  253   2e-75   
ref|XP_009116016.1|  PREDICTED: cell division control protein 48 ...    252   2e-75   Brassica rapa
ref|XP_009116015.1|  PREDICTED: cell division control protein 48 ...    252   2e-75   Brassica rapa
ref|XP_004246640.1|  PREDICTED: cell division cycle protein 48 ho...    251   4e-75   Solanum lycopersicum
gb|KDO49337.1|  hypothetical protein CISIN_1g0036232mg                  233   8e-75   Citrus sinensis [apfelsine]
ref|XP_009362967.1|  PREDICTED: cell division cycle protein 48 ho...    250   1e-74   Pyrus x bretschneideri [bai li]
ref|XP_010027352.1|  PREDICTED: cell division cycle protein 48 ho...    250   1e-74   
ref|XP_006405119.1|  hypothetical protein EUTSA_v10000577mg             249   3e-74   Eutrema salsugineum [saltwater cress]
ref|XP_008393112.1|  PREDICTED: cell division cycle protein 48 ho...    248   8e-74   
ref|XP_009762168.1|  PREDICTED: cell division cycle protein 48 ho...    248   1e-73   Nicotiana sylvestris
ref|XP_003625653.1|  Cell division control protein-like protein         230   2e-73   
ref|XP_007138037.1|  hypothetical protein PHAVU_009G175800g             247   2e-73   Phaseolus vulgaris [French bean]
gb|KIZ06105.1|  transitional endoplasmic reticulum ATPase               246   2e-73   Monoraphidium neglectum
ref|XP_006344438.1|  PREDICTED: cell division cycle protein 48 ho...    247   2e-73   Solanum tuberosum [potatoes]
ref|XP_009625492.1|  PREDICTED: cell division cycle protein 48 ho...    247   2e-73   Nicotiana tomentosiformis
gb|KDO69546.1|  hypothetical protein CISIN_1g0034991mg                  240   3e-73   Citrus sinensis [apfelsine]
gb|KDO69542.1|  hypothetical protein CISIN_1g0034991mg                  240   4e-73   Citrus sinensis [apfelsine]
gb|KEH17133.1|  cell division control-like protein                      228   5e-73   Medicago truncatula
ref|XP_008243978.1|  PREDICTED: cell division control protein 48 ...    246   5e-73   Prunus mume [ume]
ref|XP_004236235.1|  PREDICTED: cell division cycle protein 48 ho...    245   8e-73   Solanum lycopersicum
ref|XP_007132307.1|  hypothetical protein PHAVU_011G083800g             244   2e-72   Phaseolus vulgaris [French bean]
ref|XP_002946301.1|  hypothetical protein VOLCADRAFT_78972              244   3e-72   Volvox carteri f. nagariensis
ref|XP_006439879.1|  hypothetical protein CICLE_v10018887mg             243   5e-72   Citrus clementina [clementine]
gb|EMT26392.1|  Cell division control 48-E-like protein                 244   2e-71   
ref|XP_010035972.1|  PREDICTED: cell division cycle protein 48 ho...    235   2e-71   Eucalyptus grandis [rose gum]
emb|CEF96725.1|  ATPase, AAA-type, CDC48                                241   3e-71   Ostreococcus tauri
ref|XP_001415566.1|  predicted protein                                  241   4e-71   Ostreococcus lucimarinus CCE9901
ref|XP_006476838.1|  PREDICTED: cell division cycle protein 48 ho...    241   4e-71   Citrus sinensis [apfelsine]
ref|XP_001696503.1|  flagellar associated protein                       241   4e-71   Chlamydomonas reinhardtii
emb|CDP16951.1|  unnamed protein product                                241   5e-71   Coffea canephora [robusta coffee]
ref|XP_007515232.1|  predicted protein                                  241   5e-71   Bathycoccus prasinos
gb|EMS53442.1|  Cell division control protein 48-like protein E         240   6e-71   Triticum urartu
ref|XP_011401908.1|  Cell division control protein 48-like protein E    241   7e-71   Auxenochlorella protothecoides
emb|CEG79414.1|  Putative Transitional endoplasmic reticulum ATPase     224   1e-70   Rhizopus microsporus
ref|XP_005704845.1|  AAA-type ATPase                                    239   1e-70   Galdieria sulphuraria
ref|XP_009485532.1|  PREDICTED: transitional endoplasmic reticulu...    224   1e-70   Pelecanus crispus
ref|XP_005028113.1|  PREDICTED: transitional endoplasmic reticulu...    224   2e-70   
ref|XP_005850901.1|  hypothetical protein CHLNCDRAFT_140589             239   2e-70   Chlorella variabilis
ref|XP_008941408.1|  PREDICTED: transitional endoplasmic reticulu...    223   2e-70   Merops nubicus
gb|EYU17717.1|  hypothetical protein MIMGU_mgv1a001480mg                239   2e-70   Erythranthe guttata [common monkey flower]
pdb|3TIW|A  Chain A, Crystal Structure Of P97n In Complex With Th...    223   2e-70   Homo sapiens [man]
gb|ADF97605.1|  valosin-containing protein                              223   3e-70   Hypophthalmichthys molitrix
ref|XP_003056149.1|  cell division cycle protein 48                     238   3e-70   Micromonas pusilla CCMP1545
pdb|3QQ7|A  Chain A, Crystal Structure Of The P97 N-Terminal Domain     223   4e-70   Homo sapiens [man]
ref|XP_002507162.1|  cell division cycle protein 48-like protein,...    238   5e-70   Micromonas commoda
gb|EMT25725.1|  Cell division cycle 48-like protein                     238   6e-70   
ref|XP_011101302.1|  PREDICTED: cell division cycle protein 48 ho...    238   7e-70   Sesamum indicum [beniseed]
ref|XP_005648508.1|  AAA ATPase                                         237   1e-69   Coccomyxa subellipsoidea C-169
ref|XP_010282008.1|  PREDICTED: transitional endoplasmic reticulu...    224   1e-69   Phaethon lepturus
emb|CDP12653.1|  unnamed protein product                                236   2e-69   Coffea canephora [robusta coffee]
ref|XP_010165279.1|  PREDICTED: transitional endoplasmic reticulu...    224   4e-69   
emb|CEI89188.1|  Putative Cell division control protein Cdc48           225   5e-69   Rhizopus microsporus
ref|XP_006014255.1|  PREDICTED: transitional endoplasmic reticulu...    218   5e-69   Latimeria chalumnae
pdb|3QWZ|A  Chain A, Crystal Structure Of Faf1 Ubx-P97n-Domain Co...    220   6e-69   Homo sapiens [man]
ref|XP_005756362.1|  cell division cycle protein 48                     235   7e-69   
ref|XP_010770092.1|  PREDICTED: transitional endoplasmic reticulu...    224   8e-69   
ref|XP_004292462.1|  PREDICTED: cell division control protein 48 ...    224   1e-68   
ref|XP_003353613.3|  PREDICTED: transitional endoplasmic reticulu...    221   2e-68   
ref|XP_009904388.1|  PREDICTED: transitional endoplasmic reticulu...    225   2e-68   
ref|NP_001158521.1|  Transitional endoplasmic reticulum ATPase          222   3e-68   
gb|EMT22831.1|  Cell division control 48-E-like protein                 233   4e-68   
gb|EOA95334.1|  Transitional endoplasmic reticulum ATPase               218   6e-68   
gb|EXX76047.1|  AAA family ATPase CDC48                                 231   7e-68   
ref|XP_007211349.1|  hypothetical protein PRUPE_ppa001545mg             232   8e-68   
ref|XP_010723540.1|  PREDICTED: transitional endoplasmic reticulu...    227   1e-67   
gb|EXX76046.1|  AAA family ATPase CDC48                                 231   1e-67   
ref|XP_636910.1|  cell division cycle protein 48                        231   2e-67   
pdb|4KDI|A  Chain A, Crystal Structure Of P97/vcp N In Complex Wi...    216   2e-67   
gb|EMT31146.1|  Cell division control 48-E-like protein                 234   2e-67   
pdb|3QC8|A  Chain A, Crystal Structure Of Faf1 Ubx Domain In Comp...    215   2e-67   
pdb|1E32|A  Chain A, Structure Of The N-Terminal Domain And The D...    224   2e-67   
ref|XP_010121931.1|  PREDICTED: transitional endoplasmic reticulu...    226   3e-67   
gb|KFV91524.1|  Transitional endoplasmic reticulum ATPase               226   3e-67   
ref|XP_010145562.1|  PREDICTED: transitional endoplasmic reticulu...    226   3e-67   
gb|KFP43489.1|  Transitional endoplasmic reticulum ATPase               226   3e-67   
pdb|2PJH|B  Chain B, Strctural Model Of The P97 N Domain- Npl4 Ub...    215   4e-67   
pdb|3HU3|A  Chain A, Structure Of P97 N-D1 R155h Mutant In Comple...    224   4e-67   
pdb|4KLN|A  Chain A, Structure Of P97 N-d1 A232e Mutant In Comple...    224   4e-67   
tpg|DAA34120.1|  TPA: AAA+-type ATPase                                  215   4e-67   
gb|KFH64216.1|  transitional endoplasmic reticulum ATPase               229   6e-67   
emb|CDH51679.1|  aaa atpase                                             229   7e-67   
ref|XP_006482674.1|  PREDICTED: cell division cycle protein 48 ho...    229   8e-67   
gb|EIE87891.1|  transitional endoplasmic reticulum ATPase               229   8e-67   
emb|CDS04918.1|  Putative Cell division cycle protein 48                229   9e-67   
gb|KFH73693.1|  transitional endoplasmic reticulum ATPase               229   9e-67   
pdb|3HU2|A  Chain A, Structure Of P97 N-D1 R86a Mutant In Complex...    223   9e-67   
gb|EIE83190.1|  transitional endoplasmic reticulum ATPase               229   1e-66   
ref|XP_005820060.1|  CDC48-like protein                                 229   1e-66   
ref|XP_010731989.1|  PREDICTED: transitional endoplasmic reticulu...    224   1e-66   
gb|KFQ67024.1|  Transitional endoplasmic reticulum ATPase               226   2e-66   
ref|XP_010200982.1|  PREDICTED: transitional endoplasmic reticulu...    225   2e-66   
ref|XP_009782020.1|  PREDICTED: cell division cycle protein 48 ho...    228   2e-66   
ref|XP_010283725.1|  PREDICTED: transitional endoplasmic reticulu...    226   2e-66   
ref|XP_003290830.1|  cell division cycle protein 48                     228   2e-66   
gb|KFP23590.1|  Transitional endoplasmic reticulum ATPase               224   2e-66   
ref|XP_005536694.1|  transitional endoplasmic reticulum ATPase          228   2e-66   
ref|XP_007888898.1|  PREDICTED: transitional endoplasmic reticulu...    227   3e-66   
ref|WP_043700743.1|  hypothetical protein                               211   4e-66   
ref|XP_009098226.1|  PREDICTED: transitional endoplasmic reticulu...    226   4e-66   
ref|XP_009096220.1|  PREDICTED: LOW QUALITY PROTEIN: transitional...    226   4e-66   
pdb|3HU1|A  Chain A, Structure Of P97 N-D1 R95g Mutant In Complex...    221   4e-66   
emb|CDQ80314.1|  unnamed protein product                                226   6e-66   
ref|XP_006626794.1|  PREDICTED: transitional endoplasmic reticulu...    226   6e-66   
ref|XP_009556134.1|  PREDICTED: transitional endoplasmic reticulu...    226   7e-66   
dbj|BAC87740.1|  CDC48                                                  226   7e-66   
ref|XP_005311744.1|  PREDICTED: transitional endoplasmic reticulu...    226   7e-66   
ref|XP_007238029.1|  PREDICTED: transitional endoplasmic reticulu...    226   7e-66   
ref|NP_958889.1|  transitional endoplasmic reticulum ATPase             226   7e-66   
gb|EPB92524.1|  transitional endoplasmic reticulum ATPase               226   8e-66   
ref|XP_001368198.1|  PREDICTED: transitional endoplasmic reticulu...    226   8e-66   
ref|XP_008417014.1|  PREDICTED: transitional endoplasmic reticulu...    226   8e-66   
ref|XP_007559307.1|  PREDICTED: transitional endoplasmic reticulu...    226   8e-66   
ref|XP_005804058.1|  PREDICTED: transitional endoplasmic reticulu...    226   8e-66   
ref|XP_009888047.1|  PREDICTED: transitional endoplasmic reticulu...    226   8e-66   
ref|XP_004177198.1|  PREDICTED: LOW QUALITY PROTEIN: transitional...    226   8e-66   
ref|XP_009464637.1|  PREDICTED: transitional endoplasmic reticulu...    226   8e-66   
ref|XP_010214692.1|  PREDICTED: transitional endoplasmic reticulu...    226   9e-66   
ref|XP_010862756.1|  PREDICTED: transitional endoplasmic reticulu...    226   9e-66   
ref|XP_008925984.1|  PREDICTED: transitional endoplasmic reticulu...    226   9e-66   
ref|XP_009924180.1|  PREDICTED: transitional endoplasmic reticulu...    226   9e-66   
ref|XP_005060493.1|  PREDICTED: transitional endoplasmic reticulu...    226   9e-66   
gb|KFV54266.1|  Transitional endoplasmic reticulum ATPase               226   9e-66   
ref|XP_005234890.1|  PREDICTED: transitional endoplasmic reticulu...    226   9e-66   
gb|KFV75862.1|  Transitional endoplasmic reticulum ATPase               226   9e-66   
ref|XP_009889870.1|  PREDICTED: transitional endoplasmic reticulu...    226   9e-66   
ref|XP_009286527.1|  PREDICTED: transitional endoplasmic reticulu...    226   9e-66   
gb|KGL98524.1|  Transitional endoplasmic reticulum ATPase               226   9e-66   
ref|XP_009990193.1|  PREDICTED: transitional endoplasmic reticulu...    226   9e-66   
ref|XP_009645568.1|  PREDICTED: transitional endoplasmic reticulu...    226   9e-66   
ref|XP_004072466.1|  PREDICTED: transitional endoplasmic reticulu...    226   9e-66   
ref|XP_005143521.1|  PREDICTED: LOW QUALITY PROTEIN: transitional...    226   9e-66   
ref|XP_005436965.1|  PREDICTED: transitional endoplasmic reticulu...    226   9e-66   
ref|XP_004345062.1|  valosin-containing protein                         226   9e-66   
ref|XP_006003603.1|  PREDICTED: transitional endoplasmic reticulu...    226   9e-66   
ref|XP_006132821.1|  PREDICTED: transitional endoplasmic reticulu...    226   9e-66   
ref|XP_008630025.1|  PREDICTED: transitional endoplasmic reticulu...    226   9e-66   
ref|XP_006026624.1|  PREDICTED: transitional endoplasmic reticulu...    226   9e-66   
ref|XP_009576597.1|  PREDICTED: transitional endoplasmic reticulu...    226   1e-65   
ref|XP_009940998.1|  PREDICTED: transitional endoplasmic reticulu...    226   1e-65   
gb|KGL78429.1|  Transitional endoplasmic reticulum ATPase               226   1e-65   
ref|XP_009704177.1|  PREDICTED: transitional endoplasmic reticulu...    226   1e-65   
gb|EMC84965.1|  Transitional endoplasmic reticulum ATPase               226   1e-65   
ref|XP_009907223.1|  PREDICTED: transitional endoplasmic reticulu...    226   1e-65   
ref|XP_008641251.1|  PREDICTED: transitional endoplasmic reticulu...    226   1e-65   
ref|XP_009328695.1|  PREDICTED: transitional endoplasmic reticulu...    226   1e-65   
ref|XP_010212295.1|  PREDICTED: LOW QUALITY PROTEIN: transitional...    226   1e-65   
gb|KFQ09585.1|  Transitional endoplasmic reticulum ATPase               226   1e-65   
emb|CEG67530.1|  Putative Cell division cycle protein 48                226   1e-65   
gb|EDL98716.1|  valosin-containing protein, isoform CRA_a               224   1e-65   
ref|XP_007663018.1|  PREDICTED: transitional endoplasmic reticulu...    226   1e-65   
ref|XP_007055980.1|  PREDICTED: transitional endoplasmic reticulu...    226   1e-65   
ref|XP_003229140.1|  PREDICTED: transitional endoplasmic reticulu...    226   1e-65   
ref|XP_009501604.1|  PREDICTED: LOW QUALITY PROTEIN: transitional...    226   1e-65   
ref|XP_010723528.1|  PREDICTED: transitional endoplasmic reticulu...    226   1e-65   
ref|NP_001038129.1|  transitional endoplasmic reticulum ATPase          226   1e-65   
ref|XP_005428140.1|  PREDICTED: transitional endoplasmic reticulu...    226   1e-65   
ref|XP_005019488.1|  PREDICTED: transitional endoplasmic reticulu...    226   1e-65   
gb|KFP22963.1|  Transitional endoplasmic reticulum ATPase               226   1e-65   
ref|XP_010393380.1|  PREDICTED: transitional endoplasmic reticulu...    226   1e-65   
dbj|GAN06451.1|  valosin-containing protein                             226   1e-65   
ref|XP_005431228.1|  PREDICTED: transitional endoplasmic reticulu...    226   1e-65   
ref|XP_009621394.1|  PREDICTED: cell division cycle protein 48 ho...    226   1e-65   
ref|NP_001095217.1|  transitional endoplasmic reticulum ATPase          226   2e-65   
ref|NP_001005677.1|  transitional endoplasmic reticulum ATPase          226   2e-65   
ref|XP_003883697.1|  hypothetical protein NCLIV_034470                  211   2e-65   
emb|CDQ66388.1|  unnamed protein product                                225   2e-65   
ref|XP_003761839.1|  PREDICTED: transitional endoplasmic reticulu...    226   2e-65   
ref|XP_008334946.1|  PREDICTED: transitional endoplasmic reticulu...    225   2e-65   
gb|KFQ99051.1|  Transitional endoplasmic reticulum ATPase               224   2e-65   
ref|XP_006431112.1|  hypothetical protein CICLE_v10013552mg             225   2e-65   
ref|XP_008333569.1|  PREDICTED: transitional endoplasmic reticulu...    225   2e-65   
ref|XP_005507855.1|  PREDICTED: transitional endoplasmic reticulu...    226   2e-65   
emb|CAG07844.1|  unnamed protein product                                225   2e-65   
emb|CDQ62759.1|  unnamed protein product                                225   3e-65   
ref|XP_008374883.1|  PREDICTED: cell division cycle protein 48 ho...    220   3e-65   
ref|XP_009998000.1|  PREDICTED: transitional endoplasmic reticulu...    225   3e-65   
ref|XP_009993942.1|  PREDICTED: transitional endoplasmic reticulu...    225   3e-65   
ref|XP_010035971.1|  PREDICTED: cell division control protein 48 ...    219   3e-65   
ref|XP_008280227.1|  PREDICTED: transitional endoplasmic reticulu...    225   3e-65   
dbj|BAM99026.1|  valosin containing protein                             215   3e-65   
sp|P23787.3|TERA_XENLA  RecName: Full=Transitional endoplasmic re...    224   3e-65   
ref|NP_001290278.1|  transitional endoplasmic reticulum ATPase          224   3e-65   
ref|XP_006784235.1|  PREDICTED: transitional endoplasmic reticulu...    224   3e-65   
ref|XP_004544553.1|  PREDICTED: transitional endoplasmic reticulu...    224   3e-65   
ref|XP_003451720.1|  PREDICTED: transitional endoplasmic reticulu...    224   3e-65   
gb|KFU91189.1|  Transitional endoplasmic reticulum ATPase               224   4e-65   
ref|XP_006143272.1|  PREDICTED: transitional endoplasmic reticulu...    224   4e-65   
gb|EHB13930.1|  Transitional endoplasmic reticulum ATPase               224   4e-65   
gb|EHH24007.1|  Transitional endoplasmic reticulum ATPase               224   5e-65   
emb|CAA78412.1|  murine valosin-containing protein                      224   5e-65   
ref|XP_008840628.1|  PREDICTED: transitional endoplasmic reticulu...    224   5e-65   
dbj|BAE34876.1|  unnamed protein product                                224   5e-65   
ref|XP_003263530.2|  PREDICTED: transitional endoplasmic reticulu...    224   5e-65   
ref|NP_001267410.1|  transitional endoplasmic reticulum ATPase          224   5e-65   
dbj|BAC25849.1|  unnamed protein product                                224   5e-65   
gb|EPQ18792.1|  Transitional endoplasmic reticulum ATPase               224   5e-65   
ref|XP_006898592.1|  PREDICTED: transitional endoplasmic reticulu...    224   5e-65   
dbj|BAE40919.1|  unnamed protein product                                224   5e-65   
ref|NP_009057.1|  transitional endoplasmic reticulum ATPase             224   5e-65   
ref|NP_446316.1|  transitional endoplasmic reticulum ATPase             224   5e-65   
pdb|1R7R|A  Chain A, The Crystal Structure Of Murine P97VCP AT 3.6A     224   5e-65   
ref|XP_006098784.1|  PREDICTED: transitional endoplasmic reticulu...    224   5e-65   
gb|EDL02500.1|  valosin containing protein, isoform CRA_a               224   5e-65   
ref|XP_010384123.1|  PREDICTED: transitional endoplasmic reticulu...    224   5e-65   
dbj|BAG35235.1|  unnamed protein product                                224   5e-65   
dbj|BAE39824.1|  unnamed protein product                                224   5e-65   
dbj|BAM99018.1|  valosin containing protein                             214   5e-65   
ref|XP_003800301.1|  PREDICTED: transitional endoplasmic reticulu...    224   5e-65   
ref|XP_007522960.1|  PREDICTED: transitional endoplasmic reticulu...    224   5e-65   
ref|XP_010617585.1|  PREDICTED: transitional endoplasmic reticulu...    224   5e-65   
gb|AAI21795.1|  Valosin-containing protein                              224   5e-65   
ref|XP_005884071.1|  PREDICTED: transitional endoplasmic reticulu...    224   5e-65   
gb|ELK34263.1|  Transitional endoplasmic reticulum ATPase               224   5e-65   
ref|XP_006098783.1|  PREDICTED: transitional endoplasmic reticulu...    224   5e-65   
gb|ELK09049.1|  Transitional endoplasmic reticulum ATPase               224   5e-65   
gb|ERE83246.1|  spermatogeneis-associated protein 5                     224   6e-65   
ref|XP_010617584.1|  PREDICTED: transitional endoplasmic reticulu...    224   6e-65   
gb|EDL02501.1|  valosin containing protein, isoform CRA_b               224   6e-65   
ref|XP_007945216.1|  PREDICTED: transitional endoplasmic reticulu...    224   7e-65   
gb|EMP39450.1|  Transitional endoplasmic reticulum ATPase               228   8e-65   
ref|XP_007864943.1|  AAA ATPase                                         223   1e-64   
gb|KDO72529.1|  hypothetical protein CISIN_1g042193mg                   223   1e-64   
gb|KHM98917.1|  Cell division cycle protein 48 like                     222   1e-64   
ref|XP_004316142.1|  PREDICTED: transitional endoplasmic reticulu...    222   2e-64   
gb|ELW70284.1|  Transitional endoplasmic reticulum ATPase               226   2e-64   
dbj|BAC27119.1|  unnamed protein product                                223   2e-64   
ref|XP_001628281.1|  predicted protein                                  223   2e-64   
gb|KFO35355.1|  Transitional endoplasmic reticulum ATPase               226   2e-64   
gb|EFA78753.1|  cell division cycle protein 48                          223   2e-64   
ref|XP_010894620.1|  PREDICTED: transitional endoplasmic reticulu...    222   2e-64   
ref|XP_004747538.1|  PREDICTED: transitional endoplasmic reticulu...    223   3e-64   
emb|CEP11185.1|  hypothetical protein                                   222   3e-64   
gb|AGZ01980.1|  valosin-containing protein                              222   3e-64   
ref|XP_010993943.1|  PREDICTED: LOW QUALITY PROTEIN: transitional...    222   3e-64   
ref|XP_005683987.1|  PREDICTED: transitional endoplasmic reticulu...    222   3e-64   
gb|ELR52777.1|  Transitional endoplasmic reticulum ATPase               222   3e-64   
ref|XP_004747539.1|  PREDICTED: transitional endoplasmic reticulu...    222   3e-64   
ref|XP_011286873.1|  PREDICTED: transitional endoplasmic reticulu...    222   3e-64   
ref|XP_004271441.1|  PREDICTED: transitional endoplasmic reticulu...    222   3e-64   
ref|XP_006204244.1|  PREDICTED: transitional endoplasmic reticulu...    222   4e-64   
ref|XP_005605631.1|  PREDICTED: transitional endoplasmic reticulu...    222   4e-64   
ref|XP_852626.1|  PREDICTED: transitional endoplasmic reticulum A...    222   4e-64   
ref|NP_999445.1|  transitional endoplasmic reticulum ATPase             222   4e-64   
ref|XP_006187959.1|  PREDICTED: transitional endoplasmic reticulu...    222   4e-64   
ref|NP_001029466.1|  transitional endoplasmic reticulum ATPase          222   4e-64   
ref|XP_007197160.1|  PREDICTED: transitional endoplasmic reticulu...    222   4e-64   
gb|EMD39094.1|  hypothetical protein CERSUDRAFT_112787                  222   4e-64   
ref|XP_008605414.1|  cell division cycle protein 48                     221   5e-64   
ref|XP_007076669.1|  PREDICTED: transitional endoplasmic reticulu...    222   5e-64   
emb|CEL62027.1|  Cell division cycle protein 48 homolog OS=Glycin...    209   6e-64   
ref|XP_004005332.1|  PREDICTED: transitional endoplasmic reticulu...    221   6e-64   
gb|KDO34615.1|  cell division cycle protein 48                          221   6e-64   
ref|XP_008693442.1|  PREDICTED: transitional endoplasmic reticulu...    222   6e-64   
ref|XP_007363233.1|  AAA ATPase                                         221   7e-64   
gb|AER35078.1|  cell division cycle protein 48                          221   7e-64   
ref|XP_003074428.1|  putative transitional endoplasmic reticulum ...    224   7e-64   
ref|XP_004357262.1|  cell division cycle protein 48                     220   1e-63   
gb|KIO27300.1|  hypothetical protein M407DRAFT_233289                   219   2e-63   
gb|ABQ41382.1|  cell division cycle 48                                  220   2e-63   
ref|XP_002276976.1|  PREDICTED: cell division cycle protein 48 ho...    220   2e-63   
gb|EPY78588.1|  hypothetical protein CB1_001041007                      224   2e-63   
ref|XP_001662523.1|  AAEL012364-PA                                      219   2e-63   
gb|KIK05707.1|  hypothetical protein K443DRAFT_674990                   219   2e-63   
ref|XP_006373505.1|  hypothetical protein POPTR_0017s14340g             219   2e-63   
ref|XP_011424321.1|  PREDICTED: transitional endoplasmic reticulu...    219   3e-63   
emb|CDO68823.1|  hypothetical protein BN946_scf184805.g32               219   5e-63   
gb|AER57860.1|  cell division cycle protein 48                          218   5e-63   
emb|CCA70112.1|  probable CDC48-Microsomal protein of CDC48/PAS1/...    218   6e-63   
ref|XP_001654680.1|  AAEL010585-PA                                      218   6e-63   
ref|XP_003032937.1|  hypothetical protein SCHCODRAFT_85085              218   6e-63   
gb|EJK68888.1|  hypothetical protein THAOC_09893                        218   6e-63   
ref|XP_008102421.1|  PREDICTED: transitional endoplasmic reticulu...    218   7e-63   
ref|XP_007442015.1|  PREDICTED: transitional endoplasmic reticulu...    218   7e-63   
ref|XP_008037975.1|  valosin-containing protein                         218   7e-63   
ref|XP_009056899.1|  hypothetical protein LOTGIDRAFT_216777             218   7e-63   



>ref|XP_009596867.1| PREDICTED: cell division cycle protein 48 homolog [Nicotiana 
tomentosiformis]
Length=805

 Score =   283 bits (724),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 147/159 (92%), Positives = 157/159 (99%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MSHQAESSDSK  KKDFSTAILERKK+PNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD
Sbjct  1    MSHQAESSDSKGAKKDFSTAILERKKSPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDTVVIALAD+TC+EPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTVVIALADETCDEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILPIDDTIEG+TGDLF+++LKPYFLEAYRPLRKGD+FLV
Sbjct  121  ILPIDDTIEGLTGDLFDAFLKPYFLEAYRPLRKGDNFLV  159



>ref|XP_009786785.1| PREDICTED: cell division cycle protein 48 homolog [Nicotiana 
sylvestris]
 gb|ACS28251.1| cell division control protein [Nicotiana glutinosa]
Length=805

 Score =   283 bits (723),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 147/159 (92%), Positives = 157/159 (99%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MSHQAESSDSK  KKDFSTAILERKK+PNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD
Sbjct  1    MSHQAESSDSKGAKKDFSTAILERKKSPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDTVVIALAD+TC+EPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTVVIALADETCDEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILPIDDTIEG+TGDLF+++LKPYFLEAYRPLRKGD+FLV
Sbjct  121  ILPIDDTIEGLTGDLFDAFLKPYFLEAYRPLRKGDNFLV  159



>gb|EYU36158.1| hypothetical protein MIMGU_mgv1a001501mg [Erythranthe guttata]
Length=807

 Score =   280 bits (716),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 145/159 (91%), Positives = 155/159 (97%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MSHQAESSD+K  KKDFSTAILERKKA NRLVVDEAVNDDNSVVAL+PATMEKLQLFRGD
Sbjct  1    MSHQAESSDAKGGKKDFSTAILERKKAANRLVVDEAVNDDNSVVALHPATMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDTV IALAD+TCEEPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTVCIALADETCEEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEG+TGDLF++YLKPYFLEAYRP+RKGDHFLV
Sbjct  121  ILPLDDTIEGITGDLFDAYLKPYFLEAYRPVRKGDHFLV  159



>ref|XP_011089245.1| PREDICTED: cell division cycle protein 48 homolog [Sesamum indicum]
Length=805

 Score =   279 bits (714),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 146/159 (92%), Positives = 155/159 (97%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MSHQAESSDSKS KKDFSTAILERKKA NRL+VDEAVNDDNSVV+L+PATMEKLQLFRGD
Sbjct  1    MSHQAESSDSKSGKKDFSTAILERKKAANRLIVDEAVNDDNSVVSLHPATMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDTV IALADDTCEEPKIRMNKVVR NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTVCIALADDTCEEPKIRMNKVVRTNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEG+TGDLF++YLKPYFLEAYRP+RKGDHFLV
Sbjct  121  ILPLDDTIEGLTGDLFDAYLKPYFLEAYRPVRKGDHFLV  159



>emb|CDP07060.1| unnamed protein product [Coffea canephora]
Length=805

 Score =   279 bits (713),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 145/159 (91%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MSHQAESSDSK  KKDFSTAILERKKAPNRL+VDEAVNDDNSVVAL+P TMEKLQLFRGD
Sbjct  1    MSHQAESSDSKGGKKDFSTAILERKKAPNRLIVDEAVNDDNSVVALHPNTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDTV IALAD+TCEEPKIRMNKVVRANLRVRL DVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTVCIALADETCEEPKIRMNKVVRANLRVRLADVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEGVTGDLF+++LKPYFLEAYRP+RKGDHFLV
Sbjct  121  ILPLDDTIEGVTGDLFDAFLKPYFLEAYRPVRKGDHFLV  159



>ref|XP_009787355.1| PREDICTED: cell division cycle protein 48 homolog [Nicotiana 
sylvestris]
Length=806

 Score =   278 bits (711),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 153/160 (96%), Gaps = 1/160 (1%)
 Frame = +1

Query  73   MSHQAEssdskstkkdf-stAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRG  249
            MSH AESSDSK+  K   STAILERKKA NRLVVDEAVNDDNSVVAL+PATMEKLQLFRG
Sbjct  1    MSHPAESSDSKNATKKDFSTAILERKKAANRLVVDEAVNDDNSVVALHPATMEKLQLFRG  60

Query  250  DTVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRV  429
            DT+LIKGKKRKDTVVIALAD+TC+EPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRV
Sbjct  61   DTILIKGKKRKDTVVIALADETCDEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRV  120

Query  430  HILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            HILPIDDTIEGVTGDLFES+LKPYFLEAYRPLRKGDHFLV
Sbjct  121  HILPIDDTIEGVTGDLFESFLKPYFLEAYRPLRKGDHFLV  160



>ref|XP_009593345.1| PREDICTED: cell division cycle protein 48 homolog [Nicotiana 
tomentosiformis]
Length=806

 Score =   277 bits (709),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 153/160 (96%), Gaps = 1/160 (1%)
 Frame = +1

Query  73   MSHQAEssdskstkkdf-stAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRG  249
            MSH AESSDSK+  K   STAILERKKA NRL+VDEAVNDDNSVVAL+PATMEKLQLFRG
Sbjct  1    MSHPAESSDSKNATKKDFSTAILERKKAANRLIVDEAVNDDNSVVALHPATMEKLQLFRG  60

Query  250  DTVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRV  429
            DT+LIKGKKRKDTVVIALAD+TC+EPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRV
Sbjct  61   DTILIKGKKRKDTVVIALADETCDEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRV  120

Query  430  HILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            HILPIDDTIEGVTGDLFES+LKPYFLEAYRPLRKGDHFLV
Sbjct  121  HILPIDDTIEGVTGDLFESFLKPYFLEAYRPLRKGDHFLV  160



>ref|XP_006347195.1| PREDICTED: cell division cycle protein 48 homolog [Solanum tuberosum]
Length=805

 Score =   277 bits (709),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 144/159 (91%), Positives = 157/159 (99%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M++QAESSDSK  KKDFSTAILERKK+PNRLVVDEAVNDDNSVVAL+PATMEKLQLFRGD
Sbjct  1    MTNQAESSDSKGAKKDFSTAILERKKSPNRLVVDEAVNDDNSVVALHPATMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDTVVIALAD+TC+EPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTVVIALADETCDEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILPIDDTIEG+TGDLF+++LKPYFLEAYRPLRKGD+FLV
Sbjct  121  ILPIDDTIEGLTGDLFDAFLKPYFLEAYRPLRKGDNFLV  159



>ref|XP_004241286.1| PREDICTED: cell division cycle protein 48 homolog [Solanum lycopersicum]
Length=805

 Score =   277 bits (708),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 144/159 (91%), Positives = 157/159 (99%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M++QAESSDSK  KKDFSTAILERKK+PNRLVVDEAVNDDNSVVAL+PATMEKLQLFRGD
Sbjct  1    MTNQAESSDSKGAKKDFSTAILERKKSPNRLVVDEAVNDDNSVVALHPATMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDTVVIALAD+TC+EPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTVVIALADETCDEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILPIDDTIEG+TGDLF+++LKPYFLEAYRPLRKGD+FLV
Sbjct  121  ILPIDDTIEGLTGDLFDAFLKPYFLEAYRPLRKGDNFLV  159



>gb|KJB36551.1| hypothetical protein B456_006G164800 [Gossypium raimondii]
Length=594

 Score =   272 bits (696),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 143/159 (90%), Positives = 155/159 (97%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MS+QAESSDSK TKKDFSTAILERKKAPNRLVVDEA+NDDNSVVAL+P TMEKLQLFRGD
Sbjct  1    MSNQAESSDSKGTKKDFSTAILERKKAPNRLVVDEAINDDNSVVALHPDTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALADDTC+EPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALADDTCDEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPVDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>ref|XP_011089945.1| PREDICTED: cell division cycle protein 48 homolog [Sesamum indicum]
Length=806

 Score =   276 bits (707),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 144/159 (91%), Positives = 155/159 (97%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MSHQAESSDSKS KKDFSTAILERKKA NRL+VDEAVNDDNSVV+L+PATMEKLQLFRGD
Sbjct  1    MSHQAESSDSKSGKKDFSTAILERKKAANRLIVDEAVNDDNSVVSLHPATMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDTV IALAD+TCEEPKIRMNKVVR+NL+VRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTVCIALADETCEEPKIRMNKVVRSNLKVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP DDTIEG+TGDLF++YLKPYFLEAYRP+RKGDHFLV
Sbjct  121  ILPFDDTIEGLTGDLFDAYLKPYFLEAYRPVRKGDHFLV  159



>ref|XP_004251158.1| PREDICTED: cell division cycle protein 48 homolog [Solanum lycopersicum]
Length=805

 Score =   276 bits (707),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 144/159 (91%), Positives = 157/159 (99%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MSHQAESSDSK++KKDFSTAILERKKA NRL+VDE VNDDNSVVAL+PATMEKLQLFRGD
Sbjct  1    MSHQAESSDSKNSKKDFSTAILERKKAANRLIVDETVNDDNSVVALHPATMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDTVVIALAD+TC+EPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTVVIALADETCDEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILPIDDTIEG+TGDLF+++LKPYFLEAYRPLRKGD+FLV
Sbjct  121  ILPIDDTIEGLTGDLFDAFLKPYFLEAYRPLRKGDNFLV  159



>ref|XP_006340221.1| PREDICTED: cell division cycle protein 48 homolog [Solanum tuberosum]
Length=805

 Score =   276 bits (707),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 144/159 (91%), Positives = 156/159 (98%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MSHQAESSDSK+ KKDFSTAILERKKA NRL+VDE VNDDNSVVAL+PATMEKLQLFRGD
Sbjct  1    MSHQAESSDSKNAKKDFSTAILERKKAANRLIVDETVNDDNSVVALHPATMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDTVVIALAD+TC+EPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTVVIALADETCDEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILPIDDTIEG+TGDLF+++LKPYFLEAYRPLRKGD+FLV
Sbjct  121  ILPIDDTIEGLTGDLFDAFLKPYFLEAYRPLRKGDNFLV  159



>ref|XP_010241862.1| PREDICTED: cell division cycle protein 48 homolog, partial [Nelumbo 
nucifera]
Length=660

 Score =   272 bits (696),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 155/159 (97%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MS+QAESSDSK TK+DFSTAILERKK+PNRL+VDEAVNDDNSVV+LNP TMEKLQLFRGD
Sbjct  1    MSNQAESSDSKGTKRDFSTAILERKKSPNRLIVDEAVNDDNSVVSLNPETMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+L+KGKKR+DT+ IALADDTCEEPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILLKGKKRRDTICIALADDTCEEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPVDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>ref|XP_007027382.1| ATPase, AAA-type, CDC48 protein isoform 2 [Theobroma cacao]
 gb|EOY07884.1| ATPase, AAA-type, CDC48 protein isoform 2 [Theobroma cacao]
Length=638

 Score =   271 bits (693),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 141/159 (89%), Positives = 155/159 (97%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MS+QAESSDSK TK+DFSTAILERKKAPNRLVVDEA+NDDNSVV+L+P TMEKLQLFRGD
Sbjct  1    MSNQAESSDSKGTKRDFSTAILERKKAPNRLVVDEAINDDNSVVSLHPDTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALADDTC+EPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALADDTCDEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPVDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>ref|XP_008344880.1| PREDICTED: uncharacterized protein LOC103407783 [Malus domestica]
Length=452

 Score =   266 bits (679),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 147/159 (92%), Gaps = 2/159 (1%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M+HQAESSDSK        AILERKK+PNRLVVDEAVNDDNSVV+++P TMEKLQLFRGD
Sbjct  1    MAHQAESSDSKKKDFST--AILERKKSPNRLVVDEAVNDDNSVVSMHPETMEKLQLFRGD  58

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALADDTCEEP+IRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  59   TILIKGKKRKDTICIALADDTCEEPRIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  118

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILPIDD+IEGVTG+LF+++LKPYF EAYRP+RKGD FLV
Sbjct  119  ILPIDDSIEGVTGNLFDAFLKPYFXEAYRPVRKGDLFLV  157



>sp|Q96372.1|CDC48_CAPAN RecName: Full=Cell division cycle protein 48 homolog [Capsicum 
annuum]
 emb|CAA70565.1| protein of AAA family [Capsicum annuum]
Length=805

 Score =   274 bits (701),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 144/159 (91%), Positives = 156/159 (98%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M+ QAESSDSK+ KKDFSTAILERKKA NRLVVDEAVNDDNSVVAL+PATMEKLQLFRGD
Sbjct  1    MTDQAESSDSKNAKKDFSTAILERKKAANRLVVDEAVNDDNSVVALHPATMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDTVVIALAD+TC+EPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTVVIALADETCDEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILPIDDTIEG+TGDLF+++LKPYFLEAYRPLRKGD+FLV
Sbjct  121  ILPIDDTIEGLTGDLFDAFLKPYFLEAYRPLRKGDNFLV  159



>gb|KJB46512.1| hypothetical protein B456_007G373300 [Gossypium raimondii]
Length=590

 Score =   269 bits (688),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 139/159 (87%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MS+QAESSDSK TK+DFSTAILERKKAPNRLVVDEA+NDDNSVV+++P TMEKLQLFRGD
Sbjct  1    MSNQAESSDSKGTKRDFSTAILERKKAPNRLVVDEAINDDNSVVSMHPDTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALADDTC+EPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALADDTCDEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEGVTG LF++YLKPYFLEAYRP+RKGD FL 
Sbjct  121  ILPVDDTIEGVTGSLFDAYLKPYFLEAYRPVRKGDFFLA  159



>gb|KJB36552.1| hypothetical protein B456_006G164800 [Gossypium raimondii]
Length=750

 Score =   272 bits (696),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 143/159 (90%), Positives = 155/159 (97%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MS+QAESSDSK TKKDFSTAILERKKAPNRLVVDEA+NDDNSVVAL+P TMEKLQLFRGD
Sbjct  1    MSNQAESSDSKGTKKDFSTAILERKKAPNRLVVDEAINDDNSVVALHPDTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALADDTC+EPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALADDTCDEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPVDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>gb|KJB36554.1| hypothetical protein B456_006G164800 [Gossypium raimondii]
Length=803

 Score =   273 bits (697),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 143/159 (90%), Positives = 155/159 (97%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MS+QAESSDSK TKKDFSTAILERKKAPNRLVVDEA+NDDNSVVAL+P TMEKLQLFRGD
Sbjct  1    MSNQAESSDSKGTKKDFSTAILERKKAPNRLVVDEAINDDNSVVALHPDTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALADDTC+EPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALADDTCDEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPVDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>gb|KJB36550.1| hypothetical protein B456_006G164800 [Gossypium raimondii]
Length=805

 Score =   273 bits (697),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 143/159 (90%), Positives = 155/159 (97%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MS+QAESSDSK TKKDFSTAILERKKAPNRLVVDEA+NDDNSVVAL+P TMEKLQLFRGD
Sbjct  1    MSNQAESSDSKGTKKDFSTAILERKKAPNRLVVDEAINDDNSVVALHPDTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALADDTC+EPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALADDTCDEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPVDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>ref|XP_010241832.1| PREDICTED: cell division cycle protein 48 homolog [Nelumbo nucifera]
Length=807

 Score =   273 bits (697),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 155/159 (97%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MS+QAESSDSK TK+DFSTAILERKK+PNRL+VDEAVNDDNSVV+LNP TMEKLQLFRGD
Sbjct  1    MSNQAESSDSKGTKRDFSTAILERKKSPNRLIVDEAVNDDNSVVSLNPETMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+L+KGKKR+DT+ IALADDTCEEPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILLKGKKRRDTICIALADDTCEEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPVDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>ref|XP_011010444.1| PREDICTED: cell division cycle protein 48 homolog [Populus euphratica]
Length=802

 Score =   271 bits (694),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 142/159 (89%), Positives = 155/159 (97%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MS+QAESSDSK TK+DFSTAILERKKAPNRLVVDEAVNDDNSVV+L+P TMEKLQLFRGD
Sbjct  1    MSNQAESSDSKGTKRDFSTAILERKKAPNRLVVDEAVNDDNSVVSLHPETMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALADD+C+EPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALADDSCDEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILPIDDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPIDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>gb|AHA83580.1| cell division cycle protein 48 [Hevea brasiliensis]
Length=805

 Score =   271 bits (694),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 142/159 (89%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MS+QAESSDSK TK+DFSTAILERKKAPNRLVVDEA NDDNSVV+L+P TMEKLQLFRGD
Sbjct  1    MSNQAESSDSKGTKRDFSTAILERKKAPNRLVVDEATNDDNSVVSLHPDTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALADDTC+EPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALADDTCDEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILPIDDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPIDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>ref|XP_007027381.1| ATPase, AAA-type, CDC48 protein isoform 1 [Theobroma cacao]
 gb|EOY07883.1| ATPase, AAA-type, CDC48 protein isoform 1 [Theobroma cacao]
Length=805

 Score =   271 bits (694),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 141/159 (89%), Positives = 155/159 (97%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MS+QAESSDSK TK+DFSTAILERKKAPNRLVVDEA+NDDNSVV+L+P TMEKLQLFRGD
Sbjct  1    MSNQAESSDSKGTKRDFSTAILERKKAPNRLVVDEAINDDNSVVSLHPDTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALADDTC+EPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALADDTCDEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPVDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>gb|KJB62399.1| hypothetical protein B456_009G415000 [Gossypium raimondii]
Length=645

 Score =   268 bits (685),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MS+QAESSDSK  KKDFSTAILERKKA NRLVVDEA+NDDNSVV+L+P TMEKLQLFRGD
Sbjct  1    MSNQAESSDSKGAKKDFSTAILERKKAANRLVVDEAINDDNSVVSLHPDTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALADDTC+EPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALADDTCDEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPVDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>ref|XP_010558169.1| PREDICTED: cell division control protein 48 homolog E [Tarenaya 
hassleriana]
Length=808

 Score =   271 bits (694),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 152/159 (96%), Gaps = 1/159 (1%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MS+QAESSDSKS +   + AILERKKAPNRLVVDEAVNDDNSVV+L+PATMEKLQLFRGD
Sbjct  1    MSNQAESSDSKSKRDFST-AILERKKAPNRLVVDEAVNDDNSVVSLHPATMEKLQLFRGD  59

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDTV IALAD+TCEEPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  60   TILIKGKKRKDTVCIALADETCEEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  119

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILPIDDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  120  ILPIDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  158



>ref|XP_010553361.1| PREDICTED: cell division cycle protein 48 homolog [Tarenaya hassleriana]
Length=810

 Score =   271 bits (693),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 142/159 (89%), Positives = 155/159 (97%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M++QAESSDSK TK+DFSTAILERKKAPNRLVVDEA++DDNSVV+L+P TMEKLQLFRGD
Sbjct  1    MANQAESSDSKGTKRDFSTAILERKKAPNRLVVDEAISDDNSVVSLHPETMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            TVLIKGKKRKDTV IALADDTCEEPKIRMNKVVR+NLRVRLGDV+SVHQCPDVKYGKRVH
Sbjct  61   TVLIKGKKRKDTVCIALADDTCEEPKIRMNKVVRSNLRVRLGDVISVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILPIDDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPIDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>ref|XP_010543406.1| PREDICTED: cell division control protein 48 homolog E-like [Tarenaya 
hassleriana]
Length=809

 Score =   271 bits (693),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 152/159 (96%), Gaps = 1/159 (1%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MS+QAESSDSKS K   + AILERKKAPNRLVVDEAVNDDNSVV+L+PATMEKLQLFRGD
Sbjct  1    MSNQAESSDSKSKKDFST-AILERKKAPNRLVVDEAVNDDNSVVSLHPATMEKLQLFRGD  59

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDTV IALAD+TCEEPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  60   TILIKGKKRKDTVCIALADETCEEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  119

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILPIDDT+EGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  120  ILPIDDTVEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  158



>emb|CDP06763.1| unnamed protein product [Coffea canephora]
Length=805

 Score =   271 bits (692),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 155/159 (97%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MS+QAESSDSK TK+DFSTAILERKK+PNRLVVDEA+NDDNSVVAL+P TMEKLQLFRGD
Sbjct  1    MSNQAESSDSKGTKRDFSTAILERKKSPNRLVVDEAINDDNSVVALHPETMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKR+DT+ IALADDTC+EPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRRDTICIALADDTCDEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILPIDDT+EGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPIDDTVEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>gb|KJB15127.1| hypothetical protein B456_002G162100 [Gossypium raimondii]
Length=760

 Score =   270 bits (689),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MS QAESSDSK TK+DFSTAILERKKAPNR+VVDEA+NDDNSVV+L+P TMEKLQLFRGD
Sbjct  1    MSKQAESSDSKGTKRDFSTAILERKKAPNRVVVDEAINDDNSVVSLHPDTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALADDTC+EPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALADDTCDEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPVDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>gb|KHG10269.1| Cell division cycle 48 [Gossypium arboreum]
Length=805

 Score =   270 bits (691),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 139/159 (87%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MS+QAESSDSK TK+DFSTAILERKKAPNRLVVDEA+NDDNSVV+++P TMEKLQLFRGD
Sbjct  1    MSNQAESSDSKGTKRDFSTAILERKKAPNRLVVDEAINDDNSVVSMHPDTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALADDTC+EPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALADDTCDEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FL 
Sbjct  121  ILPVDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDFFLA  159



>ref|XP_002323472.1| Cell division cycle protein 48 [Populus trichocarpa]
 gb|EEF05233.1| Cell division cycle protein 48 [Populus trichocarpa]
Length=802

 Score =   270 bits (691),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 155/159 (97%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MS+QAESSDSK TK+DFSTAILERKK+PNRLVVDEA+NDDNSVV+L+P TMEKLQLFRGD
Sbjct  1    MSNQAESSDSKGTKRDFSTAILERKKSPNRLVVDEAINDDNSVVSLHPETMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALADD+C+EPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALADDSCDEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILPIDDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPIDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>gb|KJB46511.1| hypothetical protein B456_007G373300 [Gossypium raimondii]
Length=805

 Score =   270 bits (690),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 139/159 (87%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MS+QAESSDSK TK+DFSTAILERKKAPNRLVVDEA+NDDNSVV+++P TMEKLQLFRGD
Sbjct  1    MSNQAESSDSKGTKRDFSTAILERKKAPNRLVVDEAINDDNSVVSMHPDTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALADDTC+EPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALADDTCDEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEGVTG LF++YLKPYFLEAYRP+RKGD FL 
Sbjct  121  ILPVDDTIEGVTGSLFDAYLKPYFLEAYRPVRKGDFFLA  159



>ref|XP_002519500.1| Transitional endoplasmic reticulum ATPase, putative [Ricinus 
communis]
 gb|EEF42914.1| Transitional endoplasmic reticulum ATPase, putative [Ricinus 
communis]
Length=806

 Score =   270 bits (690),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 155/159 (97%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MS+QAESSDSK TK+DFSTAILERKK+PNRLVVDEA+NDDNSVV+L+P TMEKLQLFRGD
Sbjct  1    MSNQAESSDSKGTKRDFSTAILERKKSPNRLVVDEAINDDNSVVSLHPETMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALADD+C+EPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALADDSCDEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILPIDDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPIDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>ref|XP_010107503.1| Cell division cycle protein 48-like protein [Morus notabilis]
 gb|EXC16185.1| Cell division cycle protein 48-like protein [Morus notabilis]
Length=791

 Score =   270 bits (689),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 142/159 (89%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MS+QAESSDSK TK+DFSTAILERKKA NRLVVDEAVNDDNSVV+L+P TMEKLQLFRGD
Sbjct  1    MSNQAESSDSKGTKRDFSTAILERKKAANRLVVDEAVNDDNSVVSLHPETMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALADDTC+EPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALADDTCDEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILPIDDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPIDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>gb|EPS65359.1| hypothetical protein M569_09417, partial [Genlisea aurea]
Length=767

 Score =   269 bits (688),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 128/140 (91%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKKA NRL+VDEAVNDDNSVV+L+P TMEKLQLFRGDT+LIKGKKRKDTV IALAD
Sbjct  2    AILERKKAANRLIVDEAVNDDNSVVSLHPTTMEKLQLFRGDTILIKGKKRKDTVCIALAD  61

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            D CEEPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVHILP DDTIEG+TGDLFESY
Sbjct  62   DKCEEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVHILPFDDTIEGLTGDLFESY  121

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGDHFLV
Sbjct  122  LKPYFLEAYRPVRKGDHFLV  141



>ref|XP_002282146.1| PREDICTED: cell division cycle protein 48 homolog [Vitis vinifera]
 emb|CBI32765.3| unnamed protein product [Vitis vinifera]
Length=806

 Score =   270 bits (690),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 142/159 (89%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MS+QAESSDSK TK+DFSTAILERKKA NRLVVDEAVNDDNSVVAL+P TMEKLQLFRGD
Sbjct  1    MSNQAESSDSKGTKRDFSTAILERKKAANRLVVDEAVNDDNSVVALHPDTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALADDTC+EPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALADDTCDEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPVDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>gb|KJB15126.1| hypothetical protein B456_002G162100 [Gossypium raimondii]
Length=805

 Score =   270 bits (689),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MS QAESSDSK TK+DFSTAILERKKAPNR+VVDEA+NDDNSVV+L+P TMEKLQLFRGD
Sbjct  1    MSKQAESSDSKGTKRDFSTAILERKKAPNRVVVDEAINDDNSVVSLHPDTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALADDTC+EPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALADDTCDEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPVDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>gb|KDP29157.1| hypothetical protein JCGZ_16546 [Jatropha curcas]
Length=805

 Score =   270 bits (689),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 141/159 (89%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MS+QAESSDSK TK+DFSTAILERKKAPNRLVVDEA NDDNSVV+L+P TMEKLQLFRGD
Sbjct  1    MSNQAESSDSKGTKRDFSTAILERKKAPNRLVVDEATNDDNSVVSLHPDTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALAD+TC+EPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALADETCDEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILPIDDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPIDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>ref|XP_009376080.1| PREDICTED: uncharacterized protein LOC103964821 isoform X2 [Pyrus 
x bretschneideri]
Length=449

 Score =   261 bits (667),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 145/159 (91%), Gaps = 2/159 (1%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M+HQAESSD K        AILERKK+PN LVVDEAV+DDNSVVA++P TMEKLQ+FRGD
Sbjct  1    MAHQAESSDWKKEDLWT--AILERKKSPNLLVVDEAVSDDNSVVAMHPETMEKLQIFRGD  58

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALADDTCEEP+IRMNKVVR+NLRVRLGDVVSVHQCPDVKYG RVH
Sbjct  59   TILIKGKKRKDTICIALADDTCEEPRIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGNRVH  118

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILPIDD+IEGVTG+LF+++LKPYFLEAYRP+RKGD FLV
Sbjct  119  ILPIDDSIEGVTGNLFDAFLKPYFLEAYRPVRKGDLFLV  157



>ref|XP_009376079.1| PREDICTED: uncharacterized protein LOC103964821 isoform X1 [Pyrus 
x bretschneideri]
Length=450

 Score =   261 bits (667),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 145/159 (91%), Gaps = 2/159 (1%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M+HQAESSD K        AILERKK+PN LVVDEAV+DDNSVVA++P TMEKLQ+FRGD
Sbjct  1    MAHQAESSDWKKEDLWT--AILERKKSPNLLVVDEAVSDDNSVVAMHPETMEKLQIFRGD  58

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALADDTCEEP+IRMNKVVR+NLRVRLGDVVSVHQCPDVKYG RVH
Sbjct  59   TILIKGKKRKDTICIALADDTCEEPRIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGNRVH  118

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILPIDD+IEGVTG+LF+++LKPYFLEAYRP+RKGD FLV
Sbjct  119  ILPIDDSIEGVTGNLFDAFLKPYFLEAYRPVRKGDLFLV  157



>gb|KHG03955.1| Cell division cycle 48 [Gossypium arboreum]
Length=805

 Score =   270 bits (689),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 141/159 (89%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MS QAE SDSK TKKDFSTAILERKKAPNRLVVDEA+NDDNSVVAL+P TMEKLQLFRGD
Sbjct  1    MSSQAEPSDSKGTKKDFSTAILERKKAPNRLVVDEAINDDNSVVALHPDTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALADD C+EPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALADDACDEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPVDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>ref|XP_010426961.1| PREDICTED: cell division control protein 48 homolog D-like, partial 
[Camelina sativa]
Length=620

 Score =   266 bits (679),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M+++AESSDSK TKKDFSTAILERKKA NRLVVDEA+NDDNSVV L+PATMEKLQLFRGD
Sbjct  1    MANEAESSDSKGTKKDFSTAILERKKAANRLVVDEAINDDNSVVCLHPATMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            TVLIKGKKRKDTV IALADDTCEEPKIRMNKVVR+NLRVRL DV SVHQCPDVKYGKRVH
Sbjct  61   TVLIKGKKRKDTVCIALADDTCEEPKIRMNKVVRSNLRVRLADVTSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEGV+G+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPVDDTIEGVSGNLFDAYLKPYFLEAYRPVRKGDFFLV  159



>gb|EYU18799.1| hypothetical protein MIMGU_mgv1a001503mg [Erythranthe guttata]
Length=807

 Score =   269 bits (688),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 142/159 (89%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MS+Q ESSD K  KKDFSTAILERKKA NRLVVDEAVNDDNSVVA++PATMEKLQLFRGD
Sbjct  1    MSNQPESSDPKGGKKDFSTAILERKKAANRLVVDEAVNDDNSVVAIHPATMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDTV IALAD+TCEE KIRMNKVVR NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTVCIALADETCEEAKIRMNKVVRTNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEG+TGDLF+ YLKPYFLEAYRPLRKGDHFLV
Sbjct  121  ILPLDDTIEGLTGDLFDVYLKPYFLEAYRPLRKGDHFLV  159



>gb|AFW89667.1| hypothetical protein ZEAMMB73_027527 [Zea mays]
Length=403

 Score =   259 bits (662),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/140 (88%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA NDDNSVVAL+P TME+LQLFRGDTVLIKGKKRKDTV I LAD
Sbjct  21   AILERKKSPNRLVVDEATNDDNSVVALHPDTMERLQLFRGDTVLIKGKKRKDTVCIVLAD  80

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            +TCEEPK+RMNK+VR NLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEG+TG+LF+++
Sbjct  81   ETCEEPKVRMNKIVRKNLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGITGNLFDAF  140

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRPLRKGD FLV
Sbjct  141  LKPYFLEAYRPLRKGDLFLV  160



>ref|XP_010553004.1| PREDICTED: cell division control protein 48 homolog E [Tarenaya 
hassleriana]
Length=808

 Score =   269 bits (687),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 151/159 (95%), Gaps = 1/159 (1%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MS+QAESS+SKS K   + AILERKKAPNRLVVDEAVNDDNSVV+L+P TMEKLQ+FRGD
Sbjct  1    MSNQAESSESKSKKDFST-AILERKKAPNRLVVDEAVNDDNSVVSLHPTTMEKLQIFRGD  59

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALAD+TCEEPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  60   TILIKGKKRKDTICIALADETCEEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  119

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILPIDDT+EGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  120  ILPIDDTVEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  158



>ref|XP_010253965.1| PREDICTED: cell division cycle protein 48 homolog [Nelumbo nucifera]
Length=805

 Score =   269 bits (687),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MS+QAESSDSK TK+DFSTAILERKKAPNRLVVDEA NDDNSVV+++P TMEKLQLFRGD
Sbjct  1    MSNQAESSDSKGTKRDFSTAILERKKAPNRLVVDEATNDDNSVVSMHPETMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKR+DT+ IALADDTC+EPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRRDTICIALADDTCDEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEGVTG+LF++YLKPYFLEAYRP+RKGD F+V
Sbjct  121  ILPVDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFIV  159



>ref|XP_009761319.1| PREDICTED: cell division cycle protein 48 homolog [Nicotiana 
sylvestris]
Length=806

 Score =   269 bits (687),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MS++AESSDSK TK+D+STAILERKK+PNRLVVDEAVNDDNSVV+L+P TMEKLQLFRGD
Sbjct  1    MSNKAESSDSKGTKRDYSTAILERKKSPNRLVVDEAVNDDNSVVSLHPETMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALADDTC+EPKIRMNKVVR NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALADDTCDEPKIRMNKVVRNNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILPIDDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPIDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>gb|KJB62400.1| hypothetical protein B456_009G415000 [Gossypium raimondii]
Length=803

 Score =   268 bits (686),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MS+QAESSDSK  KKDFSTAILERKKA NRLVVDEA+NDDNSVV+L+P TMEKLQLFRGD
Sbjct  1    MSNQAESSDSKGAKKDFSTAILERKKAANRLVVDEAINDDNSVVSLHPDTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALADDTC+EPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALADDTCDEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPVDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>ref|XP_004497529.1| PREDICTED: cell division cycle protein 48 homolog [Cicer arietinum]
Length=808

 Score =   268 bits (686),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M++Q E+SDSK TK+DFSTAILERKKAPNRLVVDEAVNDDNSVVAL+P TMEKLQLFRGD
Sbjct  1    MANQPETSDSKGTKRDFSTAILERKKAPNRLVVDEAVNDDNSVVALHPDTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALAD+TCEEPKIRMNKVVR NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALADETCEEPKIRMNKVVRNNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPVDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>ref|XP_003538151.1| PREDICTED: cell division cycle protein 48 homolog [Glycine max]
Length=806

 Score =   268 bits (686),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 142/159 (89%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MSHQAESSDSKS KKDFSTAILERKK+PNRLVVDEAVNDDNSVVA++P T+EKLQLFRGD
Sbjct  1    MSHQAESSDSKSWKKDFSTAILERKKSPNRLVVDEAVNDDNSVVAMHPQTLEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDTV IALADD CEE KIRMNKVVR+NLRVRLGDVVSVH CPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTVCIALADDNCEESKIRMNKVVRSNLRVRLGDVVSVHACPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILPIDDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPIDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>gb|KEH42206.1| ATPase, AAA-type, CDC48 protein [Medicago truncatula]
Length=810

 Score =   268 bits (686),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M++Q ESSDSK TK+DFSTAILERKK+PNRLVVDEAVNDDNSVVAL+P TMEKLQLFRGD
Sbjct  1    MANQPESSDSKGTKRDFSTAILERKKSPNRLVVDEAVNDDNSVVALHPDTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALAD+TCEEPKIRMNKVVR NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALADETCEEPKIRMNKVVRNNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPVDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDMFLV  159



>gb|KHG08181.1| Cell division cycle 48 [Gossypium arboreum]
Length=805

 Score =   268 bits (686),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MS+QAESSDSK TK+DFSTAILERKKAPNRLVVDEA+NDDNSVV+L+  TMEKLQLFRGD
Sbjct  1    MSNQAESSDSKGTKRDFSTAILERKKAPNRLVVDEAINDDNSVVSLHSDTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALADDTC+EPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALADDTCDEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPVDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>gb|KJB62398.1| hypothetical protein B456_009G415000 [Gossypium raimondii]
Length=805

 Score =   268 bits (685),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MS+QAESSDSK  KKDFSTAILERKKA NRLVVDEA+NDDNSVV+L+P TMEKLQLFRGD
Sbjct  1    MSNQAESSDSKGAKKDFSTAILERKKAANRLVVDEAINDDNSVVSLHPDTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALADDTC+EPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALADDTCDEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPVDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>gb|KHG13688.1| Cell division cycle 48 [Gossypium arboreum]
Length=805

 Score =   268 bits (685),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MS+QAESSDSK  KKDFSTAILERKKA NRLVVDEA+NDDNSVV+L+P TMEKLQLFRGD
Sbjct  1    MSNQAESSDSKGAKKDFSTAILERKKAANRLVVDEAINDDNSVVSLHPDTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALADDTC+EPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALADDTCDEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPVDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>gb|KHN38724.1| Cell division cycle protein 48 like [Glycine soja]
Length=806

 Score =   268 bits (685),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 142/159 (89%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MSHQAESSDSKS KKDFSTAILERKK+PNRLVVDEAVNDDNSVVA++P T+EKLQLFRGD
Sbjct  1    MSHQAESSDSKSWKKDFSTAILERKKSPNRLVVDEAVNDDNSVVAMHPQTLEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDTV IALADD CEE KIRMNKVVR+NLRVRLGDVVSVH CPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTVCIALADDNCEESKIRMNKVVRSNLRVRLGDVVSVHACPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILPIDDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPIDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>ref|XP_006381424.1| Cell division cycle protein 48 [Populus trichocarpa]
 gb|ERP59221.1| Cell division cycle protein 48 [Populus trichocarpa]
Length=807

 Score =   268 bits (685),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 135/161 (84%), Positives = 148/161 (92%), Gaps = 2/161 (1%)
 Frame = +1

Query  73   MSHQAEssdskstkkdf--stAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFR  246
            MS+QAE+  S S       STAILERKKAPNRLVVDEAVNDDNSVV+L+P TMEKLQLFR
Sbjct  1    MSNQAEAESSDSKGTKRDFSTAILERKKAPNRLVVDEAVNDDNSVVSLHPETMEKLQLFR  60

Query  247  GDTVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKR  426
            GDT+LIKGKKRKDT+ IALADD+C+EPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKR
Sbjct  61   GDTILIKGKKRKDTICIALADDSCDEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKR  120

Query  427  VHILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            VHILPIDDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  VHILPIDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  161



>ref|XP_003521403.1| PREDICTED: cell division cycle protein 48 homolog [Glycine max]
Length=808

 Score =   268 bits (685),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M+ Q ESSD+K TK+DFSTAILERKKAPNRLVVDEAVNDDNSVVAL+P TMEKLQLFRGD
Sbjct  1    MASQPESSDAKGTKRDFSTAILERKKAPNRLVVDEAVNDDNSVVALHPDTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALAD+TCEEPKIRMNKVVR NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALADETCEEPKIRMNKVVRNNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPVDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>ref|XP_009627589.1| PREDICTED: cell division cycle protein 48 homolog [Nicotiana 
tomentosiformis]
Length=806

 Score =   268 bits (685),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 139/159 (87%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MS++AESSDSK TK+D+STAILERKK+PNRLVVDEAVNDDNSVV+L+P TMEKLQLFRGD
Sbjct  1    MSNKAESSDSKGTKRDYSTAILERKKSPNRLVVDEAVNDDNSVVSLHPETMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALADDTC+EP+IRMNKVVR NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALADDTCDEPRIRMNKVVRNNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILPIDDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPIDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>ref|XP_009628175.1| PREDICTED: cell division cycle protein 48 homolog [Nicotiana 
tomentosiformis]
 gb|ABF59516.1| putative spindle disassembly related protein CDC48 [Nicotiana 
tabacum]
Length=808

 Score =   268 bits (685),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 139/159 (87%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M+++AESSDSK TK+D+STAILERKK+PNRLVVDEA+NDDNSVVAL+P TMEKLQLFRGD
Sbjct  1    MTNKAESSDSKGTKRDYSTAILERKKSPNRLVVDEAINDDNSVVALHPDTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALADDTC+EPKIRMNKVVR NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALADDTCDEPKIRMNKVVRNNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILPIDDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPIDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>ref|XP_004137832.1| PREDICTED: cell division cycle protein 48 homolog [Cucumis sativus]
 ref|XP_004169829.1| PREDICTED: cell division cycle protein 48 homolog [Cucumis sativus]
 gb|KGN58971.1| hypothetical protein Csa_3G740140 [Cucumis sativus]
Length=804

 Score =   268 bits (684),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M++Q ESSDSK TK+DFSTAILERKKAPNRLVVDEA+NDDNSVVAL+P TMEKLQLFRGD
Sbjct  1    MANQPESSDSKGTKRDFSTAILERKKAPNRLVVDEAINDDNSVVALHPDTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALADDTC+EPKIRMNKVVR+NLRVRLGDVVSVHQC DVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALADDTCDEPKIRMNKVVRSNLRVRLGDVVSVHQCADVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEGVTG+LF++YLKPYFLEAYRPLRKGD FLV
Sbjct  121  ILPVDDTIEGVTGNLFDAYLKPYFLEAYRPLRKGDLFLV  159



>ref|XP_008442694.1| PREDICTED: cell division control protein 48 homolog E [Cucumis 
melo]
Length=804

 Score =   268 bits (684),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M++Q ESSDSK TK+DFSTAILERKKAPNRLVVDEA+NDDNSVVAL+P TMEKLQLFRGD
Sbjct  1    MANQPESSDSKGTKRDFSTAILERKKAPNRLVVDEAINDDNSVVALHPDTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALADDTC+EPKIRMNKVVR+NLRVRLGDVVSVHQC DVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALADDTCDEPKIRMNKVVRSNLRVRLGDVVSVHQCADVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEGVTG+LF++YLKPYFLEAYRPLRKGD FLV
Sbjct  121  ILPVDDTIEGVTGNLFDAYLKPYFLEAYRPLRKGDLFLV  159



>ref|XP_010477783.1| PREDICTED: cell division control protein 48 homolog A isoform 
X3 [Camelina sativa]
Length=713

 Score =   266 bits (679),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 124/140 (89%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA+NDDNSVV+L+PATMEKLQLFRGDT+LIKGKKRKDTV IALAD
Sbjct  19   AILERKKSPNRLVVDEAINDDNSVVSLHPATMEKLQLFRGDTILIKGKKRKDTVCIALAD  78

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            +TCEEPKIRMNKVVR+NLRVRLGDV+SVHQCPDVKYGKRVHILP+DDT+EGVTG+LF++Y
Sbjct  79   ETCEEPKIRMNKVVRSNLRVRLGDVISVHQCPDVKYGKRVHILPVDDTVEGVTGNLFDAY  138

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FLV
Sbjct  139  LKPYFLEAYRPVRKGDLFLV  158



>ref|XP_011094628.1| PREDICTED: cell division cycle protein 48 homolog [Sesamum indicum]
Length=806

 Score =   267 bits (683),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MS+QAESSD+K TK+DFSTAILERKKAPNRLVVDEAVNDDNSVV L+P TMEKLQLFRGD
Sbjct  1    MSNQAESSDAKGTKRDFSTAILERKKAPNRLVVDEAVNDDNSVVCLHPETMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDTV IALADDTC+EPKIRMNKVVR NLRVRLGDVVSVHQC DVKYGKRVH
Sbjct  61   TILIKGKKRKDTVCIALADDTCDEPKIRMNKVVRNNLRVRLGDVVSVHQCADVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDT+EGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPVDDTVEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>gb|ACN31280.1| unknown [Zea mays]
Length=289

 Score =   254 bits (648),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA NDDNSVVAL+P TME+LQLFRGDTVL+KGKKRKDT+ I LAD
Sbjct  23   AILERKKSPNRLVVDEATNDDNSVVALHPDTMERLQLFRGDTVLLKGKKRKDTICIVLAD  82

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            +TCEEPK+RMNKVVR NLRVRLGDVVSVHQC DVKYGKRVHILPIDDT+EG+TG+LF+++
Sbjct  83   ETCEEPKVRMNKVVRQNLRVRLGDVVSVHQCQDVKYGKRVHILPIDDTVEGITGNLFDAF  142

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRPLRKGD FLV
Sbjct  143  LKPYFLEAYRPLRKGDLFLV  162



>ref|XP_009376083.1| PREDICTED: cell division cycle protein 48 homolog [Pyrus x bretschneideri]
Length=804

 Score =   267 bits (683),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 148/159 (93%), Gaps = 2/159 (1%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M+HQAESSDSK        AILERKK+PNRLVVDEAVNDDNSVV+++P TMEKLQLFRGD
Sbjct  1    MAHQAESSDSKKKDFST--AILERKKSPNRLVVDEAVNDDNSVVSMHPETMEKLQLFRGD  58

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALADDTCEEP+IRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  59   TILIKGKKRKDTICIALADDTCEEPRIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  118

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILPIDD+IEGVTG+LF+++LKPYFLEAYRP+RKGD FLV
Sbjct  119  ILPIDDSIEGVTGNLFDAFLKPYFLEAYRPVRKGDLFLV  157



>ref|XP_008359586.1| PREDICTED: cell division cycle protein 48 homolog [Malus domestica]
Length=804

 Score =   266 bits (681),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 148/159 (93%), Gaps = 2/159 (1%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M+HQAESSDSK        AILERKK+PNRLVVDEAVNDDNSVV+++P TMEKLQLFRGD
Sbjct  1    MAHQAESSDSKKKDFST--AILERKKSPNRLVVDEAVNDDNSVVSMHPETMEKLQLFRGD  58

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALADDTCEEP+IRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  59   TILIKGKKRKDTICIALADDTCEEPRIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  118

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILPIDD+IEGVTG+LF+++LKPYFLEAYRP+RKGD FLV
Sbjct  119  ILPIDDSIEGVTGNLFDAFLKPYFLEAYRPVRKGDLFLV  157



>ref|XP_006833149.1| hypothetical protein AMTR_s00072p00117380 [Amborella trichopoda]
 gb|ERM98427.1| hypothetical protein AMTR_s00072p00117380 [Amborella trichopoda]
Length=808

 Score =   266 bits (681),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M+HQAESSDSK TK+DFSTAILERKKA NRL+VDEA+NDDNSVV+++P TMEKLQLFRGD
Sbjct  1    MAHQAESSDSKGTKRDFSTAILERKKAANRLIVDEAINDDNSVVSMHPDTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKR+DT+ IALAD+TC+EPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRRDTICIALADETCDEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILPIDDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPIDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>ref|XP_010477638.1| PREDICTED: cell division control protein 48 homolog A isoform 
X1 [Camelina sativa]
 ref|XP_010477713.1| PREDICTED: cell division control protein 48 homolog A isoform 
X2 [Camelina sativa]
 ref|XP_010477853.1| PREDICTED: cell division control protein 48 homolog A isoform 
X4 [Camelina sativa]
Length=809

 Score =   266 bits (681),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/140 (89%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA+NDDNSVV+L+PATMEKLQLFRGDT+LIKGKKRKDTV IALAD
Sbjct  19   AILERKKSPNRLVVDEAINDDNSVVSLHPATMEKLQLFRGDTILIKGKKRKDTVCIALAD  78

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            +TCEEPKIRMNKVVR+NLRVRLGDV+SVHQCPDVKYGKRVHILP+DDT+EGVTG+LF++Y
Sbjct  79   ETCEEPKIRMNKVVRSNLRVRLGDVISVHQCPDVKYGKRVHILPVDDTVEGVTGNLFDAY  138

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FLV
Sbjct  139  LKPYFLEAYRPVRKGDLFLV  158



>ref|XP_010486558.1| PREDICTED: cell division control protein 48 homolog A-like [Camelina 
sativa]
Length=809

 Score =   266 bits (681),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/140 (89%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA+NDDNSVV+L+PATMEKLQLFRGDT+LIKGKKRKDTV IALAD
Sbjct  19   AILERKKSPNRLVVDEAINDDNSVVSLHPATMEKLQLFRGDTILIKGKKRKDTVCIALAD  78

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            +TCEEPKIRMNKVVR+NLRVRLGDV+SVHQCPDVKYGKRVHILP+DDT+EGVTG+LF++Y
Sbjct  79   ETCEEPKIRMNKVVRSNLRVRLGDVISVHQCPDVKYGKRVHILPVDDTVEGVTGNLFDAY  138

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FLV
Sbjct  139  LKPYFLEAYRPVRKGDLFLV  158



>ref|NP_187595.1| cell division control protein 48-A [Arabidopsis thaliana]
 sp|P54609.1|CD48A_ARATH RecName: Full=Cell division control protein 48 homolog A; Short=AtCDC48a 
[Arabidopsis thaliana]
 gb|AAF23260.1|AC015985_18 putative transitional endoplasmic reticulum ATPase [Arabidopsis 
thaliana]
 gb|AAC49120.1| cell division cycle protein [Arabidopsis thaliana]
 gb|AAL38252.1| putative transitional endoplasmic reticulum ATPase [Arabidopsis 
thaliana]
 gb|AAM19807.1| AT3g09840/F8A24_11 [Arabidopsis thaliana]
 gb|ABG89127.1| CDC48a [synthetic construct]
 dbj|BAH20422.1| AT3G09840 [Arabidopsis thaliana]
 gb|AEE74820.1| cell division control protein 48-A [Arabidopsis thaliana]
Length=809

 Score =   266 bits (681),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/140 (89%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA+NDDNSVV+L+PATMEKLQLFRGDT+LIKGKKRKDTV IALAD
Sbjct  19   AILERKKSPNRLVVDEAINDDNSVVSLHPATMEKLQLFRGDTILIKGKKRKDTVCIALAD  78

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            +TCEEPKIRMNKVVR+NLRVRLGDV+SVHQCPDVKYGKRVHILP+DDT+EGVTG+LF++Y
Sbjct  79   ETCEEPKIRMNKVVRSNLRVRLGDVISVHQCPDVKYGKRVHILPVDDTVEGVTGNLFDAY  138

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FLV
Sbjct  139  LKPYFLEAYRPVRKGDLFLV  158



>ref|XP_010464643.1| PREDICTED: cell division control protein 48 homolog A-like isoform 
X1 [Camelina sativa]
 ref|XP_010464644.1| PREDICTED: cell division control protein 48 homolog A-like isoform 
X2 [Camelina sativa]
 ref|XP_010464645.1| PREDICTED: cell division control protein 48 homolog A-like isoform 
X3 [Camelina sativa]
Length=809

 Score =   266 bits (681),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/140 (89%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA+NDDNSVV+L+PATMEKLQLFRGDT+LIKGKKRKDTV IALAD
Sbjct  19   AILERKKSPNRLVVDEAINDDNSVVSLHPATMEKLQLFRGDTILIKGKKRKDTVCIALAD  78

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            +TCEEPKIRMNKVVR+NLRVRLGDV+SVHQCPDVKYGKRVHILP+DDT+EGVTG+LF++Y
Sbjct  79   ETCEEPKIRMNKVVRSNLRVRLGDVISVHQCPDVKYGKRVHILPVDDTVEGVTGNLFDAY  138

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FLV
Sbjct  139  LKPYFLEAYRPVRKGDLFLV  158



>ref|XP_010687252.1| PREDICTED: cell division cycle protein 48 homolog [Beta vulgaris 
subsp. vulgaris]
Length=804

 Score =   266 bits (680),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 126/140 (90%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEAVNDDNSVV+++P TMEKLQLFRGDTVL+KGKKRKDT+ IALAD
Sbjct  19   AILERKKSPNRLVVDEAVNDDNSVVSMHPDTMEKLQLFRGDTVLVKGKKRKDTICIALAD  78

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            +TCEEPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTG+LF++Y
Sbjct  79   ETCEEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGNLFDAY  138

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRPLRKGD FLV
Sbjct  139  LKPYFLEAYRPLRKGDLFLV  158



>ref|XP_004493989.1| PREDICTED: cell division control protein 48 homolog D-like isoform 
X2 [Cicer arietinum]
Length=809

 Score =   266 bits (680),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 139/159 (87%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M++Q ESSD+K TK+DFSTAILERKKAPNRLVVDEAVNDDNSVVAL+P TMEKLQLFRGD
Sbjct  1    MANQPESSDAKGTKRDFSTAILERKKAPNRLVVDEAVNDDNSVVALHPDTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALAD+TCEEPKIRMNKVVR NLRVRLGDVVSVHQC DVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALADETCEEPKIRMNKVVRNNLRVRLGDVVSVHQCADVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPVDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDFFLV  159



>ref|XP_006292238.1| hypothetical protein CARUB_v10018445mg [Capsella rubella]
 gb|EOA25136.1| hypothetical protein CARUB_v10018445mg [Capsella rubella]
Length=800

 Score =   266 bits (680),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 141/159 (89%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M+ QAESSDSK TKKDFST ILERKKA NRLVVDEA+NDDNSVV+L+P TMEKLQLFRGD
Sbjct  1    MADQAESSDSKGTKKDFSTKILERKKAANRLVVDEAINDDNSVVSLHPETMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            TVLIKGKKRKDTV IALADDTC+EPKIRMNKVVR+NLRVRLGDV+SVHQCPDVKYGKRVH
Sbjct  61   TVLIKGKKRKDTVCIALADDTCDEPKIRMNKVVRSNLRVRLGDVISVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILPIDDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPIDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>ref|XP_002876195.1| hypothetical protein ARALYDRAFT_485698 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52454.1| hypothetical protein ARALYDRAFT_485698 [Arabidopsis lyrata subsp. 
lyrata]
Length=810

 Score =   266 bits (680),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 139/159 (87%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M++QAESSDSK TK+DFSTAILERKKA NRLVVDEA+NDDNSVV+L+P TMEKLQLFRGD
Sbjct  1    MANQAESSDSKGTKRDFSTAILERKKAANRLVVDEAINDDNSVVSLHPETMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            TVLIKGKKRKDTV IALADDTC+EPKIRMNKVVR+NLRVRLGDV+SVHQCPDVKYGKRVH
Sbjct  61   TVLIKGKKRKDTVCIALADDTCDEPKIRMNKVVRSNLRVRLGDVISVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILPIDDTIEGV+G++F++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPIDDTIEGVSGNIFDAYLKPYFLEAYRPVRKGDLFLV  159



>ref|XP_010426959.1| PREDICTED: cell division control protein 48 homolog D-like [Camelina 
sativa]
Length=810

 Score =   266 bits (680),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M+++AESSDSK TKKDFSTAILERKKA NRLVVDEA+NDDNSVV L+PATMEKLQLFRGD
Sbjct  1    MANEAESSDSKGTKKDFSTAILERKKAANRLVVDEAINDDNSVVCLHPATMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            TVLIKGKKRKDTV IALADDTCEEPKIRMNKVVR+NLRVRL DV SVHQCPDVKYGKRVH
Sbjct  61   TVLIKGKKRKDTVCIALADDTCEEPKIRMNKVVRSNLRVRLADVTSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEGV+G+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPVDDTIEGVSGNLFDAYLKPYFLEAYRPVRKGDFFLV  159



>ref|XP_006493028.1| PREDICTED: cell division cycle protein 48 homolog [Citrus sinensis]
Length=807

 Score =   266 bits (680),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 139/159 (87%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MS+QAESSD+K TK+DFSTAILERKKAPNRLVVDEA+NDDNSVV L+P TMEKLQ FRGD
Sbjct  1    MSNQAESSDAKGTKRDFSTAILERKKAPNRLVVDEAINDDNSVVVLHPDTMEKLQFFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDTV IALADDTCEEPKIRMNKVVR+NLRVRLGDVVSVHQC DVKYGKRVH
Sbjct  61   TILIKGKKRKDTVCIALADDTCEEPKIRMNKVVRSNLRVRLGDVVSVHQCADVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEGVTG+LF++YLKPYF EAYRP+RKGD FLV
Sbjct  121  ILPVDDTIEGVTGNLFDAYLKPYFTEAYRPVRKGDLFLV  159



>ref|XP_010687253.1| PREDICTED: cell division cycle protein 48 homolog [Beta vulgaris 
subsp. vulgaris]
Length=803

 Score =   266 bits (679),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/140 (90%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEAVNDDNSVV+++P TMEKLQLFRGDTVL+KGKKRKDT+ IALAD
Sbjct  19   AILERKKSPNRLVVDEAVNDDNSVVSMHPDTMEKLQLFRGDTVLVKGKKRKDTICIALAD  78

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            +TCEEPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTG+LF++Y
Sbjct  79   ETCEEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGNLFDAY  138

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRPLRKGD FLV
Sbjct  139  LKPYFLEAYRPLRKGDLFLV  158



>gb|KDP43995.1| hypothetical protein JCGZ_05462 [Jatropha curcas]
Length=805

 Score =   266 bits (679),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MS Q ESSDSKS KKDFSTAILERKK+PNRLVVDEA+NDDNSVV++NP TMEKLQLFRGD
Sbjct  1    MSQQPESSDSKSGKKDFSTAILERKKSPNRLVVDEAINDDNSVVSMNPETMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ I LAD++CE PKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIVLADESCEAPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILPIDDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPIDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>gb|KHN06869.1| Cell division cycle protein 48 like [Glycine soja]
Length=807

 Score =   266 bits (679),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MS Q ESSD KS KKDFSTAILERKK+PNRLVVDEAVNDDNSVV ++P TMEKLQLFRGD
Sbjct  1    MSQQGESSDPKSGKKDFSTAILERKKSPNRLVVDEAVNDDNSVVTMHPQTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALAD+ CEEPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALADENCEEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILPIDDTIEGVTG+LF+++LKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPIDDTIEGVTGNLFDAFLKPYFLEAYRPVRKGDLFLV  159



>ref|XP_006428410.1| hypothetical protein CICLE_v10011046mg [Citrus clementina]
 gb|ESR41650.1| hypothetical protein CICLE_v10011046mg [Citrus clementina]
Length=864

 Score =   266 bits (681),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 140/167 (84%), Positives = 156/167 (93%), Gaps = 0/167 (0%)
 Frame = +1

Query  49   LLQYSRSKMSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATME  228
            L+ +++  MS+QAESSD+K TK+DFSTAILERKKAPNRLVVDEA+NDDNSVV L+P TME
Sbjct  50   LILFNQLIMSNQAESSDAKGTKRDFSTAILERKKAPNRLVVDEAINDDNSVVVLHPDTME  109

Query  229  KLQLFRGDTVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPD  408
            KLQ FRGDT+LIKGKKRKDTV IALADDTCEEPKIRMNKVVR+NLRVRLGDVVSVHQC D
Sbjct  110  KLQFFRGDTILIKGKKRKDTVCIALADDTCEEPKIRMNKVVRSNLRVRLGDVVSVHQCAD  169

Query  409  VKYGKRVHILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            VKYGKRVHILP+DDTIEGVTG+LF++YLKPYF EAYRP+RKGD FLV
Sbjct  170  VKYGKRVHILPVDDTIEGVTGNLFDAYLKPYFTEAYRPVRKGDLFLV  216



>ref|XP_002519502.1| Transitional endoplasmic reticulum ATPase, putative [Ricinus 
communis]
 gb|EEF42916.1| Transitional endoplasmic reticulum ATPase, putative [Ricinus 
communis]
Length=805

 Score =   266 bits (679),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MS+Q ESSDSK TK+DFSTAILERKK+PNRLVVDEA+NDDNSVV+L+P TMEKLQLFRGD
Sbjct  1    MSNQPESSDSKGTKRDFSTAILERKKSPNRLVVDEAINDDNSVVSLHPETMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALAD +C+EPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALADGSCDEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILPIDDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPIDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>ref|XP_003540195.1| PREDICTED: cell division cycle protein 48 homolog [Glycine max]
Length=807

 Score =   266 bits (679),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MS Q ESSD KS KKDFSTAILERKK+PNRLVVDEAVNDDNSVV ++P TMEKLQLFRGD
Sbjct  1    MSQQGESSDPKSGKKDFSTAILERKKSPNRLVVDEAVNDDNSVVTMHPQTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALAD+ CEEPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALADENCEEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILPIDDTIEGVTG+LF+++LKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPIDDTIEGVTGNLFDAFLKPYFLEAYRPVRKGDLFLV  159



>ref|XP_007207288.1| hypothetical protein PRUPE_ppa001607m2g, partial [Prunus persica]
 gb|EMJ08487.1| hypothetical protein PRUPE_ppa001607m2g, partial [Prunus persica]
Length=628

 Score =   262 bits (669),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M+ +AESSDSK TK+DFSTAILERKKA NRLVVD+A+NDDNSVVAL+P TMEKLQLFRGD
Sbjct  1    MTDKAESSDSKGTKRDFSTAILERKKAANRLVVDDAINDDNSVVALHPDTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALADDTCEEPKIRMNKVVR+NLRVRLGDVVSVHQC DVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALADDTCEEPKIRMNKVVRSNLRVRLGDVVSVHQCADVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPVDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>ref|NP_001235099.1| cell division cycle protein 48 homolog [Glycine max]
 sp|P54774.1|CDC48_SOYBN RecName: Full=Cell division cycle protein 48 homolog; AltName: 
Full=Valosin-containing protein homolog; Short=VCP [Glycine 
max]
 gb|AAA80587.1| valosin-containing protein [Glycine max]
 gb|ABC87759.1| plamsma membrane-associated AAA-ATPase [Glycine max]
 gb|KHN21498.1| Cell division cycle protein 48 like [Glycine soja]
Length=807

 Score =   265 bits (678),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MS Q ESSD KS KKDFSTAILERKK+PNRLVVDEAVNDDNSVV ++P TMEKLQLFRGD
Sbjct  1    MSQQGESSDPKSGKKDFSTAILERKKSPNRLVVDEAVNDDNSVVTMHPQTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALAD+ CEEPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALADENCEEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILPIDDTIEGVTG+LF+++LKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPIDDTIEGVTGNLFDAFLKPYFLEAYRPVRKGDLFLV  159



>ref|XP_004493988.1| PREDICTED: cell division control protein 48 homolog D-like isoform 
X1 [Cicer arietinum]
Length=838

 Score =   266 bits (680),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 139/159 (87%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M++Q ESSD+K TK+DFSTAILERKKAPNRLVVDEAVNDDNSVVAL+P TMEKLQLFRGD
Sbjct  1    MANQPESSDAKGTKRDFSTAILERKKAPNRLVVDEAVNDDNSVVALHPDTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALAD+TCEEPKIRMNKVVR NLRVRLGDVVSVHQC DVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALADETCEEPKIRMNKVVRNNLRVRLGDVVSVHQCADVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPVDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDFFLV  159



>ref|XP_011077329.1| PREDICTED: LOW QUALITY PROTEIN: cell division cycle protein 48 
homolog [Sesamum indicum]
Length=806

 Score =   265 bits (678),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MS+QAESSDSK TK+DFSTAILERKKAPNRLVVDEA+NDDNSVV+++P TMEKLQLF GD
Sbjct  1    MSNQAESSDSKGTKRDFSTAILERKKAPNRLVVDEAINDDNSVVSMHPETMEKLQLFXGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDTV IALADD C+EPKIRMNKVVR NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTVCIALADDNCDEPKIRMNKVVRNNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDT+EGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPVDDTVEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>ref|XP_002882640.1| hypothetical protein ARALYDRAFT_478309 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58899.1| hypothetical protein ARALYDRAFT_478309 [Arabidopsis lyrata subsp. 
lyrata]
Length=809

 Score =   265 bits (678),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/140 (88%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA+NDDNSVV+L+PATMEKLQLFRGDT+LIKGKKRKDTV IALAD
Sbjct  19   AILERKKSPNRLVVDEAINDDNSVVSLHPATMEKLQLFRGDTILIKGKKRKDTVCIALAD  78

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            ++CEEPKIRMNKVVR+NLRVRLGDV+SVHQCPDVKYGKRVHILP+DDT+EGVTG+LF++Y
Sbjct  79   ESCEEPKIRMNKVVRSNLRVRLGDVISVHQCPDVKYGKRVHILPVDDTVEGVTGNLFDAY  138

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FLV
Sbjct  139  LKPYFLEAYRPVRKGDLFLV  158



>ref|XP_002873087.1| hypothetical protein ARALYDRAFT_908201 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49346.1| hypothetical protein ARALYDRAFT_908201 [Arabidopsis lyrata subsp. 
lyrata]
Length=810

 Score =   265 bits (678),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 123/140 (88%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA+NDDNSVV+L+PATMEKLQLFRGDT+LIKGKKRKDTV IALAD
Sbjct  19   AILERKKSPNRLVVDEAINDDNSVVSLHPATMEKLQLFRGDTILIKGKKRKDTVCIALAD  78

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            +TCEEP+IRMNKVVR+NLRVRLGDV+SVHQCPDVKYGKRVHILP+DDT+EGVTG+LF++Y
Sbjct  79   ETCEEPRIRMNKVVRSNLRVRLGDVISVHQCPDVKYGKRVHILPVDDTVEGVTGNLFDAY  138

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FLV
Sbjct  139  LKPYFLEAYRPVRKGDLFLV  158



>emb|CDY41316.1| BnaA01g32030D [Brassica napus]
Length=810

 Score =   265 bits (678),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA+NDDNSVV+L+PATMEKLQLFRGDT+LIKGKKRKDT+ IALAD
Sbjct  19   AILERKKSPNRLVVDEAINDDNSVVSLHPATMEKLQLFRGDTILIKGKKRKDTICIALAD  78

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            D+CEEPKIRMNKVVR+NLRVRLGDV+SVHQCPDVKYG+RVHILP+DDT+EGVTG+LF++Y
Sbjct  79   DSCEEPKIRMNKVVRSNLRVRLGDVISVHQCPDVKYGQRVHILPVDDTVEGVTGNLFDAY  138

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FLV
Sbjct  139  LKPYFLEAYRPVRKGDLFLV  158



>ref|XP_010515813.1| PREDICTED: cell division control protein 48 homolog D [Camelina 
sativa]
Length=810

 Score =   265 bits (677),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 139/159 (87%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M+++AESSDSK TKKDFSTAILERKKA NRLVVDEA+NDDNSVV L+PATMEKLQLFRGD
Sbjct  1    MANEAESSDSKGTKKDFSTAILERKKAANRLVVDEAINDDNSVVCLHPATMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            TVLIKGKKRKDTV IALADDTC+EPKIRMNKVVR+NLRVRL DV+SVHQCPDVKYGKRVH
Sbjct  61   TVLIKGKKRKDTVCIALADDTCDEPKIRMNKVVRSNLRVRLADVISVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEGV+G+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPVDDTIEGVSGNLFDAYLKPYFLEAYRPVRKGDFFLV  159



>ref|XP_006297006.1| hypothetical protein CARUB_v10012997mg [Capsella rubella]
 gb|EOA29904.1| hypothetical protein CARUB_v10012997mg [Capsella rubella]
Length=809

 Score =   265 bits (677),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 123/140 (88%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA+NDDNSVV+L+PATMEKLQLFRGDT+LIKGKKRKDTV IALAD
Sbjct  19   AILERKKSPNRLVVDEAINDDNSVVSLHPATMEKLQLFRGDTILIKGKKRKDTVCIALAD  78

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            ++CEEPKIRMNKVVR+NLRVRLGDV+SVHQCPDVKYGKRVHILP+DDT+EGVTG+LF++Y
Sbjct  79   ESCEEPKIRMNKVVRSNLRVRLGDVISVHQCPDVKYGKRVHILPVDDTVEGVTGNLFDAY  138

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FLV
Sbjct  139  LKPYFLEAYRPVRKGDLFLV  158



>ref|XP_006407632.1| hypothetical protein EUTSA_v10020085mg [Eutrema salsugineum]
 gb|ESQ49085.1| hypothetical protein EUTSA_v10020085mg [Eutrema salsugineum]
Length=809

 Score =   265 bits (677),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 123/140 (88%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA+NDDNSVV+L+PATMEKLQLFRGDT+LIKGKKRKDTV IALAD
Sbjct  19   AILERKKSPNRLVVDEAINDDNSVVSLHPATMEKLQLFRGDTILIKGKKRKDTVCIALAD  78

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            ++CEEPKIRMNKVVR+NLRVRLGDV+SVHQCPDVKYGKRVHILP+DDT+EGVTG+LF++Y
Sbjct  79   ESCEEPKIRMNKVVRSNLRVRLGDVISVHQCPDVKYGKRVHILPVDDTVEGVTGNLFDAY  138

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FLV
Sbjct  139  LKPYFLEAYRPVRKGDLFLV  158



>ref|XP_006287085.1| hypothetical protein CARUB_v10000247mg [Capsella rubella]
 gb|EOA19983.1| hypothetical protein CARUB_v10000247mg [Capsella rubella]
Length=810

 Score =   265 bits (677),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 123/140 (88%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA+NDDNSVV+L+PATMEKLQLFRGDT+LIKGKKRKDTV IALAD
Sbjct  19   AILERKKSPNRLVVDEAINDDNSVVSLHPATMEKLQLFRGDTILIKGKKRKDTVCIALAD  78

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            ++CEEPKIRMNKVVR+NLRVRLGDV+SVHQCPDVKYGKRVHILP+DDT+EGVTG+LF++Y
Sbjct  79   ESCEEPKIRMNKVVRSNLRVRLGDVISVHQCPDVKYGKRVHILPVDDTVEGVTGNLFDAY  138

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FLV
Sbjct  139  LKPYFLEAYRPVRKGDLFLV  158



>ref|XP_006398779.1| hypothetical protein EUTSA_v10012714mg [Eutrema salsugineum]
 gb|ESQ40232.1| hypothetical protein EUTSA_v10012714mg [Eutrema salsugineum]
Length=810

 Score =   265 bits (677),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 123/140 (88%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA+NDDNSVV+++PATMEKLQLFRGDT+LIKGKKRKDTV IALAD
Sbjct  19   AILERKKSPNRLVVDEAINDDNSVVSIHPATMEKLQLFRGDTILIKGKKRKDTVCIALAD  78

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            ++CEEPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVHILP+DDT+EGVTG+LF++Y
Sbjct  79   ESCEEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVHILPVDDTVEGVTGNLFDAY  138

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FLV
Sbjct  139  LKPYFLEAYRPVRKGDLFLV  158



>ref|XP_007144357.1| hypothetical protein PHAVU_007G149400g [Phaseolus vulgaris]
 gb|ESW16351.1| hypothetical protein PHAVU_007G149400g [Phaseolus vulgaris]
Length=811

 Score =   265 bits (677),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 139/159 (87%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M++Q ESSD+K TK+DFSTAILERKKAPNRLVVDEAVNDDNSVVAL+P TM+KLQLFRGD
Sbjct  1    MANQPESSDAKGTKRDFSTAILERKKAPNRLVVDEAVNDDNSVVALHPDTMDKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+L+KGKKRKDTV IALADDTCEEPKIRMNKVVR NLRVRLGDVVSVH CPDVKYGKRVH
Sbjct  61   TILLKGKKRKDTVCIALADDTCEEPKIRMNKVVRNNLRVRLGDVVSVHPCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPVDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>ref|NP_568114.1| cell division control protein 48C [Arabidopsis thaliana]
 sp|Q9LZF6.2|CD48E_ARATH RecName: Full=Cell division control protein 48 homolog E; Short=AtCDC48e; 
AltName: Full=Transitional endoplasmic reticulum 
ATPase E [Arabidopsis thaliana]
 dbj|BAC41803.1| putative transitional endoplasmic reticulum ATPase [Arabidopsis 
thaliana]
 dbj|BAC43171.1| putative transitional endoplasmic reticulum ATPase [Arabidopsis 
thaliana]
 gb|AAP21293.1| At5g03340 [Arabidopsis thaliana]
 gb|AED90587.1| cell division control protein 48C [Arabidopsis thaliana]
Length=810

 Score =   265 bits (677),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 123/140 (88%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA+NDDNSVV+L+P TMEKLQLFRGDT+LIKGKKRKDTV IALAD
Sbjct  19   AILERKKSPNRLVVDEAINDDNSVVSLHPTTMEKLQLFRGDTILIKGKKRKDTVCIALAD  78

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            +TCEEPKIRMNKVVR+NLRVRLGDV+SVHQCPDVKYGKRVHILP+DDT+EGVTG+LF++Y
Sbjct  79   ETCEEPKIRMNKVVRSNLRVRLGDVISVHQCPDVKYGKRVHILPVDDTVEGVTGNLFDAY  138

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FLV
Sbjct  139  LKPYFLEAYRPVRKGDLFLV  158



>gb|KDO60204.1| hypothetical protein CISIN_1g003620mg [Citrus sinensis]
Length=764

 Score =   264 bits (674),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MSH AESSD+ S KKD+STAILERKK+PNRLVVDEA+NDDNSVV L+P TM+KLQ+FRGD
Sbjct  1    MSHPAESSDANSGKKDYSTAILERKKSPNRLVVDEAINDDNSVVGLHPDTMDKLQIFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALADDTCE+PKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALADDTCEQPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILPIDDTIEGVTG+LF+++L+PYF EAYRP+RKGD FLV
Sbjct  121  ILPIDDTIEGVTGNLFDAFLRPYFTEAYRPVRKGDLFLV  159



>emb|CDY41581.1| BnaC05g43180D [Brassica napus]
Length=808

 Score =   265 bits (676),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA+NDDNSVV+L+PATMEKLQLFRGDT+LIKGKKRKDT+ IALAD
Sbjct  19   AILERKKSPNRLVVDEAINDDNSVVSLHPATMEKLQLFRGDTILIKGKKRKDTICIALAD  78

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            ++CEEPKIRMNKVVR+NLRVRLGDV+SVHQCPDVKYGKRVHILP+DDT+EGVTG+LF++Y
Sbjct  79   ESCEEPKIRMNKVVRSNLRVRLGDVISVHQCPDVKYGKRVHILPVDDTVEGVTGNLFDAY  138

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FLV
Sbjct  139  LKPYFLEAYRPVRKGDLFLV  158



>ref|XP_008784494.1| PREDICTED: cell division cycle protein 48 homolog [Phoenix dactylifera]
Length=811

 Score =   265 bits (676),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 124/140 (89%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKKAPNRL+VDEA+NDDNSVV++NP TMEKLQLFRGDT+L+KGKKRKDT+ IALAD
Sbjct  23   AILERKKAPNRLIVDEAINDDNSVVSMNPETMEKLQLFRGDTILLKGKKRKDTICIALAD  82

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            DTCEEPKIRMNKVVR+NLRVRLGDVVSVHQC DVKYGKRVHILPIDDTIEGVTG+LF++Y
Sbjct  83   DTCEEPKIRMNKVVRSNLRVRLGDVVSVHQCQDVKYGKRVHILPIDDTIEGVTGNLFDAY  142

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FLV
Sbjct  143  LKPYFLEAYRPVRKGDLFLV  162



>ref|XP_007016834.1| ATPase, AAA-type, CDC48 protein [Theobroma cacao]
 gb|EOY34453.1| ATPase, AAA-type, CDC48 protein [Theobroma cacao]
Length=804

 Score =   265 bits (676),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 139/159 (87%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MSH AESSDSKS KKDFSTAILERKK+PNRLVVDE VNDDNSVV+++P TMEKLQLFRGD
Sbjct  1    MSHSAESSDSKSGKKDFSTAILERKKSPNRLVVDETVNDDNSVVSMHPDTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALAD+TCE  KIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALADETCETAKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILPIDDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPIDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>ref|XP_010035967.1| PREDICTED: cell division cycle protein 48 homolog [Eucalyptus 
grandis]
 gb|KCW47483.1| hypothetical protein EUGRSUZ_K01256 [Eucalyptus grandis]
Length=807

 Score =   265 bits (676),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M+ QAESSD K TK+DFSTAILERKKA NRLVVDEAVNDDNSVVAL+P TMEKLQLFRGD
Sbjct  1    MASQAESSDPKGTKRDFSTAILERKKAANRLVVDEAVNDDNSVVALHPETMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+L+KGKKRKDTV IALADDTC+EPKIRMNKVVR NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILVKGKKRKDTVCIALADDTCDEPKIRMNKVVRQNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEG+TG LF+++LKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPVDDTIEGITGSLFDAFLKPYFLEAYRPVRKGDLFLV  159



>ref|XP_006424506.1| hypothetical protein CICLE_v10027840mg [Citrus clementina]
 gb|ESR37746.1| hypothetical protein CICLE_v10027840mg [Citrus clementina]
Length=807

 Score =   265 bits (676),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MSH AESSD+ S KKD+STAILERKK+PNRLVVDEA+NDDNSVV L+P TM+KLQ+FRGD
Sbjct  1    MSHPAESSDANSGKKDYSTAILERKKSPNRLVVDEAINDDNSVVGLHPDTMDKLQIFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALADDTCE+PKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALADDTCEQPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILPIDDTIEGVTG+LF+++L+PYF EAYRP+RKGD FLV
Sbjct  121  ILPIDDTIEGVTGNLFDAFLRPYFTEAYRPVRKGDLFLV  159



>ref|XP_006488039.1| PREDICTED: cell division cycle protein 48 homolog [Citrus sinensis]
 gb|KDO60202.1| hypothetical protein CISIN_1g003620mg [Citrus sinensis]
Length=807

 Score =   265 bits (676),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MSH AESSD+ S KKD+STAILERKK+PNRLVVDEA+NDDNSVV L+P TM+KLQ+FRGD
Sbjct  1    MSHPAESSDANSGKKDYSTAILERKKSPNRLVVDEAINDDNSVVGLHPDTMDKLQIFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALADDTCE+PKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALADDTCEQPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILPIDDTIEGVTG+LF+++L+PYF EAYRP+RKGD FLV
Sbjct  121  ILPIDDTIEGVTGNLFDAFLRPYFTEAYRPVRKGDLFLV  159



>ref|XP_010933081.1| PREDICTED: cell division cycle protein 48 homolog [Elaeis guineensis]
Length=811

 Score =   264 bits (675),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 124/140 (89%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKKAPNRL+VDEA+NDDNSVV++NP TMEKLQLFRGDT+L+KGKKR+DTV IALAD
Sbjct  23   AILERKKAPNRLIVDEAINDDNSVVSMNPETMEKLQLFRGDTILLKGKKRRDTVCIALAD  82

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            DTCEEPKIRMNKVVR+NLRVRLGDVVSVHQC DVKYGKRVHILPIDDTIEGVTG+LF++Y
Sbjct  83   DTCEEPKIRMNKVVRSNLRVRLGDVVSVHQCQDVKYGKRVHILPIDDTIEGVTGNLFDAY  142

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FLV
Sbjct  143  LKPYFLEAYRPVRKGDLFLV  162



>tpg|DAA43414.1| TPA: hypothetical protein ZEAMMB73_941156, partial [Zea mays]
Length=453

 Score =   256 bits (653),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA NDDNSVVAL+P TME+LQLFRGDTVL+KGKKRKDT+ I LAD
Sbjct  21   AILERKKSPNRLVVDEATNDDNSVVALHPDTMERLQLFRGDTVLLKGKKRKDTICIVLAD  80

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            +TCEEPK+RMNKVVR NLRVRL DVVSVHQCPDVKYGKRVHILPIDDTIEG+TG+LF+++
Sbjct  81   ETCEEPKVRMNKVVRKNLRVRLSDVVSVHQCPDVKYGKRVHILPIDDTIEGITGNLFDAF  140

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRPLRKGD FLV
Sbjct  141  LKPYFLEAYRPLRKGDLFLV  160



>pir||T48355 transitional endoplasmic reticulum ATPase - Arabidopsis thaliana
 emb|CAB83290.1| transitional endoplasmic reticulum ATPase [Arabidopsis thaliana]
Length=843

 Score =   265 bits (676),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/140 (88%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA+NDDNSVV+L+P TMEKLQLFRGDT+LIKGKKRKDTV IALAD
Sbjct  52   AILERKKSPNRLVVDEAINDDNSVVSLHPTTMEKLQLFRGDTILIKGKKRKDTVCIALAD  111

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            +TCEEPKIRMNKVVR+NLRVRLGDV+SVHQCPDVKYGKRVHILP+DDT+EGVTG+LF++Y
Sbjct  112  ETCEEPKIRMNKVVRSNLRVRLGDVISVHQCPDVKYGKRVHILPVDDTVEGVTGNLFDAY  171

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FLV
Sbjct  172  LKPYFLEAYRPVRKGDLFLV  191



>ref|XP_003554388.1| PREDICTED: cell division cycle protein 48 homolog [Glycine max]
 gb|KHN02324.1| Cell division cycle protein 48 like [Glycine soja]
Length=808

 Score =   264 bits (675),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M+ Q ESSD+K TK+DFSTAILERKKA NRLVVDEAVNDDNSVVAL+P TMEKLQLFRGD
Sbjct  1    MADQPESSDAKGTKRDFSTAILERKKALNRLVVDEAVNDDNSVVALHPDTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDTV IALAD+TCEEPKIRMNKVVR NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTVCIALADETCEEPKIRMNKVVRNNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPVDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>ref|XP_010035969.1| PREDICTED: cell division cycle protein 48 homolog [Eucalyptus 
grandis]
 gb|KCW47490.1| hypothetical protein EUGRSUZ_K01258 [Eucalyptus grandis]
Length=807

 Score =   264 bits (674),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M+ QAESSD K TK+DFSTAILERKKA NRLVVDEAVNDDNSVV+L+P TMEKLQLFRGD
Sbjct  1    MASQAESSDPKGTKRDFSTAILERKKAANRLVVDEAVNDDNSVVSLHPETMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+L+KGKKRKDTV IALADDTC+EPKIRMNKVVR NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILVKGKKRKDTVCIALADDTCDEPKIRMNKVVRQNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEG+TG+LF+++LKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPVDDTIEGITGNLFDAFLKPYFLEAYRPVRKGDLFLV  159



>gb|AES81894.2| ATPase, AAA-type, CDC48 protein [Medicago truncatula]
Length=809

 Score =   264 bits (674),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/140 (90%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKKAPNRLVVDEAVNDDNSVVAL+P TMEKLQLFRGDT+LIKGKKRKDT+ IALAD
Sbjct  21   AILERKKAPNRLVVDEAVNDDNSVVALHPETMEKLQLFRGDTILIKGKKRKDTICIALAD  80

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            +TCEEPKIRMNKVVR NLRVRLGDVVSVHQC DVKYGKRVHILP+DDTIEGVTG+LF++Y
Sbjct  81   ETCEEPKIRMNKVVRNNLRVRLGDVVSVHQCADVKYGKRVHILPVDDTIEGVTGNLFDAY  140

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FLV
Sbjct  141  LKPYFLEAYRPVRKGDFFLV  160



>ref|XP_009123155.1| PREDICTED: cell division control protein 48 homolog A [Brassica 
rapa]
Length=810

 Score =   264 bits (674),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA+NDDNSVV+L+PATMEKLQLFRGDT+LIKGKKRKDT+ IALAD
Sbjct  19   AILERKKSPNRLVVDEAINDDNSVVSLHPATMEKLQLFRGDTILIKGKKRKDTICIALAD  78

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            ++CEEPKIRMNKVVR+NLRVRLGDV+SVHQCPDVKYG+RVHILP+DDT+EGVTG+LF++Y
Sbjct  79   ESCEEPKIRMNKVVRSNLRVRLGDVISVHQCPDVKYGQRVHILPVDDTVEGVTGNLFDAY  138

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FLV
Sbjct  139  LKPYFLEAYRPVRKGDLFLV  158



>gb|KFK24784.1| hypothetical protein AALP_AA8G024500 [Arabis alpina]
Length=808

 Score =   263 bits (673),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/140 (89%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA NDDNSVV L+PATMEKLQLFRGDT+LIKGKKRKDTV IALAD
Sbjct  19   AILERKKSPNRLVVDEATNDDNSVVCLHPATMEKLQLFRGDTILIKGKKRKDTVCIALAD  78

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            ++CEEPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVHILP+DDTIEG+TG+LF++Y
Sbjct  79   ESCEEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVHILPVDDTIEGLTGNLFDTY  138

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FLV
Sbjct  139  LKPYFLEAYRPVRKGDLFLV  158



>gb|AFF59215.1| cell division cycle protein 48 [Camellia sinensis]
Length=807

 Score =   263 bits (673),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M+ QAESSD K TK+DFSTAILERKK+PNRLVVD+A+NDDNSVVAL+P TMEKLQLFRGD
Sbjct  1    MTDQAESSDPKGTKRDFSTAILERKKSPNRLVVDDAINDDNSVVALHPDTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALADDTC+EPKIRMNKVVR+NLRVRLGDVVSVHQC DVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALADDTCDEPKIRMNKVVRSNLRVRLGDVVSVHQCADVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEGVTG LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPVDDTIEGVTGSLFDAYLKPYFLEAYRPVRKGDLFLV  159



>emb|CDY54618.1| BnaA05g28710D [Brassica napus]
Length=808

 Score =   263 bits (673),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA+NDDNSVV+L+PATMEKLQLFRGDT+LIKGKKRKDT+ IALAD
Sbjct  19   AILERKKSPNRLVVDEAINDDNSVVSLHPATMEKLQLFRGDTILIKGKKRKDTICIALAD  78

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            ++CEEPKIRMNKVVR+NLRVRLGDV+SVHQCPDVKYG+RVHILP+DDT+EGVTG+LF++Y
Sbjct  79   ESCEEPKIRMNKVVRSNLRVRLGDVISVHQCPDVKYGQRVHILPVDDTVEGVTGNLFDAY  138

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FLV
Sbjct  139  LKPYFLEAYRPVRKGDLFLV  158



>gb|KFK38374.1| hypothetical protein AALP_AA3G105700 [Arabis alpina]
Length=809

 Score =   263 bits (673),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/140 (88%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA NDDNSVV L+PATMEKLQLFRGDT+LIKGKKRKDTV IALAD
Sbjct  19   AILERKKSPNRLVVDEATNDDNSVVCLHPATMEKLQLFRGDTILIKGKKRKDTVCIALAD  78

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            +TC+EPKIRMNKVVR+NLRVRLGDV+SVHQCPDVKYGKRVHILP+DDT+EGVTG+LF++Y
Sbjct  79   ETCDEPKIRMNKVVRSNLRVRLGDVISVHQCPDVKYGKRVHILPVDDTVEGVTGNLFDAY  138

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FLV
Sbjct  139  LKPYFLEAYRPVRKGDLFLV  158



>emb|CDY07941.1| BnaC03g35820D [Brassica napus]
Length=809

 Score =   263 bits (673),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA+NDDNSVV+L+PATMEKLQLFRGDT+LIKGKKRKDTV IALAD
Sbjct  19   AILERKKSPNRLVVDEAINDDNSVVSLHPATMEKLQLFRGDTILIKGKKRKDTVCIALAD  78

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            ++CEEPKIRMNKVVR+NLRVRLGDV+SVHQCPDVKYG RVHILP+DDT+EGVTG+LF++Y
Sbjct  79   ESCEEPKIRMNKVVRSNLRVRLGDVISVHQCPDVKYGNRVHILPVDDTVEGVTGNLFDAY  138

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FLV
Sbjct  139  LKPYFLEAYRPVRKGDLFLV  158



>ref|XP_007208079.1| hypothetical protein PRUPE_ppa001552mg [Prunus persica]
 gb|EMJ09278.1| hypothetical protein PRUPE_ppa001552mg [Prunus persica]
Length=803

 Score =   263 bits (672),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 147/159 (92%), Gaps = 2/159 (1%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M+H AESSDSK        AILERKK+PNRLVVDEA+NDDNSVV+++P TMEKLQLFRGD
Sbjct  1    MAHPAESSDSKKKDFST--AILERKKSPNRLVVDEAINDDNSVVSMHPETMEKLQLFRGD  58

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALADDTCEEP+IRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  59   TILIKGKKRKDTICIALADDTCEEPRIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  118

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILPIDD+IEGVTG+LF+++LKPYFLEAYRP+RKGD FLV
Sbjct  119  ILPIDDSIEGVTGNLFDAFLKPYFLEAYRPVRKGDLFLV  157



>ref|XP_008350361.1| PREDICTED: cell division control protein 48 homolog D [Malus 
domestica]
Length=806

 Score =   263 bits (672),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 139/159 (87%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M+ +AESSDSK TK+DFSTAILERKKA NRLVVD+AVNDDNSVVAL+P TMEKLQLFRGD
Sbjct  1    MTDKAESSDSKGTKRDFSTAILERKKAANRLVVDDAVNDDNSVVALHPDTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALADDTCEEPKIRMNKVVR+NLRVRLGDVVSVHQC DVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALADDTCEEPKIRMNKVVRSNLRVRLGDVVSVHQCADVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPVDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>gb|EYU34476.1| hypothetical protein MIMGU_mgv1a0021281mg, partial [Erythranthe 
guttata]
Length=675

 Score =   261 bits (666),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MS+QAESSDSK TK+DFSTAILE+KKA NRLVVDEA+NDDNSVV+L+P TMEKLQLFRGD
Sbjct  1    MSNQAESSDSKGTKRDFSTAILEKKKAANRLVVDEAINDDNSVVSLHPDTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALAD+TC+EPKIRMNKVVR+NLRVRLGDVVSVHQC DVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALADETCDEPKIRMNKVVRSNLRVRLGDVVSVHQCADVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDT+EGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPVDDTVEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>ref|XP_008226257.1| PREDICTED: cell division cycle protein 48 homolog [Prunus mume]
Length=803

 Score =   263 bits (672),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 147/159 (92%), Gaps = 2/159 (1%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M+H AESSDSK        AILERKK+PNRLVVDEA+NDDNSVV+++P TMEKLQLFRGD
Sbjct  1    MAHPAESSDSKKKDFST--AILERKKSPNRLVVDEAINDDNSVVSMHPETMEKLQLFRGD  58

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALADDTCEEP+IRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  59   TILIKGKKRKDTICIALADDTCEEPRIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  118

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILPIDD+IEGVTG+LF+++LKPYFLEAYRP+RKGD FLV
Sbjct  119  ILPIDDSIEGVTGNLFDAFLKPYFLEAYRPVRKGDLFLV  157



>ref|XP_008385356.1| PREDICTED: cell division cycle protein 48 homolog [Malus domestica]
Length=804

 Score =   263 bits (672),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 147/159 (92%), Gaps = 2/159 (1%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M+H AESSDSK        AILERKK+PNRLVVDEA+NDDNSVV+++P TMEKLQLFRGD
Sbjct  1    MAHPAESSDSKKKDFST--AILERKKSPNRLVVDEALNDDNSVVSMHPETMEKLQLFRGD  58

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALADDTCEEP+IRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  59   TILIKGKKRKDTICIALADDTCEEPRIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  118

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILPIDD+IEGVTG+LF+++LKPYFLEAYRP+RKGD FLV
Sbjct  119  ILPIDDSIEGVTGNLFDAFLKPYFLEAYRPVRKGDLFLV  157



>ref|XP_004487074.1| PREDICTED: cell division cycle protein 48 homolog [Cicer arietinum]
Length=808

 Score =   263 bits (672),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/140 (89%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEAVNDDNSVVA++P TMEKL LFRGDT+LIKGKKRKDT+ IALAD
Sbjct  19   AILERKKSPNRLVVDEAVNDDNSVVAMHPQTMEKLGLFRGDTILIKGKKRKDTICIALAD  78

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            DTCEEP+IRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTG+LF+++
Sbjct  79   DTCEEPRIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGNLFDAF  138

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FLV
Sbjct  139  LKPYFLEAYRPVRKGDLFLV  158



>ref|XP_004249485.1| PREDICTED: cell division cycle protein 48 homolog [Solanum lycopersicum]
Length=808

 Score =   263 bits (672),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M+++AESSDSK TK+DFSTAILERKK+PNRLVVDEA NDDNSVVA++P TMEKLQLFRGD
Sbjct  1    MTNKAESSDSKGTKRDFSTAILERKKSPNRLVVDEATNDDNSVVAIHPDTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALADDTC+ PKIRMNKVVR NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALADDTCDVPKIRMNKVVRNNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILPIDDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPIDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>ref|XP_010935717.1| PREDICTED: cell division cycle protein 48 homolog [Elaeis guineensis]
Length=810

 Score =   263 bits (672),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/140 (89%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKKAPNRL+VDEAVNDDNSVV+L+P TMEKLQLFRGDT+L+KGKKR+DT+ IALAD
Sbjct  22   AILERKKAPNRLIVDEAVNDDNSVVSLHPETMEKLQLFRGDTILLKGKKRRDTICIALAD  81

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            DTCEEPKIRMNKVVR+NLRVRLGDVVSVHQC DVKYGKRVHILPIDDTIEGVTG+LF++Y
Sbjct  82   DTCEEPKIRMNKVVRSNLRVRLGDVVSVHQCQDVKYGKRVHILPIDDTIEGVTGNLFDAY  141

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FLV
Sbjct  142  LKPYFLEAYRPVRKGDLFLV  161



>ref|XP_010490810.1| PREDICTED: cell division control protein 48 homolog E-like [Camelina 
sativa]
Length=811

 Score =   263 bits (672),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MS++ ESSDSK  K+DFST ILERKK+PNRLVVDEA+NDDNSVV+L+PATMEKLQLFRGD
Sbjct  1    MSNKPESSDSKPKKEDFSTKILERKKSPNRLVVDEAINDDNSVVSLHPATMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDTV IALAD+TCEEPKIRMNKVVR+NLRVRLGDV+SVHQCPDVKYG RVH
Sbjct  61   TILIKGKKRKDTVCIALADETCEEPKIRMNKVVRSNLRVRLGDVISVHQCPDVKYGNRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDT+EGVTG+LF+++LKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPVDDTVEGVTGNLFDAFLKPYFLEAYRPVRKGDLFLV  159



>ref|XP_009356903.1| PREDICTED: cell division cycle protein 48 homolog [Pyrus x bretschneideri]
Length=804

 Score =   263 bits (671),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 147/159 (92%), Gaps = 2/159 (1%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M+H AESSDSK        AILERKK+PNRLVVDEA+NDDNSVV+++P TMEKLQLFRGD
Sbjct  1    MAHPAESSDSKKKDFST--AILERKKSPNRLVVDEALNDDNSVVSMHPETMEKLQLFRGD  58

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALADDTCEEP+IRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  59   TILIKGKKRKDTICIALADDTCEEPRIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  118

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILPIDD+IEGVTG+LF+++LKPYFLEAYRP+RKGD FLV
Sbjct  119  ILPIDDSIEGVTGNLFDAFLKPYFLEAYRPVRKGDLFLV  157



>ref|XP_009418624.1| PREDICTED: cell division cycle protein 48 homolog [Musa acuminata 
subsp. malaccensis]
Length=809

 Score =   263 bits (671),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 123/140 (88%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKKAPNRLVVDEA+NDDNSVV L+P TMEKLQLFRGDTVL+KGKKR+DT+ IALAD
Sbjct  24   AILERKKAPNRLVVDEAINDDNSVVVLHPETMEKLQLFRGDTVLLKGKKRRDTICIALAD  83

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            DTC+EPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEG+TG+LF++Y
Sbjct  84   DTCDEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGITGNLFDAY  143

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYF+EAYRP+RKGD FLV
Sbjct  144  LKPYFMEAYRPVRKGDLFLV  163



>ref|XP_009376078.1| PREDICTED: uncharacterized protein LOC103964820 isoform X2 [Pyrus 
x bretschneideri]
Length=450

 Score =   254 bits (650),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 142/159 (89%), Gaps = 2/159 (1%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M+HQAES   K        AILERKK+PNRLVVDEAVNDDNSVV+++P TMEKLQ+FRGD
Sbjct  1    MAHQAESPYWKKEDLWT--AILERKKSPNRLVVDEAVNDDNSVVSMHPETMEKLQIFRGD  58

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALAD TCEEP+IRMNKVVR+NLRVR+GDVVSVH CPDVKYGKRVH
Sbjct  59   TILIKGKKRKDTICIALADYTCEEPRIRMNKVVRSNLRVRIGDVVSVHLCPDVKYGKRVH  118

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILPIDD+IEGVTG+LF+++LKPYFLEAYR +RKGD FLV
Sbjct  119  ILPIDDSIEGVTGNLFDAFLKPYFLEAYRLVRKGDLFLV  157



>ref|XP_006339079.1| PREDICTED: cell division cycle protein 48 homolog [Solanum tuberosum]
Length=808

 Score =   263 bits (671),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M+++AESSDSK TK+DFSTAILERKK+PNRLVVDEA NDDNSVVA++P TMEKLQLFRGD
Sbjct  1    MTNKAESSDSKGTKRDFSTAILERKKSPNRLVVDEATNDDNSVVAIHPDTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALADDTC+ PKIRMNKVVR NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALADDTCDVPKIRMNKVVRNNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILPIDDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPIDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>emb|CAN61919.1| hypothetical protein VITISV_038729 [Vitis vinifera]
Length=802

 Score =   263 bits (671),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 125/140 (89%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEAVNDDNSVV++NPATMEKLQ FRGDTVLIKGKKRKDTV I L D
Sbjct  13   AILERKKSPNRLVVDEAVNDDNSVVSMNPATMEKLQFFRGDTVLIKGKKRKDTVCIVLVD  72

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            + CEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTG+LF++Y
Sbjct  73   EQCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGNLFDAY  132

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLE+YRP+RKGD FLV
Sbjct  133  LKPYFLESYRPVRKGDLFLV  152



>ref|XP_008359643.1| PREDICTED: cell division control protein 48 homolog D [Malus 
domestica]
Length=806

 Score =   263 bits (671),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M+ +AESSDSK TK+DFSTAILERKKA NRLVVD+A+NDDNSVVAL+P TMEKLQLFRGD
Sbjct  1    MTDKAESSDSKGTKRDFSTAILERKKAANRLVVDDAINDDNSVVALHPDTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALADDTCEEPKIRMNKVVR+NLRVRLGDVVSVHQC DVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALADDTCEEPKIRMNKVVRSNLRVRLGDVVSVHQCADVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPVDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>ref|XP_009135040.1| PREDICTED: cell division control protein 48 homolog A-like [Brassica 
rapa]
 emb|CDX73996.1| BnaA03g30510D [Brassica napus]
Length=809

 Score =   263 bits (671),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA+NDDNSVV+L+P TMEKLQLFRGDT+LIKGKKRKDTV IALAD
Sbjct  19   AILERKKSPNRLVVDEAINDDNSVVSLHPDTMEKLQLFRGDTILIKGKKRKDTVCIALAD  78

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            ++CEEPKIRMNKVVR+NLRVRLGDV+SVHQCPDVKYGKRVHILP+DDT+EGVTG+LF++Y
Sbjct  79   ESCEEPKIRMNKVVRSNLRVRLGDVISVHQCPDVKYGKRVHILPVDDTVEGVTGNLFDAY  138

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FLV
Sbjct  139  LKPYFLEAYRPVRKGDLFLV  158



>ref|XP_009334653.1| PREDICTED: cell division control protein 48 homolog D [Pyrus 
x bretschneideri]
Length=806

 Score =   263 bits (671),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M+ +AESSDSK TK+DFSTAILERKKA NRLVVD+A+NDDNSVVAL+P TMEKLQLFRGD
Sbjct  1    MTDKAESSDSKGTKRDFSTAILERKKAANRLVVDDAINDDNSVVALHPDTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALADDTCEEPKIRMNKVVR+NLRVRLGDVVSVHQC DVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALADDTCEEPKIRMNKVVRSNLRVRLGDVVSVHQCADVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPVDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>ref|XP_002281671.1| PREDICTED: cell division cycle protein 48 homolog [Vitis vinifera]
 emb|CBI14985.3| unnamed protein product [Vitis vinifera]
Length=814

 Score =   263 bits (671),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 125/140 (89%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEAVNDDNSVV++NPATMEKLQ FRGDTVLIKGKKRKDTV I L D
Sbjct  25   AILERKKSPNRLVVDEAVNDDNSVVSMNPATMEKLQFFRGDTVLIKGKKRKDTVCIVLVD  84

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            + CEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTG+LF++Y
Sbjct  85   EQCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGNLFDAY  144

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLE+YRP+RKGD FLV
Sbjct  145  LKPYFLESYRPVRKGDLFLV  164



>ref|XP_004143268.1| PREDICTED: cell division cycle protein 48 homolog [Cucumis sativus]
 gb|KGN48181.1| hypothetical protein Csa_6G446420 [Cucumis sativus]
Length=807

 Score =   262 bits (670),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M++QAESSDSK  K+DFSTAILERKKA NRLVVDEA+NDDNSVVAL+P TMEKLQLFRGD
Sbjct  1    MANQAESSDSKGPKRDFSTAILERKKAANRLVVDEAINDDNSVVALHPDTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALAD+TC+EPKIRMNKVVR+NLRVRLGDVVSVHQC DVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALADETCDEPKIRMNKVVRSNLRVRLGDVVSVHQCADVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPVDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>ref|XP_010684066.1| PREDICTED: cell division cycle protein 48 homolog [Beta vulgaris 
subsp. vulgaris]
Length=803

 Score =   262 bits (670),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 124/140 (89%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEAVNDDNSVV+++P TMEKLQLFRGDTVL+KGKKRKDT+ IALAD
Sbjct  19   AILERKKSPNRLVVDEAVNDDNSVVSMHPDTMEKLQLFRGDTVLVKGKKRKDTICIALAD  78

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            +TCEEPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTG+LF++Y
Sbjct  79   ETCEEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGNLFDAY  138

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYF EAYRP+RKGD FLV
Sbjct  139  LKPYFQEAYRPVRKGDLFLV  158



>gb|KHN48262.1| Cell division cycle protein 48 like [Glycine soja]
Length=811

 Score =   262 bits (670),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M++Q ESSD+K TK+DFSTAILERKKAPNRLVVDEAVNDDNSVV L+P TMEKLQLFRGD
Sbjct  1    MANQPESSDAKGTKRDFSTAILERKKAPNRLVVDEAVNDDNSVVVLHPNTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+L+KGKKRKDT+ IALAD+TCEEPKIRMNK+VR NLRVRLGDVVSVHQC DVKYGKRVH
Sbjct  61   TILLKGKKRKDTICIALADETCEEPKIRMNKIVRNNLRVRLGDVVSVHQCADVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPVDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDMFLV  159



>ref|XP_009146894.1| PREDICTED: cell division control protein 48 homolog A [Brassica 
rapa]
Length=809

 Score =   262 bits (670),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA+NDDNSVV+L PATMEKLQLFRGDT+LIKGKKRKDT+ IALAD
Sbjct  19   AILERKKSPNRLVVDEAINDDNSVVSLPPATMEKLQLFRGDTILIKGKKRKDTICIALAD  78

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            ++CEEPKIRMNKVVR+NLRVRLGDV+SVHQCPDVKYG+RVHILP+DDT+EGVTG+LF++Y
Sbjct  79   ESCEEPKIRMNKVVRSNLRVRLGDVISVHQCPDVKYGQRVHILPVDDTVEGVTGNLFDAY  138

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FLV
Sbjct  139  LKPYFLEAYRPVRKGDLFLV  158



>ref|XP_004304451.1| PREDICTED: cell division cycle protein 48 homolog [Fragaria vesca 
subsp. vesca]
Length=807

 Score =   262 bits (670),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M+ +AESSD K TK+DFSTAILERKKA NRLVVDEA+NDDNSVVAL+P TMEKLQLFRGD
Sbjct  1    MTDKAESSDPKGTKRDFSTAILERKKAANRLVVDEAINDDNSVVALHPETMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALADDTC+EPKIRMNKVVR+NLRVRLGDVVSVHQC DVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALADDTCDEPKIRMNKVVRSNLRVRLGDVVSVHQCADVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEGVTG LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPVDDTIEGVTGSLFDAYLKPYFLEAYRPVRKGDLFLV  159



>ref|XP_003535161.1| PREDICTED: cell division cycle protein 48 homolog [Glycine max]
Length=813

 Score =   262 bits (670),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 125/140 (89%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKKAPNRLVVDEAVNDDNSVVAL+P TMEKLQLFRGDT+L+KGKKRKDT+ IALAD
Sbjct  22   AILERKKAPNRLVVDEAVNDDNSVVALHPNTMEKLQLFRGDTILLKGKKRKDTICIALAD  81

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            +TCEEPKIRMNKVVR NLRVRLGDVVSVHQC DVKYGKRVHILP+DDTIEGVTG+LF++Y
Sbjct  82   ETCEEPKIRMNKVVRNNLRVRLGDVVSVHQCADVKYGKRVHILPVDDTIEGVTGNLFDAY  141

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FLV
Sbjct  142  LKPYFLEAYRPVRKGDMFLV  161



>gb|KHN39040.1| Cell division cycle protein 48 like [Glycine soja]
Length=813

 Score =   262 bits (670),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 125/140 (89%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKKAPNRLVVDEAVNDDNSVVAL+P TMEKLQLFRGDT+L+KGKKRKDT+ IALAD
Sbjct  22   AILERKKAPNRLVVDEAVNDDNSVVALHPNTMEKLQLFRGDTILLKGKKRKDTICIALAD  81

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            +TCEEPKIRMNKVVR NLRVRLGDVVSVHQC DVKYGKRVHILP+DDTIEGVTG+LF++Y
Sbjct  82   ETCEEPKIRMNKVVRNNLRVRLGDVVSVHQCADVKYGKRVHILPVDDTIEGVTGNLFDAY  141

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FLV
Sbjct  142  LKPYFLEAYRPVRKGDMFLV  161



>ref|XP_003542533.1| PREDICTED: cell division cycle protein 48 homolog [Glycine max]
Length=811

 Score =   262 bits (670),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M++Q ESSD+K TK+DFSTAILERKKAPNRLVVDEAVNDDNSVV L+P TMEKLQLFRGD
Sbjct  1    MANQPESSDAKGTKRDFSTAILERKKAPNRLVVDEAVNDDNSVVVLHPDTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+L+KGKKRKDT+ IALAD+TCEEPKIRMNK+VR NLRVRLGDVVSVHQC DVKYGKRVH
Sbjct  61   TILLKGKKRKDTICIALADETCEEPKIRMNKIVRNNLRVRLGDVVSVHQCADVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPVDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDMFLV  159



>ref|XP_008462466.1| PREDICTED: cell division cycle protein 48 homolog [Cucumis melo]
Length=807

 Score =   262 bits (669),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M++Q ESSDSK  K+DFSTAILERKKA NRLVVDEA+NDDNSVVAL+P TMEKLQLFRGD
Sbjct  1    MANQPESSDSKGPKRDFSTAILERKKAANRLVVDEAINDDNSVVALHPDTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALADDTC+EPKIRMNKVVR+NLRVRLGDVVSVHQC DVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALADDTCDEPKIRMNKVVRSNLRVRLGDVVSVHQCADVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPVDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>ref|XP_010423732.1| PREDICTED: cell division control protein 48 homolog E-like [Camelina 
sativa]
Length=810

 Score =   262 bits (669),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MS++ ESSDSK  K+DFST ILERKK+PNRLVVDEA+NDDNSVV+L+PATMEKLQLFRGD
Sbjct  1    MSNKPESSDSKPKKEDFSTKILERKKSPNRLVVDEAINDDNSVVSLHPATMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+L+KGKKRKDTV IALAD+TCEEPKIRMNKVVR+NLRVRLGDV+SVHQCPDVKYG RVH
Sbjct  61   TILVKGKKRKDTVCIALADETCEEPKIRMNKVVRSNLRVRLGDVISVHQCPDVKYGNRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDT+EGVTG+LF+++LKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPVDDTVEGVTGNLFDAFLKPYFLEAYRPVRKGDLFLV  159



>ref|XP_011018733.1| PREDICTED: cell division cycle protein 48 homolog isoform X2 
[Populus euphratica]
Length=803

 Score =   261 bits (668),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 139/159 (87%), Positives = 153/159 (96%), Gaps = 2/159 (1%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MS+QAESSDSK TK+DFSTAILERKKAPNRLVVDEA+NDDNSVV+L+P TMEKLQLFRGD
Sbjct  1    MSNQAESSDSKGTKRDFSTAILERKKAPNRLVVDEALNDDNSVVSLHPETMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIK  KRKDT+ IALADD+C+EPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIK--KRKDTICIALADDSCDEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  118

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILPIDDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  119  ILPIDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  157



>gb|KFK34571.1| hypothetical protein AALP_AA5G163100 [Arabis alpina]
Length=812

 Score =   261 bits (668),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M+ QAESSDSK TK+DFSTAILERKKA NRLVVDEA+NDDNSVV+L+P TMEKL LFRGD
Sbjct  1    MADQAESSDSKGTKRDFSTAILERKKAANRLVVDEAINDDNSVVSLHPETMEKLHLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            TVL+KGKKRKDTV IALAD+TC+EPKIRMNKVVR+NLRVRLGDV+SVHQCPDVKYGKRVH
Sbjct  61   TVLLKGKKRKDTVCIALADETCDEPKIRMNKVVRSNLRVRLGDVISVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILPIDDTIEGV+G++F++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPIDDTIEGVSGNIFDAYLKPYFLEAYRPVRKGDLFLV  159



>ref|XP_004156282.1| PREDICTED: LOW QUALITY PROTEIN: cell division cycle protein 48 
homolog [Cucumis sativus]
Length=807

 Score =   261 bits (667),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M++QAESSDSK  K+DFSTAILERKKA NRLVVDEA+NDDNSVVAL+P TMEKLQLFRGD
Sbjct  1    MANQAESSDSKGPKRDFSTAILERKKAANRLVVDEAINDDNSVVALHPDTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKG+KRKDT+ IALAD+TC+EPKIRMNKVVR+NLRVRLGDVVSVHQC DVKYGKRVH
Sbjct  61   TILIKGEKRKDTICIALADETCDEPKIRMNKVVRSNLRVRLGDVVSVHQCADVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPVDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>ref|XP_006840975.1| hypothetical protein AMTR_s00085p00052820 [Amborella trichopoda]
 gb|ERN02650.1| hypothetical protein AMTR_s00085p00052820 [Amborella trichopoda]
Length=812

 Score =   261 bits (667),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/140 (88%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKKAPNRLVVDEA+NDDNSVV++NPATMEKLQ FRGDT+LIKGKKRKDTV + L D
Sbjct  24   AILERKKAPNRLVVDEAINDDNSVVSMNPATMEKLQFFRGDTILIKGKKRKDTVCVVLVD  83

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            + CEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTG+LF++Y
Sbjct  84   EQCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGNLFDAY  143

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLE+YRP RKGD FLV
Sbjct  144  LKPYFLESYRPARKGDLFLV  163



>gb|ACC66148.3| cell division cycle protein [Dimocarpus longan]
 gb|ACM17483.1| cell division cycle protein [Dimocarpus longan]
Length=805

 Score =   261 bits (667),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M+++AESSDSK TK+DFSTAILERKKA NRL+VDEA+NDDNSVV+L+P TMEKLQLFRGD
Sbjct  1    MTNKAESSDSKGTKRDFSTAILERKKAANRLIVDEAINDDNSVVSLHPDTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKR+DT+ IALA+DTC+EPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRRDTICIALAEDTCDEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEGVTG+LF+++LKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPVDDTIEGVTGNLFDAFLKPYFLEAYRPVRKGDLFLV  159



>emb|CDY22207.1| BnaC01g38940D [Brassica napus]
Length=810

 Score =   261 bits (667),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA+NDDNSVV+L+P TMEKLQLFRGDT+LIKGKKRKDT+ IALAD
Sbjct  19   AILERKKSPNRLVVDEAINDDNSVVSLHPDTMEKLQLFRGDTILIKGKKRKDTICIALAD  78

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            ++CEEPKIRMNKVVR+NLRVRLGDV+SVHQCPDVKYG+RVHILP+DDT+EGVTG+LF++Y
Sbjct  79   ESCEEPKIRMNKVVRSNLRVRLGDVISVHQCPDVKYGQRVHILPVDDTVEGVTGNLFDAY  138

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FLV
Sbjct  139  LKPYFLEAYRPVRKGDLFLV  158



>ref|XP_010940629.1| PREDICTED: cell division cycle protein 48 homolog [Elaeis guineensis]
Length=810

 Score =   261 bits (667),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/140 (88%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKKAPNRL+VDEAVNDDNSVV+L+P TMEKLQLFRGDT+L+KGKKR+DT+ IALAD
Sbjct  22   AILERKKAPNRLIVDEAVNDDNSVVSLHPETMEKLQLFRGDTILLKGKKRRDTICIALAD  81

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            D CEEPKIRMNKVVR+NLRVRLGDVVSVHQC DVKYGKRVHILPIDDTIEGVTG+LF++Y
Sbjct  82   DACEEPKIRMNKVVRSNLRVRLGDVVSVHQCQDVKYGKRVHILPIDDTIEGVTGNLFDAY  141

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FLV
Sbjct  142  LKPYFLEAYRPVRKGDLFLV  161



>ref|XP_009130717.1| PREDICTED: cell division control protein 48 homolog E [Brassica 
rapa]
Length=810

 Score =   261 bits (666),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA+NDDNSVV+L+P  MEKLQLFRGDT+LIKGKKRKDTV IALAD
Sbjct  19   AILERKKSPNRLVVDEAINDDNSVVSLHPNAMEKLQLFRGDTILIKGKKRKDTVCIALAD  78

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            D+CEEPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYG RVHILP+DDT+EGVTG+LF++Y
Sbjct  79   DSCEEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGTRVHILPVDDTVEGVTGNLFDAY  138

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FLV
Sbjct  139  LKPYFLEAYRPVRKGDLFLV  158



>emb|CDY11249.1| BnaA03g00850D [Brassica napus]
Length=798

 Score =   261 bits (666),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA+NDDNSVV+L+P  MEKLQLFRGDT+LIKGKKRKDTV IALAD
Sbjct  19   AILERKKSPNRLVVDEAINDDNSVVSLHPNAMEKLQLFRGDTILIKGKKRKDTVCIALAD  78

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            D+CEEPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYG RVHILP+DDT+EGVTG+LF++Y
Sbjct  79   DSCEEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGTRVHILPVDDTVEGVTGNLFDAY  138

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FLV
Sbjct  139  LKPYFLEAYRPVRKGDLFLV  158



>ref|XP_002465842.1| hypothetical protein SORBIDRAFT_01g046840 [Sorghum bicolor]
 gb|EER92840.1| hypothetical protein SORBIDRAFT_01g046840 [Sorghum bicolor]
Length=810

 Score =   261 bits (666),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/140 (88%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA NDDNSVVAL+P TME+LQLFRGDTVL+KGKKRKDT+ I LAD
Sbjct  21   AILERKKSPNRLVVDEATNDDNSVVALHPDTMERLQLFRGDTVLLKGKKRKDTICIVLAD  80

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            DTCEEPK+RMNKVVR NLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEG+TG+LF+++
Sbjct  81   DTCEEPKVRMNKVVRKNLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGITGNLFDAF  140

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRPLRKGD FLV
Sbjct  141  LKPYFLEAYRPLRKGDLFLV  160



>ref|XP_008776881.1| PREDICTED: cell division cycle protein 48 homolog [Phoenix dactylifera]
Length=811

 Score =   261 bits (666),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AIL+RKKAPNRLVVDEA+NDDNSVV++NP TMEKLQLFRGDT+L+KGKKR+DT+ IALAD
Sbjct  23   AILDRKKAPNRLVVDEAINDDNSVVSMNPETMEKLQLFRGDTILLKGKKRRDTICIALAD  82

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            DTCEEPKIR+NKVVR+NLRVRLGDVVSVHQC DVKYGKRVHILPIDDTIEGVTG+LF++Y
Sbjct  83   DTCEEPKIRLNKVVRSNLRVRLGDVVSVHQCQDVKYGKRVHILPIDDTIEGVTGNLFDAY  142

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FLV
Sbjct  143  LKPYFLEAYRPVRKGDLFLV  162



>ref|XP_008800539.1| PREDICTED: cell division cycle protein 48 homolog [Phoenix dactylifera]
Length=810

 Score =   261 bits (666),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/140 (89%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKKAPNRLVVDEAVNDDNSVV+L+P TMEKLQLFRGDT+L+KGKKR+DT+ IALAD
Sbjct  22   AILERKKAPNRLVVDEAVNDDNSVVSLHPETMEKLQLFRGDTILLKGKKRRDTICIALAD  81

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            DTCEE KIRMNKVVR+NLRVRLGDVVSVHQC DVKYGKRVHILPIDDTIEGVTG+LF++Y
Sbjct  82   DTCEESKIRMNKVVRSNLRVRLGDVVSVHQCQDVKYGKRVHILPIDDTIEGVTGNLFDAY  141

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FLV
Sbjct  142  LKPYFLEAYRPVRKGDLFLV  161



>ref|XP_010452210.1| PREDICTED: cell division control protein 48 homolog E [Camelina 
sativa]
Length=810

 Score =   261 bits (666),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MS++ ESSDSK  K+DFST ILERKK+PNRLVVDEA+NDDNSVV+L+PATMEKLQLFRGD
Sbjct  1    MSNKPESSDSKPKKEDFSTKILERKKSPNRLVVDEAINDDNSVVSLHPATMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDTV IALAD+TCEEPKIRMNKVVR+NLRVRLGDV+SVHQCPDVKYG RVH
Sbjct  61   TILIKGKKRKDTVCIALADETCEEPKIRMNKVVRSNLRVRLGDVISVHQCPDVKYGNRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDT+E VTG+LF+++LKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPVDDTVEAVTGNLFDAFLKPYFLEAYRPVRKGDLFLV  159



>ref|XP_011040486.1| PREDICTED: cell division cycle protein 48 homolog isoform X2 
[Populus euphratica]
Length=810

 Score =   260 bits (665),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/140 (88%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLV+DEA+NDDNSVVA++PATMEKLQ FRGDTVLIKGKKRKDTV I LAD
Sbjct  22   AILERKKSPNRLVIDEAINDDNSVVAMHPATMEKLQFFRGDTVLIKGKKRKDTVCIVLAD  81

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            + CEEPKIR+NKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTG LF++Y
Sbjct  82   EQCEEPKIRLNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGSLFDAY  141

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLE+YRP+RKGD FLV
Sbjct  142  LKPYFLESYRPVRKGDLFLV  161



>ref|XP_011040485.1| PREDICTED: cell division cycle protein 48 homolog isoform X1 
[Populus euphratica]
Length=811

 Score =   260 bits (665),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/140 (88%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLV+DEA+NDDNSVVA++PATMEKLQ FRGDTVLIKGKKRKDTV I LAD
Sbjct  23   AILERKKSPNRLVIDEAINDDNSVVAMHPATMEKLQFFRGDTVLIKGKKRKDTVCIVLAD  82

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            + CEEPKIR+NKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTG LF++Y
Sbjct  83   EQCEEPKIRLNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGSLFDAY  142

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLE+YRP+RKGD FLV
Sbjct  143  LKPYFLESYRPVRKGDLFLV  162



>ref|XP_008660526.1| PREDICTED: cell division control protein 48 homolog E-like [Zea 
mays]
 gb|AFW89668.1| hypothetical protein ZEAMMB73_027527 [Zea mays]
Length=804

 Score =   260 bits (665),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/140 (88%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA NDDNSVVAL+P TME+LQLFRGDTVLIKGKKRKDTV I LAD
Sbjct  21   AILERKKSPNRLVVDEATNDDNSVVALHPDTMERLQLFRGDTVLIKGKKRKDTVCIVLAD  80

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            +TCEEPK+RMNK+VR NLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEG+TG+LF+++
Sbjct  81   ETCEEPKVRMNKIVRKNLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGITGNLFDAF  140

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRPLRKGD FLV
Sbjct  141  LKPYFLEAYRPLRKGDLFLV  160



>ref|XP_002318682.2| hypothetical protein POPTR_0012s09000g [Populus trichocarpa]
 gb|EEE96902.2| hypothetical protein POPTR_0012s09000g [Populus trichocarpa]
Length=810

 Score =   260 bits (665),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/140 (88%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLV+DEA+NDDNSVVA++PATMEKLQ FRGDTVLIKGKKRKDTV I LAD
Sbjct  22   AILERKKSPNRLVIDEAINDDNSVVAMHPATMEKLQFFRGDTVLIKGKKRKDTVCIVLAD  81

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            + CEEPKIR+NKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTG LF++Y
Sbjct  82   EQCEEPKIRLNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGSLFDAY  141

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLE+YRP+RKGD FLV
Sbjct  142  LKPYFLESYRPVRKGDLFLV  161



>ref|XP_011046194.1| PREDICTED: cell division cycle protein 48 homolog isoform X2 
[Populus euphratica]
Length=727

 Score =   259 bits (661),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA+NDDNSVVA++PATMEKLQ FRGDTVLIKGKKR+DTV I LA+
Sbjct  25   AILERKKSPNRLVVDEAINDDNSVVAMHPATMEKLQFFRGDTVLIKGKKRRDTVCIVLAE  84

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            + C+EPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTG+LF++Y
Sbjct  85   EQCDEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGNLFDAY  144

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLE+YRP+RKGD FLV
Sbjct  145  LKPYFLESYRPVRKGDLFLV  164



>ref|XP_004493990.1| PREDICTED: cell division control protein 48 homolog D-like isoform 
X3 [Cicer arietinum]
Length=809

 Score =   260 bits (664),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M++Q ESSD+K TK+DFSTAILERKKAPNRLVVDEAVNDDNSVVAL+P TMEKLQLFRGD
Sbjct  1    MANQPESSDAKGTKRDFSTAILERKKAPNRLVVDEAVNDDNSVVALHPDTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIK  KRKDT+ IALAD+TCEEPKIRMNKVVR NLRVRLGDVVSVHQC DVKYGKRVH
Sbjct  61   TILIKVTKRKDTICIALADETCEEPKIRMNKVVRNNLRVRLGDVVSVHQCADVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPVDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDFFLV  159



>ref|XP_009400914.1| PREDICTED: cell division cycle protein 48 homolog [Musa acuminata 
subsp. malaccensis]
Length=809

 Score =   260 bits (664),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILE+KKAPNRL+VDEAVNDDNSVV++NP TMEKLQLFRGDT+L+KGKKR+DT+ IALAD
Sbjct  21   AILEKKKAPNRLIVDEAVNDDNSVVSMNPETMEKLQLFRGDTILLKGKKRRDTICIALAD  80

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            +TC+EPKIRMNKVVR+NLRVRLGDVVSVHQC DVKYGKRVHILPIDDTIEGVTG+LF++Y
Sbjct  81   ETCDEPKIRMNKVVRSNLRVRLGDVVSVHQCQDVKYGKRVHILPIDDTIEGVTGNLFDAY  140

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FLV
Sbjct  141  LKPYFLEAYRPVRKGDLFLV  160



>ref|XP_006354354.1| PREDICTED: cell division cycle protein 48 homolog [Solanum tuberosum]
Length=807

 Score =   260 bits (664),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MS++AESSDSK  KKDFSTAILERKK+PNRLVVDEA+NDDNSVV+L+P TMEKLQ FRGD
Sbjct  1    MSNKAESSDSKGPKKDFSTAILERKKSPNRLVVDEAINDDNSVVSLHPDTMEKLQFFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IAL D+TC+EPKIRMNKVVR NLRVRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIALVDETCDEPKIRMNKVVRNNLRVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILPIDD+IEGV+G+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPIDDSIEGVSGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>dbj|BAK08045.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=813

 Score =   259 bits (663),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA NDDNSVVAL+P TME+LQLFRGDTVL+KGKKRKDT+ I LAD
Sbjct  24   AILERKKSPNRLVVDEATNDDNSVVALHPDTMERLQLFRGDTVLLKGKKRKDTICIVLAD  83

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            DTCEEPKIRMNK VR NLRVRLGDVVSVHQCPDVKYGKRVHILPIDDT+EG+TG+LF+++
Sbjct  84   DTCEEPKIRMNKTVRKNLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTVEGITGNLFDAF  143

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRPLRKGD FLV
Sbjct  144  LKPYFLEAYRPLRKGDLFLV  163



>ref|NP_001048987.1| Os03g0151800 [Oryza sativa Japonica Group]
 gb|ABF94017.1| Cell division cycle protein 48, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF10901.1| Os03g0151800 [Oryza sativa Japonica Group]
 gb|EAY88576.1| hypothetical protein OsI_10049 [Oryza sativa Indica Group]
 gb|EAZ25611.1| hypothetical protein OsJ_09438 [Oryza sativa Japonica Group]
 dbj|BAG93786.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93843.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94265.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94339.1| unnamed protein product [Oryza sativa Japonica Group]
Length=809

 Score =   259 bits (663),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA NDDNSV+ ++P TMEKLQLFRGDTVL+KGKKRKDT+ I LAD
Sbjct  22   AILERKKSPNRLVVDEATNDDNSVIGMHPDTMEKLQLFRGDTVLLKGKKRKDTICIVLAD  81

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            DTCEEPKIRMNKVVR NLRVRLGDVVSVHQCPDVKYGKRVHILPIDDT+EG+TG+LF+++
Sbjct  82   DTCEEPKIRMNKVVRKNLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTVEGITGNLFDAF  141

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRPLRKGD FLV
Sbjct  142  LKPYFLEAYRPLRKGDLFLV  161



>ref|NP_190891.1| cell division control protein 48-B [Arabidopsis thaliana]
 sp|Q9SCN8.1|CD48D_ARATH RecName: Full=Cell division control protein 48 homolog D; Short=AtCDC48d; 
AltName: Full=Transitional endoplasmic reticulum 
ATPase D [Arabidopsis thaliana]
 emb|CAB64226.1| CDC48-like protein [Arabidopsis thaliana]
 dbj|BAF00697.1| CDC48 - like protein [Arabidopsis thaliana]
 gb|AEE79050.1| cell division control protein 48-D [Arabidopsis thaliana]
Length=815

 Score =   259 bits (663),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M++QAESSDSK TKKDFSTAILE+KKA NRLVVDEA+NDDNSVV+L+P TMEKLQLFRGD
Sbjct  1    MANQAESSDSKGTKKDFSTAILEKKKAANRLVVDEAINDDNSVVSLHPDTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDTV IALAD+TC+EPKIRMNKVVR+NLRVRLGDV+SVHQCPDVKYG RVH
Sbjct  61   TILIKGKKRKDTVCIALADETCDEPKIRMNKVVRSNLRVRLGDVISVHQCPDVKYGNRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEGV+G++F++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPLDDTIEGVSGNIFDAYLKPYFLEAYRPVRKGDLFLV  159



>ref|XP_010248585.1| PREDICTED: cell division control protein 48 homolog A-like isoform 
X2 [Nelumbo nucifera]
Length=698

 Score =   258 bits (658),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRL+VDEAVNDDNSVV++NPATMEKLQ FRGDTVLIKGKKR+DTV I L D
Sbjct  30   AILERKKSPNRLIVDEAVNDDNSVVSMNPATMEKLQFFRGDTVLIKGKKRRDTVCIVLVD  89

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            + CEE KIRMNKVVRANLRVRLGDV+SVHQCPDVKYGKRVHILPIDDTIEGVTG+LF++Y
Sbjct  90   EQCEEAKIRMNKVVRANLRVRLGDVISVHQCPDVKYGKRVHILPIDDTIEGVTGNLFDAY  149

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLE+YRP+RKGD FLV
Sbjct  150  LKPYFLESYRPVRKGDLFLV  169



>emb|CDY13308.1| BnaC06g14490D [Brassica napus]
Length=810

 Score =   259 bits (663),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M++Q ESSD K  K+DFSTAILE+KKA NRLVVDEA+NDDNSVV+L+P TMEKLQLFRGD
Sbjct  1    MANQPESSDPKGAKRDFSTAILEKKKAVNRLVVDEAINDDNSVVSLHPETMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+L+KGKKRKDTV IALADDTC+EPKIRMNKVVR+NLRVRLGDVVS+HQCPDVKYGKRVH
Sbjct  61   TILLKGKKRKDTVCIALADDTCDEPKIRMNKVVRSNLRVRLGDVVSIHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEG+TG++F++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPLDDTIEGITGNIFDAYLKPYFLEAYRPVRKGDLFLV  159



>ref|XP_011046193.1| PREDICTED: cell division cycle protein 48 homolog isoform X1 
[Populus euphratica]
Length=813

 Score =   259 bits (662),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA+NDDNSVVA++PATMEKLQ FRGDTVLIKGKKR+DTV I LA+
Sbjct  25   AILERKKSPNRLVVDEAINDDNSVVAMHPATMEKLQFFRGDTVLIKGKKRRDTVCIVLAE  84

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            + C+EPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTG+LF++Y
Sbjct  85   EQCDEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGNLFDAY  144

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLE+YRP+RKGD FLV
Sbjct  145  LKPYFLESYRPVRKGDLFLV  164



>ref|XP_008789550.1| PREDICTED: cell division cycle protein 48 homolog [Phoenix dactylifera]
Length=810

 Score =   259 bits (662),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 123/140 (88%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKKA NRL+VDEAVNDDNSVV+L+P TMEKLQLFRGDT+L+KGKKRKDT+ IALAD
Sbjct  22   AILERKKAANRLIVDEAVNDDNSVVSLHPETMEKLQLFRGDTILLKGKKRKDTICIALAD  81

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            D CEEPKIRMNKVVR+NLRVRLGDVVSVHQC DVKYGKRVHILPIDDTIEGVTG+LF++Y
Sbjct  82   DACEEPKIRMNKVVRSNLRVRLGDVVSVHQCQDVKYGKRVHILPIDDTIEGVTGNLFDAY  141

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FLV
Sbjct  142  LKPYFLEAYRPVRKGDLFLV  161



>ref|XP_009103848.1| PREDICTED: cell division control protein 48 homolog D [Brassica 
rapa]
Length=810

 Score =   259 bits (661),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M++Q ESSD K  K+DFSTAILE+KKA NRLVVDEA+NDDNSVV+L+P TMEKLQLFRGD
Sbjct  1    MANQPESSDPKGAKRDFSTAILEKKKAVNRLVVDEAINDDNSVVSLHPDTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            TVL+KGKKRKDTV IALADDTC+EPKIRMNKVVR+NLRVRLGDV+S+HQCPDVKYGKRVH
Sbjct  61   TVLLKGKKRKDTVCIALADDTCDEPKIRMNKVVRSNLRVRLGDVISIHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEG+TG++F++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPLDDTIEGITGNIFDAYLKPYFLEAYRPVRKGDLFLV  159



>ref|XP_001781154.1| predicted protein [Physcomitrella patens]
 gb|EDQ54022.1| predicted protein [Physcomitrella patens]
Length=815

 Score =   259 bits (662),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 124/140 (89%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKKAPNRL+VDEAVNDDNSVVALN  TMEKLQLFRGDTVLIKGKKRKDTV I LAD
Sbjct  26   AILERKKAPNRLIVDEAVNDDNSVVALNMETMEKLQLFRGDTVLIKGKKRKDTVCIVLAD  85

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            DTC+EPKIRMNKVVRANLRVRLGDVVSVHQC DVKYGKR+H+LP DD+IEGVTG+LF++Y
Sbjct  86   DTCDEPKIRMNKVVRANLRVRLGDVVSVHQCADVKYGKRIHVLPFDDSIEGVTGNLFDAY  145

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FLV
Sbjct  146  LKPYFLEAYRPVRKGDLFLV  165



>ref|XP_003558792.1| PREDICTED: cell division control protein 48 homolog E [Brachypodium 
distachyon]
Length=811

 Score =   259 bits (661),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA NDDNSV+AL+P TME+LQLFRGDTVL+KGKKRKDT+ I LAD
Sbjct  24   AILERKKSPNRLVVDEATNDDNSVLALHPETMERLQLFRGDTVLLKGKKRKDTICIVLAD  83

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            DTCEEPKIRMNK VR NLRVRLGDVVSVHQCPDVKYGKRVHILPIDDT+EG+TG+LF+++
Sbjct  84   DTCEEPKIRMNKTVRKNLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTVEGITGNLFDAF  143

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRPLRKGD FLV
Sbjct  144  LKPYFLEAYRPLRKGDLFLV  163



>gb|KDP31060.1| hypothetical protein JCGZ_11436 [Jatropha curcas]
Length=813

 Score =   259 bits (661),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA+NDDNSVV+++P TMEKLQLFRGDTVLIKGKKR+DTV I LAD
Sbjct  25   AILERKKSPNRLVVDEAINDDNSVVSMHPDTMEKLQLFRGDTVLIKGKKRRDTVCIVLAD  84

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            + CEEPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTG+LF++Y
Sbjct  85   EQCEEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGNLFDAY  144

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLE+YRP+RKGD FLV
Sbjct  145  LKPYFLESYRPVRKGDLFLV  164



>ref|XP_010102514.1| Cell division cycle protein 48-like protein [Morus notabilis]
 gb|EXB93578.1| Cell division cycle protein 48-like protein [Morus notabilis]
Length=867

 Score =   259 bits (663),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 124/140 (89%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEAVNDDNSVV+L+P TMEKLQ FRGDTVLIKGKKRKDTV I LAD
Sbjct  29   AILERKKSPNRLVVDEAVNDDNSVVSLHPNTMEKLQFFRGDTVLIKGKKRKDTVCIVLAD  88

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            + CEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGK+VHILPIDDTIEGVTG+LF++Y
Sbjct  89   EQCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKQVHILPIDDTIEGVTGNLFDAY  148

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLE+YRP+RKGD FLV
Sbjct  149  LKPYFLESYRPVRKGDLFLV  168



>gb|EMS63012.1| Cell division cycle protein 48-like protein [Triticum urartu]
Length=813

 Score =   259 bits (661),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA NDDNSVVAL+P TMEKLQLFRGDTVL+KGKKRKDT+ I LAD
Sbjct  24   AILERKKSPNRLVVDEATNDDNSVVALHPDTMEKLQLFRGDTVLLKGKKRKDTICIVLAD  83

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            DTCEEPKIRMNK VR NLRVRLGDVVSVHQCPDVKYGKRVH LPIDDT+EG+TG+LF+++
Sbjct  84   DTCEEPKIRMNKTVRKNLRVRLGDVVSVHQCPDVKYGKRVHTLPIDDTVEGITGNLFDAF  143

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRPLRKGD FLV
Sbjct  144  LKPYFLEAYRPLRKGDLFLV  163



>emb|CDX80862.1| BnaC03g01160D [Brassica napus]
Length=809

 Score =   259 bits (661),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA+NDDNSVV+L+P  MEKLQLFRGDT+LIKGKKRKDT+ IALAD
Sbjct  30   AILERKKSPNRLVVDEAINDDNSVVSLHPNAMEKLQLFRGDTILIKGKKRKDTICIALAD  89

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            ++CEEPKIRMNKVVR+NLRVRLGDVVS+HQCPDVKYG RVHILP+DDT+EGVTG+LF++Y
Sbjct  90   ESCEEPKIRMNKVVRSNLRVRLGDVVSIHQCPDVKYGTRVHILPVDDTVEGVTGNLFDAY  149

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FLV
Sbjct  150  LKPYFLEAYRPVRKGDLFLV  169



>ref|XP_009397889.1| PREDICTED: cell division cycle protein 48 homolog [Musa acuminata 
subsp. malaccensis]
Length=809

 Score =   258 bits (660),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILE+KKAPNRL+VDEA NDDNSVV++NP TMEKLQLFRGDT+L+KGKKR+DT+ IALAD
Sbjct  21   AILEKKKAPNRLIVDEATNDDNSVVSMNPETMEKLQLFRGDTILLKGKKRRDTICIALAD  80

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            DTC+EPKIRMNKVVR+NLRVRLGDVVSVHQC +VKYGKRVHILPIDDTIEGVTG+LF++Y
Sbjct  81   DTCDEPKIRMNKVVRSNLRVRLGDVVSVHQCQNVKYGKRVHILPIDDTIEGVTGNLFDAY  140

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FLV
Sbjct  141  LKPYFLEAYRPVRKGDLFLV  160



>ref|XP_009376815.1| PREDICTED: cell division control protein 48 homolog D-like [Pyrus 
x bretschneideri]
Length=806

 Score =   258 bits (660),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M+ +AESSDSK TK+DFSTAILERKKA NRLVVD+A+NDDNSVVAL+P TMEKLQLFRGD
Sbjct  1    MTDKAESSDSKGTKRDFSTAILERKKAANRLVVDDAINDDNSVVALHPDTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIK KKRKDT+ IALADDTCEEPKIRMNKVVR+NLRVRLGDVVSVHQC DVKYGKRVH
Sbjct  61   TILIKVKKRKDTICIALADDTCEEPKIRMNKVVRSNLRVRLGDVVSVHQCADVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPVDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>ref|XP_009376076.1| PREDICTED: uncharacterized protein LOC103964820 isoform X1 [Pyrus 
x bretschneideri]
Length=450

 Score =   250 bits (639),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 144/159 (91%), Gaps = 2/159 (1%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M+HQAESSDSK+       A LERKK+PN LVVDEAVNDDNS+V+++P TMEKLQLFRGD
Sbjct  1    MAHQAESSDSKNKDLWT--ATLERKKSPNCLVVDEAVNDDNSIVSMHPETMEKLQLFRGD  58

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IALAD TCEEP+IRMNKVVR+NLRVR+GDVVSVH CPDVKYGKRVH
Sbjct  59   TILIKGKKRKDTICIALADYTCEEPRIRMNKVVRSNLRVRIGDVVSVHLCPDVKYGKRVH  118

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILPIDD+IEGVTG+LF+++LKPYFLEAYR +RKGD FLV
Sbjct  119  ILPIDDSIEGVTGNLFDAFLKPYFLEAYRLVRKGDLFLV  157



>ref|XP_001771056.1| predicted protein [Physcomitrella patens]
 gb|EDQ64057.1| predicted protein [Physcomitrella patens]
Length=820

 Score =   258 bits (660),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/140 (89%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKKAPNRLVVDEAVNDDNSVVALN  TMEKLQLFRGDTVLIKGKKRKDTV I LAD
Sbjct  32   AILERKKAPNRLVVDEAVNDDNSVVALNMETMEKLQLFRGDTVLIKGKKRKDTVCIVLAD  91

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            DTC+EPKIRMNKVVRANLRVRLGDVVSVHQC DVKYGK++H+LP DD+IEGVTG+LF++Y
Sbjct  92   DTCDEPKIRMNKVVRANLRVRLGDVVSVHQCADVKYGKQIHVLPFDDSIEGVTGNLFDAY  151

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FLV
Sbjct  152  LKPYFLEAYRPVRKGDLFLV  171



>emb|CDX73571.1| BnaC08g24320D [Brassica napus]
Length=743

 Score =   257 bits (657),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M++QA+SSDSK TKKDFSTAILERKKA NRLVVDEA+NDDNS+V+L+P TMEKLQLFRG+
Sbjct  1    MANQADSSDSKGTKKDFSTAILERKKAANRLVVDEAINDDNSIVSLHPDTMEKLQLFRGE  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
             VLIKGKKRKDTV IALADDTC EPKIRMNKVVR+NLRVRLGDV+S+HQCPDVKYG RVH
Sbjct  61   VVLIKGKKRKDTVCIALADDTCAEPKIRMNKVVRSNLRVRLGDVISLHQCPDVKYGNRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            +LPIDDTIEGVTG++F++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  VLPIDDTIEGVTGNIFDAYLKPYFLEAYRPVRKGDLFLV  159



>ref|XP_002989888.1| hypothetical protein SELMODRAFT_269585 [Selaginella moellendorffii]
 gb|EFJ08901.1| hypothetical protein SELMODRAFT_269585 [Selaginella moellendorffii]
Length=805

 Score =   258 bits (659),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/140 (89%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKKAPNRLVVDEA NDDNSVVAL+P TMEKLQLFRGDTVLIKGKKRKDTV I LAD
Sbjct  22   AILERKKAPNRLVVDEATNDDNSVVALHPETMEKLQLFRGDTVLIKGKKRKDTVCIVLAD  81

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            D+CEEPKIRMNKVVR NLRVRLGDVVSVHQC DVKYGKRVHILP+DDTIEG+TG+LF++Y
Sbjct  82   DSCEEPKIRMNKVVRTNLRVRLGDVVSVHQCADVKYGKRVHILPVDDTIEGLTGNLFDAY  141

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RK D FLV
Sbjct  142  LKPYFLEAYRPVRKADLFLV  161



>ref|XP_002968637.1| hypothetical protein SELMODRAFT_145748 [Selaginella moellendorffii]
 gb|EFJ29753.1| hypothetical protein SELMODRAFT_145748 [Selaginella moellendorffii]
Length=809

 Score =   258 bits (659),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/140 (89%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKKAPNRLVVDEA NDDNSVVAL+P TMEKLQLFRGDTVLIKGKKRKDTV I LAD
Sbjct  26   AILERKKAPNRLVVDEATNDDNSVVALHPETMEKLQLFRGDTVLIKGKKRKDTVCIVLAD  85

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            D+CEEPKIRMNKVVR NLRVRLGDVVSVHQC DVKYGKRVHILP+DDTIEG+TG+LF++Y
Sbjct  86   DSCEEPKIRMNKVVRTNLRVRLGDVVSVHQCADVKYGKRVHILPVDDTIEGLTGNLFDAY  145

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RK D FLV
Sbjct  146  LKPYFLEAYRPVRKADLFLV  165



>gb|EMS47029.1| Cell division cycle protein 48-like protein [Triticum urartu]
Length=818

 Score =   258 bits (658),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA NDDNSVVAL+P TME+LQLFRGDTVL+KGKKRKDT+ I LAD
Sbjct  29   AILERKKSPNRLVVDEATNDDNSVVALHPDTMERLQLFRGDTVLLKGKKRKDTICIVLAD  88

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            DTC+EPKIRMNK VR NLRVRLGDVVSVHQCPDVKYGKRVHILPIDDT+EG+TG+LF+++
Sbjct  89   DTCDEPKIRMNKTVRKNLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTVEGITGNLFDAF  148

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRPLRKGD FLV
Sbjct  149  LKPYFLEAYRPLRKGDLFLV  168



>ref|XP_010248584.1| PREDICTED: cell division cycle protein 48 homolog isoform X1 
[Nelumbo nucifera]
Length=818

 Score =   257 bits (657),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRL+VDEAVNDDNSVV++NPATMEKLQ FRGDTVLIKGKKR+DTV I L D
Sbjct  30   AILERKKSPNRLIVDEAVNDDNSVVSMNPATMEKLQFFRGDTVLIKGKKRRDTVCIVLVD  89

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            + CEE KIRMNKVVRANLRVRLGDV+SVHQCPDVKYGKRVHILPIDDTIEGVTG+LF++Y
Sbjct  90   EQCEEAKIRMNKVVRANLRVRLGDVISVHQCPDVKYGKRVHILPIDDTIEGVTGNLFDAY  149

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLE+YRP+RKGD FLV
Sbjct  150  LKPYFLESYRPVRKGDLFLV  169



>dbj|BAL14440.1| cell division cycle protein 48 homolog [Allium cepa]
Length=808

 Score =   257 bits (657),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKKA NRLVVDEAVNDDNSVVA++P TMEKLQLFRGDT+L+KGKKRKDT+ I LAD
Sbjct  21   AILERKKAANRLVVDEAVNDDNSVVAMHPETMEKLQLFRGDTILLKGKKRKDTICIVLAD  80

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            DT EEPKIRMNKVVR+NLRVRLGDVVSVHQCPDVKYGKRVHILP+DDTIEGVTG++F++Y
Sbjct  81   DTSEEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVHILPVDDTIEGVTGNIFDAY  140

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLE+YRP+RKGD FLV
Sbjct  141  LKPYFLESYRPVRKGDFFLV  160



>ref|XP_003558791.1| PREDICTED: cell division control protein 48 homolog E-like [Brachypodium 
distachyon]
Length=811

 Score =   257 bits (657),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA NDDNSVVAL+P TME+LQLFRGDTVL+KGKKRKDT+ I LAD
Sbjct  24   AILERKKSPNRLVVDEATNDDNSVVALHPDTMERLQLFRGDTVLLKGKKRKDTICIVLAD  83

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            +TCEEPK+RMNK VR NLRVRLGDVVSVHQCPDVKYGKRVHILPIDDT+EG+TG+LF+++
Sbjct  84   ETCEEPKVRMNKTVRKNLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTVEGITGNLFDAF  143

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRPLRKGD FLV
Sbjct  144  LKPYFLEAYRPLRKGDLFLV  163



>ref|XP_008671992.1| PREDICTED: uncharacterized protein LOC100278319 isoform X1 [Zea 
mays]
Length=807

 Score =   257 bits (656),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA NDDNSVVAL+P TME+LQLFRGDTVL+KGKKRKDT+ I LAD
Sbjct  21   AILERKKSPNRLVVDEATNDDNSVVALHPDTMERLQLFRGDTVLLKGKKRKDTICIVLAD  80

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            +TCEEPK+RMNKVVR NLRVRL DVVSVHQCPDVKYGKRVHILPIDDTIEG+TG+LF+++
Sbjct  81   ETCEEPKVRMNKVVRKNLRVRLSDVVSVHQCPDVKYGKRVHILPIDDTIEGITGNLFDAF  140

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRPLRKGD FLV
Sbjct  141  LKPYFLEAYRPLRKGDLFLV  160



>ref|XP_002511356.1| Transitional endoplasmic reticulum ATPase, putative [Ricinus 
communis]
 gb|EEF51958.1| Transitional endoplasmic reticulum ATPase, putative [Ricinus 
communis]
Length=804

 Score =   257 bits (656),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA+NDDNSVV+++P TME LQLFRGDTVLIKGKKRKDTV I LAD
Sbjct  25   AILERKKSPNRLVVDEAINDDNSVVSMHPDTMETLQLFRGDTVLIKGKKRKDTVCIVLAD  84

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            + CE+PKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTG++F++Y
Sbjct  85   EQCEQPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGNIFDAY  144

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLE+YRP+RKGD FLV
Sbjct  145  LKPYFLESYRPVRKGDLFLV  164



>ref|XP_008464542.1| PREDICTED: cell division cycle protein 48 homolog [Cucumis melo]
Length=819

 Score =   257 bits (656),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA+NDDNSVV+L+PATMEKLQ FRGDT+L+KGKKR+DTV I LAD
Sbjct  32   AILERKKSPNRLVVDEAINDDNSVVSLHPATMEKLQFFRGDTILLKGKKRRDTVCIVLAD  91

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            + CEE KIRMNK+VR NLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTG+LF++Y
Sbjct  92   EQCEESKIRMNKIVRGNLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGNLFDAY  151

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FLV
Sbjct  152  LKPYFLEAYRPVRKGDLFLV  171



>ref|XP_004985671.1| PREDICTED: cell division control protein 48 homolog E-like isoform 
X2 [Setaria italica]
Length=806

 Score =   257 bits (656),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA NDDNSVVAL+P TME+LQLFRGDTVL+KGKKRKDT+ I LAD
Sbjct  22   AILERKKSPNRLVVDEATNDDNSVVALHPDTMERLQLFRGDTVLLKGKKRKDTICIVLAD  81

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            DTCEEPKIRMNKVVR NLRVRLGDV+SVHQCPDVKYGKRVHILPIDDT+EG+TG+LF+++
Sbjct  82   DTCEEPKIRMNKVVRKNLRVRLGDVISVHQCPDVKYGKRVHILPIDDTVEGITGNLFDAF  141

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RK D FLV
Sbjct  142  LKPYFLEAYRPVRKSDLFLV  161



>ref|XP_004985670.1| PREDICTED: cell division control protein 48 homolog E-like isoform 
X1 [Setaria italica]
Length=805

 Score =   256 bits (655),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA NDDNSVVAL+P TME+LQLFRGDTVL+KGKKRKDT+ I LAD
Sbjct  21   AILERKKSPNRLVVDEATNDDNSVVALHPDTMERLQLFRGDTVLLKGKKRKDTICIVLAD  80

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            DTCEEPKIRMNKVVR NLRVRLGDV+SVHQCPDVKYGKRVHILPIDDT+EG+TG+LF+++
Sbjct  81   DTCEEPKIRMNKVVRKNLRVRLGDVISVHQCPDVKYGKRVHILPIDDTVEGITGNLFDAF  140

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RK D FLV
Sbjct  141  LKPYFLEAYRPVRKSDLFLV  160



>ref|XP_001769513.1| predicted protein [Physcomitrella patens]
 gb|EDQ65674.1| predicted protein [Physcomitrella patens]
Length=816

 Score =   257 bits (656),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 123/140 (88%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKKAPNRL+VDEAVNDDNSVVALN   MEKLQLFRGDTVLIKGKKRKDTV I LAD
Sbjct  26   AILERKKAPNRLIVDEAVNDDNSVVALNMEIMEKLQLFRGDTVLIKGKKRKDTVCIVLAD  85

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            DTC+EPKIRMNKVVRANLRVRLGDVVSVHQC DVKYGKR+H+LP DD+IEGVTG+LF++Y
Sbjct  86   DTCDEPKIRMNKVVRANLRVRLGDVVSVHQCADVKYGKRIHVLPFDDSIEGVTGNLFDAY  145

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FLV
Sbjct  146  LKPYFLEAYRPVRKGDLFLV  165



>ref|XP_004298972.1| PREDICTED: cell division cycle protein 48 homolog [Fragaria vesca 
subsp. vesca]
Length=814

 Score =   257 bits (656),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA+NDDNSVV+L+PATMEKLQ FRGDTVLIKGKKRKDTV I LAD
Sbjct  28   AILERKKSPNRLVVDEAINDDNSVVSLHPATMEKLQFFRGDTVLIKGKKRKDTVCIVLAD  87

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            + C+EP+IRMNKVVRANLRVRLGDVVSVH CPDVKYGKRVHILPIDDTIEGV+G+LF++Y
Sbjct  88   EQCDEPRIRMNKVVRANLRVRLGDVVSVHTCPDVKYGKRVHILPIDDTIEGVSGNLFDAY  147

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLE+YRP+RKGD FLV
Sbjct  148  LKPYFLESYRPVRKGDLFLV  167



>gb|EMT10596.1| Cell division control 48-E-like protein [Aegilops tauschii]
Length=903

 Score =   258 bits (658),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA NDDNSVVAL+P TME+LQLFRGDTVL+KGKKRKDT+ I LAD
Sbjct  24   AILERKKSPNRLVVDEATNDDNSVVALHPDTMERLQLFRGDTVLLKGKKRKDTICIVLAD  83

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            DTCEEPKIRMNK VR NLRVRLGDVVSVHQCPDVKYGKRVH LPIDDT+EG+TG+LF+++
Sbjct  84   DTCEEPKIRMNKTVRKNLRVRLGDVVSVHQCPDVKYGKRVHTLPIDDTVEGITGNLFDAF  143

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRPLRKGD FLV
Sbjct  144  LKPYFLEAYRPLRKGDLFLV  163



>ref|XP_006649413.1| PREDICTED: cell division control protein 48 homolog E-like [Oryza 
brachyantha]
Length=809

 Score =   256 bits (655),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA NDDNSV+ ++  TMEKLQLFRGDTVL+KGKKRKDT+ I LAD
Sbjct  22   AILERKKSPNRLVVDEATNDDNSVIGMHSDTMEKLQLFRGDTVLLKGKKRKDTICIVLAD  81

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            DTCEEPKIRMNKVVR NLRVRLGDVVSVHQCPDVKYGKRVHILPIDDT+EG+TG+LF+++
Sbjct  82   DTCEEPKIRMNKVVRKNLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTVEGITGNLFDAF  141

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRPLRKGD FLV
Sbjct  142  LKPYFLEAYRPLRKGDLFLV  161



>ref|XP_009408125.1| PREDICTED: cell division cycle protein 48 homolog [Musa acuminata 
subsp. malaccensis]
Length=812

 Score =   256 bits (654),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKKA NRL+VDEA+NDDNSVV+LNP TMEKLQLFRGDTVL+KGKKR+DT+ IALAD
Sbjct  23   AILERKKAANRLIVDEAINDDNSVVSLNPETMEKLQLFRGDTVLLKGKKRRDTICIALAD  82

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            DTCEEPKIRMNKVVR+NLRVRLGDVVSVHQC DVKYGKRVHILP+DDTIEG+TG+LF+ Y
Sbjct  83   DTCEEPKIRMNKVVRSNLRVRLGDVVSVHQCQDVKYGKRVHILPVDDTIEGITGNLFDVY  142

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LK YFLEAYRP+RKGD FLV
Sbjct  143  LKSYFLEAYRPVRKGDLFLV  162



>gb|AEI01159.1| cell division cycle protein 48 [Zea mays]
Length=768

 Score =   255 bits (652),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA NDDNSVVAL+P TME+LQLFRGDTVL+KGKKRKDT+ I LAD
Sbjct  23   AILERKKSPNRLVVDEATNDDNSVVALHPDTMERLQLFRGDTVLLKGKKRKDTICIVLAD  82

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            +TCEEPK+RMNKVVR NLRVRLGDVVSVHQC DVKYGKRVHILPIDDT+EG+TG+LF+++
Sbjct  83   ETCEEPKVRMNKVVRQNLRVRLGDVVSVHQCQDVKYGKRVHILPIDDTVEGITGNLFDAF  142

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRPLRKGD FLV
Sbjct  143  LKPYFLEAYRPLRKGDLFLV  162



>ref|XP_002467173.1| hypothetical protein SORBIDRAFT_01g020910 [Sorghum bicolor]
 gb|EER94171.1| hypothetical protein SORBIDRAFT_01g020910 [Sorghum bicolor]
Length=810

 Score =   256 bits (653),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA NDDNSVVAL+P TME+LQLFRGDTVL+KGKKRKDT+ I LAD
Sbjct  23   AILERKKSPNRLVVDEATNDDNSVVALHPDTMERLQLFRGDTVLLKGKKRKDTICIVLAD  82

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            +TCEEPK+RMNKVVR NLRVRLGDVVSVHQC DVKYGKRVHILPIDDT+EG+TG+LF+++
Sbjct  83   ETCEEPKVRMNKVVRQNLRVRLGDVVSVHQCQDVKYGKRVHILPIDDTVEGITGNLFDAF  142

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRPLRKGD FLV
Sbjct  143  LKPYFLEAYRPLRKGDLFLV  162



>ref|XP_001777213.1| predicted protein [Physcomitrella patens]
 gb|EDQ57993.1| predicted protein [Physcomitrella patens]
Length=804

 Score =   256 bits (653),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/140 (88%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKKAPNRLVVDEAVNDDNSVVAL+  TMEKLQLFRGDTVLIKGKKRKDTV I L+D
Sbjct  15   AILERKKAPNRLVVDEAVNDDNSVVALSMETMEKLQLFRGDTVLIKGKKRKDTVCIVLSD  74

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            DTC+E KIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKR+H+LP DD+IEGVTG+LF++Y
Sbjct  75   DTCDEHKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRIHVLPFDDSIEGVTGNLFDAY  134

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FLV
Sbjct  135  LKPYFLEAYRPVRKGDLFLV  154



>ref|XP_004155087.1| PREDICTED: cell division cycle protein 48 homolog [Cucumis sativus]
Length=728

 Score =   254 bits (649),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA+NDDNSVV+L+PATMEKLQ FRGDT+L+KGKKR+DTV I LAD
Sbjct  32   AILERKKSPNRLVVDEAINDDNSVVSLHPATMEKLQFFRGDTILLKGKKRRDTVCIVLAD  91

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            + CEE KIRMNK+VR NLRVRLGD+VSVHQCPDVKYG RVHILPIDDTIEGVTG+LF++Y
Sbjct  92   EQCEESKIRMNKIVRGNLRVRLGDIVSVHQCPDVKYGNRVHILPIDDTIEGVTGNLFDAY  151

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FLV
Sbjct  152  LKPYFLEAYRPVRKGDLFLV  171



>ref|XP_008644026.1| PREDICTED: uncharacterized protein LOC100382880 isoform X1 [Zea 
mays]
Length=811

 Score =   255 bits (652),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA NDDNSVVAL+P TME+LQLFRGDTVL+KGKKRKDT+ I LAD
Sbjct  23   AILERKKSPNRLVVDEATNDDNSVVALHPDTMERLQLFRGDTVLLKGKKRKDTICIVLAD  82

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            +TCEEPK+RMNKVVR NLRVRLGDVVSVHQC DVKYGKRVHILPIDDT+EG+TG+LF+++
Sbjct  83   ETCEEPKVRMNKVVRQNLRVRLGDVVSVHQCQDVKYGKRVHILPIDDTVEGITGNLFDAF  142

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRPLRKGD FLV
Sbjct  143  LKPYFLEAYRPLRKGDLFLV  162



>gb|EEC67044.1| hypothetical protein OsI_33786 [Oryza sativa Indica Group]
Length=755

 Score =   254 bits (649),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA NDDNSVVAL+P TME+LQLFRGDTVL+KGKKRKDT+ I LAD
Sbjct  22   AILERKKSPNRLVVDEATNDDNSVVALHPDTMERLQLFRGDTVLLKGKKRKDTICIVLAD  81

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            +TCEEPKIRMNKVVR NLRVRLGDVVSVHQC DVKYGKRVHILPIDDT+EG+TG+LF+++
Sbjct  82   ETCEEPKIRMNKVVRKNLRVRLGDVVSVHQCQDVKYGKRVHILPIDDTVEGITGNLFDAF  141

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FLV
Sbjct  142  LKPYFLEAYRPVRKGDLFLV  161



>ref|XP_008668346.1| PREDICTED: uncharacterized protein LOC100274218 isoform X1 [Zea 
mays]
 tpg|DAA49847.1| TPA: hypothetical protein ZEAMMB73_992208 [Zea mays]
Length=810

 Score =   255 bits (651),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA NDDNSVVAL+P TME+LQLFRGDTVL+KGKKRKDTV I LAD
Sbjct  23   AILERKKSPNRLVVDEATNDDNSVVALHPDTMERLQLFRGDTVLLKGKKRKDTVCIVLAD  82

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            +TCEEPK+RMNKVVR NLRVRLGDVVSVHQC DVKYGKRVHILPIDDT+EG+TG+LF+++
Sbjct  83   ETCEEPKVRMNKVVRQNLRVRLGDVVSVHQCQDVKYGKRVHILPIDDTVEGITGNLFDAF  142

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FLV
Sbjct  143  LKPYFLEAYRPVRKGDLFLV  162



>gb|AAP53974.2| Cell division cycle protein 48, putative, expressed [Oryza sativa 
Japonica Group]
 gb|EEE51030.1| hypothetical protein OsJ_31677 [Oryza sativa Japonica Group]
Length=808

 Score =   255 bits (651),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA NDDNSVVAL+P TME+LQLFRGDTVL+KGKKRKDT+ I LAD
Sbjct  22   AILERKKSPNRLVVDEATNDDNSVVALHPDTMERLQLFRGDTVLLKGKKRKDTICIVLAD  81

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            +TCEEPKIRMNKVVR NLRVRLGDVVSVHQC DVKYGKRVHILPIDDT+EG+TG+LF+++
Sbjct  82   ETCEEPKIRMNKVVRKNLRVRLGDVVSVHQCQDVKYGKRVHILPIDDTVEGITGNLFDAF  141

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FLV
Sbjct  142  LKPYFLEAYRPVRKGDLFLV  161



>gb|AFW68686.1| hypothetical protein ZEAMMB73_070374 [Zea mays]
Length=845

 Score =   255 bits (652),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA NDDNSVVAL+P TME+LQLFRGDTVL+KGKKRKDT+ I LAD
Sbjct  23   AILERKKSPNRLVVDEATNDDNSVVALHPDTMERLQLFRGDTVLLKGKKRKDTICIVLAD  82

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            +TCEEPK+RMNKVVR NLRVRLGDVVSVHQC DVKYGKRVHILPIDDT+EG+TG+LF+++
Sbjct  83   ETCEEPKVRMNKVVRQNLRVRLGDVVSVHQCQDVKYGKRVHILPIDDTVEGITGNLFDAF  142

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRPLRKGD FLV
Sbjct  143  LKPYFLEAYRPLRKGDLFLV  162



>ref|XP_004138100.1| PREDICTED: cell division cycle protein 48 homolog [Cucumis sativus]
 gb|KGN63558.1| hypothetical protein Csa_1G004250 [Cucumis sativus]
Length=819

 Score =   255 bits (651),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA+NDDNSVV+L+PATMEKLQ FRGDT+L+KGKKR+DTV I LAD
Sbjct  32   AILERKKSPNRLVVDEAINDDNSVVSLHPATMEKLQFFRGDTILLKGKKRRDTVCIVLAD  91

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            + CEE KIRMNK+VR NLRVRLGD+VSVHQCPDVKYG RVHILPIDDTIEGVTG+LF++Y
Sbjct  92   EQCEESKIRMNKIVRGNLRVRLGDIVSVHQCPDVKYGNRVHILPIDDTIEGVTGNLFDAY  151

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FLV
Sbjct  152  LKPYFLEAYRPVRKGDLFLV  171



>ref|XP_006662392.1| PREDICTED: cell division cycle protein 48 homolog [Oryza brachyantha]
Length=808

 Score =   255 bits (651),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA NDDNSVVAL+P TME+LQLFRGDTVL+KGKKRKDT+ I LAD
Sbjct  22   AILERKKSPNRLVVDEATNDDNSVVALHPDTMERLQLFRGDTVLLKGKKRKDTICIVLAD  81

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            +TCEEPKIRMNKVVR NLRVRLGDVVSVHQC DVKYGKRVHILPIDDT+EG+TG+LF+++
Sbjct  82   ETCEEPKIRMNKVVRKNLRVRLGDVVSVHQCQDVKYGKRVHILPIDDTVEGITGNLFDAF  141

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FLV
Sbjct  142  LKPYFLEAYRPVRKGDLFLV  161



>gb|KHN30934.1| Cell division cycle protein 48 like [Glycine soja]
Length=812

 Score =   255 bits (651),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA+ND+NSVV L+P TMEKLQ FRGDTVLIKGKKR+DT+ + LAD
Sbjct  28   AILERKKSPNRLVVDEAINDENSVVTLHPETMEKLQFFRGDTVLIKGKKRRDTICVVLAD  87

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            + C+EPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTG+LF++Y
Sbjct  88   EQCDEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGNLFDAY  147

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYF+E+YRP+RKGD FLV
Sbjct  148  LKPYFMESYRPVRKGDLFLV  167



>ref|XP_003523092.1| PREDICTED: cell division cycle protein 48 homolog [Glycine max]
Length=814

 Score =   255 bits (651),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA+ND+NSVV L+P TMEKLQ FRGDTVLIKGKKR+DT+ + LAD
Sbjct  28   AILERKKSPNRLVVDEAINDENSVVTLHPETMEKLQFFRGDTVLIKGKKRRDTICVVLAD  87

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            + C+EPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTG+LF++Y
Sbjct  88   EQCDEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGNLFDAY  147

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYF+E+YRP+RKGD FLV
Sbjct  148  LKPYFMESYRPVRKGDLFLV  167



>gb|KEH39372.1| ATPase, AAA-type, CDC48 protein [Medicago truncatula]
Length=734

 Score =   253 bits (647),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKKAPNRLVVDEAVN DNS+VA++P TMEKL LFRGDT+LIKGKKRKD+V IAL D
Sbjct  22   AILERKKAPNRLVVDEAVNGDNSIVAMHPQTMEKLGLFRGDTILIKGKKRKDSVCIALGD  81

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            DTCEEP+IRMNKVVR+NLRVRLGDVVSVHQC DVKYGKRVHILPIDDTIEG+TG+LF+++
Sbjct  82   DTCEEPRIRMNKVVRSNLRVRLGDVVSVHQCTDVKYGKRVHILPIDDTIEGLTGNLFDAF  141

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYF+EAYRP+RKGD FLV
Sbjct  142  LKPYFVEAYRPVRKGDLFLV  161



>ref|XP_004983011.1| PREDICTED: cell division cycle protein 48 homolog isoform X2 
[Setaria italica]
Length=810

 Score =   254 bits (650),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA NDDNSVVAL+P TME+LQLFRGDTVL+KGKKRKDT+ I LAD
Sbjct  23   AILERKKSPNRLVVDEATNDDNSVVALHPDTMERLQLFRGDTVLLKGKKRKDTICIVLAD  82

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            +TCEEPK+RMNKVVR NLRVRLGDVVSVHQC DVKYGKRVHILPIDDT+EG+TG+LF+++
Sbjct  83   ETCEEPKVRMNKVVRQNLRVRLGDVVSVHQCQDVKYGKRVHILPIDDTVEGITGNLFDAF  142

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FLV
Sbjct  143  LKPYFLEAYRPVRKGDLFLV  162



>ref|XP_004983010.1| PREDICTED: cell division cycle protein 48 homolog isoform X1 
[Setaria italica]
Length=834

 Score =   254 bits (650),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA NDDNSVVAL+P TME+LQLFRGDTVL+KGKKRKDT+ I LAD
Sbjct  23   AILERKKSPNRLVVDEATNDDNSVVALHPDTMERLQLFRGDTVLLKGKKRKDTICIVLAD  82

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            +TCEEPK+RMNKVVR NLRVRLGDVVSVHQC DVKYGKRVHILPIDDT+EG+TG+LF+++
Sbjct  83   ETCEEPKVRMNKVVRQNLRVRLGDVVSVHQCQDVKYGKRVHILPIDDTVEGITGNLFDAF  142

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FLV
Sbjct  143  LKPYFLEAYRPVRKGDLFLV  162



>ref|XP_010907037.1| PREDICTED: cell division cycle protein 48 homolog [Elaeis guineensis]
Length=811

 Score =   254 bits (649),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKKAPNRL+VDEAVNDDNSVV++NP TMEKLQLFRGDT+L+KGKKR+DT+ I L D
Sbjct  23   AILERKKAPNRLIVDEAVNDDNSVVSMNPETMEKLQLFRGDTILLKGKKRRDTICIVLVD  82

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            D CEE KIRMNKVVR+NLRVRLGDVVSVHQC DVKYGKRVHILPIDDTIEGVTG+LF++Y
Sbjct  83   DACEEAKIRMNKVVRSNLRVRLGDVVSVHQCQDVKYGKRVHILPIDDTIEGVTGNLFDAY  142

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLE+YRP+RKGD FLV
Sbjct  143  LKPYFLESYRPVRKGDLFLV  162



>ref|XP_002321618.1| hypothetical protein POPTR_0015s09220g [Populus trichocarpa]
 gb|EEF05745.1| hypothetical protein POPTR_0015s09220g [Populus trichocarpa]
Length=813

 Score =   254 bits (649),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA+NDDNSVVA++PATMEKLQ FRGDTVLIKGKKR+DTV I LA+
Sbjct  25   AILERKKSPNRLVVDEAINDDNSVVAMHPATMEKLQFFRGDTVLIKGKKRRDTVCIVLAE  84

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            + CEEPKIRMNKVVRANLRV LGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTG+LF++Y
Sbjct  85   EQCEEPKIRMNKVVRANLRVCLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGNLFDAY  144

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLE+YRP+RK D FLV
Sbjct  145  LKPYFLESYRPVRKDDLFLV  164



>emb|CDX78154.1| BnaA09g33490D [Brassica napus]
Length=744

 Score =   253 bits (645),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M +QA SSDSK TKKDFSTAILERKKA NRLVVDEA+NDDNS+V L+P TMEKLQLFRGD
Sbjct  1    MRNQAGSSDSKGTKKDFSTAILERKKAANRLVVDEAINDDNSIVYLHPETMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            TVLIKGKKRKDTV IAL DDTCEEPKIRMNKVVR+NLRVRLGDV+S+HQ PDVKYG RVH
Sbjct  61   TVLIKGKKRKDTVCIALPDDTCEEPKIRMNKVVRSNLRVRLGDVISLHQFPDVKYGNRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            +LPIDDTIEGVTG++F++YLKPYFLEAYRP++KGD FLV
Sbjct  121  VLPIDDTIEGVTGNIFDAYLKPYFLEAYRPVKKGDLFLV  159



>ref|XP_003638042.1| Cell division control protein-like protein [Medicago truncatula]
Length=808

 Score =   253 bits (647),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKKAPNRLVVDEAVN DNS+VA++P TMEKL LFRGDT+LIKGKKRKD+V IAL D
Sbjct  22   AILERKKAPNRLVVDEAVNGDNSIVAMHPQTMEKLGLFRGDTILIKGKKRKDSVCIALGD  81

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            DTCEEP+IRMNKVVR+NLRVRLGDVVSVHQC DVKYGKRVHILPIDDTIEG+TG+LF+++
Sbjct  82   DTCEEPRIRMNKVVRSNLRVRLGDVVSVHQCTDVKYGKRVHILPIDDTIEGLTGNLFDAF  141

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYF+EAYRP+RKGD FLV
Sbjct  142  LKPYFVEAYRPVRKGDLFLV  161



>ref|XP_001768037.1| predicted protein [Physcomitrella patens]
 gb|EDQ67109.1| predicted protein [Physcomitrella patens]
Length=812

 Score =   253 bits (647),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKKA NRLVVDEAVNDDNSVVALN  TM+KLQLFRGDTVLIKGKKRKDTV I LAD
Sbjct  20   AILERKKATNRLVVDEAVNDDNSVVALNTETMDKLQLFRGDTVLIKGKKRKDTVCIVLAD  79

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            +TCEEPKIRMNKVVRANLRVRLGDVVSVHQC DVKYGKR+H+LP+DD++EGVTG++F++Y
Sbjct  80   ETCEEPKIRMNKVVRANLRVRLGDVVSVHQCADVKYGKRIHVLPLDDSVEGVTGNIFDAY  139

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYF+EAYRP+RKGD FLV
Sbjct  140  LKPYFMEAYRPVRKGDLFLV  159



>gb|KHN19275.1| Cell division cycle protein 48 like [Glycine soja]
Length=814

 Score =   253 bits (646),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            +ILERKK+PNRLVVDEA+NDDNSVV L+P TMEKL  FRGDTVLIKGKKR+DT+ + LAD
Sbjct  28   SILERKKSPNRLVVDEAINDDNSVVTLHPETMEKLHFFRGDTVLIKGKKRRDTICVVLAD  87

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            + C+EPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTG+LF++Y
Sbjct  88   EQCDEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGNLFDAY  147

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYF+E+YRP+RKGD FLV
Sbjct  148  LKPYFMESYRPVRKGDLFLV  167



>ref|XP_003528141.1| PREDICTED: cell division cycle protein 48 homolog [Glycine max]
Length=814

 Score =   253 bits (645),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            +ILERKK+PNRLVVDEA+NDDNSVV L+P TMEKL  FRGDTVLIKGKKR+DT+ + LAD
Sbjct  28   SILERKKSPNRLVVDEAINDDNSVVTLHPETMEKLHFFRGDTVLIKGKKRRDTICVVLAD  87

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            + C+EPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTG+LF++Y
Sbjct  88   EQCDEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGNLFDAY  147

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYF+E+YRP+RKGD FLV
Sbjct  148  LKPYFMESYRPVRKGDLFLV  167



>ref|XP_001776943.1| predicted protein [Physcomitrella patens]
 gb|EDQ58192.1| predicted protein [Physcomitrella patens]
Length=821

 Score =   253 bits (645),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKKA NRL+VDEAVNDDNSVVALN  TM+KLQLFRGDTVL+KGKKRKDTV I LAD
Sbjct  29   AILERKKAANRLIVDEAVNDDNSVVALNTETMDKLQLFRGDTVLVKGKKRKDTVCIVLAD  88

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            +TCEEPKIRMNKVVRANLRVRLGDVVSVHQC DVKYGKR+H+LP+DD++EGVTG++F++Y
Sbjct  89   ETCEEPKIRMNKVVRANLRVRLGDVVSVHQCADVKYGKRIHVLPLDDSVEGVTGNIFDAY  148

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYF+EAYRP+RKGD FLV
Sbjct  149  LKPYFMEAYRPVRKGDLFLV  168



>ref|XP_009116016.1| PREDICTED: cell division control protein 48 homolog D isoform 
X2 [Brassica rapa]
Length=787

 Score =   252 bits (644),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M +QA SSDSK TKKDFSTAILERKKA NRLVVDEA+NDDNS+V L+P TMEKLQLFRGD
Sbjct  1    MRNQAGSSDSKGTKKDFSTAILERKKAANRLVVDEAINDDNSIVYLHPETMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            TVLIKGKKRKDTV IAL DDTCEEPKIRMNKVVR+NLRVRLGDV+S+HQ PDVKYG RVH
Sbjct  61   TVLIKGKKRKDTVCIALPDDTCEEPKIRMNKVVRSNLRVRLGDVISLHQFPDVKYGNRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            +LPIDDTIEGVTG++F++YLKPYFLEAYRP++KGD FLV
Sbjct  121  VLPIDDTIEGVTGNIFDAYLKPYFLEAYRPVKKGDLFLV  159



>ref|XP_009116015.1| PREDICTED: cell division control protein 48 homolog D isoform 
X1 [Brassica rapa]
Length=811

 Score =   252 bits (644),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M +QA SSDSK TKKDFSTAILERKKA NRLVVDEA+NDDNS+V L+P TMEKLQLFRGD
Sbjct  1    MRNQAGSSDSKGTKKDFSTAILERKKAANRLVVDEAINDDNSIVYLHPETMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            TVLIKGKKRKDTV IAL DDTCEEPKIRMNKVVR+NLRVRLGDV+S+HQ PDVKYG RVH
Sbjct  61   TVLIKGKKRKDTVCIALPDDTCEEPKIRMNKVVRSNLRVRLGDVISLHQFPDVKYGNRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            +LPIDDTIEGVTG++F++YLKPYFLEAYRP++KGD FLV
Sbjct  121  VLPIDDTIEGVTGNIFDAYLKPYFLEAYRPVKKGDLFLV  159



>ref|XP_004246640.1| PREDICTED: cell division cycle protein 48 homolog [Solanum lycopersicum]
Length=808

 Score =   251 bits (642),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MS++AESSDSK TKKDFSTAILERKK+PNRLV+DEA+NDDNSVV+L+P TM+KLQ FRGD
Sbjct  1    MSNKAESSDSKGTKKDFSTAILERKKSPNRLVIDEAINDDNSVVSLHPDTMQKLQFFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDT+ IA+ DD C+E KIRMNKVVR NL VRLGDVVSVHQCPDVKYGKRVH
Sbjct  61   TILIKGKKRKDTICIAIVDDKCDESKIRMNKVVRNNLSVRLGDVVSVHQCPDVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILPIDD+IEGVTG+LF++YLKPYF+EAYRP+RKGD FLV
Sbjct  121  ILPIDDSIEGVTGNLFDAYLKPYFVEAYRPVRKGDLFLV  159



>gb|KDO49337.1| hypothetical protein CISIN_1g0036232mg, partial [Citrus sinensis]
 gb|KDO49338.1| hypothetical protein CISIN_1g0036232mg, partial [Citrus sinensis]
 gb|KDO49339.1| hypothetical protein CISIN_1g0036232mg, partial [Citrus sinensis]
Length=141

 Score =   233 bits (594),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 124/141 (88%), Positives = 135/141 (96%), Gaps = 0/141 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MS+QAESSD+K TK+DFSTAILERKKAPNRLVVDEA+NDDNSVV L+P TMEKLQ FRGD
Sbjct  1    MSNQAESSDAKGTKRDFSTAILERKKAPNRLVVDEAINDDNSVVVLHPDTMEKLQFFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDTV IALADDTCEEPKIRMNKVVR+NLRVRLGDVVSVHQC DVKYGKRVH
Sbjct  61   TILIKGKKRKDTVCIALADDTCEEPKIRMNKVVRSNLRVRLGDVVSVHQCADVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLK  495
            ILP+DDTIEGVTG+LF++YLK
Sbjct  121  ILPVDDTIEGVTGNLFDAYLK  141



>ref|XP_009362967.1| PREDICTED: cell division cycle protein 48 homolog [Pyrus x bretschneideri]
Length=819

 Score =   250 bits (639),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEAVNDDNSV++L+PA +EKLQ FRGDTVLIKGKKR+DT+ I +AD
Sbjct  30   AILERKKSPNRLVVDEAVNDDNSVISLHPAALEKLQFFRGDTVLIKGKKRRDTICIIIAD  89

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            D CEE KIRMNKVVRANLRVRLGDVVSVH CPDVKYGK+VHILPIDDTIEGVTG LF++Y
Sbjct  90   DECEESKIRMNKVVRANLRVRLGDVVSVHPCPDVKYGKKVHILPIDDTIEGVTGSLFDAY  149

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYF+E+YRP+RKGD FLV
Sbjct  150  LKPYFVESYRPMRKGDLFLV  169



>ref|XP_010027352.1| PREDICTED: cell division cycle protein 48 homolog [Eucalyptus 
grandis]
 ref|XP_010027358.1| PREDICTED: cell division cycle protein 48 homolog [Eucalyptus 
grandis]
 gb|KCW83309.1| hypothetical protein EUGRSUZ_B00242 [Eucalyptus grandis]
Length=811

 Score =   250 bits (639),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILE KK+PNRL+VDEA+NDDNSVV+++P+TMEKLQLFRGDTVL+KGKKR+DTV + LAD
Sbjct  23   AILEHKKSPNRLIVDEAINDDNSVVSMHPSTMEKLQLFRGDTVLLKGKKRRDTVCVVLAD  82

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            + CEEPKIRMNKVVRANL+VRLGD++SVHQCPDVKYG+++HILPIDDTIEGVTG+LF+++
Sbjct  83   EQCEEPKIRMNKVVRANLKVRLGDIISVHQCPDVKYGRKIHILPIDDTIEGVTGNLFDAF  142

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLE+YRP+RKGD FLV
Sbjct  143  LKPYFLESYRPVRKGDLFLV  162



>ref|XP_006405119.1| hypothetical protein EUTSA_v10000577mg [Eutrema salsugineum]
 gb|ESQ46572.1| hypothetical protein EUTSA_v10000577mg [Eutrema salsugineum]
Length=808

 Score =   249 bits (636),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            MS+Q ESSDSK +KKD STAILE+KK+PNRLVVDEA+NDDNS+V+L+P+TMEKL  F GD
Sbjct  1    MSNQTESSDSKPSKKDLSTAILEKKKSPNRLVVDEAINDDNSLVSLHPSTMEKLNFFNGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKRKDTV IAL+D++CEEPKIRMNKVVR++LRVRLGDVVSV+QCPD+KYGKRVH
Sbjct  61   TILIKGKKRKDTVCIALSDESCEEPKIRMNKVVRSSLRVRLGDVVSVNQCPDIKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTI+GVTG+LF++YLKPYFL  YRP+RKGD FLV
Sbjct  121  ILPVDDTIQGVTGNLFDAYLKPYFLGTYRPVRKGDLFLV  159



>ref|XP_008393112.1| PREDICTED: cell division cycle protein 48 homolog [Malus domestica]
Length=819

 Score =   248 bits (634),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEAVNDDNSV++L+PA MEKLQ FRGDTVLIKGKKR+DT+ I +AD
Sbjct  30   AILERKKSPNRLVVDEAVNDDNSVISLHPAAMEKLQFFRGDTVLIKGKKRRDTICIIIAD  89

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            D CEEPKIRMNKVVRANLRVRLGDVVSVH CP VKYGK+VHILPIDDTIEGVTG LF++Y
Sbjct  90   DECEEPKIRMNKVVRANLRVRLGDVVSVHPCPYVKYGKKVHILPIDDTIEGVTGSLFDAY  149

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYF+++YRP RKGD FLV
Sbjct  150  LKPYFVDSYRPXRKGDLFLV  169



>ref|XP_009762168.1| PREDICTED: cell division cycle protein 48 homolog [Nicotiana 
sylvestris]
Length=810

 Score =   248 bits (632),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRL+VDEA+NDDNSVV+++PA ME+LQLFRGDTVL+KGKKRKDTV I LAD
Sbjct  21   AILERKKSPNRLIVDEALNDDNSVVSMHPAKMEELQLFRGDTVLLKGKKRKDTVCIVLAD  80

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            D CEEPKIRMNKVVRANL +RLGDVVSV QCPDVKY KRVHILPIDDT+EG+TG+LF++Y
Sbjct  81   DQCEEPKIRMNKVVRANLNIRLGDVVSVQQCPDVKYAKRVHILPIDDTVEGLTGNLFDAY  140

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLE+YRP+RKGD F+V
Sbjct  141  LKPYFLESYRPVRKGDLFVV  160



>ref|XP_003625653.1| Cell division control protein-like protein, partial [Medicago 
truncatula]
Length=145

 Score =   230 bits (586),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKKAPNRLVVDEAVNDDNSVVAL+P TMEKLQLFRGDT+LIKGKKRKDT+ IALAD
Sbjct  21   AILERKKAPNRLVVDEAVNDDNSVVALHPETMEKLQLFRGDTILIKGKKRKDTICIALAD  80

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            +TCEEPKIRMNKVVR NLRVRLGDVVSVHQC DVKYGKRVHILP+DDTIEGVTG+LF++Y
Sbjct  81   ETCEEPKIRMNKVVRNNLRVRLGDVVSVHQCADVKYGKRVHILPVDDTIEGVTGNLFDAY  140

Query  490  LKPYF  504
            LK  F
Sbjct  141  LKQAF  145



>ref|XP_007138037.1| hypothetical protein PHAVU_009G175800g [Phaseolus vulgaris]
 gb|ESW10031.1| hypothetical protein PHAVU_009G175800g [Phaseolus vulgaris]
Length=815

 Score =   247 bits (631),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRL+VDEAVNDDNSVV L+P TMEKLQL R DTVLIKGKKR+DTV IAL D
Sbjct  29   AILERKKSPNRLIVDEAVNDDNSVVTLHPETMEKLQLIRADTVLIKGKKRRDTVCIALVD  88

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            + C+EPKIRMNKVVR NLRVRLGDVVSV+QCP+VKYGKRVHILPIDDTIEGVTG+LF++Y
Sbjct  89   EHCDEPKIRMNKVVRTNLRVRLGDVVSVNQCPNVKYGKRVHILPIDDTIEGVTGNLFDAY  148

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLE+YRP+RKGD FLV
Sbjct  149  LKPYFLESYRPVRKGDLFLV  168



>gb|KIZ06105.1| transitional endoplasmic reticulum ATPase, partial [Monoraphidium 
neglectum]
Length=736

 Score =   246 bits (628),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEAVNDDNSVVAL+P TMEKLQLFRGDTVL+KGKKR+DTV I LAD
Sbjct  26   AILERKKSPNRLVVDEAVNDDNSVVALHPTTMEKLQLFRGDTVLLKGKKRRDTVCIVLAD  85

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            +T +E KIR+NKVVR NLRVRLGD+VSVHQC DVKYGKRVH+LPIDDTIEG+TG+LF+S+
Sbjct  86   ETVDETKIRINKVVRKNLRVRLGDIVSVHQCTDVKYGKRVHVLPIDDTIEGITGNLFDSF  145

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FL 
Sbjct  146  LKPYFLEAYRPVRKGDTFLA  165



>ref|XP_006344438.1| PREDICTED: cell division cycle protein 48 homolog [Solanum tuberosum]
Length=810

 Score =   247 bits (631),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRL+VDEA+NDDNSVV+++PA ME+LQLFRGDTVL+KGKKRKDTV + LAD
Sbjct  21   AILERKKSPNRLIVDEAINDDNSVVSMHPAKMEELQLFRGDTVLLKGKKRKDTVCVVLAD  80

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            + CEE KIR+NKVVRANLR+RLGDVVSVHQCPDVKY KRVHILPIDDTIEG+TG+LF++Y
Sbjct  81   EQCEEHKIRLNKVVRANLRIRLGDVVSVHQCPDVKYAKRVHILPIDDTIEGMTGNLFDAY  140

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLE+YRP+RKGD F+V
Sbjct  141  LKPYFLESYRPVRKGDLFVV  160



>ref|XP_009625492.1| PREDICTED: cell division cycle protein 48 homolog [Nicotiana 
tomentosiformis]
Length=810

 Score =   247 bits (630),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRL+VDEA+NDDNSVV+++PA ME+LQLFRGDTVL+KGKKRKDTV + L D
Sbjct  21   AILERKKSPNRLIVDEALNDDNSVVSMHPAKMEELQLFRGDTVLLKGKKRKDTVCVVLVD  80

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            D CEEPKIRMNKVVRANL++RLGDVVSV+QCPDVKY KRVHILPIDDTIEG+TG+LF++Y
Sbjct  81   DQCEEPKIRMNKVVRANLKIRLGDVVSVYQCPDVKYAKRVHILPIDDTIEGMTGNLFDAY  140

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLE+YRP+RKGD F+V
Sbjct  141  LKPYFLESYRPVRKGDLFVV  160



>gb|KDO69546.1| hypothetical protein CISIN_1g0034991mg, partial [Citrus sinensis]
Length=491

 Score =   240 bits (612),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AIL+RKK+PNRLVVDEA+NDDNSV+ ++P TMEKLQ FRGDTVL+KGKKRKDTV + L+D
Sbjct  16   AILDRKKSPNRLVVDEAINDDNSVITMHPNTMEKLQFFRGDTVLVKGKKRKDTVCVVLSD  75

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            + CE  K+R+NKVVR+NLRVRLGDVVSVH CPDVKYG+RVHILPIDDTIEGVTG+LF++Y
Sbjct  76   ELCEASKVRVNKVVRSNLRVRLGDVVSVHPCPDVKYGRRVHILPIDDTIEGVTGNLFDAY  135

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYF+E+YRP+RKGD FLV
Sbjct  136  LKPYFMESYRPVRKGDLFLV  155



>gb|KDO69542.1| hypothetical protein CISIN_1g0034991mg, partial [Citrus sinensis]
 gb|KDO69543.1| hypothetical protein CISIN_1g0034991mg, partial [Citrus sinensis]
 gb|KDO69544.1| hypothetical protein CISIN_1g0034991mg, partial [Citrus sinensis]
 gb|KDO69545.1| hypothetical protein CISIN_1g0034991mg, partial [Citrus sinensis]
Length=502

 Score =   240 bits (613),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AIL+RKK+PNRLVVDEA+NDDNSV+ ++P TMEKLQ FRGDTVL+KGKKRKDTV + L+D
Sbjct  27   AILDRKKSPNRLVVDEAINDDNSVITMHPNTMEKLQFFRGDTVLVKGKKRKDTVCVVLSD  86

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            + CE  K+R+NKVVR+NLRVRLGDVVSVH CPDVKYG+RVHILPIDDTIEGVTG+LF++Y
Sbjct  87   ELCEASKVRVNKVVRSNLRVRLGDVVSVHPCPDVKYGRRVHILPIDDTIEGVTGNLFDAY  146

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYF+E+YRP+RKGD FLV
Sbjct  147  LKPYFMESYRPVRKGDLFLV  166



>gb|KEH17133.1| cell division control-like protein [Medicago truncatula]
Length=144

 Score =   228 bits (582),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 110/124 (89%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKKAPNRLVVDEAVNDDNSVVAL+P TMEKLQLFRGDT+LIKGKKRKDT+ IALAD
Sbjct  21   AILERKKAPNRLVVDEAVNDDNSVVALHPETMEKLQLFRGDTILIKGKKRKDTICIALAD  80

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            +TCEEPKIRMNKVVR NLRVRLGDVVSVHQC DVKYGKRVHILP+DDTIEGVTG+LF++Y
Sbjct  81   ETCEEPKIRMNKVVRNNLRVRLGDVVSVHQCADVKYGKRVHILPVDDTIEGVTGNLFDAY  140

Query  490  LKPY  501
            LK +
Sbjct  141  LKRW  144



>ref|XP_008243978.1| PREDICTED: cell division control protein 48 homolog D [Prunus 
mume]
Length=806

 Score =   246 bits (628),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M+ +AESSDSK TK+DFSTAILERKKA NRLVVD+A+NDDNSVVAL+P TMEKLQLFRGD
Sbjct  1    MTDKAESSDSKGTKRDFSTAILERKKAANRLVVDDAINDDNSVVALHPDTMEKLQLFRGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIK +     + IALADDTCEEPKIRMNKVVR+NLRVRLGDVVSVHQC DVKYGKRVH
Sbjct  61   TILIKVRXXXXXICIALADDTCEEPKIRMNKVVRSNLRVRLGDVVSVHQCADVKYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEGVTG+LF++YLKPYFLEAYRP+RKGD FLV
Sbjct  121  ILPVDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLV  159



>ref|XP_004236235.1| PREDICTED: cell division cycle protein 48 homolog isoform X1 
[Solanum lycopersicum]
Length=810

 Score =   245 bits (626),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERK++PNRL+VDEA+NDDNSVV+++PA ME+LQLFRGDTVL+KGKKRKDTV + LAD
Sbjct  21   AILERKRSPNRLIVDEAINDDNSVVSMHPAKMEELQLFRGDTVLLKGKKRKDTVCVVLAD  80

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            + CEE K+R+NKVVRANLR+RLGDVVSVHQCPDVKY KRVHILPIDDTIEG+TG+LF++Y
Sbjct  81   EQCEEHKVRLNKVVRANLRIRLGDVVSVHQCPDVKYAKRVHILPIDDTIEGMTGNLFDAY  140

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLE+YRP+RKGD F+V
Sbjct  141  LKPYFLESYRPVRKGDLFVV  160



>ref|XP_007132307.1| hypothetical protein PHAVU_011G083800g [Phaseolus vulgaris]
 gb|ESW04301.1| hypothetical protein PHAVU_011G083800g [Phaseolus vulgaris]
Length=805

 Score =   244 bits (624),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = +1

Query  73   MSHQAEssdskstkkdfstAILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGD  252
            M+H AESSDS S KKDFSTAILERKK+PNRL++DEA+ D+NSVV+++P TME+ Q F GD
Sbjct  1    MAHHAESSDSNSGKKDFSTAILERKKSPNRLIIDEALKDENSVVSMHPQTMERNQFFHGD  60

Query  253  TVLIKGKKRKDTVVIALADDTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVH  432
            T+LIKGKKR+DTV I LAD+ CEEPK+RMNKVVR+NLRVRLGDVVSVH CPDV YGKRVH
Sbjct  61   TILIKGKKRRDTVCIVLADENCEEPKLRMNKVVRSNLRVRLGDVVSVHTCPDVLYGKRVH  120

Query  433  ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLV  549
            ILP+DDTIEGVTG+LF++YLKPYFLEAYRP+RKGD F+V
Sbjct  121  ILPLDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFMV  159



>ref|XP_002946301.1| hypothetical protein VOLCADRAFT_78972 [Volvox carteri f. nagariensis]
 gb|EFJ53296.1| hypothetical protein VOLCADRAFT_78972 [Volvox carteri f. nagariensis]
Length=815

 Score =   244 bits (622),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRL+V+EAVNDDNSVVAL+P TMEKLQLFRGDTVL+KGKKRKDTV I L+D
Sbjct  16   AILERKKSPNRLIVEEAVNDDNSVVALHPKTMEKLQLFRGDTVLLKGKKRKDTVCIVLSD  75

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            DT +E KIRMNKVVR NLRVRL D+VS+HQC DVKYGKR+H+LPIDDTIEG+TG+LF++Y
Sbjct  76   DTVDENKIRMNKVVRKNLRVRLADIVSIHQCTDVKYGKRIHVLPIDDTIEGITGNLFDAY  135

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYFLEAYRP+RKGD FL 
Sbjct  136  LKPYFLEAYRPVRKGDTFLA  155



>ref|XP_006439879.1| hypothetical protein CICLE_v10018887mg [Citrus clementina]
 gb|ESR53119.1| hypothetical protein CICLE_v10018887mg [Citrus clementina]
Length=813

 Score =   243 bits (621),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AIL+RKK+PNRLVVDEA+NDDNSV+ ++P TMEKLQ FRGDTVL+KGKKRKDTV + L+D
Sbjct  27   AILDRKKSPNRLVVDEAINDDNSVITMHPNTMEKLQFFRGDTVLVKGKKRKDTVCVVLSD  86

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            + CEE K+R+NKVVR+NLRVRLGDVVSVH CPDVKYG+RVHILPIDDTIEGVTG+LF++Y
Sbjct  87   ELCEESKVRVNKVVRSNLRVRLGDVVSVHPCPDVKYGRRVHILPIDDTIEGVTGNLFDAY  146

Query  490  LKPYFLEAYRPLRKGDHFLV  549
            LKPYF+E+YRP+RKGD FLV
Sbjct  147  LKPYFMESYRPVRKGDLFLV  166



>gb|EMT26392.1| Cell division control 48-E-like protein [Aegilops tauschii]
Length=1207

 Score =   244 bits (624),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 132/157 (84%), Gaps = 17/157 (11%)
 Frame = +1

Query  130  AILERKKAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALAD  309
            AILERKK+PNRLVVDEA NDDNSVVAL+P TME+LQLFRGDTVL+KGKKRKDT+ I LAD
Sbjct  29   AILERKKSPNRLVVDEATNDDNSVVALHPDTMERLQLFRGDTVLLKGKKRKDTICIVLAD  88

Query  310  DTCEEPKIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY  489
            DTCEEPK+RMNK VR NLRVRLGDVVSVHQCPDVKYGKRVHILPIDDT+EG+TG+LF+++
Sbjct  89   DTCEEPKVRMNKTVRKNLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTVEGITGNLFDAF  148

Query  490  LK-----------------PYFLEAYRPLRKGDHFLV  549
            LK                  YFLEAYRPLRKGD FLV
Sbjct  149  LKLASKNLFTNIVFVLCFSAYFLEAYRPLRKGDLFLV  185



>ref|XP_010035972.1| PREDICTED: cell division cycle protein 48 homolog [Eucalyptus 
grandis]
 gb|KCW47492.1| hypothetical protein EUGRSUZ_K01260 [Eucalyptus grandis]
Length=493

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 127/134 (95%), Gaps = 0/134 (0%)
 Frame = +1

Query  148  KAPNRLVVDEAVNDDNSVVALNPATMEKLQLFRGDTVLIKGKKRKDTVVIALADDTCEEP  327
            +A N LVVDEAVNDDNSVV+L+P TM+KLQLFRGDT+L+KGK RKDTV +ALAD+TCEEP
Sbjct  4    RACNCLVVDEAVNDDNSVVSLHPETMKKLQLFRGDTILVKGKIRKDTVCVALADETCEEP  63

Query  328  KIRMNKVVRANLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESYLKPYFL  507
            KIRMNKVVR+NLRVRLGDVVSVHQCPDVK GKRVHILP+DDTIEG+TG+LF+++LKPYFL
Sbjct  64   KIRMNKVVRSNLRVRLGDVVSVHQCPDVKDGKRVHILPVDDTIEGITGNLFDAFLKPYFL  123

Query  508  EAYRPLRKGDHFLV  549
            EAYRP+RKGD FLV
Sbjct  124  EAYRPVRKGDLFLV  137



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 590079713720