BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001E15

Length=611
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010690130.1|  PREDICTED: GDSL esterase/lipase APG-like           297   1e-96   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010654595.1|  PREDICTED: GDSL esterase/lipase APG-like           293   6e-95   Vitis vinifera
ref|XP_009344493.1|  PREDICTED: GDSL esterase/lipase APG-like           292   9e-95   Pyrus x bretschneideri [bai li]
dbj|BAM08277.1|  zinc finger protein                                    292   1e-94   Malus domestica [apple tree]
ref|XP_008358081.1|  PREDICTED: GDSL esterase/lipase APG-like           293   2e-94   
ref|XP_008380836.1|  PREDICTED: GDSL esterase/lipase APG-like           292   2e-94   
ref|XP_004235632.1|  PREDICTED: GDSL esterase/lipase APG-like           291   2e-94   Solanum lycopersicum
ref|XP_006343026.1|  PREDICTED: GDSL esterase/lipase APG-like           291   3e-94   Solanum tuberosum [potatoes]
ref|XP_008375835.1|  PREDICTED: GDSL esterase/lipase APG-like           291   3e-94   Malus domestica [apple tree]
ref|XP_009612468.1|  PREDICTED: GDSL esterase/lipase APG                290   6e-94   Nicotiana tomentosiformis
ref|XP_009337919.1|  PREDICTED: GDSL esterase/lipase APG-like           290   8e-94   Pyrus x bretschneideri [bai li]
ref|XP_009759976.1|  PREDICTED: GDSL esterase/lipase APG                290   9e-94   Nicotiana sylvestris
ref|XP_008228396.1|  PREDICTED: GDSL esterase/lipase APG                289   2e-93   Prunus mume [ume]
ref|XP_011072453.1|  PREDICTED: GDSL esterase/lipase APG                288   3e-93   Sesamum indicum [beniseed]
gb|KHN39266.1|  GDSL esterase/lipase APG                                287   7e-93   Glycine soja [wild soybean]
ref|XP_007215590.1|  hypothetical protein PRUPE_ppa007650mg             287   8e-93   Prunus persica
ref|NP_001242561.1|  uncharacterized protein LOC100815273 precursor     287   9e-93   
ref|XP_009343018.1|  PREDICTED: GDSL esterase/lipase APG-like           287   9e-93   Pyrus x bretschneideri [bai li]
ref|XP_010267093.1|  PREDICTED: GDSL esterase/lipase APG-like           285   7e-92   Nelumbo nucifera [Indian lotus]
gb|KDO38518.1|  hypothetical protein CISIN_1g018227mg                   280   1e-91   Citrus sinensis [apfelsine]
gb|KHN05319.1|  GDSL esterase/lipase APG                                284   1e-91   Glycine soja [wild soybean]
gb|ACU24285.1|  unknown                                                 284   1e-91   Glycine max [soybeans]
gb|KDO38516.1|  hypothetical protein CISIN_1g018227mg                   280   3e-91   Citrus sinensis [apfelsine]
ref|XP_010062556.1|  PREDICTED: GDSL esterase/lipase APG                283   3e-91   Eucalyptus grandis [rose gum]
ref|XP_003531641.2|  PREDICTED: GDSL esterase/lipase APG-like           284   3e-91   
emb|CDO97957.1|  unnamed protein product                                281   3e-90   Coffea canephora [robusta coffee]
ref|XP_006426844.1|  hypothetical protein CICLE_v10025938mg             280   5e-90   Citrus clementina [clementine]
ref|XP_006465718.1|  PREDICTED: GDSL esterase/lipase APG-like           280   6e-90   Citrus sinensis [apfelsine]
ref|XP_007135613.1|  hypothetical protein PHAVU_010G143600g             281   7e-90   Phaseolus vulgaris [French bean]
gb|KHN30020.1|  GDSL esterase/lipase APG                                279   9e-90   Glycine soja [wild soybean]
ref|XP_003543615.1|  PREDICTED: GDSL esterase/lipase APG-like           279   1e-89   Glycine max [soybeans]
ref|XP_004510325.1|  PREDICTED: GDSL esterase/lipase APG-like           279   1e-89   Cicer arietinum [garbanzo]
ref|XP_007150584.1|  hypothetical protein PHAVU_005G164800g             279   1e-89   Phaseolus vulgaris [French bean]
ref|XP_003597654.1|  GDSL esterase/lipase APG                           278   2e-89   Medicago truncatula
ref|XP_010244385.1|  PREDICTED: GDSL esterase/lipase APG-like           279   2e-89   Nelumbo nucifera [Indian lotus]
gb|KFK38989.1|  hypothetical protein AALP_AA3G185500                    278   4e-89   Arabis alpina [alpine rockcress]
gb|ACJ84797.1|  unknown                                                 271   3e-88   Medicago truncatula
ref|XP_011008871.1|  PREDICTED: GDSL esterase/lipase APG                275   4e-88   Populus euphratica
gb|EYU21439.1|  hypothetical protein MIMGU_mgv1a009146mg                275   4e-88   Erythranthe guttata [common monkey flower]
gb|KDP40834.1|  hypothetical protein JCGZ_24833                         275   6e-88   Jatropha curcas
ref|XP_002298249.2|  putative proline-rich protein APG isolog           273   2e-87   Populus trichocarpa [western balsam poplar]
ref|XP_004486794.1|  PREDICTED: GDSL esterase/lipase APG-like           273   2e-87   Cicer arietinum [garbanzo]
gb|EYU21440.1|  hypothetical protein MIMGU_mgv1a009146mg                273   2e-87   Erythranthe guttata [common monkey flower]
ref|XP_006406840.1|  hypothetical protein EUTSA_v10021008mg             273   2e-87   Eutrema salsugineum [saltwater cress]
ref|XP_002515932.1|  zinc finger protein, putative                      273   2e-87   Ricinus communis
ref|XP_006298028.1|  hypothetical protein CARUB_v10014074mg             273   2e-87   Capsella rubella
ref|XP_004302841.1|  PREDICTED: GDSL esterase/lipase APG                273   2e-87   Fragaria vesca subsp. vesca
ref|XP_006343027.1|  PREDICTED: GDSL esterase/lipase APG-like           273   7e-87   Solanum tuberosum [potatoes]
ref|XP_010504217.1|  PREDICTED: GDSL esterase/lipase APG-like           271   1e-86   Camelina sativa [gold-of-pleasure]
ref|XP_010465660.1|  PREDICTED: GDSL esterase/lipase APG                271   2e-86   Camelina sativa [gold-of-pleasure]
ref|XP_010487495.1|  PREDICTED: GDSL esterase/lipase APG-like           271   2e-86   Camelina sativa [gold-of-pleasure]
ref|XP_007024353.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    270   2e-86   
gb|KHG15938.1|  GDSL esterase/lipase APG -like protein                  270   3e-86   Gossypium arboreum [tree cotton]
ref|XP_008447571.1|  PREDICTED: GDSL esterase/lipase APG-like           270   4e-86   Cucumis melo [Oriental melon]
ref|XP_003627082.1|  GDSL esterase/lipase APG                           270   4e-86   Medicago truncatula
gb|KJB56732.1|  hypothetical protein B456_009G138200                    266   5e-86   Gossypium raimondii
ref|XP_004235633.1|  PREDICTED: GDSL esterase/lipase APG-like           271   8e-86   Solanum lycopersicum
ref|XP_010545663.1|  PREDICTED: GDSL esterase/lipase APG                268   1e-85   Tarenaya hassleriana [spider flower]
gb|KJB70371.1|  hypothetical protein B456_011G070000                    268   2e-85   Gossypium raimondii
gb|KJB70369.1|  hypothetical protein B456_011G070000                    268   2e-85   Gossypium raimondii
ref|XP_010098171.1|  GDSL esterase/lipase APG                           268   3e-85   Morus notabilis
emb|CAN65530.1|  hypothetical protein VITISV_039629                     268   3e-85   Vitis vinifera
gb|KJB56736.1|  hypothetical protein B456_009G138200                    266   4e-85   Gossypium raimondii
gb|KJB56734.1|  hypothetical protein B456_009G138200                    265   5e-85   Gossypium raimondii
gb|KDO38517.1|  hypothetical protein CISIN_1g018227mg                   262   6e-85   Citrus sinensis [apfelsine]
gb|KJB70370.1|  hypothetical protein B456_011G070000                    268   1e-84   Gossypium raimondii
ref|XP_002277514.1|  PREDICTED: GDSL esterase/lipase APG                266   1e-84   Vitis vinifera
emb|CBI36031.3|  unnamed protein product                                266   1e-84   Vitis vinifera
gb|KJB56735.1|  hypothetical protein B456_009G138200                    266   2e-84   Gossypium raimondii
gb|KJB56733.1|  hypothetical protein B456_009G138200                    266   2e-84   Gossypium raimondii
gb|KHG07525.1|  GDSL esterase/lipase APG -like protein                  265   3e-84   Gossypium arboreum [tree cotton]
ref|XP_009146144.1|  PREDICTED: GDSL esterase/lipase APG                265   4e-84   Brassica rapa
ref|XP_004149175.1|  PREDICTED: GDSL esterase/lipase APG-like           265   4e-84   
ref|XP_010925408.1|  PREDICTED: GDSL esterase/lipase APG                265   5e-84   Elaeis guineensis
ref|XP_009408845.1|  PREDICTED: GDSL esterase/lipase APG-like           264   8e-84   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY30167.1|  BnaC05g36950D                                          263   1e-83   Brassica napus [oilseed rape]
ref|NP_188258.1|  GDSL esterase/lipase                                  263   1e-83   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002883003.1|  GDSL-motif lipase/hydrolase family protein         263   2e-83   
ref|XP_009388555.1|  PREDICTED: GDSL esterase/lipase APG-like           263   3e-83   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006426845.1|  hypothetical protein CICLE_v10025957mg             261   9e-83   Citrus clementina [clementine]
gb|KJB56729.1|  hypothetical protein B456_009G138200                    260   2e-82   Gossypium raimondii
ref|XP_002436473.1|  hypothetical protein SORBIDRAFT_10g003340          259   5e-82   Sorghum bicolor [broomcorn]
ref|XP_004516916.1|  PREDICTED: GDSL esterase/lipase APG-like           259   7e-82   Cicer arietinum [garbanzo]
ref|XP_004964566.1|  PREDICTED: GDSL esterase/lipase APG-like           258   2e-81   Setaria italica
ref|XP_004486795.1|  PREDICTED: GDSL esterase/lipase APG-like           256   7e-81   
ref|XP_008654481.1|  PREDICTED: uncharacterized protein LOC100216...    258   1e-80   Zea mays [maize]
ref|NP_001136705.1|  hypothetical protein precursor                     255   1e-80   Zea mays [maize]
gb|EPS71085.1|  hypothetical protein M569_03672                         254   2e-80   Genlisea aurea
ref|XP_006465717.1|  PREDICTED: GDSL esterase/lipase APG-like iso...    255   4e-80   Citrus sinensis [apfelsine]
ref|XP_008793255.1|  PREDICTED: GDSL esterase/lipase APG                254   4e-80   Phoenix dactylifera
gb|AAB63641.1|  Proline-rich protein APG isolog                         253   5e-80   Arabidopsis thaliana [mouse-ear cress]
gb|EMS47165.1|  GDSL esterase/lipase APG                                251   1e-78   Triticum urartu
ref|NP_001056808.1|  Os06g0148200                                       249   3e-78   
ref|XP_002515934.1|  zinc finger protein, putative                      249   5e-78   Ricinus communis
ref|XP_006655787.1|  PREDICTED: GDSL esterase/lipase APG-like           249   6e-78   Oryza brachyantha
ref|XP_003557194.1|  PREDICTED: GDSL esterase/lipase APG                248   2e-77   Brachypodium distachyon [annual false brome]
gb|KDP40835.1|  hypothetical protein JCGZ_24834                         247   4e-77   Jatropha curcas
emb|CDO97958.1|  unnamed protein product                                247   6e-77   Coffea canephora [robusta coffee]
emb|CAB81548.2|  putative proline-rich protein APG isolog               246   7e-77   Cicer arietinum [garbanzo]
ref|XP_011044241.1|  PREDICTED: GDSL esterase/lipase At5g22810          244   3e-76   Populus euphratica
ref|XP_006826756.1|  hypothetical protein AMTR_s00136p00069360          244   6e-76   
ref|XP_010242974.1|  PREDICTED: GDSL esterase/lipase At5g22810          243   1e-75   Nelumbo nucifera [Indian lotus]
gb|KJB56728.1|  hypothetical protein B456_009G138200                    243   2e-75   Gossypium raimondii
gb|EMT10375.1|  GDSL esterase/lipase APG                                242   3e-75   
ref|XP_002313641.2|  GDSL-motif lipase family protein                   241   4e-75   Populus trichocarpa [western balsam poplar]
gb|KDO38511.1|  hypothetical protein CISIN_1g018227mg                   241   7e-75   Citrus sinensis [apfelsine]
gb|KDO42514.1|  hypothetical protein CISIN_1g040658mg                   238   2e-74   Citrus sinensis [apfelsine]
ref|XP_006484945.1|  PREDICTED: GDSL esterase/lipase At5g22810-like     239   4e-74   Citrus sinensis [apfelsine]
ref|XP_002271400.1|  PREDICTED: GDSL esterase/lipase At5g22810          237   2e-73   Vitis vinifera
gb|KDP34349.1|  hypothetical protein JCGZ_11232                         236   1e-72   Jatropha curcas
ref|XP_009796088.1|  PREDICTED: GDSL esterase/lipase At5g22810          235   1e-72   Nicotiana sylvestris
ref|XP_002527431.1|  zinc finger protein, putative                      236   1e-72   Ricinus communis
ref|XP_010247794.1|  PREDICTED: GDSL esterase/lipase At5g22810-like     235   1e-72   Nelumbo nucifera [Indian lotus]
ref|XP_007015991.1|  GDSL esterase/lipase isoform 1                     235   2e-72   Theobroma cacao [chocolate]
ref|XP_006838752.1|  hypothetical protein AMTR_s00002p00255920          234   2e-72   Amborella trichopoda
ref|XP_009337386.1|  PREDICTED: GDSL esterase/lipase At5g22810          234   3e-72   Pyrus x bretschneideri [bai li]
gb|KHG22657.1|  hypothetical protein F383_04802                         232   5e-72   Gossypium arboreum [tree cotton]
gb|KJB09007.1|  hypothetical protein B456_001G118700                    231   1e-71   Gossypium raimondii
ref|XP_009625753.1|  PREDICTED: GDSL esterase/lipase At5g22810 is...    233   1e-71   Nicotiana tomentosiformis
ref|XP_004295642.1|  PREDICTED: GDSL esterase/lipase At5g22810          233   1e-71   Fragaria vesca subsp. vesca
ref|XP_008366379.1|  PREDICTED: GDSL esterase/lipase At5g22810-like     233   1e-71   
ref|XP_006349065.1|  PREDICTED: GDSL esterase/lipase At5g22810-like     232   2e-71   Solanum tuberosum [potatoes]
ref|XP_004251004.1|  PREDICTED: GDSL esterase/lipase At5g22810          232   3e-71   
gb|KJB09006.1|  hypothetical protein B456_001G118700                    231   4e-71   Gossypium raimondii
ref|XP_002515937.1|  zinc finger protein, putative                      231   5e-71   Ricinus communis
ref|XP_011089987.1|  PREDICTED: GDSL esterase/lipase At5g22810          230   9e-71   
gb|KDO38513.1|  hypothetical protein CISIN_1g018227mg                   229   1e-70   Citrus sinensis [apfelsine]
ref|XP_010558217.1|  PREDICTED: GDSL esterase/lipase At5g03820-like     229   2e-70   Tarenaya hassleriana [spider flower]
ref|XP_010689974.1|  PREDICTED: GDSL esterase/lipase At5g22810          229   4e-70   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006424380.1|  hypothetical protein CICLE_v10027727mg             240   5e-70   
ref|XP_009625752.1|  PREDICTED: GDSL esterase/lipase At5g22810 is...    228   9e-70   Nicotiana tomentosiformis
gb|AFK42211.1|  unknown                                                 227   1e-69   Lotus japonicus
ref|XP_002873116.1|  GDSL-motif lipase/hydrolase family protein         227   1e-69   
ref|XP_008226994.1|  PREDICTED: GDSL esterase/lipase At5g22810          227   2e-69   Prunus mume [ume]
ref|XP_007132365.1|  hypothetical protein PHAVU_011G088700g             227   2e-69   Phaseolus vulgaris [French bean]
ref|XP_003540212.1|  PREDICTED: GDSL esterase/lipase At5g22810-like     226   4e-69   Glycine max [soybeans]
ref|XP_006482367.1|  PREDICTED: GDSL esterase/lipase At5g03820-like     226   4e-69   Citrus sinensis [apfelsine]
emb|CBI17099.3|  unnamed protein product                                238   4e-69   Vitis vinifera
gb|KDO60993.1|  hypothetical protein CISIN_1g036829mg                   226   5e-69   Citrus sinensis [apfelsine]
ref|XP_003551088.1|  PREDICTED: GDSL esterase/lipase At5g22810-like     226   5e-69   Glycine max [soybeans]
gb|KHN21470.1|  GDSL esterase/lipase                                    226   9e-69   Glycine soja [wild soybean]
ref|XP_006430343.1|  hypothetical protein CICLE_v10013829mg             225   9e-69   Citrus clementina [clementine]
ref|XP_007150122.1|  hypothetical protein PHAVU_005G128600g             225   1e-68   Phaseolus vulgaris [French bean]
ref|XP_007027551.1|  GDSL-like Lipase/Acylhydrolase family protein      228   2e-68   
ref|NP_196002.1|  GDSL esterase/lipase                                  224   2e-68   
gb|KHN27690.1|  GDSL esterase/lipase                                    224   2e-68   Glycine soja [wild soybean]
ref|XP_010045272.1|  PREDICTED: GDSL esterase/lipase At5g22810          224   5e-68   Eucalyptus grandis [rose gum]
ref|XP_010493379.1|  PREDICTED: GDSL esterase/lipase At5g22810          223   8e-68   Camelina sativa [gold-of-pleasure]
ref|XP_009397028.1|  PREDICTED: GDSL esterase/lipase At5g03810-like     223   9e-68   
gb|KHG27777.1|  hypothetical protein F383_16365                         222   1e-67   Gossypium arboreum [tree cotton]
ref|XP_002872020.1|  predicted protein                                  222   1e-67   
ref|XP_009780981.1|  PREDICTED: GDSL esterase/lipase At5g03820          217   2e-67   Nicotiana sylvestris
ref|XP_006366788.1|  PREDICTED: GDSL esterase/lipase At5g03820-like     222   2e-67   Solanum tuberosum [potatoes]
ref|XP_006338923.1|  PREDICTED: GDSL esterase/lipase At5g03820-like     221   2e-67   Solanum tuberosum [potatoes]
ref|XP_004156262.1|  PREDICTED: GDSL esterase/lipase At5g03810-like     221   3e-67   
ref|XP_010098864.1|  GDSL esterase/lipase                               221   3e-67   Morus notabilis
ref|XP_004143292.1|  PREDICTED: GDSL esterase/lipase At5g03810-like     221   3e-67   Cucumis sativus [cucumbers]
ref|XP_007207052.1|  hypothetical protein PRUPE_ppa007967mg             221   5e-67   
ref|XP_004964856.1|  PREDICTED: GDSL esterase/lipase APG-like           221   5e-67   Setaria italica
ref|XP_004487544.1|  PREDICTED: GDSL esterase/lipase At5g22810-like     220   7e-67   Cicer arietinum [garbanzo]
ref|XP_006286643.1|  hypothetical protein CARUB_v10002513mg             220   8e-67   Capsella rubella
ref|XP_011094449.1|  PREDICTED: GDSL esterase/lipase At5g03810-like     220   1e-66   Sesamum indicum [beniseed]
emb|CDY09169.1|  BnaA02g05950D                                          220   1e-66   Brassica napus [oilseed rape]
emb|CDY50286.1|  BnaC02g45410D                                          220   1e-66   Brassica napus [oilseed rape]
ref|XP_006398840.1|  hypothetical protein EUTSA_v10013969mg             219   2e-66   
ref|XP_006289497.1|  hypothetical protein CARUB_v10003031mg             219   2e-66   
ref|XP_008462518.1|  PREDICTED: GDSL esterase/lipase At5g03820          219   2e-66   
ref|XP_004249641.1|  PREDICTED: GDSL esterase/lipase At5g03820          219   2e-66   Solanum lycopersicum
ref|XP_010558978.1|  PREDICTED: GDSL esterase/lipase At3g53100          219   2e-66   Tarenaya hassleriana [spider flower]
ref|NP_196001.2|  GDSL esterase/lipase                                  219   2e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002284087.2|  PREDICTED: GDSL esterase/lipase At5g03820-like     219   2e-66   Vitis vinifera
ref|XP_009593509.1|  PREDICTED: GDSL esterase/lipase At5g03820-li...    219   2e-66   Nicotiana tomentosiformis
ref|NP_197672.1|  GDSL esterase/lipase                                  218   3e-66   
emb|CBI30208.3|  unnamed protein product                                219   3e-66   Vitis vinifera
sp|Q9FFC6.3|GDL78_ARATH  RecName: Full=GDSL esterase/lipase At5g2...    219   4e-66   Arabidopsis thaliana [mouse-ear cress]
gb|KEH38918.1|  GDSL-like lipase/acylhydrolase                          218   5e-66   Medicago truncatula
gb|KCW89297.1|  hypothetical protein EUGRSUZ_A01587                     218   5e-66   Eucalyptus grandis [rose gum]
ref|XP_002436480.1|  hypothetical protein SORBIDRAFT_10g003420          218   5e-66   
gb|KFK27616.1|  hypothetical protein AALP_AA8G406700                    218   7e-66   Arabis alpina [alpine rockcress]
ref|XP_009776666.1|  PREDICTED: GDSL esterase/lipase At5g03820-like     218   7e-66   Nicotiana sylvestris
ref|XP_010050200.1|  PREDICTED: GDSL esterase/lipase At5g03820          218   8e-66   Eucalyptus grandis [rose gum]
ref|XP_009126566.1|  PREDICTED: GDSL esterase/lipase At5g22810          218   8e-66   Brassica rapa
ref|XP_010923281.1|  PREDICTED: GDSL esterase/lipase At5g03810-like     217   2e-65   Elaeis guineensis
ref|XP_010933399.1|  PREDICTED: GDSL esterase/lipase At5g03810-like     217   2e-65   Elaeis guineensis
ref|XP_009589481.1|  PREDICTED: GDSL esterase/lipase At5g03820-like     217   2e-65   
ref|XP_010092821.1|  GDSL esterase/lipase                               215   2e-65   
ref|XP_010683957.1|  PREDICTED: GDSL esterase/lipase At5g03820          217   2e-65   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004246904.1|  PREDICTED: GDSL esterase/lipase At5g03820-like     216   3e-65   Solanum lycopersicum
ref|XP_002528628.1|  zinc finger protein, putative                      216   4e-65   Ricinus communis
ref|XP_009125521.1|  PREDICTED: GDSL esterase/lipase At5g03820-like     217   8e-65   Brassica rapa
ref|XP_004303055.1|  PREDICTED: GDSL esterase/lipase At5g03810-like     214   2e-64   Fragaria vesca subsp. vesca
ref|XP_009340968.1|  PREDICTED: GDSL esterase/lipase At5g03820-like     214   2e-64   Pyrus x bretschneideri [bai li]
ref|XP_010452277.1|  PREDICTED: GDSL esterase/lipase At5g03820          214   2e-64   Camelina sativa [gold-of-pleasure]
ref|XP_006369216.1|  hypothetical protein POPTR_0001s19240g             213   2e-64   
emb|CDY04898.1|  BnaAnng00800D                                          214   3e-64   
ref|XP_009389038.1|  PREDICTED: GDSL esterase/lipase At5g03810-li...    215   4e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010490874.1|  PREDICTED: GDSL esterase/lipase At5g03820-like     213   4e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010100155.1|  GDSL esterase/lipase                               213   4e-64   Morus notabilis
ref|XP_009389037.1|  PREDICTED: GDSL esterase/lipase At5g03810-li...    215   4e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003538180.1|  PREDICTED: GDSL esterase/lipase At5g22810          213   4e-64   Glycine max [soybeans]
ref|XP_006400789.1|  hypothetical protein EUTSA_v10015700mg             213   5e-64   
ref|XP_008794047.1|  PREDICTED: GDSL esterase/lipase At5g03810-like     213   9e-64   Phoenix dactylifera
gb|KJB16733.1|  hypothetical protein B456_002G245100                    211   1e-63   Gossypium raimondii
gb|KDP29224.1|  hypothetical protein JCGZ_16613                         212   1e-63   Jatropha curcas
emb|CDX80889.1|  BnaC03g01430D                                          212   1e-63   
ref|XP_004155946.1|  PREDICTED: GDSL esterase/lipase APG-like           212   1e-63   
ref|XP_009130783.1|  PREDICTED: GDSL esterase/lipase At5g03810-li...    212   2e-63   Brassica rapa
ref|XP_009130784.1|  PREDICTED: GDSL esterase/lipase At5g03810-li...    211   2e-63   Brassica rapa
gb|KJB16732.1|  hypothetical protein B456_002G245100                    211   2e-63   Gossypium raimondii
emb|CDP15327.1|  unnamed protein product                                211   4e-63   Coffea canephora [robusta coffee]
ref|XP_004145774.1|  PREDICTED: GDSL esterase/lipase At5g22810-like     211   4e-63   Cucumis sativus [cucumbers]
ref|XP_008458651.1|  PREDICTED: GDSL esterase/lipase At5g22810          209   1e-62   Cucumis melo [Oriental melon]
emb|CAB85501.1|  putative protein                                       208   1e-62   Arabidopsis thaliana [mouse-ear cress]
gb|KHN32662.1|  GDSL esterase/lipase APG                                207   2e-62   Glycine soja [wild soybean]
ref|XP_010493512.1|  PREDICTED: GDSL esterase/lipase At5g22810-like     208   4e-62   Camelina sativa [gold-of-pleasure]
emb|CDY11271.1|  BnaA03g01070D                                          208   5e-62   Brassica napus [oilseed rape]
ref|XP_006403725.1|  hypothetical protein EUTSA_v10010500mg             207   6e-62   
ref|XP_008387479.1|  PREDICTED: GDSL esterase/lipase At5g03820-like     207   1e-61   
emb|CDP14394.1|  unnamed protein product                                206   2e-61   Coffea canephora [robusta coffee]
ref|XP_011101470.1|  PREDICTED: GDSL esterase/lipase At5g03820-like     206   2e-61   Sesamum indicum [beniseed]
gb|ABZ85648.1|  At5g03810                                               202   4e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011018853.1|  PREDICTED: GDSL esterase/lipase At5g03820          205   5e-61   Populus euphratica
emb|CDP17381.1|  unnamed protein product                                204   7e-61   Coffea canephora [robusta coffee]
gb|EYU41566.1|  hypothetical protein MIMGU_mgv1a008897mg                204   1e-60   Erythranthe guttata [common monkey flower]
gb|ABZ85655.1|  At5g03810                                               201   1e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006381340.1|  hypothetical protein POPTR_0006s11970g             204   1e-60   Populus trichocarpa [western balsam poplar]
gb|ABZ85657.1|  At5g03810                                               201   2e-60   Arabidopsis thaliana [mouse-ear cress]
gb|ACG42669.1|  hypothetical protein                                    204   2e-60   Zea mays [maize]
dbj|BAJ89672.1|  predicted protein                                      204   2e-60   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDO38512.1|  hypothetical protein CISIN_1g018227mg                   202   3e-60   Citrus sinensis [apfelsine]
gb|ABZ85649.1|  At5g03810                                               200   3e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003561180.2|  PREDICTED: GDSL esterase/lipase APG-like           205   4e-60   
ref|NP_001140661.1|  hypothetical protein precursor                     202   6e-60   Zea mays [maize]
ref|XP_002466664.1|  hypothetical protein SORBIDRAFT_01g011850          202   1e-59   Sorghum bicolor [broomcorn]
ref|XP_008462404.1|  PREDICTED: GDSL esterase/lipase APG isoform X5     203   3e-59   
gb|EMT26145.1|  GDSL esterase/lipase APG                                201   4e-59   
ref|XP_004506128.1|  PREDICTED: GDSL esterase/lipase At5g22810-like     200   5e-59   Cicer arietinum [garbanzo]
ref|XP_004982165.1|  PREDICTED: GDSL esterase/lipase At5g03820-li...    200   7e-59   Setaria italica
emb|CDX95394.1|  BnaC04g27640D                                          199   8e-59   
ref|XP_003561182.1|  PREDICTED: GDSL esterase/lipase APG-like           200   8e-59   Brachypodium distachyon [annual false brome]
ref|NP_001241778.1|  anther-specific proline-rich protein APG pre...    199   1e-58   
ref|XP_006656639.1|  PREDICTED: GDSL esterase/lipase APG-like           199   1e-58   
ref|XP_010515794.1|  PREDICTED: GDSL esterase/lipase At3g53100-li...    195   1e-58   Camelina sativa [gold-of-pleasure]
ref|XP_006650413.1|  PREDICTED: GDSL esterase/lipase At5g03810-like     199   1e-58   Oryza brachyantha
ref|XP_009139436.1|  PREDICTED: GDSL esterase/lipase At3g53100 is...    199   2e-58   Brassica rapa
emb|CDX76226.1|  BnaA04g04900D                                          198   2e-58   
ref|XP_006291405.1|  hypothetical protein CARUB_v10017544mg             198   2e-58   Capsella rubella
ref|NP_001142139.1|  uncharacterized protein LOC100274304 precursor     198   4e-58   Zea mays [maize]
ref|XP_010109948.1|  GDSL esterase/lipase                               198   4e-58   Morus notabilis
ref|XP_002877901.1|  GDSL-motif lipase/hydrolase family protein         197   5e-58   Arabidopsis lyrata subsp. lyrata
gb|KJB26682.1|  hypothetical protein B456_004G254700                    197   5e-58   Gossypium raimondii
gb|EMT28018.1|  GDSL esterase/lipase APG                                193   9e-58   
gb|ABK21582.1|  unknown                                                 197   1e-57   Picea sitchensis
gb|KFK34547.1|  hypothetical protein AALP_AA5G160400                    196   2e-57   Arabis alpina [alpine rockcress]
ref|XP_010515793.1|  PREDICTED: GDSL esterase/lipase At3g53100-li...    195   2e-57   Camelina sativa [gold-of-pleasure]
gb|EMT10908.1|  GDSL esterase/lipase                                    196   2e-57   
ref|XP_004141668.1|  PREDICTED: GDSL esterase/lipase APG-like           196   2e-57   Cucumis sativus [cucumbers]
gb|EMS52953.1|  GDSL esterase/lipase APG                                196   3e-57   Triticum urartu
ref|XP_004982164.1|  PREDICTED: GDSL esterase/lipase At5g03820-li...    197   3e-57   
ref|XP_010426939.1|  PREDICTED: GDSL esterase/lipase At3g53100-like     194   2e-56   Camelina sativa [gold-of-pleasure]
emb|CAB64213.1|  putative protein                                       192   4e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008462401.1|  PREDICTED: probable LRR receptor-like serine...    202   4e-56   
ref|XP_008462402.1|  PREDICTED: probable LRR receptor-like serine...    202   5e-56   
ref|XP_008462399.1|  PREDICTED: probable LRR receptor-like serine...    202   5e-56   
gb|KEH29917.1|  GDSL-like lipase/acylhydrolase                          192   6e-56   Medicago truncatula
ref|XP_008462403.1|  PREDICTED: probable LRR receptor-like serine...    202   6e-56   Cucumis melo [Oriental melon]
ref|NP_190878.2|  GDSL esterase/lipase                                  192   9e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009139435.1|  PREDICTED: GDSL esterase/lipase At3g53100 is...    190   8e-55   Brassica rapa
ref|XP_003561212.2|  PREDICTED: GDSL esterase/lipase At5g03810-like     189   2e-54   Brachypodium distachyon [annual false brome]
ref|XP_004506129.1|  PREDICTED: GDSL esterase/lipase At5g22810-like     188   2e-54   Cicer arietinum [garbanzo]
ref|XP_004488333.1|  PREDICTED: GDSL esterase/lipase At5g22810-like     186   9e-54   Cicer arietinum [garbanzo]
gb|ABK26273.1|  unknown                                                 186   2e-53   Picea sitchensis
gb|EAZ28161.1|  hypothetical protein OsJ_12134                          181   2e-51   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001050914.1|  Os03g0683800                                       180   2e-51   
gb|KEH29925.1|  GDSL-like lipase/acylhydrolase                          181   2e-51   Medicago truncatula
gb|EAY91425.1|  hypothetical protein OsI_13052                          180   3e-51   Oryza sativa Indica Group [Indian rice]
ref|XP_010495383.1|  PREDICTED: GDSL esterase/lipase At5g22810-like     174   5e-51   
gb|KHN38683.1|  GDSL esterase/lipase                                    178   6e-51   Glycine soja [wild soybean]
ref|XP_006426843.1|  hypothetical protein CICLE_v10025938mg             176   2e-50   
gb|AFW83670.1|  hypothetical protein ZEAMMB73_889110                    174   2e-50   
gb|ABZ85654.1|  truncated At5g03810                                     171   2e-50   
gb|ABK26503.1|  unknown                                                 177   3e-50   
ref|XP_006852535.1|  hypothetical protein AMTR_s00021p00183530          176   3e-50   
gb|KJB57454.1|  hypothetical protein B456_009G165200                    176   8e-50   
emb|CDY55498.1|  BnaA05g34360D                                          176   1e-49   
ref|XP_009793062.1|  PREDICTED: GDSL esterase/lipase At5g45950 is...    176   2e-49   
ref|XP_009615525.1|  PREDICTED: GDSL esterase/lipase At5g45950          175   2e-49   
ref|XP_010052242.1|  PREDICTED: GDSL esterase/lipase At5g45950          175   3e-49   
gb|KHG24677.1|  hypothetical protein F383_10020                         175   3e-49   
emb|CDP05715.1|  unnamed protein product                                175   3e-49   
ref|XP_009142896.1|  PREDICTED: GDSL esterase/lipase At2g42990          174   3e-49   
emb|CDY53653.1|  BnaC04g52870D                                          174   4e-49   
ref|XP_003545614.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     174   5e-49   
ref|XP_009804685.1|  PREDICTED: GDSL esterase/lipase At4g26790-like     174   5e-49   
ref|XP_009606234.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     174   8e-49   
ref|XP_001775976.1|  predicted protein                                  173   1e-48   
gb|KFK37141.1|  hypothetical protein AALP_AA4G218400                    173   1e-48   
ref|XP_004243509.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     173   1e-48   
ref|XP_003601542.1|  GDSL esterase/lipase                               173   2e-48   
ref|XP_010101540.1|  GDSL esterase/lipase                               173   2e-48   
ref|NP_001239864.1|  uncharacterized protein LOC100809260 precursor     172   2e-48   
ref|XP_002277279.1|  PREDICTED: GDSL esterase/lipase At5g45950          172   3e-48   
ref|XP_009593510.1|  PREDICTED: GDSL esterase/lipase At5g03820-li...    171   3e-48   
ref|XP_006411572.1|  hypothetical protein EUTSA_v10016869mg             172   3e-48   
ref|XP_009385218.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     171   4e-48   
ref|XP_010252590.1|  PREDICTED: GDSL esterase/lipase At2g42990-li...    171   5e-48   
ref|XP_006357973.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     171   6e-48   
ref|XP_009589386.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     171   8e-48   
ref|XP_006357972.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     171   8e-48   
ref|XP_010110233.1|  GDSL esterase/lipase                               171   8e-48   
ref|XP_010524116.1|  PREDICTED: GDSL esterase/lipase At2g42990          171   9e-48   
ref|XP_010517851.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     171   1e-47   
ref|XP_008229570.1|  PREDICTED: GDSL esterase/lipase At2g42990          170   1e-47   
ref|XP_003616833.1|  GDSL esterase/lipase                               171   1e-47   
ref|XP_006852534.1|  hypothetical protein AMTR_s00021p00182700          171   1e-47   
ref|XP_007215624.1|  hypothetical protein PRUPE_ppa007979mg             170   1e-47   
gb|EPS67060.1|  hypothetical protein M569_07715                         170   2e-47   
ref|XP_010508487.1|  PREDICTED: GDSL esterase/lipase At2g42990          170   2e-47   
gb|KDP30830.1|  hypothetical protein JCGZ_13773                         170   2e-47   
ref|XP_009796437.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     170   3e-47   
ref|XP_007049207.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    169   3e-47   
gb|KEH29406.1|  GDSL-like lipase/acylhydrolase                          165   3e-47   
ref|XP_011096387.1|  PREDICTED: GDSL esterase/lipase At5g45950          170   3e-47   
ref|XP_006381650.1|  hypothetical protein POPTR_0006s14670g             168   3e-47   
ref|XP_004305967.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     169   5e-47   
ref|NP_181827.2|  GDSL esterase/lipase                                  169   5e-47   
ref|XP_006293493.1|  hypothetical protein CARUB_v10023509mg             169   6e-47   
ref|XP_004502157.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     169   6e-47   
ref|XP_003528475.1|  PREDICTED: GDSL esterase/lipase At5g45960-like     169   6e-47   
ref|XP_002880015.1|  GDSL-motif lipase/hydrolase family protein         169   7e-47   
gb|KDP39193.1|  hypothetical protein JCGZ_00950                         168   8e-47   
ref|XP_002305097.1|  GDSL-motif lipase/hydrolase family protein         169   8e-47   
ref|XP_004305968.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     168   9e-47   
gb|KHG15434.1|  hypothetical protein F383_19515                         168   1e-46   
ref|XP_010494752.1|  PREDICTED: GDSL esterase/lipase At5g45960-li...    164   1e-46   
ref|XP_009776386.1|  PREDICTED: GDSL esterase/lipase At5g45960-li...    164   1e-46   
ref|XP_002964035.1|  hypothetical protein SELMODRAFT_438768             168   1e-46   
gb|KJB10712.1|  hypothetical protein B456_001G217800                    168   1e-46   
ref|XP_010943280.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     166   2e-46   
gb|AAM65485.1|  putative GDSL-motif lipase/hydrolase                    167   2e-46   
gb|KHG19347.1|  hypothetical protein F383_26236                         167   2e-46   
ref|XP_010279185.1|  PREDICTED: GDSL esterase/lipase At5g45950-like     167   2e-46   
gb|KDP21040.1|  hypothetical protein JCGZ_21511                         167   2e-46   
ref|XP_010111929.1|  GDSL esterase/lipase                               164   2e-46   
ref|XP_009365141.1|  PREDICTED: GDSL esterase/lipase At2g42990-li...    166   2e-46   
gb|KJB42834.1|  hypothetical protein B456_007G169400                    166   2e-46   
ref|XP_007141675.1|  hypothetical protein PHAVU_008G215600g             167   2e-46   
ref|XP_004305842.1|  PREDICTED: GDSL esterase/lipase At2g42990          167   2e-46   
ref|XP_006298032.1|  hypothetical protein CARUB_v10014077mg             167   2e-46   
ref|XP_002528958.1|  zinc finger protein, putative                      167   2e-46   
ref|XP_008799468.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     167   3e-46   
gb|AFK45979.1|  unknown                                                 167   3e-46   
ref|XP_008379703.1|  PREDICTED: GDSL esterase/lipase At2g42990-li...    166   3e-46   
ref|XP_004243510.2|  PREDICTED: GDSL esterase/lipase At2g42990-like     167   3e-46   
ref|XP_008229820.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     167   3e-46   
ref|XP_002301596.1|  GDSL-motif lipase/hydrolase family protein         167   3e-46   
ref|XP_007141674.1|  hypothetical protein PHAVU_008G215500g             167   3e-46   
ref|XP_009365140.1|  PREDICTED: GDSL esterase/lipase At2g42990-li...    167   3e-46   
ref|XP_010928403.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     167   4e-46   
ref|XP_011027739.1|  PREDICTED: GDSL esterase/lipase At5g45950          167   4e-46   
gb|KJB10713.1|  hypothetical protein B456_001G218000                    166   4e-46   
ref|XP_008379702.1|  PREDICTED: GDSL esterase/lipase At2g42990-li...    166   4e-46   
ref|XP_006367195.1|  PREDICTED: GDSL esterase/lipase At5g45950-like     166   5e-46   
ref|XP_002321156.2|  hypothetical protein POPTR_0014s15840g             165   5e-46   
gb|EYU28038.1|  hypothetical protein MIMGU_mgv1a008691mg                167   5e-46   
gb|KHG13393.1|  hypothetical protein F383_18050                         166   5e-46   
gb|KJB42833.1|  hypothetical protein B456_007G169400                    166   5e-46   
ref|XP_007049209.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    168   6e-46   
ref|XP_010488704.1|  PREDICTED: GDSL esterase/lipase At2g04570          166   6e-46   
ref|XP_004491082.1|  PREDICTED: GDSL esterase/lipase At4g26790-like     166   6e-46   
ref|XP_004491083.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     166   7e-46   
ref|XP_011003480.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     166   7e-46   
ref|XP_008449490.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     166   7e-46   
ref|XP_010467017.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     166   8e-46   
ref|XP_009395858.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     166   9e-46   
ref|XP_002883649.1|  GDSL-motif lipase/hydrolase family protein         165   1e-45   
gb|EEC80013.1|  hypothetical protein OsI_21681                          165   1e-45   
ref|XP_008225438.1|  PREDICTED: GDSL esterase/lipase At5g45950          166   1e-45   
ref|XP_004240155.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     165   1e-45   
ref|XP_007211484.1|  hypothetical protein PRUPE_ppa007642mg             165   1e-45   
ref|XP_009136143.1|  PREDICTED: GDSL esterase/lipase At2g04570          165   2e-45   
ref|XP_007215622.1|  hypothetical protein PRUPE_ppa007953mg             165   2e-45   
ref|XP_004140129.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     164   2e-45   
ref|XP_002459883.1|  hypothetical protein SORBIDRAFT_02g012990          165   2e-45   
ref|XP_010518560.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     165   2e-45   
emb|CDY15057.1|  BnaC03g44180D                                          164   2e-45   
ref|XP_006342261.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     165   2e-45   
ref|XP_004232946.1|  PREDICTED: GDSL esterase/lipase At5g45950          165   2e-45   
ref|XP_009356602.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     164   2e-45   
ref|XP_007148085.1|  hypothetical protein PHAVU_006G179500g             164   2e-45   
ref|XP_011100466.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     164   2e-45   
ref|NP_178536.1|  GDSL esterase/lipase                                  164   3e-45   
dbj|BAD43087.1|  putative GDSL-motif lipase/hydrolase                   164   3e-45   
ref|XP_010532997.1|  PREDICTED: GDSL esterase/lipase At2g04570          164   4e-45   
ref|XP_010260395.1|  PREDICTED: GDSL esterase/lipase At5g45950-like     164   4e-45   
ref|XP_006382055.1|  hypothetical protein POPTR_0006s256601g            156   5e-45   
emb|CDY14175.1|  BnaC02g02920D                                          163   5e-45   
ref|XP_006377451.1|  GDSL-motif lipase/hydrolase family protein         164   5e-45   
gb|KFK31786.1|  hypothetical protein AALP_AA6G158100                    163   5e-45   
ref|XP_004134938.1|  PREDICTED: GDSL esterase/lipase At5g45950-like     164   5e-45   
gb|EEE65090.1|  hypothetical protein OsJ_20133                          163   6e-45   
ref|XP_010494751.1|  PREDICTED: GDSL esterase/lipase At5g45960-li...    164   6e-45   
ref|XP_003616835.1|  GDSL esterase/lipase                               163   6e-45   
gb|EYU27381.1|  hypothetical protein MIMGU_mgv1a025165mg                163   6e-45   
dbj|BAG87330.1|  unnamed protein product                                162   6e-45   
ref|XP_006452455.1|  hypothetical protein CICLE_v10008798mg             163   6e-45   
ref|XP_011085484.1|  PREDICTED: GDSL esterase/lipase At2g04570          163   6e-45   
ref|XP_008439783.1|  PREDICTED: GDSL esterase/lipase At5g45950          164   7e-45   
ref|XP_008449488.1|  PREDICTED: GDSL esterase/lipase At2g04570          163   7e-45   
ref|XP_009784175.1|  PREDICTED: GDSL esterase/lipase At5g45960-like     160   7e-45   
ref|XP_007025488.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    163   8e-45   
gb|ACN40345.1|  unknown                                                 163   8e-45   
ref|XP_007025489.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    163   8e-45   
ref|XP_009776384.1|  PREDICTED: GDSL esterase/lipase At5g45960-li...    163   8e-45   
ref|XP_006447674.1|  hypothetical protein CICLE_v10015771mg             163   9e-45   
ref|XP_002276681.1|  PREDICTED: GDSL esterase/lipase At2g04570          163   1e-44   
ref|XP_002438873.1|  hypothetical protein SORBIDRAFT_10g027580          162   1e-44   
ref|XP_006602262.1|  PREDICTED: GDSL esterase/lipase At2g42990-li...    162   1e-44   
ref|XP_006602261.1|  PREDICTED: GDSL esterase/lipase At2g42990-li...    162   1e-44   
ref|XP_007048967.1|  GDSL Lipase/Acylhydrolase superfamily protein      162   1e-44   
gb|KHN18936.1|  GDSL esterase/lipase                                    162   1e-44   
ref|XP_009776383.1|  PREDICTED: GDSL esterase/lipase At5g45960-li...    163   1e-44   
ref|XP_002306752.2|  GDSL-motif lipase/hydrolase family protein         162   1e-44   
ref|XP_010688929.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     163   2e-44   
ref|NP_001242159.1|  uncharacterized protein LOC100812614 precursor     162   2e-44   
ref|XP_006475005.1|  PREDICTED: GDSL esterase/lipase At4g26790-like     162   2e-44   
gb|ABK21631.1|  unknown                                                 162   2e-44   
gb|KDO59582.1|  hypothetical protein CISIN_1g018664mg                   162   2e-44   
ref|XP_003551930.1|  PREDICTED: GDSL esterase/lipase At2g42990-li...    162   2e-44   
gb|KHG24676.1|  hypothetical protein F383_10019                         162   2e-44   
ref|XP_003542316.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     162   2e-44   
ref|NP_001062626.1|  Os09g0132200                                       162   2e-44   
gb|KDO77761.1|  hypothetical protein CISIN_1g018195mg                   161   2e-44   
emb|CDO96724.1|  unnamed protein product                                162   3e-44   
gb|KJB57456.1|  hypothetical protein B456_009G165300                    162   3e-44   
gb|KHN38506.1|  GDSL esterase/lipase                                    162   3e-44   
ref|XP_008380187.1|  PREDICTED: GDSL esterase/lipase At2g42990          161   3e-44   
ref|XP_010441648.1|  PREDICTED: GDSL esterase/lipase At5g45960-like     162   4e-44   
ref|XP_003519438.1|  PREDICTED: GDSL esterase/lipase At2g04570-li...    161   4e-44   
ref|XP_001775537.1|  predicted protein                                  162   4e-44   
gb|KHN44743.1|  GDSL esterase/lipase                                    161   4e-44   
ref|NP_001242128.1|  uncharacterized protein LOC100804416 precursor     161   4e-44   
emb|CDP05713.1|  unnamed protein product                                161   5e-44   
gb|KCW88729.1|  hypothetical protein EUGRSUZ_A01084                     159   6e-44   
gb|KHN47206.1|  GDSL esterase/lipase                                    161   6e-44   
ref|XP_007020707.1|  Zinc finger protein, putative                      160   7e-44   
ref|XP_009392112.1|  PREDICTED: GDSL esterase/lipase At4g26790-like     160   7e-44   
ref|XP_004499972.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     160   7e-44   
ref|XP_006467695.1|  PREDICTED: GDSL esterase/lipase At5g45950-like     160   7e-44   
emb|CDO96723.1|  unnamed protein product                                161   8e-44   
gb|KHN08474.1|  GDSL esterase/lipase                                    160   8e-44   
ref|XP_003542710.1|  PREDICTED: GDSL esterase/lipase At5g45960-like     161   8e-44   
ref|XP_009802938.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     160   8e-44   
ref|XP_006449447.1|  hypothetical protein CICLE_v10015728mg             160   9e-44   
ref|XP_003616836.1|  GDSL esterase/lipase                               160   9e-44   
gb|AFK34636.1|  unknown                                                 160   9e-44   
ref|XP_009398920.1|  PREDICTED: GDSL esterase/lipase EXL3-like          160   9e-44   
ref|XP_006342286.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     160   9e-44   
ref|XP_008357836.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     160   1e-43   
ref|XP_010067942.1|  PREDICTED: GDSL esterase/lipase At4g26790-like     160   1e-43   
ref|XP_009408725.1|  PREDICTED: GDSL esterase/lipase At4g26790-like     160   1e-43   
ref|XP_003541717.1|  PREDICTED: GDSL esterase/lipase At5g45950-like     160   1e-43   
gb|KFK29189.1|  hypothetical protein AALP_AA7G101100                    160   1e-43   
ref|XP_008348146.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     159   1e-43   
ref|XP_011080712.1|  PREDICTED: GDSL esterase/lipase At2g30310-like     160   1e-43   
ref|XP_004505116.1|  PREDICTED: GDSL esterase/lipase At5g45960-like     160   1e-43   
ref|XP_006418560.1|  hypothetical protein EUTSA_v10002592mg             160   1e-43   
ref|XP_006377450.1|  hypothetical protein POPTR_0011s06030g             160   2e-43   
ref|XP_008379700.1|  PREDICTED: GDSL esterase/lipase At2g04570          160   2e-43   
ref|XP_008806090.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     159   2e-43   
ref|XP_004240156.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     159   2e-43   
ref|XP_010686362.1|  PREDICTED: GDSL esterase/lipase At5g45960-like     160   2e-43   
ref|XP_004134939.1|  PREDICTED: GDSL esterase/lipase At5g45960-like     160   2e-43   
ref|XP_011095454.1|  PREDICTED: GDSL esterase/lipase At4g26790          159   2e-43   
ref|XP_011086020.1|  PREDICTED: GDSL esterase/lipase At5g45960-like     160   2e-43   
gb|KEH30938.1|  GDSL-like lipase/acylhydrolase                          160   2e-43   
gb|AFK46089.1|  unknown                                                 157   2e-43   
ref|XP_006361071.1|  PREDICTED: GDSL esterase/lipase At5g45960-like     159   2e-43   
ref|XP_009620415.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     159   2e-43   
gb|EYU27380.1|  hypothetical protein MIMGU_mgv1a019511mg                159   3e-43   
emb|CAN70740.1|  hypothetical protein VITISV_013920                     159   3e-43   
ref|XP_004140128.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     159   3e-43   
ref|XP_006660429.1|  PREDICTED: GDSL esterase/lipase At2g42990-li...    159   3e-43   
ref|XP_011003477.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     159   3e-43   
ref|XP_010536687.1|  PREDICTED: GDSL esterase/lipase At4g26790-like     159   3e-43   
ref|XP_008439785.1|  PREDICTED: GDSL esterase/lipase At5g45960          159   3e-43   
ref|NP_001130213.1|  hypothetical protein precursor                     159   3e-43   
ref|XP_007153690.1|  hypothetical protein PHAVU_003G056700g             159   3e-43   
ref|XP_010644495.1|  PREDICTED: GDSL esterase/lipase At4g26790          159   4e-43   
ref|XP_009365138.1|  PREDICTED: GDSL esterase/lipase At2g04570          159   4e-43   
emb|CBI26692.3|  unnamed protein product                                159   4e-43   
emb|CAN76714.1|  hypothetical protein VITISV_018794                     159   4e-43   
dbj|BAK07884.1|  predicted protein                                      159   4e-43   
ref|XP_009618391.1|  PREDICTED: GDSL esterase/lipase At5g45960-li...    159   5e-43   
gb|KHM99646.1|  GDSL esterase/lipase                                    158   5e-43   
emb|CBI28884.3|  unnamed protein product                                162   5e-43   
ref|XP_007215626.1|  hypothetical protein PRUPE_ppa007991mg             158   5e-43   
ref|XP_007015992.1|  GDSL esterase/lipase isoform 2                     156   5e-43   
ref|XP_010657253.1|  PREDICTED: GDSL esterase/lipase At4g26790-like     158   6e-43   
ref|XP_004499293.1|  PREDICTED: GDSL esterase/lipase EXL3-like          158   6e-43   



>ref|XP_010690130.1| PREDICTED: GDSL esterase/lipase APG-like [Beta vulgaris subsp. 
vulgaris]
Length=354

 Score =   297 bits (760),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/171 (84%), Positives = 159/171 (93%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            Q LVPAII FGDS+VDVGNN+YV T+FKADYPPYGRDFA+H+PTGRFCNGKLATDITADT
Sbjct  26   QSLVPAIITFGDSTVDVGNNDYVATLFKADYPPYGRDFANHKPTGRFCNGKLATDITADT  85

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+SYP AYLSPQA+G+NLLIGANFASAASGYD+KTALLS+AI LSQQ+EYYKEYQGKL
Sbjct  86   LGFTSYPPAYLSPQASGQNLLIGANFASAASGYDDKTALLSHAISLSQQLEYYKEYQGKL  145

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
              VAGS KA SIIKDALYIVGFGSSDF+QNYYVNP+  K+YTPD+Y SYLV
Sbjct  146  TKVAGSSKAKSIIKDALYIVGFGSSDFVQNYYVNPFYYKLYTPDEYSSYLV  196



>ref|XP_010654595.1| PREDICTED: GDSL esterase/lipase APG-like [Vitis vinifera]
 emb|CAN65529.1| hypothetical protein VITISV_039628 [Vitis vinifera]
 emb|CBI36030.3| unnamed protein product [Vitis vinifera]
Length=356

 Score =   293 bits (749),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 158/169 (93%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAII FGDS+VDVGNN+Y+ TIFKA+YPPYGRDF +HQPTGRFCNGKLATDITADTLG
Sbjct  30   LVPAIITFGDSAVDVGNNDYLLTIFKANYPPYGRDFINHQPTGRFCNGKLATDITADTLG  89

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F +YP AYLSP+A+GKNLLIGANFASA SGYD+KTA+LS+AIPLSQQ+EYYKEYQ KLA 
Sbjct  90   FKTYPPAYLSPKASGKNLLIGANFASAGSGYDDKTAILSHAIPLSQQLEYYKEYQAKLAK  149

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            VAGS+KAA+IIKDALY+VG GSSDF+QNYYVNP+LNKVYTPDQY S LV
Sbjct  150  VAGSQKAATIIKDALYVVGAGSSDFIQNYYVNPFLNKVYTPDQYASILV  198



>ref|XP_009344493.1| PREDICTED: GDSL esterase/lipase APG-like [Pyrus x bretschneideri]
Length=358

 Score =   292 bits (748),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 148/190 (78%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = +1

Query  40   FGEVLavifvaafivgggaQPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASH  219
            FG VLA  FV        +  LVPAI+ FGDS+VDVGNN+Y+ TIFKA+YPPYGRDF SH
Sbjct  11   FGLVLAFAFVIGGNYAQESTTLVPAIMTFGDSAVDVGNNDYLPTIFKANYPPYGRDFVSH  70

Query  220  QPTGRFCNGKLATDITADTLGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLS  399
            QPTGRFCNGKLATDITADTLGF++YP AYLSPQA+GKNLLIGANFASAASGYDEK A L+
Sbjct  71   QPTGRFCNGKLATDITADTLGFTTYPPAYLSPQASGKNLLIGANFASAASGYDEKAATLN  130

Query  400  NAIPLSQQVEYYKEYQGKLAGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVY  579
            +AIPLSQQ++YYKEYQ KLA VAGSKKAASIIKDALY++  G+SDFLQNYYVNP++NKVY
Sbjct  131  HAIPLSQQLQYYKEYQKKLAKVAGSKKAASIIKDALYLLSAGNSDFLQNYYVNPFVNKVY  190

Query  580  TPDQYGSYLV  609
            TPDQYGS LV
Sbjct  191  TPDQYGSILV  200



>dbj|BAM08277.1| zinc finger protein [Malus domestica]
Length=358

 Score =   292 bits (748),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 148/190 (78%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = +1

Query  40   FGEVLavifvaafivgggaQPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASH  219
            FG VLA  FV        +  LVPAI+ FGDS+VDVGNN+Y+ TIFKA+YPPYGRDF SH
Sbjct  11   FGLVLAFAFVIGGNYAQESTTLVPAIMTFGDSAVDVGNNDYLPTIFKANYPPYGRDFVSH  70

Query  220  QPTGRFCNGKLATDITADTLGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLS  399
            QPTGRFCNGKLATDITADTLGF++YP AYLSPQA+GKNLLIGANFASAASGYDEK A L+
Sbjct  71   QPTGRFCNGKLATDITADTLGFTTYPPAYLSPQASGKNLLIGANFASAASGYDEKAATLN  130

Query  400  NAIPLSQQVEYYKEYQGKLAGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVY  579
            +AIPLSQQ++YYKEYQ KLA VAGSKKAASIIKDALY++  G+SDFLQNYYVNP++NKVY
Sbjct  131  HAIPLSQQLQYYKEYQTKLAKVAGSKKAASIIKDALYLLSAGNSDFLQNYYVNPFVNKVY  190

Query  580  TPDQYGSYLV  609
            TPDQYGS LV
Sbjct  191  TPDQYGSILV  200



>ref|XP_008358081.1| PREDICTED: GDSL esterase/lipase APG-like [Malus domestica]
Length=388

 Score =   293 bits (749),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 148/190 (78%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = +1

Query  40   FGEVLavifvaafivgggaQPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASH  219
            FG VLA  FV        +  LVPAI+ FGDS+VDVGNN+Y+ TIFKA+YPPYGRDF SH
Sbjct  41   FGLVLAFAFVIGGNYAQESTTLVPAIMTFGDSAVDVGNNDYLPTIFKANYPPYGRDFVSH  100

Query  220  QPTGRFCNGKLATDITADTLGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLS  399
            QPTGRFCNGKLATDITADTLGF++YP AYLSPQA+GKNLLIGANFASAASGYDEK A L+
Sbjct  101  QPTGRFCNGKLATDITADTLGFTTYPPAYLSPQASGKNLLIGANFASAASGYDEKAATLN  160

Query  400  NAIPLSQQVEYYKEYQGKLAGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVY  579
            +AIPLSQQ++YYKEYQ KLA VAGSKKAASIIKDALY++  G+SDFLQNYYVNP++NKVY
Sbjct  161  HAIPLSQQLQYYKEYQTKLAKVAGSKKAASIIKDALYLLSAGNSDFLQNYYVNPFVNKVY  220

Query  580  TPDQYGSYLV  609
            TPDQYGS LV
Sbjct  221  TPDQYGSILV  230



>ref|XP_008380836.1| PREDICTED: GDSL esterase/lipase APG-like [Malus domestica]
Length=388

 Score =   292 bits (748),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 148/190 (78%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = +1

Query  40   FGEVLavifvaafivgggaQPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASH  219
            FG VLA  FV        +  LVPAI+ FGDS+VDVGNN+Y+ TIFKA+YPPYGRDF SH
Sbjct  41   FGLVLAFAFVIGGNYAQESTTLVPAIMTFGDSAVDVGNNDYLPTIFKANYPPYGRDFVSH  100

Query  220  QPTGRFCNGKLATDITADTLGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLS  399
            QPTGRFCNGKLATDITADTLGF++YP AYLSPQA+GKNLLIGANFASAASGYDEK A L+
Sbjct  101  QPTGRFCNGKLATDITADTLGFTTYPPAYLSPQASGKNLLIGANFASAASGYDEKAATLN  160

Query  400  NAIPLSQQVEYYKEYQGKLAGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVY  579
            +AIPLSQQ++YYKEYQ KLA VAGSKKAASIIKDALY++  G+SDFLQNYYVNP++NKVY
Sbjct  161  HAIPLSQQLQYYKEYQTKLAKVAGSKKAASIIKDALYLLSAGNSDFLQNYYVNPFVNKVY  220

Query  580  TPDQYGSYLV  609
            TPDQYGS LV
Sbjct  221  TPDQYGSILV  230



>ref|XP_004235632.1| PREDICTED: GDSL esterase/lipase APG-like [Solanum lycopersicum]
Length=359

 Score =   291 bits (745),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 158/169 (93%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAII FGDS+VDVGNN+Y+HT+FKA+YPPYGRDF + QPTGRFCNGKLATDITADTLG
Sbjct  33   LVPAIITFGDSAVDVGNNDYIHTLFKANYPPYGRDFVTRQPTGRFCNGKLATDITADTLG  92

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F++YP AYLSP+A+GKNLLIG NFASAA+G+D+KTA+L++AIP S Q++YYKEYQ KLA 
Sbjct  93   FTTYPAAYLSPEASGKNLLIGTNFASAAAGFDDKTAILNHAIPFSTQMQYYKEYQSKLAK  152

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            VAGS+KAASI+KDALYI+  GSSDFLQNYY+NPYLNK+YTPDQYGSYLV
Sbjct  153  VAGSQKAASILKDALYIISAGSSDFLQNYYINPYLNKLYTPDQYGSYLV  201



>ref|XP_006343026.1| PREDICTED: GDSL esterase/lipase APG-like [Solanum tuberosum]
Length=359

 Score =   291 bits (745),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 158/169 (93%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAII FGDS+VDVGNN+Y+HT+FKA+YPPYGRDF + QPTGRFCNGKLATDITADTLG
Sbjct  33   LVPAIITFGDSAVDVGNNDYIHTLFKANYPPYGRDFVTRQPTGRFCNGKLATDITADTLG  92

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F++YP AYLSP+A+GKNLLIG NFASAA+G+D+KTA+L++AIP S Q++YYKEYQ KLA 
Sbjct  93   FTTYPAAYLSPEASGKNLLIGTNFASAAAGFDDKTAILNHAIPFSTQMQYYKEYQSKLAK  152

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            VAGS+KAASI+KDALYI+  GSSDFLQNYY+NPYLNK+YTPDQYGSYLV
Sbjct  153  VAGSQKAASILKDALYIISAGSSDFLQNYYLNPYLNKLYTPDQYGSYLV  201



>ref|XP_008375835.1| PREDICTED: GDSL esterase/lipase APG-like [Malus domestica]
Length=357

 Score =   291 bits (744),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 147/194 (76%), Positives = 165/194 (85%), Gaps = 0/194 (0%)
 Frame = +1

Query  28   MGCRFGEVLavifvaafivgggaQPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRD  207
            +   FG VL   FV        +  LVPAI+ FGDS+VDVGNN+Y+ TIFKADYPPYGRD
Sbjct  6    LSAAFGLVLVFAFVIGGNYAQESTTLVPAIMTFGDSAVDVGNNDYLPTIFKADYPPYGRD  65

Query  208  FASHQPTGRFCNGKLATDITADTLGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKT  387
            F +HQPTGRFCNGKLATDITADTLGFS+YP AYLSPQA+GKNLLIGANFASAASGYD+K 
Sbjct  66   FVNHQPTGRFCNGKLATDITADTLGFSTYPPAYLSPQASGKNLLIGANFASAASGYDDKA  125

Query  388  ALLSNAIPLSQQVEYYKEYQGKLAGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYL  567
            A LS+AIPLSQQ++YYKEYQ KLA VAGS KAASIIKDALY++  G+SDFLQNYYVNP++
Sbjct  126  ATLSHAIPLSQQLQYYKEYQTKLAKVAGSMKAASIIKDALYLLSAGNSDFLQNYYVNPFV  185

Query  568  NKVYTPDQYGSYLV  609
            NKVYTPDQYGS LV
Sbjct  186  NKVYTPDQYGSILV  199



>ref|XP_009612468.1| PREDICTED: GDSL esterase/lipase APG [Nicotiana tomentosiformis]
Length=354

 Score =   290 bits (742),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 158/169 (93%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAII FGDS+VDVGNN+Y+HT+FKA+YPPYGRDF + QPTGRFCNGKLATDITADTLG
Sbjct  28   LVPAIITFGDSAVDVGNNDYIHTLFKANYPPYGRDFVNRQPTGRFCNGKLATDITADTLG  87

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F++YP AYLSPQA+GKNLLIG NFASAA+GYD+KTA+L++AIPLS Q++YYKEYQ KL  
Sbjct  88   FTTYPSAYLSPQASGKNLLIGTNFASAAAGYDDKTAILNHAIPLSIQMQYYKEYQAKLTK  147

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            VAGS+KAASI+KDALY++  GSSDFLQNYY+NPY+NK+YTPDQYGSYLV
Sbjct  148  VAGSQKAASILKDALYLLSAGSSDFLQNYYINPYINKLYTPDQYGSYLV  196



>ref|XP_009337919.1| PREDICTED: GDSL esterase/lipase APG-like [Pyrus x bretschneideri]
Length=357

 Score =   290 bits (741),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 147/194 (76%), Positives = 165/194 (85%), Gaps = 0/194 (0%)
 Frame = +1

Query  28   MGCRFGEVLavifvaafivgggaQPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRD  207
            +   FG VLA  FV        +  LVPAI+ FGDS+VDVGNNN++ TIFKADYPPYGRD
Sbjct  6    LSAAFGLVLAFAFVIGGNYAQESTTLVPAIMTFGDSAVDVGNNNFLPTIFKADYPPYGRD  65

Query  208  FASHQPTGRFCNGKLATDITADTLGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKT  387
            F +HQPTGRFCNGKLATDITADTLGF++YP AYLSPQA+GKNLLIGANFASAASGYD+K 
Sbjct  66   FVNHQPTGRFCNGKLATDITADTLGFTTYPPAYLSPQASGKNLLIGANFASAASGYDDKA  125

Query  388  ALLSNAIPLSQQVEYYKEYQGKLAGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYL  567
            A LS+AIPLSQQ+ YYKEYQ KLA VAGS KAASIIKDALY++  G+SDFLQNYYVNP++
Sbjct  126  ATLSHAIPLSQQLHYYKEYQTKLATVAGSMKAASIIKDALYLLSAGNSDFLQNYYVNPFV  185

Query  568  NKVYTPDQYGSYLV  609
            NKVYTPDQYGS LV
Sbjct  186  NKVYTPDQYGSILV  199



>ref|XP_009759976.1| PREDICTED: GDSL esterase/lipase APG [Nicotiana sylvestris]
Length=354

 Score =   290 bits (741),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 158/169 (93%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAII FGDS+VDVGNN+Y+HT+FKA+YPPYGRDF + QPTGRFCNGKLATDITADTLG
Sbjct  28   LVPAIITFGDSAVDVGNNDYIHTLFKANYPPYGRDFVNRQPTGRFCNGKLATDITADTLG  87

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F++YP AYLSPQA+GKNLLIG NFASAA+GYD+KTA+L++AIPLS Q++YYKEYQ KL  
Sbjct  88   FTTYPPAYLSPQASGKNLLIGTNFASAAAGYDDKTAVLNHAIPLSIQMQYYKEYQAKLTK  147

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            VAGS+KAASI+KDALYI+  GSSDFLQNYY+NPY+NK+YTPDQYGSYL+
Sbjct  148  VAGSQKAASILKDALYILSAGSSDFLQNYYINPYINKLYTPDQYGSYLI  196



>ref|XP_008228396.1| PREDICTED: GDSL esterase/lipase APG [Prunus mume]
Length=360

 Score =   289 bits (739),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 158/169 (93%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAI+ FGDS+VDVGNN+Y+ TIFKA+YPPYGRDF +HQPTGRFCNGKLATDITADTLG
Sbjct  34   LVPAIMTFGDSAVDVGNNDYLPTIFKANYPPYGRDFVNHQPTGRFCNGKLATDITADTLG  93

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F++YP AYLSPQA+GKNLLIGANFASAASGYDEK A L++AIPLSQQ++Y++EYQGKLA 
Sbjct  94   FTTYPPAYLSPQASGKNLLIGANFASAASGYDEKAATLNHAIPLSQQLQYFREYQGKLAK  153

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            VAGSKKAASI+KDALY++  G+SDFLQNYYVNPYLN+VYTP+QY S LV
Sbjct  154  VAGSKKAASIVKDALYLLSAGNSDFLQNYYVNPYLNRVYTPEQYSSILV  202



>ref|XP_011072453.1| PREDICTED: GDSL esterase/lipase APG [Sesamum indicum]
Length=350

 Score =   288 bits (737),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 165/203 (81%), Gaps = 14/203 (7%)
 Frame = +1

Query  1    IISHTIS*KMGCRFGEVLavifvaafivgggaQPLVPAIIAFGDSSVDVGNNNYVHTIFK  180
            ++++T++  + C FG                   LVPAII FGDS VDVGNN+Y+HTIFK
Sbjct  4    VLAYTLAVALFCSFGNAQVT--------------LVPAIITFGDSVVDVGNNDYIHTIFK  49

Query  181  ADYPPYGRDFASHQPTGRFCNGKLATDITADTLGFSSYPVAYLSPQATGKNLLIGANFAS  360
            A+YPPYGRDF + + TGRFCNGKLATDITA+ LGF+SYP AYLSPQA+GKNLL+G+NFAS
Sbjct  50   ANYPPYGRDFKNQEATGRFCNGKLATDITAENLGFTSYPPAYLSPQASGKNLLLGSNFAS  109

Query  361  AASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAGVAGSKKAASIIKDALYIVGFGSSDFL  540
            A +GYDE T+LLS+ IPLSQQ+EYYKEYQGKLA VAGSKKAASIIKDALY+V  GSSDF+
Sbjct  110  AGAGYDEHTSLLSHVIPLSQQLEYYKEYQGKLAKVAGSKKAASIIKDALYLVSAGSSDFI  169

Query  541  QNYYVNPYLNKVYTPDQYGSYLV  609
            QNYYVNP+LNK YTPDQY SYLV
Sbjct  170  QNYYVNPFLNKAYTPDQYSSYLV  192



>gb|KHN39266.1| GDSL esterase/lipase APG [Glycine soja]
Length=353

 Score =   287 bits (735),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAII FGDS+VDVGNN+Y+ T+FKADYPPYGRDFA+HQPTGRFCNGKLATD TADTLG
Sbjct  27   LVPAIITFGDSAVDVGNNDYLPTLFKADYPPYGRDFANHQPTGRFCNGKLATDFTADTLG  86

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F +Y  AYLSPQA+GKNLLIGANFASAASGYDE  A L++AIPLSQQ+ Y+KEYQGKLA 
Sbjct  87   FKTYAPAYLSPQASGKNLLIGANFASAASGYDENAATLNHAIPLSQQLSYFKEYQGKLAK  146

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            VAGSKKAASIIKDALY++  GSSDF+QNYYVNP++NKVY+PDQY SYLV
Sbjct  147  VAGSKKAASIIKDALYVLSAGSSDFVQNYYVNPWINKVYSPDQYSSYLV  195



>ref|XP_007215590.1| hypothetical protein PRUPE_ppa007650mg [Prunus persica]
 gb|EMJ16789.1| hypothetical protein PRUPE_ppa007650mg [Prunus persica]
Length=360

 Score =   287 bits (735),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAI+ FGDS+VDVGNN+Y+ TIFKA+YPPYGRDF +HQPTGRFCNGKLATDITADTLG
Sbjct  34   LVPAIMTFGDSAVDVGNNDYLPTIFKANYPPYGRDFVNHQPTGRFCNGKLATDITADTLG  93

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F++YP AYLSPQA+G NLLIGANFASAASGYDEK A L++AIPLSQQ++Y++EYQGKLA 
Sbjct  94   FTTYPPAYLSPQASGNNLLIGANFASAASGYDEKAATLNHAIPLSQQLQYFREYQGKLAE  153

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            VAGSKKAASIIKDALY++  G+SDFLQNYYVNPYLN+VYTP+QY S LV
Sbjct  154  VAGSKKAASIIKDALYLLSAGNSDFLQNYYVNPYLNRVYTPEQYSSILV  202



>ref|NP_001242561.1| uncharacterized protein LOC100815273 precursor [Glycine max]
 gb|ACU20309.1| unknown [Glycine max]
Length=353

 Score =   287 bits (734),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAII FGDS+VDVGNN+Y+ T+FKADYPPYGRDFA+HQPTGRFCNGKLATD TADTLG
Sbjct  27   LVPAIITFGDSAVDVGNNDYLPTLFKADYPPYGRDFANHQPTGRFCNGKLATDFTADTLG  86

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F +Y  AYLSPQA+GKNLLIGANFASAASGYDE  A L++AIPLSQQ+ Y+KEYQGKLA 
Sbjct  87   FKTYAPAYLSPQASGKNLLIGANFASAASGYDENAATLNHAIPLSQQLSYFKEYQGKLAK  146

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            VAGSKKAASIIKDALY++  GSSDF+QNYYVNP++NKVY+PDQY SYLV
Sbjct  147  VAGSKKAASIIKDALYVLSAGSSDFVQNYYVNPWINKVYSPDQYSSYLV  195



>ref|XP_009343018.1| PREDICTED: GDSL esterase/lipase APG-like [Pyrus x bretschneideri]
Length=357

 Score =   287 bits (734),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 145/194 (75%), Positives = 165/194 (85%), Gaps = 0/194 (0%)
 Frame = +1

Query  28   MGCRFGEVLavifvaafivgggaQPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRD  207
            +   FG VLA  FV        +  LVPAI+ FGDS+VDVGNNN++ TIFKA+YPPYGRD
Sbjct  6    LSAAFGLVLAFAFVIGGNYAQESTTLVPAIMTFGDSAVDVGNNNFLPTIFKANYPPYGRD  65

Query  208  FASHQPTGRFCNGKLATDITADTLGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKT  387
            F +HQPTGRFCNGKLATDITADTLGF++YP AYLSPQA+GKNLL+GANFASAASGYD+K 
Sbjct  66   FVNHQPTGRFCNGKLATDITADTLGFTTYPPAYLSPQASGKNLLMGANFASAASGYDDKA  125

Query  388  ALLSNAIPLSQQVEYYKEYQGKLAGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYL  567
            A LS+AIPLSQQ+ YYKEYQ KLA VAGS KAASIIKDALY++  G+SDFLQNYYVNP++
Sbjct  126  ATLSHAIPLSQQLHYYKEYQTKLATVAGSTKAASIIKDALYLLSAGNSDFLQNYYVNPFV  185

Query  568  NKVYTPDQYGSYLV  609
            NKVYTPDQYGS LV
Sbjct  186  NKVYTPDQYGSILV  199



>ref|XP_010267093.1| PREDICTED: GDSL esterase/lipase APG-like [Nelumbo nucifera]
Length=354

 Score =   285 bits (728),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAII FGDS+VDVGNN+Y+ TIFKADYPPYGRDF +H+ TGRFCNGKLATDITA+TLG
Sbjct  28   LVPAIITFGDSAVDVGNNDYLATIFKADYPPYGRDFVNHEATGRFCNGKLATDITAETLG  87

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            FS+YP AYLSP+A+GKNLLIGANFASA SGYD+KT+LLS+AIPLSQQ+EYYKEYQGKLA 
Sbjct  88   FSTYPPAYLSPKASGKNLLIGANFASAGSGYDDKTSLLSHAIPLSQQLEYYKEYQGKLAE  147

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYL  606
            VAG+ KA SI+KD+LYIV  G SDFLQNYYVNPY+NK+YTPDQY SYL
Sbjct  148  VAGNSKATSILKDSLYIVSAGPSDFLQNYYVNPYINKLYTPDQYSSYL  195



>gb|KDO38518.1| hypothetical protein CISIN_1g018227mg [Citrus sinensis]
Length=220

 Score =   280 bits (715),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +1

Query  100  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  279
            PLVPAII FGDS+VDVGNNNY+ T+FKA+YPPYGRDF +HQPTGRFCNGKLATD TADTL
Sbjct  33   PLVPAIITFGDSAVDVGNNNYLATLFKANYPPYGRDFINHQPTGRFCNGKLATDFTADTL  92

Query  280  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  459
            GF +Y  AYLSPQATGKNLLIGANFASA SGYD++T+ L++AI L+QQ++YY+EYQ KLA
Sbjct  93   GFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLA  152

Query  460  GVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             VAGSK++ASIIKDA+YIVG GS DFLQNYYVNP LNKVYTP+QY S LV
Sbjct  153  KVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLLNKVYTPEQYSSMLV  202



>gb|KHN05319.1| GDSL esterase/lipase APG [Glycine soja]
Length=354

 Score =   284 bits (727),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 153/169 (91%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAII FGDS+VDVGNN+Y+ T+FKADYPPYGRDF +HQPTGRFCNGKLATD TADTLG
Sbjct  28   LVPAIITFGDSAVDVGNNDYLPTLFKADYPPYGRDFVNHQPTGRFCNGKLATDFTADTLG  87

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F +Y  AYLSP A+GKNLLIGANFASAASGYDE  A L++AIPLSQQ+ Y+KEYQGKLA 
Sbjct  88   FKTYAPAYLSPHASGKNLLIGANFASAASGYDENAATLNHAIPLSQQLSYFKEYQGKLAK  147

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            VAGSKKAASIIKDALY++  GSSDF+QNYYVNP++NKVYTPDQY SYL+
Sbjct  148  VAGSKKAASIIKDALYVLSAGSSDFVQNYYVNPWINKVYTPDQYSSYLI  196



>gb|ACU24285.1| unknown [Glycine max]
Length=354

 Score =   284 bits (727),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 153/169 (91%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAII FGDS+VDVGNN+Y+ T+FKADYPPYGRDF +HQPTGRFCNGKLATD TADTLG
Sbjct  28   LVPAIITFGDSAVDVGNNDYLPTLFKADYPPYGRDFVNHQPTGRFCNGKLATDFTADTLG  87

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F +Y  AYLSP A+GKNLLIGANFASAASGYDE  A L++AIPLSQQ+ Y+KEYQGKLA 
Sbjct  88   FKTYAPAYLSPHASGKNLLIGANFASAASGYDENAATLNHAIPLSQQLSYFKEYQGKLAK  147

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            VAGSKKAASIIKDALY++  GSSDF+QNYYVNP++NKVYTPDQY SYL+
Sbjct  148  VAGSKKAASIIKDALYVLSAGSSDFVQNYYVNPWINKVYTPDQYSSYLI  196



>gb|KDO38516.1| hypothetical protein CISIN_1g018227mg [Citrus sinensis]
Length=273

 Score =   280 bits (717),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +1

Query  100  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  279
            PLVPAII FGDS+VDVGNNNY+ T+FKA+YPPYGRDF +HQPTGRFCNGKLATD TADTL
Sbjct  33   PLVPAIITFGDSAVDVGNNNYLATLFKANYPPYGRDFINHQPTGRFCNGKLATDFTADTL  92

Query  280  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  459
            GF +Y  AYLSPQATGKNLLIGANFASA SGYD++T+ L++AI L+QQ++YY+EYQ KLA
Sbjct  93   GFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLA  152

Query  460  GVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             VAGSK++ASIIKDA+YIVG GS DFLQNYYVNP LNKVYTP+QY S LV
Sbjct  153  KVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLLNKVYTPEQYSSMLV  202



>ref|XP_010062556.1| PREDICTED: GDSL esterase/lipase APG [Eucalyptus grandis]
 gb|KCW69695.1| hypothetical protein EUGRSUZ_F03090 [Eucalyptus grandis]
Length=356

 Score =   283 bits (724),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAII FGDS+VDVGNNNY+ TIF+A+YPPYGRDFA+H+PTGRFCNGKLATDITA+TLG
Sbjct  31   LVPAIITFGDSAVDVGNNNYLPTIFRANYPPYGRDFANHKPTGRFCNGKLATDITAETLG  90

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F+ +P AYLSP+A+GKNLLIGANFASAASGYDEK ALL++AI L QQ+EY+KEYQGKLA 
Sbjct  91   FTKFPPAYLSPEASGKNLLIGANFASAASGYDEKAALLNHAIALPQQLEYFKEYQGKLAK  150

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            VAGSK+AASI+K ALYI+  GS DFLQNYYVNPY+NKVYTPD YGS LV
Sbjct  151  VAGSKQAASIVKGALYILSAGSGDFLQNYYVNPYVNKVYTPDAYGSMLV  199



>ref|XP_003531641.2| PREDICTED: GDSL esterase/lipase APG-like [Glycine max]
Length=393

 Score =   284 bits (727),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 153/169 (91%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAII FGDS+VDVGNN+Y+ T+FKADYPPYGRDF +HQPTGRFCNGKLATD TADTLG
Sbjct  67   LVPAIITFGDSAVDVGNNDYLPTLFKADYPPYGRDFVNHQPTGRFCNGKLATDFTADTLG  126

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F +Y  AYLSP A+GKNLLIGANFASAASGYDE  A L++AIPLSQQ+ Y+KEYQGKLA 
Sbjct  127  FKTYAPAYLSPHASGKNLLIGANFASAASGYDENAATLNHAIPLSQQLSYFKEYQGKLAK  186

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            VAGSKKAASIIKDALY++  GSSDF+QNYYVNP++NKVYTPDQY SYL+
Sbjct  187  VAGSKKAASIIKDALYVLSAGSSDFVQNYYVNPWINKVYTPDQYSSYLI  235



>emb|CDO97957.1| unnamed protein product [Coffea canephora]
Length=359

 Score =   281 bits (718),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 155/174 (89%), Gaps = 3/174 (2%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDIT---  267
            QPLVPA+I FGDS+VDVGNNNY+ T+FKADYPPYGRDF +HQPTGRFCNGKLATDIT   
Sbjct  28   QPLVPALITFGDSAVDVGNNNYLPTLFKADYPPYGRDFINHQPTGRFCNGKLATDITGKY  87

Query  268  ADTLGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQ  447
             DTLGF++YP AYLSPQA+GKNLLIGANFASAASGYD+KTA LS+AIPLSQQ++Y+KEY+
Sbjct  88   TDTLGFTTYPPAYLSPQASGKNLLIGANFASAASGYDDKTAYLSHAIPLSQQLQYFKEYR  147

Query  448  GKLAGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             KL  VAG+ +AASI   ALYIVG GSSDFLQNYY+NP LNKVYTPDQY SYLV
Sbjct  148  SKLEQVAGTSQAASITGSALYIVGAGSSDFLQNYYLNPLLNKVYTPDQYSSYLV  201



>ref|XP_006426844.1| hypothetical protein CICLE_v10025938mg [Citrus clementina]
 gb|ESR40084.1| hypothetical protein CICLE_v10025938mg [Citrus clementina]
 gb|KDO38514.1| hypothetical protein CISIN_1g018227mg [Citrus sinensis]
Length=359

 Score =   280 bits (716),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +1

Query  100  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  279
            PLVPAII FGDS+VDVGNNNY+ T+FKA+YPPYGRDF +HQPTGRFCNGKLATD TADTL
Sbjct  33   PLVPAIITFGDSAVDVGNNNYLATLFKANYPPYGRDFINHQPTGRFCNGKLATDFTADTL  92

Query  280  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  459
            GF +Y  AYLSPQATGKNLLIGANFASA SGYD++T+ L++AI L+QQ++YY+EYQ KLA
Sbjct  93   GFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLA  152

Query  460  GVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             VAGSK++ASIIKDA+YIVG GS DFLQNYYVNP LNKVYTP+QY S LV
Sbjct  153  KVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLLNKVYTPEQYSSMLV  202



>ref|XP_006465718.1| PREDICTED: GDSL esterase/lipase APG-like [Citrus sinensis]
Length=357

 Score =   280 bits (716),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +1

Query  100  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  279
            PLVPAII FGDS+VDVGNNNY+ T+FKA+YPPYGRDF +HQPTGRFCNGKLATD TADTL
Sbjct  31   PLVPAIITFGDSAVDVGNNNYLATLFKANYPPYGRDFINHQPTGRFCNGKLATDFTADTL  90

Query  280  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  459
            GF +Y  AYLSPQATGKNLLIGANFASA SGYD++T+ L++AI L+QQ++YY+EYQ KLA
Sbjct  91   GFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLA  150

Query  460  GVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             VAGSK++ASIIKDA+YIVG GS DFLQNYYVNP LNKVYTP+QY S LV
Sbjct  151  KVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLNKVYTPEQYSSMLV  200



>ref|XP_007135613.1| hypothetical protein PHAVU_010G143600g [Phaseolus vulgaris]
 gb|ESW07607.1| hypothetical protein PHAVU_010G143600g [Phaseolus vulgaris]
Length=384

 Score =   281 bits (718),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 152/169 (90%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAII FGDS VDVGNNNY+ T FKADYPPYGRDF++HQPTGRFCNGKLATDITA+TLG
Sbjct  58   LVPAIITFGDSVVDVGNNNYLPTFFKADYPPYGRDFSNHQPTGRFCNGKLATDITAETLG  117

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F +Y  AYLSPQA+GKNLLIGANFASAASGYDE  A L++AI LSQQ+ Y+KEYQGKLA 
Sbjct  118  FKTYAPAYLSPQASGKNLLIGANFASAASGYDENAATLNHAITLSQQLSYFKEYQGKLAK  177

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            VAGS+KA+SIIKDALY++  GSSDF+QNYYVNP++NK YTPDQY SYL+
Sbjct  178  VAGSQKASSIIKDALYVLSAGSSDFVQNYYVNPWINKAYTPDQYSSYLI  226



>gb|KHN30020.1| GDSL esterase/lipase APG [Glycine soja]
Length=353

 Score =   279 bits (714),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 154/169 (91%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAII FGDS+VDVGNN+Y+ T+FKA+YPPYGRDF +HQPTGRFCNGKLATDITA+TLG
Sbjct  27   LVPAIITFGDSAVDVGNNDYLPTLFKANYPPYGRDFINHQPTGRFCNGKLATDITAETLG  86

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F SY  AYLSPQA+GKNLLIGANFASAASGYDEK A+L++AIPLSQQ++YYKEY+GKLA 
Sbjct  87   FKSYAPAYLSPQASGKNLLIGANFASAASGYDEKAAILNHAIPLSQQLKYYKEYRGKLAK  146

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            V GSKKAA IIK+ALYI+  GSSDF+QNYYVNP +NK +TPDQY +YLV
Sbjct  147  VVGSKKAALIIKNALYILSAGSSDFVQNYYVNPLINKAFTPDQYSAYLV  195



>ref|XP_003543615.1| PREDICTED: GDSL esterase/lipase APG-like [Glycine max]
Length=353

 Score =   279 bits (714),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 154/169 (91%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAII FGDS+VDVGNN+Y+ T+FKA+YPPYGRDF +HQPTGRFCNGKLATDITA+TLG
Sbjct  27   LVPAIITFGDSAVDVGNNDYLPTLFKANYPPYGRDFINHQPTGRFCNGKLATDITAETLG  86

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F SY  AYLSPQA+GKNLLIGANFASAASGYDEK A+L++AIPLSQQ++YYKEY+GKLA 
Sbjct  87   FKSYAPAYLSPQASGKNLLIGANFASAASGYDEKAAILNHAIPLSQQLKYYKEYRGKLAK  146

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            V GSKKAA IIK+ALYI+  GSSDF+QNYYVNP +NK +TPDQY +YLV
Sbjct  147  VVGSKKAALIIKNALYILSAGSSDFVQNYYVNPLINKAFTPDQYSAYLV  195



>ref|XP_004510325.1| PREDICTED: GDSL esterase/lipase APG-like [Cicer arietinum]
Length=356

 Score =   279 bits (713),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAII FGDS+VDVGNN+Y+ T+FKA+YPPYGRDF + QPTGRFCNGKLATDITA+TLG
Sbjct  30   LVPAIITFGDSAVDVGNNDYLPTLFKANYPPYGRDFVNKQPTGRFCNGKLATDITAETLG  89

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F+S+  AYLSPQA+GKNLLIGANFASAASGYDEK A+L++A+PLSQQ+EYYKEYQ KLA 
Sbjct  90   FTSFAPAYLSPQASGKNLLIGANFASAASGYDEKAAILNHALPLSQQLEYYKEYQSKLAK  149

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            VAGSKKAASIIKDALY++  GSSDF+QNYYVNP++NKV T DQY SYL+
Sbjct  150  VAGSKKAASIIKDALYLLSAGSSDFVQNYYVNPWINKVLTVDQYSSYLL  198



>ref|XP_007150584.1| hypothetical protein PHAVU_005G164800g [Phaseolus vulgaris]
 gb|ESW22578.1| hypothetical protein PHAVU_005G164800g [Phaseolus vulgaris]
Length=353

 Score =   279 bits (713),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 154/169 (91%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAII FGDS+VDVGNN+Y+ T+FKA+YPPYGRDF +HQPTGRFCNGKLATDITA+TLG
Sbjct  27   LVPAIITFGDSAVDVGNNDYLPTLFKANYPPYGRDFVNHQPTGRFCNGKLATDITAETLG  86

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F S+  AYLSPQA+GKNLLIGANFASAASGYDEK A+L++AIPLSQQ++YYKEYQ KLA 
Sbjct  87   FKSFAPAYLSPQASGKNLLIGANFASAASGYDEKAAILNHAIPLSQQLKYYKEYQCKLAK  146

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            VAGSKKA+ IIKDALYI+  GSSDF+QNYYVNP +NK +TPDQY +YLV
Sbjct  147  VAGSKKASLIIKDALYILSAGSSDFVQNYYVNPLINKAFTPDQYSAYLV  195



>ref|XP_003597654.1| GDSL esterase/lipase APG [Medicago truncatula]
 gb|AES67905.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=354

 Score =   278 bits (712),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 154/169 (91%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            +VPAI+ FGDS+VDVGNN+Y+ T+FKA+YPPYGRDF SH+PTGRFCNGKLATDITA+TLG
Sbjct  28   VVPAIVTFGDSAVDVGNNDYLFTLFKANYPPYGRDFVSHKPTGRFCNGKLATDITAETLG  87

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F SY  AYLSPQATGKNLLIGANFASAASGYDEK A+L++AIPLSQQ++YYKEYQ KL+ 
Sbjct  88   FKSYAPAYLSPQATGKNLLIGANFASAASGYDEKAAILNHAIPLSQQLKYYKEYQSKLSK  147

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            +AGSKKAASIIK ALY++  GSSDF+QNYYVNP +NKV TPDQY +YLV
Sbjct  148  IAGSKKAASIIKGALYLLSGGSSDFIQNYYVNPLINKVVTPDQYSAYLV  196



>ref|XP_010244385.1| PREDICTED: GDSL esterase/lipase APG-like [Nelumbo nucifera]
Length=358

 Score =   279 bits (713),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 152/169 (90%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAII FGDSSVDVGNN+YV T FKA+YPPYGRDF + +PTGRFCNGKLATDITA+TLG
Sbjct  32   LVPAIITFGDSSVDVGNNDYVTTFFKANYPPYGRDFINRKPTGRFCNGKLATDITAETLG  91

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F++YP AYLSPQA+GKNLLIGANFASA SGYD+KTALLS+ IPLSQQ+EY+KEY+ KL  
Sbjct  92   FTTYPPAYLSPQASGKNLLIGANFASAGSGYDDKTALLSHVIPLSQQLEYFKEYRRKLTK  151

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            VAG +KAASI KDALY+V  G SDFLQNYYVNPY+NKVYTPD+Y SYLV
Sbjct  152  VAGIRKAASITKDALYLVSAGPSDFLQNYYVNPYVNKVYTPDEYASYLV  200



>gb|KFK38989.1| hypothetical protein AALP_AA3G185500 [Arabis alpina]
Length=352

 Score =   278 bits (710),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 154/169 (91%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            +VPAII FGDS VDVGNNNY+ TIF+ADYPPYGRDFA+H+ TGRFCNGKLATDITA+TLG
Sbjct  26   VVPAIITFGDSVVDVGNNNYLPTIFRADYPPYGRDFANHKATGRFCNGKLATDITAETLG  85

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F+ YP AYLSP+A+GKNLLIGANFASAASGYD+K ALL++AIPL QQVEY+KEY+ KL  
Sbjct  86   FTKYPPAYLSPEASGKNLLIGANFASAASGYDDKAALLNHAIPLYQQVEYFKEYKSKLIK  145

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            +AGSK++ASIIK A+Y++  GSSDF+QNYYVNPYLNKVYTPDQYGS L+
Sbjct  146  IAGSKQSASIIKGAIYLLSAGSSDFVQNYYVNPYLNKVYTPDQYGSMLI  194



>gb|ACJ84797.1| unknown [Medicago truncatula]
 gb|AFK43797.1| unknown [Medicago truncatula]
Length=236

 Score =   271 bits (694),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 152/169 (90%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAI+ FGDS+VDVGNN+Y+ T+FKA+YPPYGRDF + QPTGRFCNGKLATD TA+TLG
Sbjct  29   LVPAIMTFGDSAVDVGNNDYLPTLFKANYPPYGRDFTNKQPTGRFCNGKLATDFTAETLG  88

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F+S+  AYLSPQA+GKNLL+GANFASAASGYDEK A L++AIPLSQQ+EY+KEYQGKLA 
Sbjct  89   FTSFAPAYLSPQASGKNLLLGANFASAASGYDEKAATLNHAIPLSQQLEYFKEYQGKLAQ  148

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            VAGSKKAASIIKD+LY++  GSSDF+QNYY NP++N+  T DQY SYL+
Sbjct  149  VAGSKKAASIIKDSLYVLSAGSSDFVQNYYTNPWINQAITVDQYSSYLL  197



>ref|XP_011008871.1| PREDICTED: GDSL esterase/lipase APG [Populus euphratica]
Length=352

 Score =   275 bits (703),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 153/169 (91%), Gaps = 1/169 (1%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAII FGDS+VDVGNN+Y+ TIFKA+YPPYGRDF  H+PTGRFCNGKLATDITA+TLG
Sbjct  27   LVPAIITFGDSAVDVGNNDYLPTIFKANYPPYGRDFVDHKPTGRFCNGKLATDITAETLG  86

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F SY  AYLSP+A+GKNLLIG+NFASAASGYDE+ A L++AIPLSQQ+EY+KEYQ KLA 
Sbjct  87   FKSYAPAYLSPEASGKNLLIGSNFASAASGYDERAAALNHAIPLSQQLEYFKEYQSKLAK  146

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            VAGS K+ASIIK ALYI+  GSSDFLQNYYVNPYLNK+YT DQYGSYLV
Sbjct  147  VAGS-KSASIIKGALYILSAGSSDFLQNYYVNPYLNKIYTADQYGSYLV  194



>gb|EYU21439.1| hypothetical protein MIMGU_mgv1a009146mg [Erythranthe guttata]
Length=351

 Score =   275 bits (703),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAII FGDS VDVGNN+Y+ TIFKADYPPYGRDF + QPTGRFCNGKLATDITA+TLG
Sbjct  25   LVPAIITFGDSVVDVGNNDYIPTIFKADYPPYGRDFKNKQPTGRFCNGKLATDITAETLG  84

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F+S+   YLSPQA+GKNLL+GANFASA +GYD+ T+LLS+ IPLSQQ++YYKEYQ  LA 
Sbjct  85   FTSFAPPYLSPQASGKNLLLGANFASAGAGYDDHTSLLSHVIPLSQQLKYYKEYQVNLAK  144

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            VAGSK+AASIIKDALY+V  GSSDF+QNYY+NP+LNK YTPDQY SYLV
Sbjct  145  VAGSKQAASIIKDALYLVAAGSSDFVQNYYINPFLNKAYTPDQYSSYLV  193



>gb|KDP40834.1| hypothetical protein JCGZ_24833 [Jatropha curcas]
Length=352

 Score =   275 bits (702),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            +VPAII FGDS+VDVGNN+Y+ TI+KA+YPPYGRDF +HQPTGRFCNGKLATDITA++LG
Sbjct  27   VVPAIITFGDSAVDVGNNDYLPTIYKANYPPYGRDFVNHQPTGRFCNGKLATDITAESLG  86

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F +YP AYLSP A+GKNLLIGANFASAASGYD+K A +++AIPL QQ++Y++EY+G+LA 
Sbjct  87   FKTYPPAYLSPDASGKNLLIGANFASAASGYDDKAATVNHAIPLPQQLQYFREYKGRLAK  146

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            VAGS K+ASIIKDALYI+  GSSDF+QNYYVNP LNK+YTPDQYGSYLV
Sbjct  147  VAGSAKSASIIKDALYILSAGSSDFVQNYYVNPLLNKLYTPDQYGSYLV  195



>ref|XP_002298249.2| putative proline-rich protein APG isolog [Populus trichocarpa]
 gb|ABK95990.1| unknown [Populus trichocarpa]
 gb|EEE83054.2| putative proline-rich protein APG isolog [Populus trichocarpa]
Length=352

 Score =   273 bits (699),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 152/169 (90%), Gaps = 1/169 (1%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAII FGDS+VDVGNN+Y+ TIFKA+YPPYGRDF   +PTGRFCNGKLATDITA+TLG
Sbjct  27   LVPAIITFGDSAVDVGNNDYLPTIFKANYPPYGRDFVDQKPTGRFCNGKLATDITAETLG  86

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F SY  AYLSP A+GKNLLIG+NFASAASGYDEK A L++AIPLSQQ+EY+KEYQGKLA 
Sbjct  87   FKSYAPAYLSPDASGKNLLIGSNFASAASGYDEKAAALNHAIPLSQQLEYFKEYQGKLAK  146

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            VAGS K+ASIIK ALYI+  GSSDFLQNYYVNPYLNK+YT DQYGSYLV
Sbjct  147  VAGS-KSASIIKGALYILSAGSSDFLQNYYVNPYLNKIYTVDQYGSYLV  194



>ref|XP_004486794.1| PREDICTED: GDSL esterase/lipase APG-like [Cicer arietinum]
Length=353

 Score =   273 bits (699),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAII FGDS+VDVGNN+Y+ T+FKA+YPPYGRDF +H+ TGRFCNGKLATDITA+TLG
Sbjct  27   LVPAIITFGDSAVDVGNNDYLPTLFKANYPPYGRDFVNHKSTGRFCNGKLATDITAETLG  86

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F SY  AYLSPQATGKNLLIGANFASAASGYDEK ++L++AIPLSQQ++YYKEYQ KL  
Sbjct  87   FKSYAPAYLSPQATGKNLLIGANFASAASGYDEKASILNHAIPLSQQLKYYKEYQSKLIK  146

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            +AG KKAASIIK ALYI+  GSSDF+QNYYVNP +NKV TPDQY +YLV
Sbjct  147  IAGRKKAASIIKGALYILSAGSSDFVQNYYVNPLINKVVTPDQYSAYLV  195



>gb|EYU21440.1| hypothetical protein MIMGU_mgv1a009146mg [Erythranthe guttata]
Length=342

 Score =   273 bits (698),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 150/168 (89%), Gaps = 0/168 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAII FGDS VDVGNN+Y+ TIFKADYPPYGRDF + QPTGRFCNGKLATDITA+TLG
Sbjct  25   LVPAIITFGDSVVDVGNNDYIPTIFKADYPPYGRDFKNKQPTGRFCNGKLATDITAETLG  84

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F+S+   YLSPQA+GKNLL+GANFASA +GYD+ T+LLS+ IPLSQQ++YYKEYQ  LA 
Sbjct  85   FTSFAPPYLSPQASGKNLLLGANFASAGAGYDDHTSLLSHVIPLSQQLKYYKEYQVNLAK  144

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYL  606
            VAGSK+AASIIKDALY+V  GSSDF+QNYY+NP+LNK YTPDQY SYL
Sbjct  145  VAGSKQAASIIKDALYLVAAGSSDFVQNYYINPFLNKAYTPDQYSSYL  192



>ref|XP_006406840.1| hypothetical protein EUTSA_v10021008mg [Eutrema salsugineum]
 dbj|BAJ33787.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ48293.1| hypothetical protein EUTSA_v10021008mg [Eutrema salsugineum]
Length=358

 Score =   273 bits (699),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 152/169 (90%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAI+ FGDS VDVGNNNY+ T+F+ADYPPYGRDFA+H+PTGRFCNGKLATDITA+TLG
Sbjct  32   LVPAIMTFGDSVVDVGNNNYLPTLFRADYPPYGRDFANHKPTGRFCNGKLATDITAETLG  91

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F+ YP AYLSP+A+GKNLLIGANFASAASGYD+K ALL++AIPL QQVEY+KEY+ KL  
Sbjct  92   FTKYPPAYLSPEASGKNLLIGANFASAASGYDDKAALLNHAIPLYQQVEYFKEYKSKLIK  151

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            VAGSKK+ SIIK A+Y++  GSSDF+QNYYVNP+L K YTPDQYGS L+
Sbjct  152  VAGSKKSDSIIKGAIYLLSAGSSDFVQNYYVNPFLYKAYTPDQYGSMLI  200



>ref|XP_002515932.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF46352.1| zinc finger protein, putative [Ricinus communis]
Length=353

 Score =   273 bits (698),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 152/165 (92%), Gaps = 0/165 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAII FGDS+VDVGNN+Y+ TI+KA+YPPYGRDF +H+PTGRFCNGKLATDITA+TLG
Sbjct  28   LVPAIITFGDSAVDVGNNDYLPTIYKANYPPYGRDFVNHKPTGRFCNGKLATDITAETLG  87

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F +Y  AYLSP A+GKNLLIGANFASAASGYDEK A+L++AIPLSQQ++Y++EYQ KLA 
Sbjct  88   FKTYAPAYLSPDASGKNLLIGANFASAASGYDEKAAMLNHAIPLSQQLQYFREYQSKLAK  147

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYG  597
            VAGS K+ASI+KDALY++  GSSDFLQNYYVNP++NK+YTPDQYG
Sbjct  148  VAGSSKSASIVKDALYLLSAGSSDFLQNYYVNPWINKLYTPDQYG  192



>ref|XP_006298028.1| hypothetical protein CARUB_v10014074mg [Capsella rubella]
 gb|EOA30926.1| hypothetical protein CARUB_v10014074mg [Capsella rubella]
Length=353

 Score =   273 bits (698),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAI+ FGDS VDVGNNNY+ TIF+ADYPPYGRDFA+H+PTGRFCNGKLATDITA+TLG
Sbjct  27   LVPAIMTFGDSVVDVGNNNYLPTIFRADYPPYGRDFANHKPTGRFCNGKLATDITAETLG  86

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F+ YP AYLSP+A+GKNLLIGANFASAASGYD+K ALL++AIPL QQVEY+KEY+ KL  
Sbjct  87   FTKYPPAYLSPEASGKNLLIGANFASAASGYDDKAALLNHAIPLYQQVEYFKEYKSKLIK  146

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            +AGSKKA SII  A+ ++  GSSDF+QNYYVNP LNKVYT DQYGSYL+
Sbjct  147  IAGSKKADSIISGAICLLSAGSSDFVQNYYVNPLLNKVYTVDQYGSYLI  195



>ref|XP_004302841.1| PREDICTED: GDSL esterase/lipase APG [Fragaria vesca subsp. vesca]
Length=357

 Score =   273 bits (699),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAI  FGDS+VDVGNN+Y+ TIFKA+YPPYGRDF +H+ TGRFCNGKLATDITADTLG
Sbjct  31   LVPAIFTFGDSAVDVGNNDYLPTIFKANYPPYGRDFVNHKATGRFCNGKLATDITADTLG  90

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F  YP AYLSPQA+GKNLLIGANFASAASGYDEK A L++AI L QQ+EY+KEYQGKL  
Sbjct  91   FKLYPAAYLSPQASGKNLLIGANFASAASGYDEKAAYLNHAISLPQQLEYFKEYQGKLNK  150

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            VAGSKKAA+IIK ALY++  G+SDFLQNYYVNP++NKVYTPDQYG  L+
Sbjct  151  VAGSKKAATIIKGALYLLSAGNSDFLQNYYVNPFVNKVYTPDQYGDILI  199



>ref|XP_006343027.1| PREDICTED: GDSL esterase/lipase APG-like [Solanum tuberosum]
Length=387

 Score =   273 bits (698),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 152/169 (90%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAII FGDS+ DVGNN+Y+ T+FKA+YPPYGRDF +HQPTGRFCNGKL TD+TAD LG
Sbjct  61   LVPAIITFGDSASDVGNNDYIITLFKANYPPYGRDFVTHQPTGRFCNGKLVTDMTADALG  120

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F++YP AYLSP+A+GKNLLIG NFASAA+GYD+KTA+L++AIPLS+Q++YYKEY+ KLA 
Sbjct  121  FTTYPAAYLSPEASGKNLLIGTNFASAAAGYDDKTAILNHAIPLSKQMQYYKEYKTKLAK  180

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            VAGS+KA SIIKDALYI+  G++DFLQNYY NPYLNK+ TP QY SYL+
Sbjct  181  VAGSQKAESIIKDALYILSAGTADFLQNYYFNPYLNKISTPHQYSSYLI  229



>ref|XP_010504217.1| PREDICTED: GDSL esterase/lipase APG-like [Camelina sativa]
Length=353

 Score =   271 bits (693),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAI+ FGDS VDVGNNNY+ TIF+ADYPPYGRDFA+H+PTGRFCNGKLATDITA+TLG
Sbjct  27   LVPAIMTFGDSVVDVGNNNYLPTIFRADYPPYGRDFANHKPTGRFCNGKLATDITAETLG  86

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F+ YP AYLSP+A+GKNLLIGANFASAASGYD+K AL+++AIPL QQVEY+KEY+ KL  
Sbjct  87   FTKYPPAYLSPEASGKNLLIGANFASAASGYDDKAALINHAIPLYQQVEYFKEYKSKLIK  146

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            +AGSKKA SII  A+ ++  GSSDF+QNYYVNP LNKVYT DQYGS+L+
Sbjct  147  IAGSKKADSIISGAICLLSAGSSDFVQNYYVNPLLNKVYTVDQYGSFLI  195



>ref|XP_010465660.1| PREDICTED: GDSL esterase/lipase APG [Camelina sativa]
Length=354

 Score =   271 bits (693),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAI+ FGDS VDVGNNNY+ TIF+ADYPPYGRDFA+H+PTGRFCNGKLATDITA+TLG
Sbjct  27   LVPAIMTFGDSVVDVGNNNYLPTIFRADYPPYGRDFANHKPTGRFCNGKLATDITAETLG  86

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F+ YP AYLSP+A+GKNLLIGANFASAASGYD+K AL+++AIPL QQVEY+KEY+ KL  
Sbjct  87   FTKYPPAYLSPEASGKNLLIGANFASAASGYDDKAALINHAIPLYQQVEYFKEYKSKLIK  146

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            +AGSKKA SII  A+ ++  GSSDF+QNYYVNP LNKVYT DQYGS+L+
Sbjct  147  IAGSKKADSIISGAICLLSAGSSDFVQNYYVNPLLNKVYTVDQYGSFLI  195



>ref|XP_010487495.1| PREDICTED: GDSL esterase/lipase APG-like [Camelina sativa]
Length=366

 Score =   271 bits (693),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAI+ FGDS VDVGNNNY+ TIF+ADYPPYGRDFA+H+PTGRFCNGKLATDITA+TLG
Sbjct  40   LVPAIMTFGDSVVDVGNNNYLPTIFRADYPPYGRDFANHKPTGRFCNGKLATDITAETLG  99

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F+ YP AYLSP+A+GKNLLIGANFASAASGYD+K AL+++AIPL QQVEY+KEY+ KL  
Sbjct  100  FTKYPPAYLSPEASGKNLLIGANFASAASGYDDKAALINHAIPLYQQVEYFKEYKSKLIK  159

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            +AGSKKA SII  A+ ++  GSSDF+QNYYVNP LNKVYT DQYGS+L+
Sbjct  160  IAGSKKADSIISGAICLLSAGSSDFVQNYYVNPLLNKVYTVDQYGSFLI  208



>ref|XP_007024353.1| GDSL-like Lipase/Acylhydrolase superfamily protein [Theobroma 
cacao]
 gb|EOY26975.1| GDSL-like Lipase/Acylhydrolase superfamily protein [Theobroma 
cacao]
Length=354

 Score =   270 bits (691),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 149/169 (88%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            +VPAII FGDS VDVGNN+Y+ TIFKA+YPPYGRDF +HQPTGRFCNGKLATDITA TLG
Sbjct  29   VVPAIITFGDSVVDVGNNDYLPTIFKANYPPYGRDFDNHQPTGRFCNGKLATDITAKTLG  88

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F++YP AYLSP+A+GKNLLIGANFASA SGYD+  A L++AI L+QQVEY+KEYQ KLA 
Sbjct  89   FTTYPPAYLSPEASGKNLLIGANFASAGSGYDDNAATLNHAITLTQQVEYFKEYQAKLAK  148

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            VAGS K+ASIIKDALY++  GS DFLQNYYVNP +N VYTPDQYGS L+
Sbjct  149  VAGSSKSASIIKDALYVLSAGSGDFLQNYYVNPLINHVYTPDQYGSILI  197



>gb|KHG15938.1| GDSL esterase/lipase APG -like protein [Gossypium arboreum]
Length=356

 Score =   270 bits (691),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 152/169 (90%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAII FGDS VDVGNN+Y+ TIFKA+YPPYGRDFA+ +PTGRFCNGKLATDITA+TLG
Sbjct  31   LVPAIITFGDSVVDVGNNDYLPTIFKANYPPYGRDFANKKPTGRFCNGKLATDITAETLG  90

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F++YP AYLSP+A+GKNLLIGANFASA SGYD+K +++++AI L+QQ+EY+KEYQ KLA 
Sbjct  91   FTTYPPAYLSPEASGKNLLIGANFASAGSGYDDKASMVNHAITLTQQLEYFKEYQAKLAK  150

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            VAGS K+ASIIKDALY++  GS DFLQNYYVNP LN  YTPDQYGS+L+
Sbjct  151  VAGSTKSASIIKDALYVLSAGSGDFLQNYYVNPLLNHAYTPDQYGSFLI  199



>ref|XP_008447571.1| PREDICTED: GDSL esterase/lipase APG-like [Cucumis melo]
Length=354

 Score =   270 bits (690),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAII FGDS+VDVGNNNY++TI+KA+YPPYG+DF +HQPTGRFCNGKLATD TA TLG
Sbjct  28   LVPAIITFGDSAVDVGNNNYLYTIYKANYPPYGKDFVNHQPTGRFCNGKLATDFTAQTLG  87

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F ++P+ YLSP+A+GKNLLIG NFASAASGYDE  ALL++A+ L QQV ++KEYQ KLA 
Sbjct  88   FKTFPLPYLSPEASGKNLLIGVNFASAASGYDENAALLNHALSLPQQVGFFKEYQAKLAK  147

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            VAG++KAASIIKDALY++  GS DFLQNYY+NPY+NKVYTPDQYG+ L+
Sbjct  148  VAGNEKAASIIKDALYLLSAGSGDFLQNYYINPYINKVYTPDQYGTMLI  196



>ref|XP_003627082.1| GDSL esterase/lipase APG [Medicago truncatula]
 gb|AET01558.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=355

 Score =   270 bits (690),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 152/169 (90%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAI+ FGDS+VDVGNN+Y+ T+FKA+YPPYGRDF + QPTGRFCNGKLATD TA+TLG
Sbjct  29   LVPAIMTFGDSAVDVGNNDYLPTLFKANYPPYGRDFTNKQPTGRFCNGKLATDFTAETLG  88

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F+S+  AYLSPQA+GKNLL+GANFASAASGYDEK A L++AIPLSQQ+EY+KEYQGKLA 
Sbjct  89   FTSFAPAYLSPQASGKNLLLGANFASAASGYDEKAATLNHAIPLSQQLEYFKEYQGKLAQ  148

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            VAGSKKAASIIKD+LY++  GSSDF+QNYY NP++N+  T DQY SYL+
Sbjct  149  VAGSKKAASIIKDSLYVLSAGSSDFVQNYYTNPWINQAITVDQYSSYLL  197



>gb|KJB56732.1| hypothetical protein B456_009G138200 [Gossypium raimondii]
Length=237

 Score =   266 bits (679),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAII FGDS VDVGNN+Y+ TIFKA+YPPYGRDFA+ +PTGRFCNGKLATDITA+TLG
Sbjct  31   LVPAIITFGDSVVDVGNNDYLPTIFKANYPPYGRDFANKKPTGRFCNGKLATDITAETLG  90

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F++YP AYLSP+A+GKNLL+GANFASA SGYD++ +++++AI L+QQ+EY+KEYQ KLA 
Sbjct  91   FTTYPPAYLSPEASGKNLLLGANFASAGSGYDDEASMVNHAITLTQQLEYFKEYQAKLAK  150

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            VAGS K+ASI KDALY++  GS DFLQNYYVNP LN  YTPDQYGS+L+
Sbjct  151  VAGSTKSASITKDALYVLSAGSGDFLQNYYVNPLLNHAYTPDQYGSFLI  199



>ref|XP_004235633.1| PREDICTED: GDSL esterase/lipase APG-like [Solanum lycopersicum]
Length=417

 Score =   271 bits (693),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAII FGDS+ DVGNN+Y+ T+FKA+YPPYGRDF +HQPTGRFCNGKL TD+TAD LG
Sbjct  91   LVPAIITFGDSASDVGNNDYIITLFKANYPPYGRDFVTHQPTGRFCNGKLVTDMTADALG  150

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F++YP AYLSP+A+GKNLLIG NFASAA+GYD+KTA+L++AIPLS+Q++YYKEY+ KL  
Sbjct  151  FTTYPAAYLSPEASGKNLLIGTNFASAAAGYDDKTAILNHAIPLSKQMQYYKEYKSKLVK  210

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            VAGS+KA SI+KDALYI+  G++DFLQNYY NPYLNK+ TP QY SYLV
Sbjct  211  VAGSQKAESILKDALYILSAGTADFLQNYYFNPYLNKISTPRQYSSYLV  259



>ref|XP_010545663.1| PREDICTED: GDSL esterase/lipase APG [Tarenaya hassleriana]
Length=357

 Score =   268 bits (686),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAII FGDS+VDVGNNNY+ TIF+ADYPPYGRDFA+H+ TGRFCNGKLATDITA+TLG
Sbjct  31   LVPAIITFGDSAVDVGNNNYLPTIFRADYPPYGRDFANHEATGRFCNGKLATDITAETLG  90

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F++YP AYLSPQA+GKNLLIGANFASAASGYD K A++++AIPL QQVEY+KEY+ KL  
Sbjct  91   FTAYPPAYLSPQASGKNLLIGANFASAASGYDPKPAIINHAIPLYQQVEYFKEYKSKLVK  150

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            +AG  K+ SII+ A+ I+  GSSDF+QNYYVNP L KVYTPDQYGSYL+
Sbjct  151  IAGKTKSESIIRGAICILSAGSSDFIQNYYVNPLLFKVYTPDQYGSYLI  199



>gb|KJB70371.1| hypothetical protein B456_011G070000 [Gossypium raimondii]
Length=353

 Score =   268 bits (685),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAI+ FGDS VDVGNN+Y+ TIF+A+YPPYGRDFA+ +PTGRFCNGKLATDITA+TLG
Sbjct  31   LVPAILTFGDSVVDVGNNDYLPTIFRANYPPYGRDFANQKPTGRFCNGKLATDITAETLG  90

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F++YP AYLSP+A+G NLLIGANFASA SGYD++ A L++AI LSQQVEY+KEYQ KLA 
Sbjct  91   FTTYPPAYLSPEASGNNLLIGANFASAGSGYDDRAASLNHAITLSQQVEYFKEYQAKLAK  150

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            VAGS K+ASIIKDALY++  GS DFLQNYYVNP +N  YTPDQYGS+L+
Sbjct  151  VAGSSKSASIIKDALYVLSAGSGDFLQNYYVNPLVNHAYTPDQYGSFLI  199



>gb|KJB70369.1| hypothetical protein B456_011G070000 [Gossypium raimondii]
Length=356

 Score =   268 bits (685),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAI+ FGDS VDVGNN+Y+ TIF+A+YPPYGRDFA+ +PTGRFCNGKLATDITA+TLG
Sbjct  31   LVPAILTFGDSVVDVGNNDYLPTIFRANYPPYGRDFANQKPTGRFCNGKLATDITAETLG  90

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F++YP AYLSP+A+G NLLIGANFASA SGYD++ A L++AI LSQQVEY+KEYQ KLA 
Sbjct  91   FTTYPPAYLSPEASGNNLLIGANFASAGSGYDDRAASLNHAITLSQQVEYFKEYQAKLAK  150

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            VAGS K+ASIIKDALY++  GS DFLQNYYVNP +N  YTPDQYGS+L+
Sbjct  151  VAGSSKSASIIKDALYVLSAGSGDFLQNYYVNPLVNHAYTPDQYGSFLI  199



>ref|XP_010098171.1| GDSL esterase/lipase APG [Morus notabilis]
 gb|EXB74608.1| GDSL esterase/lipase APG [Morus notabilis]
Length=353

 Score =   268 bits (684),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPA+IAFGDSSVDVGNNNY  T+FKA+YPPYGRDF +HQ TGRFCNGKLATD+TA+TLG
Sbjct  28   LVPAVIAFGDSSVDVGNNNYRPTLFKANYPPYGRDFINHQATGRFCNGKLATDLTAETLG  87

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F  YP AYLSP+A+GKNLLIGANFASAA+GYDEK ++L++AIPLSQQ++Y+KEY+ KLA 
Sbjct  88   FKKYPAAYLSPEASGKNLLIGANFASAAAGYDEKASVLNHAIPLSQQLDYFKEYKTKLAK  147

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            VAG KKA SIIK+ALY++G GS DF+QNYY+NP +NKVYT DQY + L+
Sbjct  148  VAGQKKADSIIKEALYVLGAGSGDFVQNYYINPLVNKVYTVDQYSNLLI  196



>emb|CAN65530.1| hypothetical protein VITISV_039629 [Vitis vinifera]
Length=355

 Score =   268 bits (684),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 150/168 (89%), Gaps = 0/168 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            +VPA+I FGDS+VD GNNNY  T FKA+Y PYG+DF SHQPTGRFCNGKLATDITAD LG
Sbjct  30   IVPALILFGDSAVDSGNNNYFPTAFKANYLPYGKDFISHQPTGRFCNGKLATDITADILG  89

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F +YP AYLSPQATGKNLL+GANF SAA+GYD+ TA++++AIPLSQQ+EYYKEY+ KLA 
Sbjct  90   FKTYPPAYLSPQATGKNLLVGANFGSAAAGYDDNTAIINHAIPLSQQLEYYKEYRVKLAK  149

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYL  606
            VAGSK+AA+I+K ALY+VGFG++DFLQNYYVNP L K+YTPDQY +YL
Sbjct  150  VAGSKRAAAILKGALYLVGFGTADFLQNYYVNPSLKKLYTPDQYSTYL  197



>gb|KJB56736.1| hypothetical protein B456_009G138200 [Gossypium raimondii]
Length=300

 Score =   266 bits (679),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAII FGDS VDVGNN+Y+ TIFKA+YPPYGRDFA+ +PTGRFCNGKLATDITA+TLG
Sbjct  31   LVPAIITFGDSVVDVGNNDYLPTIFKANYPPYGRDFANKKPTGRFCNGKLATDITAETLG  90

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F++YP AYLSP+A+GKNLL+GANFASA SGYD++ +++++AI L+QQ+EY+KEYQ KLA 
Sbjct  91   FTTYPPAYLSPEASGKNLLLGANFASAGSGYDDEASMVNHAITLTQQLEYFKEYQAKLAK  150

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            VAGS K+ASI KDALY++  GS DFLQNYYVNP LN  YTPDQYGS+L+
Sbjct  151  VAGSTKSASITKDALYVLSAGSGDFLQNYYVNPLLNHAYTPDQYGSFLI  199



>gb|KJB56734.1| hypothetical protein B456_009G138200 [Gossypium raimondii]
Length=296

 Score =   265 bits (678),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAII FGDS VDVGNN+Y+ TIFKA+YPPYGRDFA+ +PTGRFCNGKLATDITA+TLG
Sbjct  31   LVPAIITFGDSVVDVGNNDYLPTIFKANYPPYGRDFANKKPTGRFCNGKLATDITAETLG  90

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F++YP AYLSP+A+GKNLL+GANFASA SGYD++ +++++AI L+QQ+EY+KEYQ KLA 
Sbjct  91   FTTYPPAYLSPEASGKNLLLGANFASAGSGYDDEASMVNHAITLTQQLEYFKEYQAKLAK  150

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            VAGS K+ASI KDALY++  GS DFLQNYYVNP LN  YTPDQYGS+L+
Sbjct  151  VAGSTKSASITKDALYVLSAGSGDFLQNYYVNPLLNHAYTPDQYGSFLI  199



>gb|KDO38517.1| hypothetical protein CISIN_1g018227mg [Citrus sinensis]
Length=219

 Score =   262 bits (670),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 144/163 (88%), Gaps = 0/163 (0%)
 Frame = +1

Query  100  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  279
            PLVPAII FGDS+VDVGNNNY+ T+FKA+YPPYGRDF +HQPTGRFCNGKLATD TADTL
Sbjct  33   PLVPAIITFGDSAVDVGNNNYLATLFKANYPPYGRDFINHQPTGRFCNGKLATDFTADTL  92

Query  280  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  459
            GF +Y  AYLSPQATGKNLLIGANFASA SGYD++T+ L++AI L+QQ++YY+EYQ KLA
Sbjct  93   GFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLA  152

Query  460  GVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPD  588
             VAGSK++ASIIKDA+YIVG GS DFLQNYYVNP LNK    D
Sbjct  153  KVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLLNKKIWSD  195



>gb|KJB70370.1| hypothetical protein B456_011G070000 [Gossypium raimondii]
Length=394

 Score =   268 bits (684),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAI+ FGDS VDVGNN+Y+ TIF+A+YPPYGRDFA+ +PTGRFCNGKLATDITA+TLG
Sbjct  31   LVPAILTFGDSVVDVGNNDYLPTIFRANYPPYGRDFANQKPTGRFCNGKLATDITAETLG  90

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F++YP AYLSP+A+G NLLIGANFASA SGYD++ A L++AI LSQQVEY+KEYQ KLA 
Sbjct  91   FTTYPPAYLSPEASGNNLLIGANFASAGSGYDDRAASLNHAITLSQQVEYFKEYQAKLAK  150

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            VAGS K+ASIIKDALY++  GS DFLQNYYVNP +N  YTPDQYGS+L+
Sbjct  151  VAGSSKSASIIKDALYVLSAGSGDFLQNYYVNPLVNHAYTPDQYGSFLI  199



>ref|XP_002277514.1| PREDICTED: GDSL esterase/lipase APG [Vitis vinifera]
Length=355

 Score =   266 bits (681),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 149/168 (89%), Gaps = 0/168 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            + PA+I FGDS+VD GNNNY  T FKA+Y PYG+DF SHQPTGRFCNGKLATDITAD LG
Sbjct  30   IAPAMILFGDSAVDSGNNNYFPTAFKANYLPYGKDFISHQPTGRFCNGKLATDITADILG  89

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F +YP AYLSPQATGKNLL+GANF SAA+GYD+ TA++++AIPLSQQ+EYYKEY+ KLA 
Sbjct  90   FETYPPAYLSPQATGKNLLVGANFGSAAAGYDDNTAIINHAIPLSQQLEYYKEYRVKLAK  149

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYL  606
            VAGSK+AA+I+K ALY+VGFG++DFLQNYYVNP L K+YTPDQY +YL
Sbjct  150  VAGSKRAAAILKGALYLVGFGTADFLQNYYVNPSLKKLYTPDQYSTYL  197



>emb|CBI36031.3| unnamed protein product [Vitis vinifera]
Length=363

 Score =   266 bits (681),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 149/168 (89%), Gaps = 0/168 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            + PA+I FGDS+VD GNNNY  T FKA+Y PYG+DF SHQPTGRFCNGKLATDITAD LG
Sbjct  38   IAPAMILFGDSAVDSGNNNYFPTAFKANYLPYGKDFISHQPTGRFCNGKLATDITADILG  97

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F +YP AYLSPQATGKNLL+GANF SAA+GYD+ TA++++AIPLSQQ+EYYKEY+ KLA 
Sbjct  98   FETYPPAYLSPQATGKNLLVGANFGSAAAGYDDNTAIINHAIPLSQQLEYYKEYRVKLAK  157

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYL  606
            VAGSK+AA+I+K ALY+VGFG++DFLQNYYVNP L K+YTPDQY +YL
Sbjct  158  VAGSKRAAAILKGALYLVGFGTADFLQNYYVNPSLKKLYTPDQYSTYL  205



>gb|KJB56735.1| hypothetical protein B456_009G138200 [Gossypium raimondii]
Length=356

 Score =   266 bits (679),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAII FGDS VDVGNN+Y+ TIFKA+YPPYGRDFA+ +PTGRFCNGKLATDITA+TLG
Sbjct  31   LVPAIITFGDSVVDVGNNDYLPTIFKANYPPYGRDFANKKPTGRFCNGKLATDITAETLG  90

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F++YP AYLSP+A+GKNLL+GANFASA SGYD++ +++++AI L+QQ+EY+KEYQ KLA 
Sbjct  91   FTTYPPAYLSPEASGKNLLLGANFASAGSGYDDEASMVNHAITLTQQLEYFKEYQAKLAK  150

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            VAGS K+ASI KDALY++  GS DFLQNYYVNP LN  YTPDQYGS+L+
Sbjct  151  VAGSTKSASITKDALYVLSAGSGDFLQNYYVNPLLNHAYTPDQYGSFLI  199



>gb|KJB56733.1| hypothetical protein B456_009G138200 [Gossypium raimondii]
Length=364

 Score =   266 bits (680),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAII FGDS VDVGNN+Y+ TIFKA+YPPYGRDFA+ +PTGRFCNGKLATDITA+TLG
Sbjct  31   LVPAIITFGDSVVDVGNNDYLPTIFKANYPPYGRDFANKKPTGRFCNGKLATDITAETLG  90

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F++YP AYLSP+A+GKNLL+GANFASA SGYD++ +++++AI L+QQ+EY+KEYQ KLA 
Sbjct  91   FTTYPPAYLSPEASGKNLLLGANFASAGSGYDDEASMVNHAITLTQQLEYFKEYQAKLAK  150

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            VAGS K+ASI KDALY++  GS DFLQNYYVNP LN  YTPDQYGS+L+
Sbjct  151  VAGSTKSASITKDALYVLSAGSGDFLQNYYVNPLLNHAYTPDQYGSFLI  199



>gb|KHG07525.1| GDSL esterase/lipase APG -like protein [Gossypium arboreum]
Length=357

 Score =   265 bits (678),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAI+ FGDS VDVGNN+Y+ TIF+A+YPPYGRDFA+ +P+GRFCNGKLATDITA+TLG
Sbjct  31   LVPAILTFGDSVVDVGNNDYLPTIFRANYPPYGRDFANQKPSGRFCNGKLATDITAETLG  90

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F++YP AYLSP+A+G NLLIGANFASA SGYD++ A L++AI LSQQVEY+KEYQ KLA 
Sbjct  91   FTTYPPAYLSPEASGSNLLIGANFASAGSGYDDRAASLNHAITLSQQVEYFKEYQAKLAK  150

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            VAGS K+A+IIKDALY++  GS DFLQNYYVNP +N  YTPDQYGS+L+
Sbjct  151  VAGSSKSAAIIKDALYVLSAGSGDFLQNYYVNPLVNHAYTPDQYGSFLI  199



>ref|XP_009146144.1| PREDICTED: GDSL esterase/lipase APG [Brassica rapa]
 emb|CDY56196.1| BnaA05g36890D [Brassica napus]
Length=358

 Score =   265 bits (677),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            L P +I FGDS VDVGNNNY+ T+F+ADYPPYGRDFA H+PTGRFCNGKLATDITA+TLG
Sbjct  32   LFPGMIIFGDSVVDVGNNNYLPTLFRADYPPYGRDFAGHKPTGRFCNGKLATDITAETLG  91

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F+ YP AYLSP+A+GKNLLIGANFASAASGYD+K ALL++AIPL QQVEYYKEY+ KL  
Sbjct  92   FTKYPPAYLSPEASGKNLLIGANFASAASGYDDKAALLNHAIPLYQQVEYYKEYKSKLIK  151

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            VAGSK+A +IIK ++Y++  GSSDF+QNYYVNP +NK YT DQYGS L+
Sbjct  152  VAGSKQADTIIKGSIYLLSAGSSDFVQNYYVNPLVNKFYTADQYGSMLI  200



>ref|XP_004149175.1| PREDICTED: GDSL esterase/lipase APG-like [Cucumis sativus]
 ref|XP_004170192.1| PREDICTED: GDSL esterase/lipase APG-like [Cucumis sativus]
 gb|KGN58016.1| hypothetical protein Csa_3G434970 [Cucumis sativus]
Length=354

 Score =   265 bits (676),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAI+ FGDS+VDVGNNNY++T+FKA++ PYG+DF +HQPTGRFCNGKLATD TA TLG
Sbjct  28   LVPAIMTFGDSAVDVGNNNYLYTVFKANHLPYGKDFVNHQPTGRFCNGKLATDFTAQTLG  87

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F ++P+ YLSP+A+GKNLLIG NFASAASGYDE  ALL++A+ L QQV ++KEYQ KLA 
Sbjct  88   FKTFPLPYLSPEASGKNLLIGVNFASAASGYDENAALLNHALSLPQQVGFFKEYQVKLAK  147

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            VAG++KAASIIKDALY++  GS DFLQNYY+NPY+NKVYTPDQYG+ L+
Sbjct  148  VAGNEKAASIIKDALYLLSAGSGDFLQNYYINPYINKVYTPDQYGTMLI  196



>ref|XP_010925408.1| PREDICTED: GDSL esterase/lipase APG [Elaeis guineensis]
Length=365

 Score =   265 bits (677),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAII FGDS+VDVGNN+Y+HTIFKA+YPPYGRDF +HQ TGRFCNGKLATDITA+TLG
Sbjct  39   LVPAIITFGDSTVDVGNNDYIHTIFKANYPPYGRDFVNHQATGRFCNGKLATDITANTLG  98

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F+SYP AYLSPQA+G NLL+G NFASAASGY + TA L++AIPLSQQ++YYKEYQ KLA 
Sbjct  99   FTSYPPAYLSPQASGNNLLMGVNFASAASGYYDGTAYLNHAIPLSQQLKYYKEYQSKLAK  158

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            VAGSK+A+SI+  ALYI+  G+SDF+QNYY+NP LNK+ TPDQ+ S+L+
Sbjct  159  VAGSKQASSILSGALYILSAGASDFIQNYYINPDLNKLQTPDQFSSFLI  207



>ref|XP_009408845.1| PREDICTED: GDSL esterase/lipase APG-like [Musa acuminata subsp. 
malaccensis]
Length=359

 Score =   264 bits (675),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAII FGDS+VDVGNN+Y+ TIFKAD+PPYGRDF +H+PTGRFCNGKLATDITADTLG
Sbjct  33   LVPAIITFGDSTVDVGNNDYLKTIFKADFPPYGRDFKNHKPTGRFCNGKLATDITADTLG  92

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            FSSYP AYLSP+A+GKNLLIGANFASAASGY + TA L +AIPLSQQ+E+YKEYQ KL+ 
Sbjct  93   FSSYPSAYLSPEASGKNLLIGANFASAASGYYDDTAYLYHAIPLSQQLEFYKEYQHKLSR  152

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            VAG+ KA+SII  ALYIV  G+SDF+QNYY+NP+L +  +PDQ+ S+LV
Sbjct  153  VAGTSKASSIISGALYIVSTGASDFVQNYYINPHLYETRSPDQFSSFLV  201



>emb|CDY30167.1| BnaC05g36950D [Brassica napus]
Length=354

 Score =   263 bits (673),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            L P ++ FGDS VDVGNNNY+ T+F+ADYPPYGRDFA H+PTGRFCNGKLATDITA+TLG
Sbjct  28   LFPGMMIFGDSVVDVGNNNYLPTLFRADYPPYGRDFAGHKPTGRFCNGKLATDITAETLG  87

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F+ YP AYLSP+A+GKNLLIGANFASAASGYD+K ALL++AIPL QQVEYYKEY+ KL  
Sbjct  88   FTKYPPAYLSPEASGKNLLIGANFASAASGYDDKAALLNHAIPLYQQVEYYKEYKRKLIK  147

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            VAGSK+A +IIK ++Y++  GSSDF+QNYYVNP +NK YT DQYGS L+
Sbjct  148  VAGSKQADTIIKGSIYLLSAGSSDFVQNYYVNPLVNKFYTADQYGSMLI  196



>ref|NP_188258.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9LU14.1|APG2_ARATH RecName: Full=GDSL esterase/lipase APG; AltName: Full=Extracellular 
lipase APG; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB01276.1| proline-rich protein APG-like; GDSL-motif lipase/hydrolase-like 
protein [Arabidopsis thaliana]
 gb|AAL77704.1| AT3g16370/MYA6_18 [Arabidopsis thaliana]
 gb|AAO11525.1| At3g16370/MYA6_18 [Arabidopsis thaliana]
 gb|AEE75804.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=353

 Score =   263 bits (673),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 149/169 (88%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAI+ FGDS VDVGNNNY+ T+F+ADYPPYGRDFA+H+ TGRFCNGKLATDITA+TLG
Sbjct  27   LVPAIMTFGDSVVDVGNNNYLPTLFRADYPPYGRDFANHKATGRFCNGKLATDITAETLG  86

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F+ YP AYLSP+A+GKNLLIGANFASAASGYD+K ALL++AIPL QQVEY+KEY+ KL  
Sbjct  87   FTKYPPAYLSPEASGKNLLIGANFASAASGYDDKAALLNHAIPLYQQVEYFKEYKSKLIK  146

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            +AGSKKA SIIK A+ ++  GSSDF+QNYYVNP L KVYT D YGS+L+
Sbjct  147  IAGSKKADSIIKGAICLLSAGSSDFVQNYYVNPLLYKVYTVDAYGSFLI  195



>ref|XP_002883003.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH59262.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=353

 Score =   263 bits (672),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 149/169 (88%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAI+ FGDS VDVGNNNY+ T+F+ADYPPYGRDFA+H+ TGRFCNGKLATDITA+TLG
Sbjct  27   LVPAIMTFGDSVVDVGNNNYLPTLFRADYPPYGRDFANHKATGRFCNGKLATDITAETLG  86

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F+ YP AYLSP+A+GKNLLIGANFASAASGYD+K AL+++AIPL QQVEY+KEY+ KL  
Sbjct  87   FTKYPPAYLSPEASGKNLLIGANFASAASGYDDKAALINHAIPLYQQVEYFKEYKSKLIK  146

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            +AGSKKA SIIK A+ ++  GSSDF+QNYYVNP L KVYT D YGS+L+
Sbjct  147  IAGSKKADSIIKGAICLLSAGSSDFVQNYYVNPLLYKVYTVDAYGSFLI  195



>ref|XP_009388555.1| PREDICTED: GDSL esterase/lipase APG-like [Musa acuminata subsp. 
malaccensis]
Length=358

 Score =   263 bits (672),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPA+I FGDS+VDVGNN+Y+ T+F+AD+PPYGRDF +H+PTGRFCNGKLATD+TADTLG
Sbjct  32   LVPALITFGDSTVDVGNNDYLKTVFRADFPPYGRDFKNHEPTGRFCNGKLATDLTADTLG  91

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F++YP AYLSPQA+GKNLLIGANFASA SG  ++T+ LS+AIPL+QQ+EYYKEYQ KLA 
Sbjct  92   FTTYPPAYLSPQASGKNLLIGANFASAGSGLYDETSYLSHAIPLTQQLEYYKEYQSKLAH  151

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            VAGS +A +II DALYIV  G+SDF+QNYY+NP+L K  +PDQ+ S+LV
Sbjct  152  VAGSSQAKAIISDALYIVSTGASDFIQNYYINPFLFKTQSPDQFSSFLV  200



>ref|XP_006426845.1| hypothetical protein CICLE_v10025957mg [Citrus clementina]
 gb|ESR40085.1| hypothetical protein CICLE_v10025957mg [Citrus clementina]
Length=355

 Score =   261 bits (668),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 146/170 (86%), Gaps = 0/170 (0%)
 Frame = +1

Query  100  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  279
            PLVPAII+FGDSSVDVGNNN++ T FKA+YPPYGRDF +HQPTGRFC+GKL TD TADTL
Sbjct  29   PLVPAIISFGDSSVDVGNNNHLLTYFKANYPPYGRDFINHQPTGRFCDGKLVTDFTADTL  88

Query  280  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  459
            GF +Y  AYLSPQAT KNLLIGANFASA SGYD  T+++++AI L+ Q++YY+EYQ KLA
Sbjct  89   GFKTYAPAYLSPQATRKNLLIGANFASAGSGYDGNTSIINHAISLTHQLQYYREYQSKLA  148

Query  460  GVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             +AG K++ASIIKDA+YIVG GS DFLQNYY  P LNKVYTP+QY S LV
Sbjct  149  KLAGRKQSASIIKDAIYIVGAGSGDFLQNYYAKPSLNKVYTPEQYSSMLV  198



>gb|KJB56729.1| hypothetical protein B456_009G138200 [Gossypium raimondii]
Length=354

 Score =   260 bits (665),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 149/169 (88%), Gaps = 2/169 (1%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAII FGDS VDVGNN+Y+ TIFKA+YPPYGRDFA+ +PTGRFCNGKLATDITA+TLG
Sbjct  31   LVPAIITFGDSVVDVGNNDYLPTIFKANYPPYGRDFANKKPTGRFCNGKLATDITAETLG  90

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F++YP AYLSP+A+GKNLL+GANFASA SGYD++ ++  +AI L+QQ+EY+KEYQ KLA 
Sbjct  91   FTTYPPAYLSPEASGKNLLLGANFASAGSGYDDEASM--HAITLTQQLEYFKEYQAKLAK  148

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            VAGS K+ASI KDALY++  GS DFLQNYYVNP LN  YTPDQYGS+L+
Sbjct  149  VAGSTKSASITKDALYVLSAGSGDFLQNYYVNPLLNHAYTPDQYGSFLI  197



>ref|XP_002436473.1| hypothetical protein SORBIDRAFT_10g003340 [Sorghum bicolor]
 gb|EER87840.1| hypothetical protein SORBIDRAFT_10g003340 [Sorghum bicolor]
Length=360

 Score =   259 bits (663),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 147/171 (86%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA++ FGDS+VDVGNN+Y+HTI KA++PPYGRDFA+H  TGRFCNGKLATDITADT
Sbjct  32   QPLVPAVLTFGDSTVDVGNNDYLHTILKANFPPYGRDFANHVATGRFCNGKLATDITADT  91

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF++YP AYLSPQA+G+NLLIGANFASA SGY + TAL+ +AIPLSQQ+EY+KEYQ KL
Sbjct  92   LGFTTYPAAYLSPQASGQNLLIGANFASAGSGYYDHTALMYHAIPLSQQLEYFKEYQSKL  151

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            A VAG+ +A SII  ALYI+  G+SDF+QNYY+NP+L K  T DQ+   LV
Sbjct  152  AAVAGAGQAHSIITGALYIISAGASDFVQNYYINPFLYKTQTADQFSDRLV  202



>ref|XP_004516916.1| PREDICTED: GDSL esterase/lipase APG-like [Cicer arietinum]
Length=352

 Score =   259 bits (662),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 148/171 (87%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            Q LVPAII FGDS+VDVGNN+ + T+FK+++PPYGRDF + +PTGRFCNGKLATDITADT
Sbjct  24   QTLVPAIITFGDSAVDVGNNDNLPTLFKSNHPPYGRDFLNQEPTGRFCNGKLATDITADT  83

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+SY  AYLS QATGKNLL+GANFASAASGYDE +A  + AIPLSQQV YYKEYQ KL
Sbjct  84   LGFTSYAPAYLSSQATGKNLLLGANFASAASGYDENSATFNGAIPLSQQVIYYKEYQSKL  143

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            A VAGS+ A++IIK+ALYI+  GSSDF+QNYY+NP++NK  TPDQY + LV
Sbjct  144  AQVAGSENASAIIKNALYILSAGSSDFVQNYYINPFINKFITPDQYSARLV  194



>ref|XP_004964566.1| PREDICTED: GDSL esterase/lipase APG-like [Setaria italica]
Length=357

 Score =   258 bits (659),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 146/171 (85%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA++ FGDSSVDVGNN+Y+HTI KA++PPYGRDFA+H  TGRFCNGKLATDITADT
Sbjct  29   QPLVPAVMTFGDSSVDVGNNDYLHTIIKANFPPYGRDFANHVATGRFCNGKLATDITADT  88

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF++YP AYLSPQA+G+NLLIGANFASA SGY + TAL+ +AIPLSQQ++Y++EYQ KL
Sbjct  89   LGFTTYPAAYLSPQASGQNLLIGANFASAGSGYYDHTALMYHAIPLSQQLQYFREYQSKL  148

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            A VAG  +A SII  ALYI+  G+SDF+QNYY+NP+L K  T DQ+   LV
Sbjct  149  AAVAGGAQAHSIISGALYIISAGASDFVQNYYINPFLFKTQTADQFSDRLV  199



>ref|XP_004486795.1| PREDICTED: GDSL esterase/lipase APG-like [Cicer arietinum]
Length=352

 Score =   256 bits (655),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 146/171 (85%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            Q LVPAII FGDS+VDVGNN+ + TIFK++YPPYGRDF + +PTGRFCNGKLATDITADT
Sbjct  24   QSLVPAIITFGDSTVDVGNNDNLSTIFKSNYPPYGRDFLNQEPTGRFCNGKLATDITADT  83

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF++Y  AYLS QATGKNLL+GANFASAASGYDE +A    AIPLSQQV+YYKEYQ KL
Sbjct  84   LGFTNYAPAYLSSQATGKNLLLGANFASAASGYDENSATFYGAIPLSQQVKYYKEYQSKL  143

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
              +AGS+ A++IIK+ALYI+  GSSDF+QNYY+NP +NK  TPD+Y + LV
Sbjct  144  VQIAGSENASAIIKNALYILSAGSSDFVQNYYINPLINKFITPDEYSARLV  194



>ref|XP_008654481.1| PREDICTED: uncharacterized protein LOC100216840 isoform X1 [Zea 
mays]
 gb|AFW83669.1| hypothetical protein ZEAMMB73_889110 [Zea mays]
Length=420

 Score =   258 bits (659),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 145/171 (85%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA+  FGDSSVDVGNN+Y+HTI KA++PPYGRDFA+H  TGRFCNGKLATDITADT
Sbjct  92   QPLVPALFTFGDSSVDVGNNDYLHTIIKANFPPYGRDFANHVATGRFCNGKLATDITADT  151

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF++YP AYLSPQA+G+NLLIGANFASA SGY + TAL+ +AIPLSQQ+EY++EYQ KL
Sbjct  152  LGFTTYPAAYLSPQASGQNLLIGANFASAGSGYYDHTALMYHAIPLSQQLEYFREYQTKL  211

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            A VAG+ +A SI+  ALYIV  G+SDF+QNYY+NP L K  T DQ+   LV
Sbjct  212  AAVAGAGQARSILSGALYIVSAGASDFVQNYYINPLLFKTQTADQFSDRLV  262



>ref|NP_001136705.1| hypothetical protein precursor [Zea mays]
 gb|ACF82439.1| unknown [Zea mays]
Length=341

 Score =   255 bits (652),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 145/171 (85%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA+  FGDSSVDVGNN+Y+HTI KA++PPYGRDFA+H  TGRFCNGKLATDITADT
Sbjct  29   QPLVPALFTFGDSSVDVGNNDYLHTIIKANFPPYGRDFANHVATGRFCNGKLATDITADT  88

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF++YP AYLSPQA+G+NLLIGANFASA SGY + TAL+ +AIPLSQQ+EY++EYQ KL
Sbjct  89   LGFTTYPAAYLSPQASGQNLLIGANFASAGSGYYDHTALMYHAIPLSQQLEYFREYQTKL  148

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            A VAG+ +A SI+  ALYIV  G+SDF+QNYY+NP L K  T DQ+   LV
Sbjct  149  AAVAGAGQARSILSGALYIVSAGASDFVQNYYINPLLFKTQTADQFSDRLV  199



>gb|EPS71085.1| hypothetical protein M569_03672, partial [Genlisea aurea]
Length=327

 Score =   254 bits (649),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 145/170 (85%), Gaps = 1/170 (1%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAII FGDS+VD GNN+Y+ T+F+AD+PPYGRDF +  PTGRF NGKL TD+TADTLG
Sbjct  1    LVPAIIIFGDSAVDTGNNDYIPTVFRADHPPYGRDFKNKLPTGRFSNGKLVTDLTADTLG  60

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F+SYP AYL P+A+GK LL+GANFASA SGYDE+TALLS+ IPL+QQ+EY+KEY+GKLA 
Sbjct  61   FTSYPAAYLGPEASGKRLLVGANFASAGSGYDERTALLSSVIPLNQQLEYFKEYKGKLAS  120

Query  463  VAGSKKAA-SIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            VAG +KAA  IIK ALYI  FGSSDF+QNYY+NP LNK+ + D Y SYL+
Sbjct  121  VAGGEKAAGDIIKSALYIASFGSSDFVQNYYINPLLNKLVSSDDYSSYLI  170



>ref|XP_006465717.1| PREDICTED: GDSL esterase/lipase APG-like isoform X1 [Citrus sinensis]
Length=355

 Score =   255 bits (651),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 122/170 (72%), Positives = 144/170 (85%), Gaps = 0/170 (0%)
 Frame = +1

Query  100  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  279
            PLVPAI++FGDSSVDVGNNN++ T FKA+YPPYGR+F  HQPTGRF +GKL TD TADTL
Sbjct  29   PLVPAIVSFGDSSVDVGNNNHLLTYFKANYPPYGREFIDHQPTGRFSDGKLVTDFTADTL  88

Query  280  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  459
            GF +Y  AYLS QATGKNLLIGANFASA SGYD  T+++++AI L+ Q++YY+EYQ KLA
Sbjct  89   GFKTYAPAYLSSQATGKNLLIGANFASAGSGYDGNTSIINHAISLTHQLQYYREYQSKLA  148

Query  460  GVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             +AG K++ASIIKDA+YIVG GS DFLQNYY  P LNKVYTP+QY S LV
Sbjct  149  KLAGRKQSASIIKDAIYIVGTGSGDFLQNYYAKPSLNKVYTPEQYSSMLV  198



>ref|XP_008793255.1| PREDICTED: GDSL esterase/lipase APG [Phoenix dactylifera]
Length=358

 Score =   254 bits (650),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 147/169 (87%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAII FGDS+VDVGNN+Y+HT FKA+ PPYGRDF +HQ TGRFCNGKLATDITA+TLG
Sbjct  32   LVPAIITFGDSTVDVGNNDYIHTAFKANCPPYGRDFVNHQATGRFCNGKLATDITANTLG  91

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F+SYP AYLSPQA+GKNLL+G NFASAASGY ++TA L++AIPL QQ++YYKEYQ KLA 
Sbjct  92   FTSYPPAYLSPQASGKNLLMGVNFASAASGYYDETAYLNHAIPLPQQLKYYKEYQSKLAM  151

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            VAGSK+A+SI+  ALYI+  G+SDF+QNYY+NP L K  +PDQY S LV
Sbjct  152  VAGSKQASSILSGALYILSAGASDFIQNYYINPDLYKSQSPDQYSSLLV  200



>gb|AAB63641.1| Proline-rich protein APG isolog [Arabidopsis thaliana]
Length=322

 Score =   253 bits (647),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = +1

Query  118  IAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLGFSSYP  297
            + FGDS VDVGNNNY+ T+F+ADYPPYGRDFA+H+ TGRFCNGKLATDITA+TLGF+ YP
Sbjct  1    MTFGDSVVDVGNNNYLPTLFRADYPPYGRDFANHKATGRFCNGKLATDITAETLGFTKYP  60

Query  298  VAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAGVAGSK  477
             AYLSP+A+GKNLLIGANFASAASGYD+K ALL++AIPL QQVEY+KEY+ KL  +AGSK
Sbjct  61   PAYLSPEASGKNLLIGANFASAASGYDDKAALLNHAIPLYQQVEYFKEYKSKLIKIAGSK  120

Query  478  KAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            KA SIIK A+ ++  GSSDF+QNYYVNP L KVYT D YGS+L+
Sbjct  121  KADSIIKGAICLLSAGSSDFVQNYYVNPLLYKVYTVDAYGSFLI  164



>gb|EMS47165.1| GDSL esterase/lipase APG [Triticum urartu]
Length=351

 Score =   251 bits (640),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/171 (70%), Positives = 140/171 (82%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVP +  FGDSSVD+GNN+Y+HT+ KAD+PPYGRDF +   TGRFCNGKLATDITADT
Sbjct  23   QPLVPGVFTFGDSSVDIGNNDYLHTLIKADFPPYGRDFPNRVATGRFCNGKLATDITADT  82

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+SYP AYLSPQA+GKNLLIGANFASA SGY + TAL+ +AIP SQQ+EY++EYQ KL
Sbjct  83   LGFTSYPPAYLSPQASGKNLLIGANFASAGSGYYDHTALMYHAIPFSQQLEYFREYQSKL  142

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
               AGS +A SII  +LYIV FG+SDF+QNYY+NP L K  T DQ+   LV
Sbjct  143  TAFAGSSQAKSIISGSLYIVSFGASDFVQNYYINPLLFKTQTVDQFSDRLV  193



>ref|NP_001056808.1| Os06g0148200 [Oryza sativa Japonica Group]
 gb|AAP33477.1| putative lipase [Oryza sativa Japonica Group]
 dbj|BAD68619.1| putative nodulin [Oryza sativa Japonica Group]
 dbj|BAD68792.1| putative nodulin [Oryza sativa Japonica Group]
 dbj|BAF18722.1| Os06g0148200 [Oryza sativa Japonica Group]
 gb|EAY99692.1| hypothetical protein OsI_21674 [Oryza sativa Indica Group]
 dbj|BAG87362.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG98734.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE65086.1| hypothetical protein OsJ_20126 [Oryza sativa Japonica Group]
Length=351

 Score =   249 bits (637),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 142/171 (83%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA++ FGDSSVDVGNN+Y+ TI KA++PPYGRDF +  PTGRFCNGKLATDITA+T
Sbjct  23   QPLVPAVMTFGDSSVDVGNNDYLKTIIKANFPPYGRDFKNQVPTGRFCNGKLATDITAET  82

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF SY  AYLSP A+GKNLLIGANFASA SGY + TALL +AIPLSQQ+EY+KEYQ KL
Sbjct  83   LGFESYAPAYLSPDASGKNLLIGANFASAGSGYYDHTALLYHAIPLSQQLEYFKEYQSKL  142

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            A VAGS +A SII  +LYI+  G+SDF+QNYY+NP+L K  T DQ+   LV
Sbjct  143  AAVAGSSQAQSIINGSLYIISAGASDFVQNYYINPFLYKTQTADQFSDRLV  193



>ref|XP_002515934.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF46354.1| zinc finger protein, putative [Ricinus communis]
Length=354

 Score =   249 bits (636),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            + PAI  FGDS++DVGNNNY+ T +KA+YPPYGRDFASH+PTGRFC+GKL +DITA+TLG
Sbjct  27   IFPAIFTFGDSAMDVGNNNYLSTFYKANYPPYGRDFASHEPTGRFCDGKLVSDITAETLG  86

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F +Y  AYLSP A+G+NLLIGA+FASAASGYD+K+++ ++AI L QQ++Y+KEYQ +LA 
Sbjct  87   FKTYAPAYLSPDASGENLLIGASFASAASGYDDKSSIRNDAITLPQQLQYFKEYQSRLAK  146

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            VAGS K+A+IIKDALY++  G+ DFL NYYVNP L+K YTPDQY SYLV
Sbjct  147  VAGSNKSATIIKDALYLLSAGTGDFLVNYYVNPRLHKAYTPDQYSSYLV  195



>ref|XP_006655787.1| PREDICTED: GDSL esterase/lipase APG-like [Oryza brachyantha]
Length=351

 Score =   249 bits (635),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 142/171 (83%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVP ++ FGDSSVDVGNN+Y+HTI KA++PPYGRDF +   TGRFCNGKLATDITA+T
Sbjct  23   QPLVPGVMTFGDSSVDVGNNDYLHTIIKANFPPYGRDFKNGAATGRFCNGKLATDITAET  82

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF SY  AYLSP+A+GKNLLIGANFASA SGY + TALL +AIPLSQQ+EY+KEYQ KL
Sbjct  83   LGFESYAPAYLSPEASGKNLLIGANFASAGSGYYDHTALLYHAIPLSQQLEYFKEYQSKL  142

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            A VAGS +A SII  +LYI+  G+SDF+QNYY+NP+L K  T DQ+   LV
Sbjct  143  AAVAGSSQAQSIINGSLYIISAGASDFVQNYYINPFLFKTQTADQFSDRLV  193



>ref|XP_003557194.1| PREDICTED: GDSL esterase/lipase APG [Brachypodium distachyon]
Length=352

 Score =   248 bits (632),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 140/171 (82%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVP +  FGDSSVDVGNN+Y+HT+ KAD+PPYGRDF     TGRFCNGKLATDITADT
Sbjct  24   QPLVPGLFTFGDSSVDVGNNDYLHTLIKADFPPYGRDFQGRVATGRFCNGKLATDITADT  83

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+SYP AYLSP+A+G+NLLIGANFASA SGY + TAL+ +AI  +QQ+EY+KEYQ KL
Sbjct  84   LGFTSYPPAYLSPEASGQNLLIGANFASAGSGYYDHTALMYHAISFTQQLEYFKEYQSKL  143

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            A VAGS +A SI+  +LYI+ FG+SDF+QNYY+NP L K  T DQ+   LV
Sbjct  144  AAVAGSSQAKSIVTGSLYIISFGASDFVQNYYINPLLFKTQTVDQFSDRLV  194



>gb|KDP40835.1| hypothetical protein JCGZ_24834 [Jatropha curcas]
Length=359

 Score =   247 bits (631),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 146/171 (85%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            + LVPAII FGDS +DVGNN+Y+ T FKA+Y PYG+DF +H+PTGRFCNGKL +DI A+T
Sbjct  28   ETLVPAIITFGDSGLDVGNNDYLPTKFKANYSPYGKDFLNHRPTGRFCNGKLISDIIAET  87

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            +GF +YP AYLS  A+G+NLLIGA+FASAASG+D+K  + +NAIPL QQ++Y+KEY+ KL
Sbjct  88   MGFKTYPPAYLSRDASGENLLIGASFASAASGFDDKIVIANNAIPLHQQLQYFKEYKSKL  147

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            A VAGS K+ SIIKDALY++  G+SDFL NYY+NP +NK+YTPDQYGS+LV
Sbjct  148  AKVAGSNKSMSIIKDALYLLSAGTSDFLLNYYINPQINKIYTPDQYGSFLV  198



>emb|CDO97958.1| unnamed protein product [Coffea canephora]
Length=363

 Score =   247 bits (630),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 142/180 (79%), Gaps = 9/180 (5%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDIT---  267
            +PLVPA+I FGDS VDVGNNN++ T FKA++ PYGRDFASHQ TGRFCNGKL TD T   
Sbjct  25   KPLVPALIIFGDSDVDVGNNNHLSTFFKANFAPYGRDFASHQATGRFCNGKLVTDFTGKL  84

Query  268  ------ADTLGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVE  429
                  ADTLGF+ YP AYLSP A+GK+LLIGANF SA SGYDEKTA ++ AI L +Q +
Sbjct  85   QFKNPTADTLGFTFYPPAYLSPHASGKSLLIGANFGSAGSGYDEKTASINQAISLRRQFQ  144

Query  430  YYKEYQGKLAGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            Y+KEY+ KL   AG++KAASII DALYI+G GS DFLQNYY +P LNKVYTP QY SYLV
Sbjct  145  YFKEYKSKLEKSAGTRKAASIIGDALYILGTGSGDFLQNYYFHPALNKVYTPAQYSSYLV  204



>emb|CAB81548.2| putative proline-rich protein APG isolog [Cicer arietinum]
Length=350

 Score =   246 bits (628),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 143/169 (85%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAII FGDS+VDVGNN+Y+ T+FKA+YPPYGRDF + QPTGRFCNGKLATDITA+TLG
Sbjct  24   LVPAIITFGDSAVDVGNNDYLPTLFKANYPPYGRDFVNKQPTGRFCNGKLATDITAETLG  83

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F+S+  AYLSPQA+GKNLLIGANFASAASGYDEK A+L++A+PLSQQ+EYYKEYQ KLA 
Sbjct  84   FTSFAPAYLSPQASGKNLLIGANFASAASGYDEKAAILNHALPLSQQLEYYKEYQSKLAK  143

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            VAGSKKAASIIKDALY++   +    +       +NKV T DQY SYL+
Sbjct  144  VAGSKKAASIIKDALYLLMLAAVTLYKIIMSILGINKVLTVDQYSSYLL  192



>ref|XP_011044241.1| PREDICTED: GDSL esterase/lipase At5g22810 [Populus euphratica]
Length=352

 Score =   244 bits (624),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 141/171 (82%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA+  FGDS VD GNNN+++TI KA++PPYGRDF +H+PTGRFCNGKLA+D+TA+ 
Sbjct  25   QPLVPAMFIFGDSVVDAGNNNHLYTIVKANFPPYGRDFVNHKPTGRFCNGKLASDLTAEN  84

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+SYP AYLS +A GKNLLIGANFASAASGY E TA L +AIPLSQQ+  YKEYQ K+
Sbjct  85   LGFTSYPPAYLSKKARGKNLLIGANFASAASGYYETTAKLYHAIPLSQQLGNYKEYQNKI  144

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             G+AG   A+SII  ALY++  GSSDF+QNYY+NP L KVYTPDQ+   L+
Sbjct  145  VGIAGKSNASSIISGALYLISAGSSDFVQNYYINPLLYKVYTPDQFSDLLI  195



>ref|XP_006826756.1| hypothetical protein AMTR_s00136p00069360 [Amborella trichopoda]
 gb|ERM93993.1| hypothetical protein AMTR_s00136p00069360 [Amborella trichopoda]
Length=349

 Score =   244 bits (622),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            Q LVPAII FGDS+VDVGNN+Y+ TIFKAD+PPYGRDF +  PTGRFCNGKLATDITA+T
Sbjct  22   QALVPAIITFGDSAVDVGNNDYLPTIFKADFPPYGRDFVNRSPTGRFCNGKLATDITAET  81

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+S+P AYLS QA+GKNLLIGANFAS ASGY +KTA L +AI LSQQ+EYYKEYQGKL
Sbjct  82   LGFTSFPPAYLSSQASGKNLLIGANFASGASGYYDKTAYLYHAISLSQQLEYYKEYQGKL  141

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            A +AG+ KA SI+ +ALYI+  GSSD++QNYY++P LNK+YTPDQ+  +LV
Sbjct  142  AKIAGAAKAKSILSNALYILSEGSSDWVQNYYIDPLLNKIYTPDQFSDFLV  192



>ref|XP_010242974.1| PREDICTED: GDSL esterase/lipase At5g22810 [Nelumbo nucifera]
Length=352

 Score =   243 bits (620),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/171 (67%), Positives = 141/171 (82%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA+  FGDS VDVGNNN ++T+ KA++PPYGRDF  H+PTGRFCNGKLA+D TA+ 
Sbjct  25   QPLVPALCIFGDSVVDVGNNNNLYTLVKANFPPYGRDFTKHRPTGRFCNGKLASDFTAEN  84

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF++YP AYLSP+A G NLLIGANFASA+SGY ++TA L +AIPL+QQ+EYYKEYQ K+
Sbjct  85   LGFTTYPPAYLSPEARGNNLLIGANFASASSGYYDRTAQLYDAIPLTQQLEYYKEYQKKV  144

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            A +AG   A+SI   A+Y+V  GSSDF+QNYY+NP L KVYTPDQ+   L+
Sbjct  145  ANIAGKSNASSIFSGAIYLVSAGSSDFVQNYYINPLLYKVYTPDQFSDLLM  195



>gb|KJB56728.1| hypothetical protein B456_009G138200 [Gossypium raimondii]
Length=345

 Score =   243 bits (619),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 141/169 (83%), Gaps = 11/169 (7%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAII FGDS VDVGNN+Y+ TIFKA+YPPYGRDFA+ +PTGRFCNGKLATDITA    
Sbjct  31   LVPAIITFGDSVVDVGNNDYLPTIFKANYPPYGRDFANKKPTGRFCNGKLATDITA----  86

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
                   YLSP+A+GKNLL+GANFASA SGYD++ +++++AI L+QQ+EY+KEYQ KLA 
Sbjct  87   -------YLSPEASGKNLLLGANFASAGSGYDDEASMVNHAITLTQQLEYFKEYQAKLAK  139

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            VAGS K+ASI KDALY++  GS DFLQNYYVNP LN  YTPDQYGS+L+
Sbjct  140  VAGSTKSASITKDALYVLSAGSGDFLQNYYVNPLLNHAYTPDQYGSFLI  188



>gb|EMT10375.1| GDSL esterase/lipase APG [Aegilops tauschii]
Length=351

 Score =   242 bits (617),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 137/171 (80%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVP +  FGDSSVD+GNN+ +H + KAD+PPYGR F +   TGRFCNGKLATDITADT
Sbjct  23   QPLVPGVFTFGDSSVDIGNNDSLHPLIKADFPPYGRAFPNRVATGRFCNGKLATDITADT  82

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+SYP AYLSPQA+GKNLLIGANFASA SGY + TAL+ +AIP SQQ+EY++EYQ KL
Sbjct  83   LGFTSYPPAYLSPQASGKNLLIGANFASAGSGYYDHTALMYHAIPFSQQLEYFREYQSKL  142

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
               AGS +A SII  +LYIV FG+SDF+QNYY+NP L K  T DQ+   LV
Sbjct  143  TAFAGSSQAKSIISGSLYIVSFGASDFVQNYYINPLLFKTQTVDQFSDRLV  193



>ref|XP_002313641.2| GDSL-motif lipase family protein [Populus trichocarpa]
 gb|EEE87596.2| GDSL-motif lipase family protein [Populus trichocarpa]
Length=352

 Score =   241 bits (616),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 140/171 (82%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA+  FGDS VD GNNN+++TI KA++PPYGRDF +H+PTGRFCNGKLA+D+TA+ 
Sbjct  25   QPLVPAMFIFGDSVVDAGNNNHLYTIIKANFPPYGRDFVNHKPTGRFCNGKLASDLTAEN  84

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+SYP AYLS +A GKNLLIGANFASAASGY E TA L +AIPLSQQ+  YKEYQ K+
Sbjct  85   LGFTSYPPAYLSKKARGKNLLIGANFASAASGYYETTAKLYHAIPLSQQLGNYKEYQNKI  144

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             G+AG   A+SII  ALY++  GSSDF+QNYY+NP L KVYT DQ+   L+
Sbjct  145  VGIAGKSNASSIISGALYLISAGSSDFVQNYYINPLLYKVYTLDQFSDLLI  195



>gb|KDO38511.1| hypothetical protein CISIN_1g018227mg [Citrus sinensis]
Length=340

 Score =   241 bits (614),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 137/170 (81%), Gaps = 19/170 (11%)
 Frame = +1

Query  100  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  279
            PLVPAII FGDS+VDVGNNNY+ T+FKA+YPPYGRDF +HQPTGRFCNGKLATD T    
Sbjct  33   PLVPAIITFGDSAVDVGNNNYLATLFKANYPPYGRDFINHQPTGRFCNGKLATDFT----  88

Query  280  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  459
                           GKNLLIGANFASA SGYD++T+ L++AI L+QQ++YY+EYQ KLA
Sbjct  89   ---------------GKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLA  133

Query  460  GVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             VAGSK++ASIIKDA+YIVG GS DFLQNYYVNP LNKVYTP+QY S LV
Sbjct  134  KVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLLNKVYTPEQYSSMLV  183



>gb|KDO42514.1| hypothetical protein CISIN_1g040658mg, partial [Citrus sinensis]
Length=287

 Score =   238 bits (607),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/171 (67%), Positives = 136/171 (80%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA+  FGDS VD GNNNY++TI KA++ PYGRDF  H+PTGRFCNGKLA D TA+ 
Sbjct  24   QPLVPAMFIFGDSVVDAGNNNYIYTIVKANFRPYGRDFVHHKPTGRFCNGKLAADFTAEN  83

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            +GF+SYP AYLS +A GKNLLIGANFAS ASGY E TA L +AIPLSQQ+E++K+YQ KL
Sbjct  84   IGFTSYPPAYLSEEAKGKNLLIGANFASGASGYYETTAKLYHAIPLSQQLEHFKDYQRKL  143

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             G+AG   A+SII   L +V  GSSDF+QNYY+NP L KVYTPDQ+   L+
Sbjct  144  EGIAGKTNASSIISGGLCLVSSGSSDFIQNYYINPLLYKVYTPDQFSDILI  194



>ref|XP_006484945.1| PREDICTED: GDSL esterase/lipase At5g22810-like, partial [Citrus 
sinensis]
Length=351

 Score =   239 bits (610),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 114/171 (67%), Positives = 136/171 (80%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA+  FGDS VD GNNNY++TI KA++ PYGRDF  H+PTGRFCNGKLA D TA+ 
Sbjct  24   QPLVPAMFIFGDSVVDAGNNNYIYTIVKANFRPYGRDFVHHKPTGRFCNGKLAADFTAEN  83

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            +GF+SYP AYLS +A GKNLLIGANFAS ASGY E TA L +AIPLSQQ+E++K+YQ KL
Sbjct  84   IGFTSYPPAYLSEEAKGKNLLIGANFASGASGYYETTAKLYHAIPLSQQLEHFKDYQRKL  143

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             G+AG   A+SII   L +V  GSSDF+QNYY+NP L KVYTPDQ+   L+
Sbjct  144  EGIAGKTNASSIISGGLCLVSSGSSDFIQNYYINPLLYKVYTPDQFSDILI  194



>ref|XP_002271400.1| PREDICTED: GDSL esterase/lipase At5g22810 [Vitis vinifera]
Length=351

 Score =   237 bits (605),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 138/171 (81%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA+  FGDS+VD GNNN++ TI KA++PPYGRDF SH+PTGRFCNGKLA+D TA+ 
Sbjct  24   QPLVPAMFIFGDSAVDAGNNNHLDTIVKANFPPYGRDFISHKPTGRFCNGKLASDFTAEN  83

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            +GF+SYP AYLS +A G NLLIGANFASAASGY   TA LSNAI LS+Q+EY+KEYQ ++
Sbjct  84   IGFTSYPPAYLSKEAKGNNLLIGANFASAASGYYHTTAKLSNAISLSKQLEYFKEYQERV  143

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            A + G   A+SII  A+Y+V  GSSDFLQNYY+NP L + Y+PDQ+   L+
Sbjct  144  AKIVGKSNASSIISGAVYLVSGGSSDFLQNYYINPLLYEAYSPDQFSDLLI  194



>gb|KDP34349.1| hypothetical protein JCGZ_11232 [Jatropha curcas]
Length=351

 Score =   236 bits (601),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 141/171 (82%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA+  FGDS +D GNNN+++TI KA++PPYGRDF +H+PTGRFCNGKLA+D TA+ 
Sbjct  24   QPLVPAMFIFGDSVIDAGNNNHLYTIVKANFPPYGRDFINHKPTGRFCNGKLASDFTAEN  83

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            +GF+SYP AYLS +A G NLLIGANFASAASG+ + TA L +AIPLS+Q+EYYK+YQ K+
Sbjct  84   IGFTSYPPAYLSKEAHGTNLLIGANFASAASGFYDTTAKLYHAIPLSKQLEYYKDYQKKI  143

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             G+AG   A+SII  ++Y+V  G+SDF+QNYY+NP+L K YTPDQ+   L+
Sbjct  144  VGIAGKSNASSIISGSVYLVSAGASDFVQNYYINPFLYKEYTPDQFSDILM  194



>ref|XP_009796088.1| PREDICTED: GDSL esterase/lipase At5g22810 [Nicotiana sylvestris]
Length=352

 Score =   235 bits (600),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 136/171 (80%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA+  FGDS VD GNNNY+ TI KA++PPYGRDF  H PTGRFCNGKLA+D TA+ 
Sbjct  25   QPLVPALFIFGDSVVDAGNNNYLKTIVKANFPPYGRDFPKHTPTGRFCNGKLASDFTAEN  84

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+SYP AYLS +A GKNLLIGANFAS +SGY + TA L +AIPLS+Q+E+YKEYQ K+
Sbjct  85   LGFTSYPPAYLSKKAKGKNLLIGANFASGSSGYYDTTARLYDAIPLSKQLEFYKEYQKKV  144

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
              +AG   A SII  ++++V  GSSDF+QNYY+NP L KVYTPDQ+   L+
Sbjct  145  VVIAGKVNATSIINGSIHLVSAGSSDFVQNYYINPLLYKVYTPDQFSDILI  195



>ref|XP_002527431.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF34923.1| zinc finger protein, putative [Ricinus communis]
Length=359

 Score =   236 bits (601),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 140/171 (82%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA+  FGDS VD GNNN+++TI KA++PPYGRDFA+H+ TGRFCNGKLA+D TA+ 
Sbjct  32   QPLVPAMFIFGDSVVDAGNNNHLYTIVKANFPPYGRDFANHKSTGRFCNGKLASDFTAEN  91

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            +GF+SYP AYLS +A G NLLIGANFAS ASG+ + TA L +AI L+QQ+EYYKEYQ K+
Sbjct  92   IGFTSYPPAYLSKEAEGTNLLIGANFASGASGFYDSTAKLYHAISLTQQLEYYKEYQRKI  151

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             G+AG   A+SII  A+Y++  G+SDF+QNYY+NP+L+K YTPDQ+   L+
Sbjct  152  VGIAGKSNASSIISGAIYLISAGASDFVQNYYINPFLHKEYTPDQFSDILM  202



>ref|XP_010247794.1| PREDICTED: GDSL esterase/lipase At5g22810-like [Nelumbo nucifera]
Length=351

 Score =   235 bits (600),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 138/171 (81%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA+  FGDS VDVGNNN + T+ KA++PPYGRDF + + TGRFCNGKLATD  A+T
Sbjct  24   QPLVPALCIFGDSVVDVGNNNNLLTLVKANFPPYGRDFTTQRATGRFCNGKLATDFAAET  83

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF++Y  AYLS +ATG NLLIGANFASAASGY ++TA L +AIPL+QQ+EYY+EYQ K+
Sbjct  84   LGFTTYQPAYLSQEATGSNLLIGANFASAASGYYDRTAQLYDAIPLTQQLEYYREYQKKV  143

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
              +AG   AASI  DA+Y+V  GSSDF+QNYY+NP L  VYTPDQ+ + L+
Sbjct  144  VKIAGRSNAASIFSDAIYLVSAGSSDFVQNYYINPLLYGVYTPDQFSALLM  194



>ref|XP_007015991.1| GDSL esterase/lipase isoform 1 [Theobroma cacao]
 gb|EOY33610.1| GDSL esterase/lipase isoform 1 [Theobroma cacao]
Length=355

 Score =   235 bits (599),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 135/171 (79%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA+  FGDS VD GNNN ++TI KA++PPYGRDF +H+PTGRFCNGKLA+D TA+ 
Sbjct  28   QPLVPAMFIFGDSVVDAGNNNNLYTIIKANFPPYGRDFVNHKPTGRFCNGKLASDFTAEN  87

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            +GF+SYP AYLS QA GKNLLIGANFASA+SGY E TA L + + LS+Q+E YKEYQ KL
Sbjct  88   IGFTSYPPAYLSKQAEGKNLLIGANFASASSGYYETTAKLYHTLSLSKQLENYKEYQNKL  147

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
              +AG   A+SII   +Y++  GSSDFLQNYY+NP L K YTPDQ+   L+
Sbjct  148  VAIAGKSNASSIISGGIYLISSGSSDFLQNYYINPLLYKAYTPDQFSDILI  198



>ref|XP_006838752.1| hypothetical protein AMTR_s00002p00255920 [Amborella trichopoda]
 gb|ERN01321.1| hypothetical protein AMTR_s00002p00255920 [Amborella trichopoda]
Length=348

 Score =   234 bits (598),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 135/171 (79%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA++ FGDS+ D GNNN ++T+ KA++PPYGRDF  H PTGRFCNGKLATDITADT
Sbjct  21   QPLVPAMMIFGDSTADCGNNNGLYTLVKANFPPYGRDFVDHSPTGRFCNGKLATDITADT  80

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+SYP  YL  Q   KN LIGANFASAASGY ++TA L +AIPLS+Q++YYKEYQ K+
Sbjct  81   LGFTSYPPPYLGSQPAPKNFLIGANFASAASGYYDRTAQLYHAIPLSKQMQYYKEYQSKV  140

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
              + G  KA +I  DALY++  GSSDF+QNYY+NP +N+ Y PDQ+   L+
Sbjct  141  IKMVGKAKAETIFSDALYVLSTGSSDFVQNYYINPVVNRAYNPDQFSDILI  191



>ref|XP_009337386.1| PREDICTED: GDSL esterase/lipase At5g22810 [Pyrus x bretschneideri]
Length=350

 Score =   234 bits (597),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/173 (65%), Positives = 139/173 (80%), Gaps = 2/173 (1%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA+  FGDS VD GNNN+++T+ KA++PPYGRDF +H+PTGRFCNGKLA+D TA+ 
Sbjct  21   QPLVPAMFVFGDSVVDAGNNNHLYTLIKANFPPYGRDFVNHKPTGRFCNGKLASDFTAEN  80

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+SYP AYLS +A GKNLLIGANF SA SGY E TA L NAI L+QQ++YYKEYQ K+
Sbjct  81   LGFTSYPPAYLSKEANGKNLLIGANFGSAGSGYYEYTAKLYNAISLNQQLKYYKEYQNKV  140

Query  457  AGVAGSKKA--ASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
              +A + KA   SII DA+Y+VG GSSDFLQNYY++P L K YTP+Q+   L+
Sbjct  141  VRIAAANKANFTSIISDAIYLVGAGSSDFLQNYYIDPLLYKAYTPNQFSDILM  193



>gb|KHG22657.1| hypothetical protein F383_04802 [Gossypium arboreum]
Length=307

 Score =   232 bits (592),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 134/171 (78%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA+  FGDS VDVGNNN ++TI KAD+PPYGRDF +H+PTGRFCNGKLA+D TA+ 
Sbjct  24   QPLVPAMFIFGDSVVDVGNNNNLYTIIKADFPPYGRDFLNHKPTGRFCNGKLASDFTAEN  83

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            +GF+ YP AYLS +A G NLLIGANFASA+SGY E TA L + + LS+Q+E YK+YQ KL
Sbjct  84   IGFTDYPPAYLSKKAKGNNLLIGANFASASSGYYETTAKLYHTLSLSKQLENYKQYQNKL  143

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
              + G   A+SII D +Y++  GSSDFLQNYY+NP L K YTPDQ+   L+
Sbjct  144  VAIVGKSNASSIISDGIYLISSGSSDFLQNYYINPLLYKSYTPDQFSDVLI  194



>gb|KJB09007.1| hypothetical protein B456_001G118700 [Gossypium raimondii]
Length=293

 Score =   231 bits (589),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 135/171 (79%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA+  FGDS VDVGNNN ++TI KAD+PPYGRDF +H+PTGRFCNGKLA+D TA+ 
Sbjct  24   QPLVPAMFIFGDSVVDVGNNNNLYTIIKADFPPYGRDFLNHKPTGRFCNGKLASDFTAEN  83

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            +GF+ YP AYLS +A G NLLIGANFASA+SGY E TA L + + LS+Q+E YK+YQ KL
Sbjct  84   IGFTDYPPAYLSKKAKGNNLLIGANFASASSGYYETTAKLYHTLSLSKQLENYKQYQNKL  143

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
              +AG   A+SI+ D +Y++  GSSDFLQNYY+NP L + YTPDQ+   L+
Sbjct  144  VAIAGKSNASSIVSDGIYLISSGSSDFLQNYYINPLLYESYTPDQFSDVLI  194



>ref|XP_009625753.1| PREDICTED: GDSL esterase/lipase At5g22810 isoform X2 [Nicotiana 
tomentosiformis]
Length=352

 Score =   233 bits (593),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 135/171 (79%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QP VPA+  FGDS VD GNNNY+ TI KA++PPYGRDF  H PTGRFCNGKLA+D TA+ 
Sbjct  25   QPSVPALFIFGDSVVDAGNNNYLKTIVKANFPPYGRDFPKHIPTGRFCNGKLASDFTAEN  84

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+SYP AYLS +A GKNLLIGANFAS +SGY + T+ L +AIPLS+Q+E+YKEYQ KL
Sbjct  85   LGFTSYPPAYLSKKAKGKNLLIGANFASGSSGYYDTTSRLYDAIPLSKQLEFYKEYQKKL  144

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
              +AG   A SII  ++++V  GSSDF+QNYY+NP L KVYTPDQ+   LV
Sbjct  145  VVIAGKVNATSIINGSIHLVSAGSSDFVQNYYINPLLYKVYTPDQFSDILV  195



>ref|XP_004295642.1| PREDICTED: GDSL esterase/lipase At5g22810 [Fragaria vesca subsp. 
vesca]
Length=353

 Score =   233 bits (593),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 134/171 (78%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA+  FGDS VDVGNNN + T+ K+++PPYGRDF +H PTGRFCNGKLA+D TA+ 
Sbjct  26   QPLVPAMFIFGDSVVDVGNNNDLLTLVKSNFPPYGRDFINHNPTGRFCNGKLASDFTAEN  85

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+SY  AYLS +ATGKNLLIGANFASA SGY E TA L  AI LSQQV+YYKEYQ K+
Sbjct  86   LGFTSYQPAYLSGEATGKNLLIGANFASAGSGYYEATAKLFGAISLSQQVQYYKEYQNKV  145

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             G+ G   A  II  A+Y+V  GSSDF+QNYYVNP LNKVYT DQ+   L+
Sbjct  146  RGIGGKVNATLIISGAIYLVSAGSSDFVQNYYVNPLLNKVYTADQFSDILM  196



>ref|XP_008366379.1| PREDICTED: GDSL esterase/lipase At5g22810-like [Malus domestica]
Length=350

 Score =   233 bits (593),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/173 (65%), Positives = 137/173 (79%), Gaps = 2/173 (1%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA+  FGDS VD GNNN+++T+ KA++PPYGRDF +H+PTGRFCNGKLA+D TA+ 
Sbjct  21   QPLVPAMFIFGDSVVDAGNNNHLYTVIKANFPPYGRDFVNHKPTGRFCNGKLASDFTAEN  80

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+SYP AYLS +A G NLLIGANF SA SGY E TA L + I L+QQ+EYYKEYQ K+
Sbjct  81   LGFTSYPPAYLSKEANGTNLLIGANFGSAGSGYYEYTAKLYDVISLNQQLEYYKEYQNKV  140

Query  457  AGVAGSKKA--ASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             G+A   KA   SII DA+Y+VG GSSDFLQNYY++P L K YTP+Q+   L+
Sbjct  141  VGIAARNKANFTSIISDAVYLVGAGSSDFLQNYYIDPLLYKFYTPNQFSDILM  193



>ref|XP_006349065.1| PREDICTED: GDSL esterase/lipase At5g22810-like [Solanum tuberosum]
Length=353

 Score =   232 bits (592),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 135/171 (79%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA+  FGDS VD GNNNY+ TI KA++PPYGRDF    PTGRFCNGKLA+D TA+ 
Sbjct  26   QPLVPALFIFGDSVVDAGNNNYLKTIVKANFPPYGRDFPKQIPTGRFCNGKLASDFTAEN  85

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+SYP AYLS +A GKNLLIGANFAS +SGY + T+ L +AIPLS+Q+EYYKEYQ KL
Sbjct  86   LGFTSYPPAYLSKKAKGKNLLIGANFASGSSGYYDTTSRLYDAIPLSKQLEYYKEYQKKL  145

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
              +AG   A SII  +++++  GSSDF+QNYY+NP L KVYTPDQ+   L+
Sbjct  146  VVIAGKLNATSIINGSIHLISAGSSDFVQNYYINPLLYKVYTPDQFSDILI  196



>ref|XP_004251004.1| PREDICTED: GDSL esterase/lipase At5g22810 [Solanum lycopersicum]
Length=355

 Score =   232 bits (591),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 135/171 (79%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA+  FGDS VD GNNNY+ TI KA++PPYGRDF    PTGRFCNGKLA+D TA+ 
Sbjct  28   QPLVPALFIFGDSVVDAGNNNYLKTIIKANFPPYGRDFPKKIPTGRFCNGKLASDFTAEN  87

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+SYP AYLS +A GKNLLIGANFAS +SGY + TA L +AIPLS+Q+EYYKEYQ KL
Sbjct  88   LGFTSYPPAYLSKKAKGKNLLIGANFASGSSGYYDTTARLYDAIPLSKQLEYYKEYQKKL  147

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
              +AG   A+SI   +++++  GSSDF+QNYY+NP L KVYTPDQ+   L+
Sbjct  148  VVIAGKLNASSITNASIHLISAGSSDFVQNYYINPLLYKVYTPDQFSDILI  198



>gb|KJB09006.1| hypothetical protein B456_001G118700 [Gossypium raimondii]
Length=351

 Score =   231 bits (590),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 135/171 (79%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA+  FGDS VDVGNNN ++TI KAD+PPYGRDF +H+PTGRFCNGKLA+D TA+ 
Sbjct  24   QPLVPAMFIFGDSVVDVGNNNNLYTIIKADFPPYGRDFLNHKPTGRFCNGKLASDFTAEN  83

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            +GF+ YP AYLS +A G NLLIGANFASA+SGY E TA L + + LS+Q+E YK+YQ KL
Sbjct  84   IGFTDYPPAYLSKKAKGNNLLIGANFASASSGYYETTAKLYHTLSLSKQLENYKQYQNKL  143

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
              +AG   A+SI+ D +Y++  GSSDFLQNYY+NP L + YTPDQ+   L+
Sbjct  144  VAIAGKSNASSIVSDGIYLISSGSSDFLQNYYINPLLYESYTPDQFSDVLI  194



>ref|XP_002515937.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF46357.1| zinc finger protein, putative [Ricinus communis]
Length=369

 Score =   231 bits (590),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 143/183 (78%), Gaps = 14/183 (8%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATD-------  261
            + PAI  FGDS++DVGNNNY+ T +KA+YPPYGRDFASH+PTGRFC+GK           
Sbjct  28   IFPAIFTFGDSAMDVGNNNYLSTFYKANYPPYGRDFASHEPTGRFCDGKXDLLDRSYLFC  87

Query  262  -------ITADTLGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQ  420
                   + A+TLGF +Y  AYLSP A+G+NLLIGA+FASAASGYD+K+++ ++AI L Q
Sbjct  88   SCMNQFLLAAETLGFKTYAPAYLSPDASGENLLIGASFASAASGYDDKSSIRNHAITLPQ  147

Query  421  QVEYYKEYQGKLAGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGS  600
            Q++Y+KEYQ KLA VAGSKK+A+IIKDALY++  G+ DFL NYYVNP L+K YTPDQY S
Sbjct  148  QLQYFKEYQSKLAKVAGSKKSATIIKDALYLLSAGTGDFLVNYYVNPRLHKAYTPDQYSS  207

Query  601  YLV  609
            YLV
Sbjct  208  YLV  210



>ref|XP_011089987.1| PREDICTED: GDSL esterase/lipase At5g22810 [Sesamum indicum]
Length=338

 Score =   230 bits (586),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 133/171 (78%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA++ FGDS VDVGNNN + TI KA++PPYGRDF  H+PTGRFCNGKLA+D TA+ 
Sbjct  11   QPLVPALLIFGDSVVDVGNNNNLETIVKANFPPYGRDFIKHKPTGRFCNGKLASDFTAEN  70

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+SYP AYLS QA GKNLLIGANFAS +SGY + TA + N IPLS+QVE YKEYQ KL
Sbjct  71   LGFTSYPPAYLSKQARGKNLLIGANFASGSSGYYDTTAKIYNTIPLSKQVELYKEYQKKL  130

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
              + G   A+SI+  +++ V  GSSDF+QNYY+NP L K YT DQ+   L+
Sbjct  131  VALVGQSNASSIVNGSVHFVSAGSSDFVQNYYINPLLYKKYTTDQFSDILL  181



>gb|KDO38513.1| hypothetical protein CISIN_1g018227mg [Citrus sinensis]
Length=319

 Score =   229 bits (585),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 130/148 (88%), Gaps = 2/148 (1%)
 Frame = +1

Query  100  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  279
            PLVPAII FGDS+VDVGNNNY+ T+FKA+YPPYGRDF +HQPTGRFCNGKLATD TADTL
Sbjct  33   PLVPAIITFGDSAVDVGNNNYLATLFKANYPPYGRDFINHQPTGRFCNGKLATDFTADTL  92

Query  280  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  459
            GF +Y  AYLSPQATGKNLLIGANFASA SGYD++T+ L++AI L+QQ++YY+EYQ KLA
Sbjct  93   GFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLA  152

Query  460  GVAGSKKAASIIKDALYI--VGFGSSDF  537
             VAGSK++ASIIKDA+YI   G G+  F
Sbjct  153  KVAGSKQSASIIKDAIYINMYGLGARKF  180



>ref|XP_010558217.1| PREDICTED: GDSL esterase/lipase At5g03820-like [Tarenaya hassleriana]
Length=354

 Score =   229 bits (585),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 132/171 (77%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA+I  GDS VDVGNNN ++T+ KA++PPYGRDFASH PTGRFCNGKLATD TAD 
Sbjct  26   QPLVPALIIMGDSVVDVGNNNNLNTLVKANFPPYGRDFASHIPTGRFCNGKLATDFTADF  85

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF SYP AYLS +A GKNLL GANFAS ASG D+ TA + NAI L+QQ+  YKEYQ K+
Sbjct  86   LGFPSYPPAYLSREARGKNLLTGANFASGASGLDDGTARIYNAISLNQQLNNYKEYQSKV  145

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
              + G  +A  I    ++++  GSSDF+QNYY+NP LN+VYTPDQ+   L+
Sbjct  146  TSMVGRARANEIFAGGIHLLSAGSSDFIQNYYINPILNRVYTPDQFSDRLM  196



>ref|XP_010689974.1| PREDICTED: GDSL esterase/lipase At5g22810 [Beta vulgaris subsp. 
vulgaris]
Length=354

 Score =   229 bits (583),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 134/171 (78%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QP+VPA+  FGDS VDVGNNN +HTI K+D+ PYGRDF+ HQPTGRFCNGKLATD TA+T
Sbjct  27   QPIVPALFIFGDSVVDVGNNNNLHTIVKSDFLPYGRDFSYHQPTGRFCNGKLATDFTAET  86

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            +GF+SY  AYLS +ATG+NLLIGANFASA+SGY   T  + N IPLS+Q+E+Y +YQ KL
Sbjct  87   IGFTSYQPAYLSTEATGENLLIGANFASASSGYHASTPKIYNTIPLSEQLEHYMDYQKKL  146

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
              VAG   A  II   +Y++  GSSDFLQNYY+NP L K+Y+P+++   LV
Sbjct  147  ELVAGQDNATLIITQGIYLISAGSSDFLQNYYINPLLYKLYSPEEFSHVLV  197



>ref|XP_006424380.1| hypothetical protein CICLE_v10027727mg [Citrus clementina]
 gb|ESR37620.1| hypothetical protein CICLE_v10027727mg [Citrus clementina]
Length=1058

 Score =   240 bits (613),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 114/171 (67%), Positives = 136/171 (80%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA+  FGDS VD GNNNY++TI KA++ PYGRDF  H+PTGRFCNGKLA D TA+ 
Sbjct  731  QPLVPAMFIFGDSVVDAGNNNYIYTIVKANFRPYGRDFVHHKPTGRFCNGKLAADFTAEN  790

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            +GF+SYP AYLS +A GKNLLIGANFAS ASGY E TA L +AIPLSQQ+E++K+YQ KL
Sbjct  791  IGFTSYPPAYLSEEAKGKNLLIGANFASGASGYYETTAKLYHAIPLSQQLEHFKDYQRKL  850

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             G+AG   A+SII   L +V  GSSDF+QNYY+NP L KVYTPDQ+   L+
Sbjct  851  EGIAGKTNASSIISGGLCLVSSGSSDFIQNYYINPLLYKVYTPDQFSDILI  901



>ref|XP_009625752.1| PREDICTED: GDSL esterase/lipase At5g22810 isoform X1 [Nicotiana 
tomentosiformis]
Length=353

 Score =   228 bits (581),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 135/172 (78%), Gaps = 1/172 (1%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITA-D  273
            QP VPA+  FGDS VD GNNNY+ TI KA++PPYGRDF  H PTGRFCNGKLA+D TA +
Sbjct  25   QPSVPALFIFGDSVVDAGNNNYLKTIVKANFPPYGRDFPKHIPTGRFCNGKLASDFTAAE  84

Query  274  TLGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGK  453
             LGF+SYP AYLS +A GKNLLIGANFAS +SGY + T+ L +AIPLS+Q+E+YKEYQ K
Sbjct  85   NLGFTSYPPAYLSKKAKGKNLLIGANFASGSSGYYDTTSRLYDAIPLSKQLEFYKEYQKK  144

Query  454  LAGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            L  +AG   A SII  ++++V  GSSDF+QNYY+NP L KVYTPDQ+   LV
Sbjct  145  LVVIAGKVNATSIINGSIHLVSAGSSDFVQNYYINPLLYKVYTPDQFSDILV  196



>gb|AFK42211.1| unknown [Lotus japonicus]
Length=350

 Score =   227 bits (579),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 134/171 (78%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA+  FGDS VDVGNNN + TI K+++ PYGRDF +HQPTGRFCNGKLATD+TA+ 
Sbjct  23   QPLVPALFIFGDSVVDVGNNNQLPTIVKSNFLPYGRDFQNHQPTGRFCNGKLATDLTAEN  82

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+SYP AY++ +  G NLL GANFAS ASGY E TA L +AIPLSQQ+E+YKE Q  L
Sbjct  83   LGFTSYPPAYMNLKTKGNNLLNGANFASGASGYYEPTAKLYHAIPLSQQLEHYKESQNIL  142

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             GVAG   A+SII  A+Y++  GSSDF+QNYY+NP L KVYT DQ+   L+
Sbjct  143  VGVAGKSNASSIISGAIYLISAGSSDFVQNYYINPLLYKVYTADQFSDILI  193



>ref|XP_002873116.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH49375.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=343

 Score =   227 bits (579),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 134/171 (78%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA+I  GDS VD GNNN+++T+ KA++PPYGRDF +H  TGRF NGKLATD TA++
Sbjct  15   QPLVPALIIMGDSVVDAGNNNHLNTLVKANFPPYGRDFFAHNATGRFSNGKLATDFTAES  74

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+SYPVAYLS +A G NLL GANFAS ASG+D+ TAL  NAI L+QQ+E YKEYQ K+
Sbjct  75   LGFTSYPVAYLSQEANGTNLLTGANFASGASGFDDGTALFYNAITLNQQLENYKEYQNKV  134

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
              + G ++A  I   A++++  GSSDFLQ+YY+NP LN ++TPDQY   L+
Sbjct  135  TNIVGRERANEIFSGAIHLLSTGSSDFLQSYYINPILNLIFTPDQYSDRLL  185



>ref|XP_008226994.1| PREDICTED: GDSL esterase/lipase At5g22810 [Prunus mume]
Length=351

 Score =   227 bits (579),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 132/171 (77%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA+  FGDS VD GNNN V TI KA++ PYGRDF +H+PTGRFCNGKLA+D TA+ 
Sbjct  24   QPLVPALFLFGDSVVDAGNNNNVETIIKANFNPYGRDFVNHKPTGRFCNGKLASDFTAEN  83

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+SYP AYLS +A GKNLLIGANFASA SGY + TA L + I L+QQ+E YKEYQ K+
Sbjct  84   LGFTSYPPAYLSKEAAGKNLLIGANFASAGSGYYDSTAKLYHTISLNQQLENYKEYQNKV  143

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             G+AG     SII  A+Y+V  GSSDF+QNYY+NP L KVYT +Q+   L+
Sbjct  144  LGIAGKANLTSIISGAIYLVSAGSSDFVQNYYINPLLYKVYTANQFSDILI  194



>ref|XP_007132365.1| hypothetical protein PHAVU_011G088700g [Phaseolus vulgaris]
 gb|ESW04359.1| hypothetical protein PHAVU_011G088700g [Phaseolus vulgaris]
Length=365

 Score =   227 bits (579),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 131/171 (77%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA+  FGDS VDVGNNN+  T+ KA++PPYGRD+ +H PTGRFCNGKLATD TA+ 
Sbjct  38   QPLVPALFIFGDSVVDVGNNNHQITVIKANFPPYGRDYENHDPTGRFCNGKLATDFTAEV  97

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+S P AYL+    G NLL GANFASA+SGY E TA L N IPLSQQ+EYYKE Q KL
Sbjct  98   LGFTSSPPAYLNLNTKGNNLLNGANFASASSGYYEPTAKLYNTIPLSQQLEYYKECQNKL  157

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
               AG   A+SII DA+Y+V  G+SDF+QNYY+NP LNK YT DQ+   ++
Sbjct  158  VEAAGKSNASSIISDAIYLVSAGTSDFVQNYYINPLLNKFYTIDQFSDTIL  208



>ref|XP_003540212.1| PREDICTED: GDSL esterase/lipase At5g22810-like [Glycine max]
Length=350

 Score =   226 bits (577),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 135/171 (79%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA+  FGDS VDVGNNN+++TI KA++PPYGRDF +H PTGRFCNGKLA+D TA+ 
Sbjct  23   QPLVPALFIFGDSVVDVGNNNHLYTIVKANFPPYGRDFKNHNPTGRFCNGKLASDYTAEN  82

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+SYP AYL+ +A G NLL GANFASAASGY + TA L +AIPLSQQ+E+YKE Q  L
Sbjct  83   LGFTSYPPAYLNLKAKGNNLLNGANFASAASGYYDPTAKLYHAIPLSQQLEHYKECQNIL  142

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             G  G   A+SII  ++Y++  G+SDF+QNYY+NP L KVYT DQ+   L+
Sbjct  143  VGTVGQSNASSIISGSIYLISAGNSDFIQNYYINPLLYKVYTADQFSDILL  193



>ref|XP_006482367.1| PREDICTED: GDSL esterase/lipase At5g03820-like [Citrus sinensis]
Length=347

 Score =   226 bits (576),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 134/171 (78%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA+I FGDS VDVGNNN + T+ KA++PPYGRDF +H+PTGRFCNGKLATD TA+ 
Sbjct  20   QPLVPALIIFGDSIVDVGNNNNLSTLIKANFPPYGRDFVTHRPTGRFCNGKLATDFTAEY  79

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+SYP AYLS +A G  LL G NFASAASG  ++TA L  AIPL+QQ+ YYKEYQ K+
Sbjct  80   LGFTSYPPAYLSQEAKGNILLTGVNFASAASGLYDRTAQLYRAIPLTQQLNYYKEYQNKV  139

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
              + G +KA +I    ++++  GSSDF+QNYY+NP LN+VY+PD++   L+
Sbjct  140  VSMVGKEKANAIFSGGVHLLSAGSSDFIQNYYINPLLNRVYSPDRFSDMLM  190



>emb|CBI17099.3| unnamed protein product [Vitis vinifera]
Length=1026

 Score =   238 bits (606),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 138/171 (81%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA+  FGDS+VD GNNN++ TI KA++PPYGRDF SH+PTGRFCNGKLA+D TA+ 
Sbjct  699  QPLVPAMFIFGDSAVDAGNNNHLDTIVKANFPPYGRDFISHKPTGRFCNGKLASDFTAEN  758

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            +GF+SYP AYLS +A G NLLIGANFASAASGY   TA LSNAI LS+Q+EY+KEYQ ++
Sbjct  759  IGFTSYPPAYLSKEAKGNNLLIGANFASAASGYYHTTAKLSNAISLSKQLEYFKEYQERV  818

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            A + G   A+SII  A+Y+V  GSSDFLQNYY+NP L + Y+PDQ+   L+
Sbjct  819  AKIVGKSNASSIISGAVYLVSGGSSDFLQNYYINPLLYEAYSPDQFSDLLI  869



>gb|KDO60993.1| hypothetical protein CISIN_1g036829mg [Citrus sinensis]
Length=347

 Score =   226 bits (576),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 134/171 (78%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA+I FGDS VDVGNNN + T+ KA++PPYGRDF +H+PTGRFCNGKLATD TA+ 
Sbjct  20   QPLVPALIIFGDSIVDVGNNNNLSTLIKANFPPYGRDFVTHRPTGRFCNGKLATDFTAEY  79

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+SYP AYLS +A G  LL G NFASAASG  ++TA L  AIPL+QQ+ YYKEYQ K+
Sbjct  80   LGFTSYPPAYLSQEAKGNILLTGVNFASAASGLYDRTAQLYRAIPLTQQLNYYKEYQNKV  139

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
              + G +KA +I    ++++  GSSDF+QNYY+NP LN+VY+PD++   L+
Sbjct  140  VSMVGKEKANAIFSGGVHLLSAGSSDFIQNYYINPLLNRVYSPDRFSDMLM  190



>ref|XP_003551088.1| PREDICTED: GDSL esterase/lipase At5g22810-like [Glycine max]
Length=350

 Score =   226 bits (576),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 135/171 (79%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA+  FGDS VDVGNNN+++T+ KA++PPYGRDF +H PTGRFCNGKLA+D TA+ 
Sbjct  23   QPLVPALFIFGDSVVDVGNNNHLYTVVKANFPPYGRDFKNHNPTGRFCNGKLASDYTAEN  82

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+SYP AYL+ +A G NLL GANFASAASGY + TA L +AIPLSQQ+E+YKE Q  L
Sbjct  83   LGFTSYPPAYLNLKAKGNNLLNGANFASAASGYYDPTAKLYHAIPLSQQLEHYKECQNIL  142

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             G  G   A+SII  A+Y++  G+SDF+QNYY+NP L KVYT DQ+   L+
Sbjct  143  VGTVGQPNASSIISGAIYLISAGNSDFIQNYYINPLLYKVYTADQFSDILL  193



>gb|KHN21470.1| GDSL esterase/lipase [Glycine soja]
Length=359

 Score =   226 bits (575),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 135/171 (79%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA+  FGDS VDVGNNN+++T+ KA++PPYGRDF +H PTGRFCNGKLA+D TA+ 
Sbjct  23   QPLVPALFIFGDSVVDVGNNNHLYTVVKANFPPYGRDFKNHNPTGRFCNGKLASDYTAEN  82

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+SYP AYL+ +A G NLL GANFASAASGY + TA L +AIPLSQQ+E+YKE Q  L
Sbjct  83   LGFTSYPPAYLNLKAKGNNLLNGANFASAASGYYDPTAKLYHAIPLSQQLEHYKECQNIL  142

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             G  G   A+SII  A+Y++  G+SDF+QNYY+NP L KVYT DQ+   L+
Sbjct  143  VGTVGQPNASSIISGAIYLISAGNSDFIQNYYINPLLYKVYTADQFSDILL  193



>ref|XP_006430343.1| hypothetical protein CICLE_v10013829mg [Citrus clementina]
 gb|ESR43583.1| hypothetical protein CICLE_v10013829mg [Citrus clementina]
Length=347

 Score =   225 bits (574),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 134/171 (78%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA+I FGDS VDVGNNN + T+ KA++PPYGRDF +H+PTGRFCNGKLATD TA+ 
Sbjct  20   QPLVPALIIFGDSIVDVGNNNNLSTLIKANFPPYGRDFVTHRPTGRFCNGKLATDFTAEY  79

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+SYP AYLS +A G  LL G NFASAASG  ++TA L  AIPL+QQ+ YYKEYQ K+
Sbjct  80   LGFTSYPPAYLSQEAKGNILLSGVNFASAASGLYDRTAQLYRAIPLTQQLNYYKEYQNKV  139

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
              + G +KA +I    ++++  GSSDF+QNYY+NP LN+VY+PD++   L+
Sbjct  140  VSMVGKEKANAIFSGGVHLLSAGSSDFIQNYYINPLLNRVYSPDRFSDMLM  190



>ref|XP_007150122.1| hypothetical protein PHAVU_005G128600g [Phaseolus vulgaris]
 gb|ESW22116.1| hypothetical protein PHAVU_005G128600g [Phaseolus vulgaris]
Length=350

 Score =   225 bits (574),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 134/171 (78%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA+  FGDS  DVGNNN + TI KA++PPYGRDF +H PTGRFCNGKLA+D TA+ 
Sbjct  23   QPLVPALFIFGDSVFDVGNNNQLSTIVKANFPPYGRDFNNHTPTGRFCNGKLASDYTAEN  82

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+SYP AYL+ +  GKNLL GANFASAASGY + TA L +AIPLSQQ+E+YKE Q  L
Sbjct  83   LGFTSYPPAYLNLKVKGKNLLNGANFASAASGYYDPTAKLYHAIPLSQQLEHYKESQNIL  142

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             G+AG   A+SII  A+Y++  G+SDF+QNYY+NP L KVYT DQ+   L+
Sbjct  143  MGIAGQSNASSIISGAIYLISAGNSDFIQNYYINPLLYKVYTADQFSDILM  193



>ref|XP_007027551.1| GDSL-like Lipase/Acylhydrolase family protein [Theobroma cacao]
 gb|EOY08053.1| GDSL-like Lipase/Acylhydrolase family protein [Theobroma cacao]
Length=465

 Score =   228 bits (581),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 133/170 (78%), Gaps = 0/170 (0%)
 Frame = +1

Query  100  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  279
            PLVPA+I FGDS VDVGNNN ++T+ KA++PPYGRDF +H+PTGRFCNGKLATD TA+ L
Sbjct  139  PLVPAVIIFGDSVVDVGNNNNLNTLIKANFPPYGRDFVTHRPTGRFCNGKLATDFTAEYL  198

Query  280  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  459
            GF+SYP AYLS  A G +LL GANFASAASG  ++TA L  AIPL+QQ+ YYKEYQ K+ 
Sbjct  199  GFTSYPPAYLSRDARGNDLLTGANFASAASGLYDRTANLYRAIPLTQQLNYYKEYQTKVV  258

Query  460  GVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
               G  KA  I   A++++  GSSD++QNYY+NP LN+VYTPDQ+   L+
Sbjct  259  NTVGKAKANDIFAGAIHLLSAGSSDYIQNYYINPMLNRVYTPDQFSDILI  308



>ref|NP_196002.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9LZC5.1|GDL73_ARATH RecName: Full=GDSL esterase/lipase At5g03820; AltName: Full=Extracellular 
lipase At5g03820; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB85502.1| putative protein [Arabidopsis thaliana]
 dbj|BAB08608.1| proline-rich protein APG-like [Arabidopsis thaliana]
 gb|AED90658.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=354

 Score =   224 bits (572),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 103/171 (60%), Positives = 134/171 (78%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            +PLVPA+I  GDS VD GNNN ++T+ KA++PPYGRDF +H  TGRF NGKLATD TA++
Sbjct  25   EPLVPALIIMGDSVVDAGNNNRLNTLIKANFPPYGRDFLAHNATGRFSNGKLATDFTAES  84

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+SYPV YLS +A G NLL GANFAS ASGYD+ TA+  NAI L+QQ++ YKEYQ K+
Sbjct  85   LGFTSYPVPYLSQEANGTNLLTGANFASGASGYDDGTAIFYNAITLNQQLKNYKEYQNKV  144

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
              + GS++A  I   A++++  GSSDFLQ+YY+NP LN+++TPDQY   L+
Sbjct  145  TNIVGSERANKIFSGAIHLLSTGSSDFLQSYYINPILNRIFTPDQYSDRLM  195



>gb|KHN27690.1| GDSL esterase/lipase [Glycine soja]
Length=345

 Score =   224 bits (571),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 134/171 (78%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA+  FGDS VDVGNNN+++TI KA++PPYGRD  +H PTGRFCNGKLA+D TA+ 
Sbjct  23   QPLVPALFIFGDSVVDVGNNNHLYTIVKANFPPYGRDLKNHNPTGRFCNGKLASDYTAEN  82

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+SYP AYL+ +A G NLL GANFASAASGY + TA L +AIPLSQQ+E+YKE Q  L
Sbjct  83   LGFTSYPPAYLNLKAKGNNLLNGANFASAASGYYDPTAKLYHAIPLSQQLEHYKECQNIL  142

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             G  G   A+SII  ++Y++  G+SDF+QNYY+NP L KVYT DQ+   L+
Sbjct  143  VGTVGQSNASSIISGSIYLISAGNSDFIQNYYINPLLYKVYTADQFSDILL  193



>ref|XP_010045272.1| PREDICTED: GDSL esterase/lipase At5g22810 [Eucalyptus grandis]
 gb|KCW87433.1| hypothetical protein EUGRSUZ_B03904 [Eucalyptus grandis]
Length=361

 Score =   224 bits (570),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 134/173 (77%), Gaps = 2/173 (1%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVP++  FGDS VD GNNN+++TI KA++PPYGRDF  HQPTGRFCNGK A D TA+ 
Sbjct  28   QPLVPSMFVFGDSVVDTGNNNHLYTIVKANFPPYGRDFIKHQPTGRFCNGKTAADFTAEN  87

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            +GF+SYP AYLS +A GK+LLIGANFASA+SGY + TA L + I L++Q++YYKEYQ K+
Sbjct  88   IGFTSYPPAYLSQKAKGKHLLIGANFASASSGYYDSTAKLYHTISLTEQLKYYKEYQNKI  147

Query  457  AGVAGSKKA--ASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
              +A   KA   +II D LY+V  GSSDF QNYY+NP L KVYTPDQ+   L+
Sbjct  148  IRIAAKYKANVTAIISDGLYLVSAGSSDFAQNYYINPLLYKVYTPDQFSDLLM  200



>ref|XP_010493379.1| PREDICTED: GDSL esterase/lipase At5g22810 [Camelina sativa]
Length=361

 Score =   223 bits (569),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 136/174 (78%), Gaps = 3/174 (2%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVP++  FGDS VDVGNNN ++TI KA++PPYGRDF +H+PTGRFCNGKLATD TA+ 
Sbjct  31   QPLVPSMFIFGDSVVDVGNNNEIYTIVKANFPPYGRDFTTHKPTGRFCNGKLATDFTAEN  90

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+SYP AYLS +A GKNLL GANFASAASGY + TA L +AI L QQ+E+YK+Y  ++
Sbjct  91   LGFTSYPQAYLSKKAKGKNLLTGANFASAASGYYDGTAKLYSAISLPQQLEHYKDYISRI  150

Query  457  AGVAGSK---KAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
              +A S     A++II D +YIV  GSSDF+QNYY+NP L KV +PD +  YL+
Sbjct  151  QEIAVSNNNANASAIISDGIYIVSAGSSDFIQNYYINPLLYKVQSPDDFSDYLI  204



>ref|XP_009397028.1| PREDICTED: GDSL esterase/lipase At5g03810-like [Musa acuminata 
subsp. malaccensis]
Length=347

 Score =   223 bits (567),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 132/171 (77%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            Q LVP +I FGDS VD GNNN++ T+ +A++PPYGRDFA H PTGRFCNGKLATD T + 
Sbjct  20   QGLVPGVIIFGDSVVDAGNNNHLSTLVRANFPPYGRDFAQHSPTGRFCNGKLATDFTVEN  79

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+SYP AYLS  ATG NLL GANFASAASGY + TA L  AI L+QQ++YYKEYQ K+
Sbjct  80   LGFTSYPPAYLSQDATGNNLLHGANFASAASGYLDSTANLYQAISLTQQLQYYKEYQSKV  139

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
              VAG  KAA++   A+Y++  GSSD++QNYY+NP L+  YTPDQ+   L+
Sbjct  140  ERVAGKPKAAALFAGAIYLLSAGSSDYVQNYYINPLLSGSYTPDQFSDLLL  190



>gb|KHG27777.1| hypothetical protein F383_16365 [Gossypium arboreum]
Length=352

 Score =   222 bits (566),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 135/170 (79%), Gaps = 0/170 (0%)
 Frame = +1

Query  100  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  279
            PLVPA+I FGDS VDVGNNN ++T+ K+++PPYGRDF +H+PTGRFCNGKLATD TA+ L
Sbjct  26   PLVPALIIFGDSVVDVGNNNNLNTLIKSNFPPYGRDFVTHRPTGRFCNGKLATDFTAEYL  85

Query  280  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  459
            GF+SYP AYLS  A G  LL GANFASAASG  + TA L  AI L+QQ+ YY+EYQ KL 
Sbjct  86   GFTSYPPAYLSRDAIGNALLTGANFASAASGLYDSTANLYRAITLTQQLNYYREYQAKLV  145

Query  460  GVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             +AG+  A++I+  A++++  GSSD++QNYY+NP +N++YTPDQ+   L+
Sbjct  146  NMAGNDGASNIVSGAIHLLSAGSSDYIQNYYINPLVNRIYTPDQFSDILI  195



>ref|XP_002872020.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48279.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=337

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/174 (63%), Positives = 135/174 (78%), Gaps = 3/174 (2%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA+  FGDS VDVGNNN ++TI KA++PPYGRDF +H PTGRFCNGKLATD TA+ 
Sbjct  7    QPLVPAMFIFGDSVVDVGNNNDIYTIVKANFPPYGRDFTTHTPTGRFCNGKLATDFTAEN  66

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+SYP AYLS +A GKNLLIGANFASAASGY + TA L +AI L QQ+E+YK+Y  ++
Sbjct  67   LGFTSYPQAYLSKKAKGKNLLIGANFASAASGYYDGTAKLYSAISLPQQLEHYKDYISRI  126

Query  457  AGVAGSK---KAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
              +A S     A+SII + +YIV  GSSDF+QNYY+NP L KV +PD +   L+
Sbjct  127  QEIATSNNNANASSIISNGIYIVSAGSSDFIQNYYINPLLYKVQSPDDFSDLLI  180



>ref|XP_009780981.1| PREDICTED: GDSL esterase/lipase At5g03820 [Nicotiana sylvestris]
Length=210

 Score =   217 bits (553),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 131/170 (77%), Gaps = 0/170 (0%)
 Frame = +1

Query  100  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  279
            PLVPA+  FGDS VDVGNNN + T+ KA++PPYGRDF +H+PTGRFCNGKLATD TA+ L
Sbjct  24   PLVPALCIFGDSVVDVGNNNNLSTLIKANFPPYGRDFVTHKPTGRFCNGKLATDFTAEYL  83

Query  280  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  459
            GF+SYP AYLS +A GK +L G NFASA+SGY E+TA L  A+ L  Q++YY+ +Q K+ 
Sbjct  84   GFTSYPPAYLSREARGKRILTGVNFASASSGYYERTAKLYRALTLPHQLKYYRVWQRKVV  143

Query  460  GVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             + G  KA +I   +++++  GSSDF+QNYY+NP LN+VY+PDQ+   L+
Sbjct  144  NLVGRTKANNIFSGSIHLISAGSSDFIQNYYINPLLNRVYSPDQFSDILM  193



>ref|XP_006366788.1| PREDICTED: GDSL esterase/lipase At5g03820-like [Solanum tuberosum]
Length=350

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 130/170 (76%), Gaps = 0/170 (0%)
 Frame = +1

Query  100  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  279
            PLVPA+  FGDS VDVGNNN + T+ KA++PPYGRDF +H+PTGRFCNGKLATD TAD L
Sbjct  24   PLVPALCIFGDSVVDVGNNNNLSTLIKANFPPYGRDFVTHKPTGRFCNGKLATDFTADYL  83

Query  280  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  459
            GF+SYP AYLS +A GK +L G NFASAASGY E+TA L  A+ L+ Q++YYK +Q K+ 
Sbjct  84   GFTSYPPAYLSREARGKRVLTGVNFASAASGYYERTARLFRALTLTHQLKYYKLWQRKVV  143

Query  460  GVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             + G   A +I    ++++  GSSDF+QNYY+NP LN+VY+PDQ+   L+
Sbjct  144  NLVGRTNATNIFSRGIHLISAGSSDFMQNYYINPLLNRVYSPDQFSDILM  193



>ref|XP_006338923.1| PREDICTED: GDSL esterase/lipase At5g03820-like [Solanum tuberosum]
Length=348

 Score =   221 bits (564),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/170 (59%), Positives = 134/170 (79%), Gaps = 0/170 (0%)
 Frame = +1

Query  100  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  279
            PLVPA+  FGDS VDVGNNN + T+ KA++ PYGRDF +H+PTGRFCNGKLATD TA+ L
Sbjct  22   PLVPALNIFGDSVVDVGNNNNLTTLIKANFLPYGRDFVTHRPTGRFCNGKLATDFTAEYL  81

Query  280  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  459
            GF++YP AYLSP+A G+N+L G NFASAASGY E+T  L  A+ L+QQ++YY+E+Q K+ 
Sbjct  82   GFTTYPPAYLSPEARGRNILTGVNFASAASGYYERTPQLYRALTLAQQLQYYREWQAKVV  141

Query  460  GVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             + G  +A SII   ++++  GSSDF+QNYYVNP LN++Y+PD++   L+
Sbjct  142  NLVGRTQANSIISGGIHLLSAGSSDFIQNYYVNPMLNRIYSPDRFSDILM  191



>ref|XP_004156262.1| PREDICTED: GDSL esterase/lipase At5g03810-like [Cucumis sativus]
Length=351

 Score =   221 bits (564),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 132/170 (78%), Gaps = 0/170 (0%)
 Frame = +1

Query  100  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  279
            PLVPA+  FGDS VDVGNNN + T+ KA++PPYGRDF +H PTGRFCNGKLATDITA+ L
Sbjct  26   PLVPALCIFGDSVVDVGNNNNLLTVVKANFPPYGRDFVTHAPTGRFCNGKLATDITAELL  85

Query  280  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  459
            GFSSYP AYLS  ATG  LL GANFASAASG+ + TA L +A+ L+QQ+ YYKEYQ K+ 
Sbjct  86   GFSSYPPAYLSQDATGNKLLTGANFASAASGFYDGTAQLYHAVSLTQQLNYYKEYQSKVV  145

Query  460  GVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             + G++KA +I   A++++  GSSDF+QNYYVNP L + Y+P Q+   L+
Sbjct  146  NMVGTEKANAIFSGAIHLLSAGSSDFIQNYYVNPLLYRTYSPQQFSDILI  195



>ref|XP_010098864.1| GDSL esterase/lipase [Morus notabilis]
 gb|EXB75952.1| GDSL esterase/lipase [Morus notabilis]
Length=353

 Score =   221 bits (564),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 131/170 (77%), Gaps = 0/170 (0%)
 Frame = +1

Query  100  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  279
            PLVP ++ FGDS VD GNNNY++T+ KA++PPYGRDF +H+PTGRFCNGKLATD TA+ L
Sbjct  28   PLVPGLMIFGDSVVDTGNNNYLYTLVKANFPPYGRDFVTHKPTGRFCNGKLATDFTAEYL  87

Query  280  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  459
            GF+SYP AYLSP+A GK LL GANFAS ASGY ++TA L  AI L+QQ+ YYK YQ K+ 
Sbjct  88   GFTSYPPAYLSPEAKGKKLLTGANFASGASGYYDRTAQLYRAISLTQQLNYYKAYQDKVV  147

Query  460  GVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             + G  KA  +   A++++  GSSDF+QNYY+NP LN+ YT DQ+   L+
Sbjct  148  NMVGQAKANDLFSGAIHLLSAGSSDFVQNYYINPVLNRAYTVDQFSDILM  197



>ref|XP_004143292.1| PREDICTED: GDSL esterase/lipase At5g03810-like [Cucumis sativus]
 gb|KGN48218.1| hypothetical protein Csa_6G449250 [Cucumis sativus]
Length=351

 Score =   221 bits (564),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 132/170 (78%), Gaps = 0/170 (0%)
 Frame = +1

Query  100  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  279
            PLVPA+  FGDS VDVGNNN + T+ KA++PPYGRDF +H PTGRFCNGKLATDITA+ L
Sbjct  26   PLVPALCIFGDSVVDVGNNNNLLTVVKANFPPYGRDFVTHAPTGRFCNGKLATDITAELL  85

Query  280  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  459
            GFSSYP AYLS  ATG  LL GANFASAASG+ + TA L +A+ L+QQ+ YYKEYQ K+ 
Sbjct  86   GFSSYPPAYLSQDATGNKLLTGANFASAASGFYDGTAQLYHAVSLTQQLNYYKEYQSKVV  145

Query  460  GVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             + G++KA +I   A++++  GSSDF+QNYYVNP L + Y+P Q+   L+
Sbjct  146  NMVGTEKANAIFSGAIHLLSAGSSDFIQNYYVNPLLYRTYSPQQFSDILI  195



>ref|XP_007207052.1| hypothetical protein PRUPE_ppa007967mg [Prunus persica]
 gb|EMJ08251.1| hypothetical protein PRUPE_ppa007967mg [Prunus persica]
Length=350

 Score =   221 bits (562),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 131/171 (77%), Gaps = 1/171 (1%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA+  FGDS VD GNNN V TI KA++PPYGRDF++H+PTGRFCNGKLA+D TA+ 
Sbjct  24   QPLVPALFLFGDSVVDAGNNNNVKTIIKANFPPYGRDFSNHKPTGRFCNGKLASDFTAEN  83

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LG   YP AYLS +A GKNLLIGANFASA SGY + TA L + I L+QQ+E YKEYQ K+
Sbjct  84   LGLY-YPPAYLSKEAAGKNLLIGANFASAGSGYYDSTAKLYHTISLNQQLENYKEYQNKV  142

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             G+AG     SII  A+Y+V  GSSDF+QNYY+NP L KVYT +Q+   L+
Sbjct  143  VGIAGKANLTSIISGAVYLVSAGSSDFVQNYYINPLLYKVYTANQFSDILI  193



>ref|XP_004964856.1| PREDICTED: GDSL esterase/lipase APG-like [Setaria italica]
Length=357

 Score =   221 bits (563),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 133/172 (77%), Gaps = 1/172 (1%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYV-HTIFKADYPPYGRDFASHQPTGRFCNGKLATDITAD  273
            QPLVPA+I+FGDS++DVGNNNY+   +FKADY PYG +F   +PTGRF +GK+ TDITA+
Sbjct  28   QPLVPAVISFGDSTIDVGNNNYLPRAVFKADYAPYGENFVRQEPTGRFSDGKIVTDITAE  87

Query  274  TLGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGK  453
            TLGF SY   YLSPQA+GKNLLIGANFASAAS Y + TA + +AI L+QQ++YYKEYQ K
Sbjct  88   TLGFESYAPPYLSPQASGKNLLIGANFASAASSYYDDTAAVYDAITLTQQLKYYKEYQSK  147

Query  454  LAGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            LA VAG  KA SI+  ALY+V  G+ DFLQNYY N  L++ Y  DQY   LV
Sbjct  148  LAAVAGRAKARSILTGALYVVSTGTGDFLQNYYHNASLSRRYNVDQYCDLLV  199



>ref|XP_004487544.1| PREDICTED: GDSL esterase/lipase At5g22810-like [Cicer arietinum]
Length=351

 Score =   220 bits (561),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 104/171 (61%), Positives = 133/171 (78%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA+  FGDS VD GNNN ++T+ K+++PPYGRDF  H PTGRFCNGKLA+D TA+ 
Sbjct  24   QPLVPALFIFGDSVVDAGNNNNLYTVVKSNFPPYGRDFKDHMPTGRFCNGKLASDFTAEN  83

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF++YP AYL+ +  GKNLL GANFASAASGY + TA L +AI +++Q+E+YK+ Q  L
Sbjct  84   LGFTTYPPAYLNLEVKGKNLLNGANFASAASGYYDSTAKLYHAISMTEQLEHYKDCQNIL  143

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             GVAG   A+SII  A+Y++  GSSDF+QNYY+NP L KVYT DQ+   L+
Sbjct  144  VGVAGKSNASSIISGAVYLISAGSSDFIQNYYINPLLYKVYTADQFSDILM  194



>ref|XP_006286643.1| hypothetical protein CARUB_v10002513mg [Capsella rubella]
 gb|EOA19541.1| hypothetical protein CARUB_v10002513mg [Capsella rubella]
Length=353

 Score =   220 bits (561),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 103/171 (60%), Positives = 132/171 (77%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA+I  GDS VD GNNN + T+ KA++PPYGRDF +H  TGRF NGKLATD TA++
Sbjct  25   QPLVPALIIMGDSVVDAGNNNRLGTLVKANFPPYGRDFFAHNATGRFSNGKLATDFTAES  84

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+SYPVAYLS  A G NLL GANFAS ASG+ + TALL NAI L+QQ++ YKEYQ K+
Sbjct  85   LGFTSYPVAYLSQDANGTNLLTGANFASGASGFHDGTALLYNAITLNQQLKNYKEYQNKV  144

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
              + G ++A  I   A++++  GSSDFLQ+YY+NP LN+++TPD+Y   L+
Sbjct  145  TNMVGRERANEIFSGAVHLLSTGSSDFLQSYYINPILNRIFTPDRYSDRLM  195



>ref|XP_011094449.1| PREDICTED: GDSL esterase/lipase At5g03810-like [Sesamum indicum]
Length=351

 Score =   220 bits (560),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 129/170 (76%), Gaps = 0/170 (0%)
 Frame = +1

Query  100  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  279
            PLVPA+  FGDS VD GNNN + T+ KA++PPYGRDF SH+PTGRFCNGKLATD TA+ L
Sbjct  25   PLVPALCIFGDSVVDAGNNNNLQTLIKANFPPYGRDFVSHRPTGRFCNGKLATDFTAEYL  84

Query  280  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  459
            GF+SYP AYLS +A G+N+L G NFASAASGY E T  L  A+ L++Q+EYYK++Q K+ 
Sbjct  85   GFNSYPPAYLSQEARGRNILNGVNFASAASGYYENTPQLYRALTLTRQLEYYKDWQSKVV  144

Query  460  GVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             + G  KA  I    +++V  GSSDF+QNYY+NP LN+ YTPDQ+   L+
Sbjct  145  NLVGRTKANDIFSGGIHLVSAGSSDFIQNYYINPLLNRAYTPDQFSDILM  194



>emb|CDY09169.1| BnaA02g05950D [Brassica napus]
Length=361

 Score =   220 bits (561),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 134/171 (78%), Gaps = 2/171 (1%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVP++  FGDS VDVGNNN+++TI KA++PPYGRDF +H PTGRFCNGKLATD TA+ LG
Sbjct  34   LVPSMFIFGDSVVDVGNNNHIYTIVKANFPPYGRDFTTHTPTGRFCNGKLATDFTAENLG  93

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F+SYP AYLS +A G+NLLIGANFASAASGY + TA L +AI L QQ+E+YK+Y  ++  
Sbjct  94   FTSYPQAYLSKKAKGRNLLIGANFASAASGYYDGTAKLYSAISLPQQLEHYKDYINRIQE  153

Query  463  VAGSK--KAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            +A S    A SII D +Y+V  GSSDF+QNYY+NP L KV +PD++   L+
Sbjct  154  IATSNNANATSIISDGIYVVSAGSSDFIQNYYINPLLYKVQSPDEFSDLLI  204



>emb|CDY50286.1| BnaC02g45410D [Brassica napus]
Length=360

 Score =   220 bits (560),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 134/171 (78%), Gaps = 2/171 (1%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVP++  FGDS VDVGNNN+++TI KA++PPYGRDF +H PTGRFCNGKLATD TA+ LG
Sbjct  33   LVPSMFIFGDSVVDVGNNNHIYTIVKANFPPYGRDFTTHTPTGRFCNGKLATDFTAENLG  92

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F+SYP AYLS +A G+NLLIGANFASAASGY + TA L +AI L QQ+E+YK+Y  ++  
Sbjct  93   FTSYPQAYLSKKAKGRNLLIGANFASAASGYYDGTAKLYSAISLPQQLEHYKDYINRIQE  152

Query  463  VAGSK--KAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            +A S    A SII D +Y+V  GSSDF+QNYY+NP L KV +PD++   L+
Sbjct  153  IATSSNANATSIISDGIYVVSAGSSDFIQNYYINPLLYKVQSPDEFSDLLI  203



>ref|XP_006398840.1| hypothetical protein EUTSA_v10013969mg [Eutrema salsugineum]
 gb|ESQ40293.1| hypothetical protein EUTSA_v10013969mg [Eutrema salsugineum]
Length=352

 Score =   219 bits (559),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/171 (60%), Positives = 131/171 (77%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA+I  GDS VD GNNN+ +T+ KA++PPYGRDF +H  TGRF NGKLATD TA+ 
Sbjct  24   QPLVPALIIMGDSVVDAGNNNHRNTLIKANFPPYGRDFFAHNATGRFSNGKLATDFTAEN  83

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+SYPVAYLS +A G NLL GANFAS ASG+ + TALL NAI L+QQ++ YKEYQ K+
Sbjct  84   LGFTSYPVAYLSQEANGTNLLTGANFASGASGFHDDTALLYNAITLNQQLKNYKEYQSKV  143

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
              + G  +A  I   A++++  G SDFLQ+YY+NP LN+++TPD+Y   L+
Sbjct  144  TSMVGRDRAKEIFAGAIHLLSTGPSDFLQSYYINPILNRIFTPDRYSDRLM  194



>ref|XP_006289497.1| hypothetical protein CARUB_v10003031mg [Capsella rubella]
 gb|EOA22395.1| hypothetical protein CARUB_v10003031mg [Capsella rubella]
Length=337

 Score =   219 bits (558),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 134/174 (77%), Gaps = 3/174 (2%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVP++  FGDS  DVGNNN ++TI KA++PPYGRDF +H+PTGRFCNGKLATD TA+ 
Sbjct  7    QPLVPSMFIFGDSVADVGNNNDIYTIVKANFPPYGRDFTTHKPTGRFCNGKLATDFTAEN  66

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+SYP AYLS +A G+NLLIGANFASAASGY + TA L  AI L QQ+E+YK+Y  ++
Sbjct  67   LGFTSYPQAYLSKKAKGRNLLIGANFASAASGYYDDTAKLYGAISLPQQLEHYKDYTSRI  126

Query  457  AGVAGSK---KAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
              +A S     A+SII + +YIV  GSSDF+QNYY+NP L KV +PD +   L+
Sbjct  127  QDLATSNNNVNASSIISNGIYIVSAGSSDFIQNYYINPLLYKVQSPDDFSDLLI  180



>ref|XP_008462518.1| PREDICTED: GDSL esterase/lipase At5g03820 [Cucumis melo]
Length=351

 Score =   219 bits (559),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 131/170 (77%), Gaps = 0/170 (0%)
 Frame = +1

Query  100  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  279
            PLVPA+  FGDS VDVGNNN + T+ KA++PPYGRDF +H PTGRFCNGKLATD TA+ L
Sbjct  26   PLVPALCIFGDSVVDVGNNNNLLTVVKANFPPYGRDFVTHTPTGRFCNGKLATDFTAENL  85

Query  280  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  459
            GFSSYP AYLS  ATG  LL GANFASAASG+ + TA L +A+ L+QQ+ YYKEYQ K+ 
Sbjct  86   GFSSYPPAYLSQDATGNKLLTGANFASAASGFYDGTAQLYHAVSLTQQLNYYKEYQSKVV  145

Query  460  GVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             + G++KA +I   A++++  GSSDF+QNYYVNP L + Y+P Q+   L+
Sbjct  146  NMVGTEKANAIFSGAIHLLSAGSSDFIQNYYVNPLLYRTYSPQQFSDILI  195



>ref|XP_004249641.1| PREDICTED: GDSL esterase/lipase At5g03820 [Solanum lycopersicum]
Length=348

 Score =   219 bits (558),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 134/170 (79%), Gaps = 0/170 (0%)
 Frame = +1

Query  100  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  279
            PLVPA+  FGDS VDVGNNN + T+ KA++ PYGRDF +H+PTGRFCNGKLATD TA+ L
Sbjct  22   PLVPALNIFGDSVVDVGNNNNLTTLIKANFLPYGRDFVTHRPTGRFCNGKLATDFTAEYL  81

Query  280  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  459
            GF++YP AYLSP+A G+N+L G NFASAASGY E+T  +  A+ L+QQ++YY+E+Q K+ 
Sbjct  82   GFTTYPPAYLSPEARGRNILTGVNFASAASGYYERTPQIYRALTLAQQLQYYREWQAKVV  141

Query  460  GVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             + G  +A +II   ++++  GSSDF+QNYYVNP LN++Y+PD++   L+
Sbjct  142  NLVGRTQANNIISGGIHLLSAGSSDFIQNYYVNPMLNRIYSPDRFSDILM  191



>ref|XP_010558978.1| PREDICTED: GDSL esterase/lipase At3g53100 [Tarenaya hassleriana]
Length=351

 Score =   219 bits (559),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/171 (60%), Positives = 135/171 (79%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            Q +VPAII FGDS VDVGNNN++ TI K+++PPYGRDF +  PTGRFCNGKLA D +A+ 
Sbjct  24   QSIVPAIIIFGDSIVDVGNNNFLLTIVKSNFPPYGRDFINRTPTGRFCNGKLAVDFSAEY  83

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
             GFSSYP AYLSPQATG+NLLIGANFASA+SGY + TA L  +IPL++Q+ YYKEYQ K+
Sbjct  84   TGFSSYPPAYLSPQATGQNLLIGANFASASSGYYDATAALFGSIPLTRQLNYYKEYQHKV  143

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
              + G+ +A ++   A+++V  GSSDFLQNYY++P L  +Y+PD++   L+
Sbjct  144  TNMIGTNRAHNLFSKAIHLVSAGSSDFLQNYYIDPVLKLLYSPDRFSDILM  194



>ref|NP_196001.2| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9FFN0.1|GDL72_ARATH RecName: Full=GDSL esterase/lipase At5g03810; AltName: Full=Extracellular 
lipase At5g03810; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB08607.1| proline-rich protein APG-like [Arabidopsis thaliana]
 gb|AED90657.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=353

 Score =   219 bits (558),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 131/171 (77%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            + LVPA+I  GDS VD GNNN+  T+ KA++PPYGRDF +H  TGRF NGKLATD TA+ 
Sbjct  25   ETLVPALIIMGDSVVDAGNNNHRITLVKANFPPYGRDFVAHSATGRFSNGKLATDFTAEN  84

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+SYPVAYLS +A   NLL GANFAS ASG+D+ TA+  NAI LSQQ++ YKEYQ K+
Sbjct  85   LGFTSYPVAYLSQEANETNLLTGANFASGASGFDDATAIFYNAITLSQQLKNYKEYQNKV  144

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
              + G ++A  I   A++++  GSSDFLQ+YY+NP LN+++TPDQY  +L+
Sbjct  145  TNIVGKERANEIFSGAIHLLSTGSSDFLQSYYINPILNRIFTPDQYSDHLL  195



>ref|XP_002284087.2| PREDICTED: GDSL esterase/lipase At5g03820-like [Vitis vinifera]
Length=351

 Score =   219 bits (558),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 130/170 (76%), Gaps = 0/170 (0%)
 Frame = +1

Query  100  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  279
            PLVPA+  FGDS VD GNNN + T+ KA++PPYGRDF +H+PTGRFCNGKLATD TA+ L
Sbjct  25   PLVPALCIFGDSVVDAGNNNNLATLVKANFPPYGRDFVTHRPTGRFCNGKLATDFTAEYL  84

Query  280  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  459
            GF+SYP  YLS +A GKNLL GANFASA+SGY ++TA L  AI L+QQVEYYKEYQ K+ 
Sbjct  85   GFTSYPPPYLSQEAQGKNLLQGANFASASSGYYDRTAQLYRAISLTQQVEYYKEYQAKVV  144

Query  460  GVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             + G  +A  I    ++++  GSSDF+QNYY+NP LN+ Y+ DQ+   L+
Sbjct  145  RLVGKARAHDIFSGGIHLLSAGSSDFVQNYYINPLLNRAYSADQFSDLLM  194



>ref|XP_009593509.1| PREDICTED: GDSL esterase/lipase At5g03820-like isoform X1 [Nicotiana 
tomentosiformis]
Length=351

 Score =   219 bits (558),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 132/170 (78%), Gaps = 0/170 (0%)
 Frame = +1

Query  100  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  279
            PLVPA+  FGDS VDVGNNN + T+ KA++PPYGRDF +H+PTGRFCNGKLATD TA+ L
Sbjct  25   PLVPALNIFGDSVVDVGNNNNLSTLIKANFPPYGRDFVTHRPTGRFCNGKLATDFTAEYL  84

Query  280  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  459
            GF+SYP AY SP+A GKN+L G NFASAASGY ++T  L  A+ L+QQ+  Y+E+QGK+ 
Sbjct  85   GFTSYPPAYFSPEARGKNILTGVNFASAASGYYDRTPQLYRALTLAQQLNNYREWQGKVV  144

Query  460  GVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             + G  +A +I    ++++  GSSDF+QNYY+NP LN+VY+PD++   L+
Sbjct  145  NLVGRTQANNIFSGGIHLLSAGSSDFIQNYYINPMLNRVYSPDRFSDMLM  194



>ref|NP_197672.1| GDSL esterase/lipase [Arabidopsis thaliana]
 dbj|BAB10602.1| GDSL-motif lipase/hydrolase-like protein [Arabidopsis thaliana]
 gb|AED93082.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=337

 Score =   218 bits (556),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 134/174 (77%), Gaps = 3/174 (2%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPAI  FGDS VDVGNNN ++TI KA++PPYGRDF +H PTGRFCNGKLATD TA+ 
Sbjct  7    QPLVPAIFIFGDSVVDVGNNNDIYTIVKANFPPYGRDFTTHTPTGRFCNGKLATDFTAEN  66

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF SYP AYLS +A GKNLLIGANFASAASGY + TA L +AI L QQ+E+YK+Y  ++
Sbjct  67   LGFKSYPQAYLSKKAKGKNLLIGANFASAASGYYDGTAKLYSAISLPQQLEHYKDYISRI  126

Query  457  AGVAGSK---KAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
              +A S     A++II + +YIV  GSSDF+QNYY+NP L +  +PD++   L+
Sbjct  127  QEIATSNNNSNASAIISNGIYIVSAGSSDFIQNYYINPLLYRDQSPDEFSDLLI  180



>emb|CBI30208.3| unnamed protein product [Vitis vinifera]
Length=363

 Score =   219 bits (558),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 130/170 (76%), Gaps = 0/170 (0%)
 Frame = +1

Query  100  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  279
            PLVPA+  FGDS VD GNNN + T+ KA++PPYGRDF +H+PTGRFCNGKLATD TA+ L
Sbjct  25   PLVPALCIFGDSVVDAGNNNNLATLVKANFPPYGRDFVTHRPTGRFCNGKLATDFTAEYL  84

Query  280  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  459
            GF+SYP  YLS +A GKNLL GANFASA+SGY ++TA L  AI L+QQVEYYKEYQ K+ 
Sbjct  85   GFTSYPPPYLSQEAQGKNLLQGANFASASSGYYDRTAQLYRAISLTQQVEYYKEYQAKVV  144

Query  460  GVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             + G  +A  I    ++++  GSSDF+QNYY+NP LN+ Y+ DQ+   L+
Sbjct  145  RLVGKARAHDIFSGGIHLLSAGSSDFVQNYYINPLLNRAYSADQFSDLLM  194



>sp|Q9FFC6.3|GDL78_ARATH RecName: Full=GDSL esterase/lipase At5g22810; AltName: Full=Extracellular 
lipase At5g22810; Flags: Precursor [Arabidopsis 
thaliana]
Length=362

 Score =   219 bits (557),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 134/174 (77%), Gaps = 3/174 (2%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPAI  FGDS VDVGNNN ++TI KA++PPYGRDF +H PTGRFCNGKLATD TA+ 
Sbjct  32   QPLVPAIFIFGDSVVDVGNNNDIYTIVKANFPPYGRDFTTHTPTGRFCNGKLATDFTAEN  91

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF SYP AYLS +A GKNLLIGANFASAASGY + TA L +AI L QQ+E+YK+Y  ++
Sbjct  92   LGFKSYPQAYLSKKAKGKNLLIGANFASAASGYYDGTAKLYSAISLPQQLEHYKDYISRI  151

Query  457  AGVAGSK---KAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
              +A S     A++II + +YIV  GSSDF+QNYY+NP L +  +PD++   L+
Sbjct  152  QEIATSNNNSNASAIISNGIYIVSAGSSDFIQNYYINPLLYRDQSPDEFSDLLI  205



>gb|KEH38918.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=352

 Score =   218 bits (556),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 130/171 (76%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA+  FGDS VD GNNN ++TI K+++PPYGRDF +  PTGRFCNGKLA D TA+ 
Sbjct  25   QPLVPALFIFGDSVVDAGNNNNLYTIVKSNFPPYGRDFNNQMPTGRFCNGKLAADFTAEN  84

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF++YP AYL+ Q  GKNLL GANFAS ASGY + TA L +AI L QQ+E+YKE Q  L
Sbjct  85   LGFTTYPPAYLNLQEKGKNLLNGANFASGASGYFDPTAKLYHAISLEQQLEHYKECQNIL  144

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             GVAG   A+SII  A+Y+V  GSSDF+QNYY+NP L KV+T DQ+   L+
Sbjct  145  VGVAGKSNASSIISGAIYLVSAGSSDFVQNYYINPLLYKVFTADQFSDILM  195



>gb|KCW89297.1| hypothetical protein EUGRSUZ_A01587, partial [Eucalyptus grandis]
Length=331

 Score =   218 bits (554),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 133/170 (78%), Gaps = 0/170 (0%)
 Frame = +1

Query  100  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  279
            PLVPA+  FGDS VD GNNN ++T+ KA++PPYGRDFASH PTGRFCNGKLATD TA+ L
Sbjct  5    PLVPALCIFGDSVVDAGNNNDLYTLVKANFPPYGRDFASHNPTGRFCNGKLATDFTAENL  64

Query  280  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  459
            GF+SY  AYLS +ATGKNLLIGANFASAASGY ++TA L  +I L QQ+  YK++Q K+ 
Sbjct  65   GFTSYQPAYLSREATGKNLLIGANFASAASGYLDRTAQLYQSISLPQQLNNYKDWQSKVV  124

Query  460  GVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             + G +KA +I   A++++  G+SDF+QNYY++P L+  +TPDQ+   L+
Sbjct  125  SMVGRRKANAIFSGAIHLLSAGNSDFIQNYYIDPVLSGAFTPDQFSDILL  174



>ref|XP_002436480.1| hypothetical protein SORBIDRAFT_10g003420 [Sorghum bicolor]
 gb|EER87847.1| hypothetical protein SORBIDRAFT_10g003420 [Sorghum bicolor]
Length=346

 Score =   218 bits (555),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 133/171 (78%), Gaps = 1/171 (1%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYV-HTIFKADYPPYGRDFASHQPTGRFCNGKLATDITAD  273
            QP+VPA+I+FGDS++DVGNNNY+   +FKADY PYG+DF SH+ TGRF +GK+ TDITA+
Sbjct  17   QPIVPAVISFGDSTIDVGNNNYLPGAVFKADYAPYGQDFVSHEATGRFSDGKIVTDITAE  76

Query  274  TLGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGK  453
            TLGF SY   YLSPQA+GKNLLIGANFASAAS Y + TA + +AI L+QQ++YYKEYQ K
Sbjct  77   TLGFESYAPPYLSPQASGKNLLIGANFASAASSYYDDTAAMYDAITLTQQLKYYKEYQSK  136

Query  454  LAGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYL  606
            L  VAG  KA +I+ DALY+V  G+ DFLQNYY N  L++ Y   QY   L
Sbjct  137  LGAVAGRAKAGAILADALYVVSTGTGDFLQNYYHNASLSRRYNVHQYCDLL  187



>gb|KFK27616.1| hypothetical protein AALP_AA8G406700 [Arabis alpina]
Length=364

 Score =   218 bits (556),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 133/174 (76%), Gaps = 3/174 (2%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            Q LVP++  FGDS VDVGNNN ++TI KA++PPYGRDF  HQPTGRFCNGKLATD TA+ 
Sbjct  34   QSLVPSMFIFGDSVVDVGNNNNIYTIVKANFPPYGRDFTRHQPTGRFCNGKLATDFTAEN  93

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+SYP AYLS +A GKNLLIGANFASAASGY + TA L +AI L+QQ+E+YK+Y  ++
Sbjct  94   LGFTSYPQAYLSKKAKGKNLLIGANFASAASGYYDGTAKLYSAISLAQQLEHYKDYTNRI  153

Query  457  AGVAGSK---KAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
              +A S     A SII + +YIV  GSSDF+QNYY+NP L KV T D +   L+
Sbjct  154  QEMAISNNTINATSIISNGIYIVSAGSSDFIQNYYINPLLYKVQTLDDFSDQLI  207



>ref|XP_009776666.1| PREDICTED: GDSL esterase/lipase At5g03820-like [Nicotiana sylvestris]
Length=351

 Score =   218 bits (555),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 132/170 (78%), Gaps = 0/170 (0%)
 Frame = +1

Query  100  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  279
            PLVPA+  FGDS VDVGNNN + T+ KA++PPYGRDF +H+PTGRFCNGKLATD TA+ L
Sbjct  25   PLVPALNIFGDSVVDVGNNNNLSTLIKANFPPYGRDFVTHRPTGRFCNGKLATDFTAEYL  84

Query  280  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  459
            GF+SYP AY SP+A GKN++ G NFASAASGY ++T  L  A+ L+QQ+  Y+E+QGK+ 
Sbjct  85   GFTSYPPAYFSPEARGKNIITGVNFASAASGYYDRTPQLYRALTLAQQLNNYREWQGKVV  144

Query  460  GVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             + G  +A +I    ++++  GSSDF+QNYY+NP LN+VY+PD++   L+
Sbjct  145  NLVGRTQANNIFSGGIHLLSAGSSDFIQNYYINPMLNRVYSPDRFSDMLM  194



>ref|XP_010050200.1| PREDICTED: GDSL esterase/lipase At5g03820 [Eucalyptus grandis]
Length=351

 Score =   218 bits (554),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 133/170 (78%), Gaps = 0/170 (0%)
 Frame = +1

Query  100  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  279
            PLVPA+  FGDS VD GNNN ++T+ KA++PPYGRDFASH PTGRFCNGKLATD TA+ L
Sbjct  25   PLVPALCIFGDSVVDAGNNNDLYTLVKANFPPYGRDFASHNPTGRFCNGKLATDFTAENL  84

Query  280  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  459
            GF+SY  AYLS +ATGKNLLIGANFASAASGY ++TA L  +I L QQ+  YK++Q K+ 
Sbjct  85   GFTSYQPAYLSREATGKNLLIGANFASAASGYLDRTAQLYQSISLPQQLNNYKDWQSKVV  144

Query  460  GVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             + G +KA +I   A++++  G+SDF+QNYY++P L+  +TPDQ+   L+
Sbjct  145  SMVGRRKANAIFSGAIHLLSAGNSDFIQNYYIDPVLSGAFTPDQFSDILL  194



>ref|XP_009126566.1| PREDICTED: GDSL esterase/lipase At5g22810 [Brassica rapa]
Length=361

 Score =   218 bits (555),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 133/171 (78%), Gaps = 2/171 (1%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVP++  FGDS VDVGNNN+++TI KA++PPYGRDF +H PTGRFCNGKLATD TA+ LG
Sbjct  34   LVPSMFIFGDSVVDVGNNNHIYTIVKANFPPYGRDFTTHTPTGRFCNGKLATDFTAENLG  93

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F+SYP AYLS +A G+NLLIGANFASAAS Y + TA L +AI L QQ+E+YK+Y  ++  
Sbjct  94   FTSYPQAYLSKKAKGRNLLIGANFASAASAYYDGTAKLYSAISLPQQLEHYKDYINRIQE  153

Query  463  VAGSK--KAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            +A S    A SII D +Y+V  GSSDF+QNYY+NP L KV +PD++   L+
Sbjct  154  IATSNNANATSIISDGIYVVSAGSSDFIQNYYINPLLYKVQSPDEFSDLLI  204



>ref|XP_010923281.1| PREDICTED: GDSL esterase/lipase At5g03810-like [Elaeis guineensis]
Length=358

 Score =   217 bits (553),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 125/171 (73%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            Q LVP +I FGDS VDVGNNN+  T+ KAD+PPYGRDF  H PTGRFCNGKLATD T + 
Sbjct  31   QSLVPGVIIFGDSVVDVGNNNHRLTLVKADFPPYGRDFIHHTPTGRFCNGKLATDFTVEN  90

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+SYP AYLS QA GKNLL G NF S ASGY E T++L N I L QQ+  YK+Y+ K+
Sbjct  91   LGFTSYPPAYLSEQARGKNLLSGVNFGSGASGYLESTSILYNVISLDQQLRNYKDYRSKV  150

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
              +AG   A ++   ++Y+V  G+SD++QNYY+NP LN+ Y PDQ+   LV
Sbjct  151  ERIAGRTNATALFTGSIYVVTTGTSDYVQNYYINPLLNRAYNPDQFADLLV  201



>ref|XP_010933399.1| PREDICTED: GDSL esterase/lipase At5g03810-like [Elaeis guineensis]
Length=358

 Score =   217 bits (553),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/171 (60%), Positives = 130/171 (76%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            Q LVP ++ FGDS VDVGNNN   T+ KA++PPYGRDFA+H PTGRFCNGKLATD T + 
Sbjct  31   QGLVPGVMIFGDSVVDVGNNNNRLTLVKANFPPYGRDFANHIPTGRFCNGKLATDFTVEN  90

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+SYP AYLS QATGKNLL GANFAS ASGY + T+ L  AI L+QQ+  YK+YQ K+
Sbjct  91   LGFTSYPPAYLSEQATGKNLLSGANFASGASGYLDSTSTLYGAISLNQQLRNYKDYQSKV  150

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
              VAG   A ++   ++Y+V  G+SDF+QNYY+NP +N+ YTPD++   +V
Sbjct  151  EKVAGRANATALFTGSIYVVSAGASDFVQNYYINPVVNRAYTPDRFADLVV  201



>ref|XP_009589481.1| PREDICTED: GDSL esterase/lipase At5g03820-like [Nicotiana tomentosiformis]
Length=350

 Score =   217 bits (552),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 131/170 (77%), Gaps = 0/170 (0%)
 Frame = +1

Query  100  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  279
            PLVPA+  FGDS VDVGNNN + T+ KA++PPYGRDF +H+PTGRFCNGKLATD TA+ L
Sbjct  24   PLVPALCIFGDSVVDVGNNNNLSTLIKANFPPYGRDFVTHRPTGRFCNGKLATDFTAEYL  83

Query  280  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  459
            GF+SYP AYLS +A GK +L G NFASA+SGY E+TA L  A+ L  Q++YY+ +Q K+ 
Sbjct  84   GFTSYPPAYLSREARGKRILTGINFASASSGYYERTANLYRALTLPHQLKYYRVWQRKVV  143

Query  460  GVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             + G  KA +I   +++++  GSSDF+QNYY+NP LN+VY+PDQ+   L+
Sbjct  144  NLVGRTKANNIFSGSIHLISAGSSDFIQNYYINPLLNRVYSPDQFSDILM  193



>ref|XP_010092821.1| GDSL esterase/lipase [Morus notabilis]
 gb|EXB52561.1| GDSL esterase/lipase [Morus notabilis]
Length=303

 Score =   215 bits (548),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 134/169 (79%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPA+  FGDS +DVGNNN++ T+ KA++PPYGRDF +H PTGRF NGK++ DI A+TLG
Sbjct  22   LVPALFIFGDSVMDVGNNNHLPTLIKANFPPYGRDFFNHTPTGRFSNGKISADIIAETLG  81

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F+SY  AYLS +A G+NLLIGANFASAASGY E TA  + AIPLS+Q++ YKEYQGK+A 
Sbjct  82   FASYQPAYLSSEAKGENLLIGANFASAASGYYEPTANSNLAIPLSKQLDNYKEYQGKVAE  141

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            + G+  A S++   +Y++  G+SDF+QNYY+NP LN  YTPDQ+ + LV
Sbjct  142  IIGAANATSLLSSGIYLLSAGNSDFVQNYYINPLLNSAYTPDQFSNILV  190



>ref|XP_010683957.1| PREDICTED: GDSL esterase/lipase At5g03820 [Beta vulgaris subsp. 
vulgaris]
Length=354

 Score =   217 bits (552),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 129/171 (75%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            +PLVP +  FGDS  D GNNN ++TI KA++PPYGRDF +H PTGRFCNGK+ATD TA+ 
Sbjct  27   EPLVPILCIFGDSVADTGNNNGLYTIIKANFPPYGRDFVTHTPTGRFCNGKIATDFTAEN  86

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGFS+YP +YL+  A G NLLIGANFASA SGY E TA L  AI L+QQ+ YYKEYQ K+
Sbjct  87   LGFSAYPPSYLTQAAQGNNLLIGANFASAGSGYSETTANLYRAISLTQQLGYYKEYQSKV  146

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
              + GS++A  +    ++I+  G+SD++QNYY+NPY+ + YTPDQY   L+
Sbjct  147  TKMVGSERANKMFSGGIHILSAGASDYIQNYYINPYVYRQYTPDQYADLLM  197



>ref|XP_004246904.1| PREDICTED: GDSL esterase/lipase At5g03820-like [Solanum lycopersicum]
Length=350

 Score =   216 bits (551),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 100/170 (59%), Positives = 130/170 (76%), Gaps = 0/170 (0%)
 Frame = +1

Query  100  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  279
            PLVPA+  FGDS VDVGNNN + T+ KA++PPYGRDF +H+PTGRFCNGKLATD TA+ L
Sbjct  24   PLVPALCIFGDSVVDVGNNNNLSTLIKANFPPYGRDFVNHKPTGRFCNGKLATDYTAEYL  83

Query  280  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  459
            GF+SYP AYLS +A GK +L G NFASAASGY E+TA L  A+ L++Q++YYK +Q K+ 
Sbjct  84   GFTSYPPAYLSREARGKKVLTGVNFASAASGYYERTARLFRALTLTRQLKYYKLWQRKVV  143

Query  460  GVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             + G   A +I    ++I+  GSSDF+QNYY+NP LN+VY+P Q+   L+
Sbjct  144  NLVGRTNATNIFSRGIHILSAGSSDFMQNYYINPLLNRVYSPAQFSDILM  193



>ref|XP_002528628.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF33731.1| zinc finger protein, putative [Ricinus communis]
Length=352

 Score =   216 bits (550),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/170 (59%), Positives = 132/170 (78%), Gaps = 0/170 (0%)
 Frame = +1

Query  100  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  279
            P+VPA+I FGDS VDVGNNN ++T+ KA++PPYGRDF +H+PTGRFCNGKLATD TA+ L
Sbjct  26   PIVPALIIFGDSVVDVGNNNNLNTLIKANFPPYGRDFVTHRPTGRFCNGKLATDFTAEYL  85

Query  280  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  459
            GF+SYP AYLS  A G+N+L G NFASAASG  + TA L +A+ L++Q+ YYKEYQ K+ 
Sbjct  86   GFTSYPPAYLSQDAQGRNILTGVNFASAASGLYDGTATLYSAVSLTRQLNYYKEYQTKVV  145

Query  460  GVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             + G  KA  I   A++++  GSSDF+QNYY+NP +N +YTPD++   L+
Sbjct  146  IMVGQAKANDIFAGAIHLLSAGSSDFIQNYYINPLINGIYTPDRFSDNLI  195



>ref|XP_009125521.1| PREDICTED: GDSL esterase/lipase At5g03820-like [Brassica rapa]
Length=406

 Score =   217 bits (552),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 130/171 (76%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA+I  GDS VD GNNN+  T+ KA++PPYGRDF +H  TGRF NGKL  D TA++
Sbjct  78   QPLVPALIIIGDSVVDAGNNNHRTTLIKANFPPYGRDFFAHNSTGRFSNGKLVIDFTAES  137

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+SYPVAYLS  A G NLL GANFAS ASG+D+ T+LL NAI L+QQ++ YKEY+ K+
Sbjct  138  LGFTSYPVAYLSQDANGTNLLTGANFASGASGFDDGTSLLYNAITLNQQLKNYKEYKIKV  197

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
              + G  +A  I   A+Y++  GSSDFLQ+YY+NP LN+++TPD+Y   L+
Sbjct  198  TNMVGRDRANEIFSGAIYLLSTGSSDFLQSYYINPILNRIFTPDRYSDRLM  248



>ref|XP_004303055.1| PREDICTED: GDSL esterase/lipase At5g03810-like [Fragaria vesca 
subsp. vesca]
Length=350

 Score =   214 bits (546),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 131/170 (77%), Gaps = 1/170 (1%)
 Frame = +1

Query  100  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  279
            PLVPA+  FGDS VDVGNNN + T+ KA++PPYGRDF +H+PTGRFCNGKLATD TA+ L
Sbjct  26   PLVPALFIFGDSVVDVGNNNNLSTVIKANFPPYGRDFVNHKPTGRFCNGKLATDFTAEYL  85

Query  280  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  459
            GF++Y  AYLS +A+GKNLL GANFASAASG+ + TALL N+I L+QQ+  YKEYQ K+ 
Sbjct  86   GFTTYQPAYLSQEASGKNLLTGANFASAASGFYDPTALLYNSISLTQQLNNYKEYQSKVV  145

Query  460  GVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             + G  KA +I    ++++  GSSDF+QNYY+ P L  VYTPDQ+   L+
Sbjct  146  NLVGQTKANAIFSGGIHLLSAGSSDFIQNYYITP-LATVYTPDQFSDILI  194



>ref|XP_009340968.1| PREDICTED: GDSL esterase/lipase At5g03820-like [Pyrus x bretschneideri]
Length=350

 Score =   214 bits (546),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 132/171 (77%), Gaps = 1/171 (1%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            +PLVPA+I FGDS  DVGNNN + T  KA++PPYGRDF +H+PTGRFCNGKLATD TA+ 
Sbjct  24   EPLVPALIIFGDSVADVGNNNNLTTPIKANFPPYGRDFVTHRPTGRFCNGKLATDFTAEY  83

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+SYP AYLSP+A G+NLL G NFASAASGY + T  L NA+ L+QQ+ YY++YQ  +
Sbjct  84   LGFTSYPPAYLSPEAKGQNLLTGVNFASAASGYWDYTPFLYNALSLTQQLNYYRQYQNAV  143

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
              + GS  A++I   A++++  G SDF+QNYY+NP L ++Y+PDQ  + L+
Sbjct  144  VSMVGSDNASAIFSGAIHLLSAGISDFIQNYYINPLL-RIYSPDQLSNILI  193



>ref|XP_010452277.1| PREDICTED: GDSL esterase/lipase At5g03820 [Camelina sativa]
Length=350

 Score =   214 bits (545),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 128/171 (75%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA+I  GDS VD GNNN + T+ KA++PPYGRDF  H  TGRF NGK+ATD TA+ 
Sbjct  22   QPLVPALIIMGDSVVDAGNNNRLTTLVKANFPPYGRDFFDHNATGRFTNGKIATDFTAEN  81

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+SY V YLS  A G NLL GANFAS ASG+ + TALL NAI L+QQ++ YKEYQ K+
Sbjct  82   LGFTSYTVPYLSQDANGTNLLTGANFASGASGFLDATALLYNAITLNQQLKNYKEYQTKV  141

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
              + G ++A  I   A++++  GSSDFLQ+YY+NP LN+++TPD+Y   L+
Sbjct  142  MNIVGRERANEIFSRAIHLLSTGSSDFLQSYYINPILNRIFTPDRYSDRLM  192



>ref|XP_006369216.1| hypothetical protein POPTR_0001s19240g [Populus trichocarpa]
 gb|ERP65785.1| hypothetical protein POPTR_0001s19240g [Populus trichocarpa]
Length=329

 Score =   213 bits (543),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 124/168 (74%), Gaps = 24/168 (14%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            L PAII+FGDSSVDVGNNN++ TIFKA+YPPYGRDFA+H+PTGRFCNGKL  DITA+ LG
Sbjct  27   LFPAIISFGDSSVDVGNNNHLSTIFKANYPPYGRDFANHKPTGRFCNGKLTIDITAEALG  86

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F +Y  AYLSP+A+GKNLLIG NFASAASGYD+KTA L+NAIPLS Q++++KEYQ KL  
Sbjct  87   FKTYAPAYLSPEASGKNLLIGVNFASAASGYDDKTAFLNNAIPLSLQLKHFKEYQTKLVK  146

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYL  606
            VAG                            NP +NKVYTPDQY SYL
Sbjct  147  VAGE------------------------LLCNPSVNKVYTPDQYSSYL  170



>emb|CDY04898.1| BnaAnng00800D [Brassica napus]
Length=350

 Score =   214 bits (544),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 128/171 (75%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA+I  GDS VD GNNN+     KA++PPYGRDF +H  TGRF NGKL  D TA++
Sbjct  22   QPLVPALIIMGDSVVDAGNNNHRTIFIKANFPPYGRDFFAHNSTGRFSNGKLVIDFTAES  81

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+SYPVAYLS  A G NLL GANFAS ASG+D+ T+LL NAI L+QQ++ YKEY+ K+
Sbjct  82   LGFTSYPVAYLSQDANGTNLLTGANFASGASGFDDGTSLLYNAITLNQQLKNYKEYKIKV  141

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
              + G  +A  I   A+Y++  GSSDFLQ+YY+NP LN+++TPD+Y   L+
Sbjct  142  TNMVGRDRANEIFSGAIYLLSTGSSDFLQSYYINPILNRIFTPDRYSDRLM  192



>ref|XP_009389038.1| PREDICTED: GDSL esterase/lipase At5g03810-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=396

 Score =   215 bits (547),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 96/171 (56%), Positives = 130/171 (76%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            Q LVP +I FGDS+VDVGNNN++ T+ KA++PPYGRDF  H PTGRFCNGKL TD   + 
Sbjct  66   QGLVPGVIIFGDSTVDVGNNNHLLTLVKANFPPYGRDFPHHSPTGRFCNGKLVTDFVVEV  125

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+++P AYLS +ATG NLL GANFASA+SGY + TA L  A+ L++Q+ Y+++YQ K+
Sbjct  126  LGFTTHPPAYLSKEATGNNLLNGANFASASSGYLDATASLYQAVSLTRQLRYFEQYQAKV  185

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
              +AG   A ++  D++Y++  GSSDFLQNYY+NP L  +Y+PDQ+   L+
Sbjct  186  KSIAGKATATALFADSIYVLSAGSSDFLQNYYINPLLRAIYSPDQFSGLLL  236



>ref|XP_010490874.1| PREDICTED: GDSL esterase/lipase At5g03820-like [Camelina sativa]
Length=350

 Score =   213 bits (543),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 127/171 (74%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA+I  GDS VD GNNN + T+ KA++PPYGRDF  H  TGRF NGKLATD TA+ 
Sbjct  22   QPLVPALIIMGDSVVDAGNNNRLTTLVKANFPPYGRDFFDHNATGRFTNGKLATDFTAEN  81

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+SYPV YLS  A G NLL GANFAS ASG+ + TALL NAI L+QQ++ YKEYQ K+
Sbjct  82   LGFTSYPVPYLSQDANGTNLLTGANFASGASGFLDATALLYNAITLNQQLKNYKEYQTKV  141

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
              + G ++A      A++++  G SDFLQ+YY+NP LN+++TPD+Y   L+
Sbjct  142  TNIVGRERANETFSRAIHLLSTGPSDFLQSYYINPILNRIFTPDRYSHRLM  192



>ref|XP_010100155.1| GDSL esterase/lipase [Morus notabilis]
 gb|EXB81606.1| GDSL esterase/lipase [Morus notabilis]
Length=353

 Score =   213 bits (543),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 101/169 (60%), Positives = 130/169 (77%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPA+  FGDS VDVGNNN + TI KA++PPYGRDF +H+PTGRF NGKLATD  A+ L 
Sbjct  28   LVPAMFIFGDSVVDVGNNNQLATIIKANFPPYGRDFFNHRPTGRFTNGKLATDFVAEALS  87

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F+SY  AYLS QA G+NLLIGANFASA+SGY + TA L + +PLS+Q+  YKEYQG++ G
Sbjct  88   FTSYQPAYLSRQARGRNLLIGANFASASSGYLDATANLYHTVPLSRQLNNYKEYQGRVVG  147

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            + G+  A S+    +Y++  GSSDF+QNYYVNP L+  YTP+Q+ + L+
Sbjct  148  ILGAANATSLFSSGIYLISAGSSDFVQNYYVNPLLHNTYTPEQFTNILM  196



>ref|XP_009389037.1| PREDICTED: GDSL esterase/lipase At5g03810-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=401

 Score =   215 bits (547),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 96/171 (56%), Positives = 130/171 (76%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            Q LVP +I FGDS+VDVGNNN++ T+ KA++PPYGRDF  H PTGRFCNGKL TD   + 
Sbjct  66   QGLVPGVIIFGDSTVDVGNNNHLLTLVKANFPPYGRDFPHHSPTGRFCNGKLVTDFVVEV  125

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+++P AYLS +ATG NLL GANFASA+SGY + TA L  A+ L++Q+ Y+++YQ K+
Sbjct  126  LGFTTHPPAYLSKEATGNNLLNGANFASASSGYLDATASLYQAVSLTRQLRYFEQYQAKV  185

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
              +AG   A ++  D++Y++  GSSDFLQNYY+NP L  +Y+PDQ+   L+
Sbjct  186  KSIAGKATATALFADSIYVLSAGSSDFLQNYYINPLLRAIYSPDQFSGLLL  236



>ref|XP_003538180.1| PREDICTED: GDSL esterase/lipase At5g22810 [Glycine max]
Length=353

 Score =   213 bits (543),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 134/171 (78%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPAI  FGDS VDVGNNN+  TI KA++PPYGRDF +H PTGRFCNGKLATD  AD 
Sbjct  26   QPLVPAIFTFGDSIVDVGNNNHQLTIVKANFPPYGRDFENHFPTGRFCNGKLATDFIADI  85

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+SY  AYL+ +  GKNLL GANFASA+SGY E T+ L ++IPLS+Q+EYYKE Q KL
Sbjct  86   LGFTSYQPAYLNLKTKGKNLLNGANFASASSGYFELTSKLYSSIPLSKQLEYYKECQTKL  145

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
               AG   A+SII DA+Y++  G+SDF+QNYY+NP LNK+YT DQ+   L+
Sbjct  146  VEAAGQSSASSIISDAIYLISAGTSDFVQNYYINPLLNKLYTTDQFSDTLL  196



>ref|XP_006400789.1| hypothetical protein EUTSA_v10015700mg [Eutrema salsugineum]
 gb|ESQ42242.1| hypothetical protein EUTSA_v10015700mg [Eutrema salsugineum]
Length=336

 Score =   213 bits (541),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 134/176 (76%), Gaps = 5/176 (3%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVP++  FGDS VDVGNNN+++TI KA++PPYGRDF +H+PTGRFCNGKLATD TA+ 
Sbjct  4    QPLVPSMFIFGDSVVDVGNNNHIYTIVKANFPPYGRDFTTHKPTGRFCNGKLATDFTAEN  63

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+SYP AYLS +A G+NLLIGANFASAASGY + TA L +AI L QQ+E+YK+Y  ++
Sbjct  64   LGFTSYPQAYLSKKAKGRNLLIGANFASAASGYYDGTAKLYSAISLPQQLEHYKDYISQI  123

Query  457  AGV-----AGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
              +     + +    SII D +YIV  GSSDF+QNYY+NP L K  + D++   L+
Sbjct  124  QELANSNNSKNANVTSIISDGIYIVSAGSSDFIQNYYINPLLYKAQSSDEFSDLLI  179



>ref|XP_008794047.1| PREDICTED: GDSL esterase/lipase At5g03810-like [Phoenix dactylifera]
Length=359

 Score =   213 bits (541),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 127/171 (74%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            Q LVP ++ FGDS VDVGNNN   T+ KA++PPYGRDF  H PTGRFCNGKLATD T + 
Sbjct  32   QGLVPGVVIFGDSVVDVGNNNNRLTLVKANFPPYGRDFVDHAPTGRFCNGKLATDFTVEN  91

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+SYP AYLS QATGKNLL GANFAS  +GY + T+ L  AI L+QQ+  YK+YQ K+
Sbjct  92   LGFTSYPPAYLSEQATGKNLLSGANFASGGAGYLDSTSTLYGAISLNQQLRNYKDYQSKV  151

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
              +AG   A ++   ++Y+V  G+SD++QNYY+NP LN+ YTPDQ+   ++
Sbjct  152  ERIAGKANATALFAGSIYVVSAGASDYVQNYYINPVLNRAYTPDQFADLVL  202



>gb|KJB16733.1| hypothetical protein B456_002G245100 [Gossypium raimondii]
Length=295

 Score =   211 bits (536),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 134/170 (79%), Gaps = 0/170 (0%)
 Frame = +1

Query  100  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  279
            PLVPA+I FGDS VDVGNNN ++T+ K+++PPYGRDF +H+PTGRFCNGKLATD TA+ L
Sbjct  26   PLVPALIIFGDSVVDVGNNNNLNTLIKSNFPPYGRDFVNHRPTGRFCNGKLATDFTAEYL  85

Query  280  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  459
            GF+SYP AYLS  A G  LL GANFASAASG  + TA L  AI L+QQ+ YY+EYQ KL 
Sbjct  86   GFTSYPPAYLSRDAIGNALLTGANFASAASGLYDSTANLYRAITLTQQLNYYREYQTKLV  145

Query  460  GVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             +AG+  A +II  A++++  GSSD++QNYY+NP ++++YTPDQ+   L+
Sbjct  146  NMAGNNGANNIISGAIHLLSAGSSDYIQNYYINPLVSRIYTPDQFSDILI  195



>gb|KDP29224.1| hypothetical protein JCGZ_16613 [Jatropha curcas]
Length=353

 Score =   212 bits (540),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 131/171 (77%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            +P+VPA+I FGDS VDVGNNN ++T+ KA++ PYGRDF +H+PTGRFCNGKLATD TA+ 
Sbjct  26   EPIVPALIIFGDSVVDVGNNNNLNTVVKANFLPYGRDFVTHRPTGRFCNGKLATDFTAEY  85

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+SYP AYLS  A G N+L G NFASAASG+ + TA L  AI L+QQ+ YY+EY+ K+
Sbjct  86   LGFTSYPPAYLSQDAKGSNILTGVNFASAASGFYDGTARLYGAIALTQQLNYYREYKRKV  145

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
              + G  KA  I   A++++  GSSDF+QNYY+NP LN +Y+PD++   L+
Sbjct  146  VDMVGQTKANDIFSGAIHLLSAGSSDFIQNYYINPLLNGIYSPDRFSDNLL  196



>emb|CDX80889.1| BnaC03g01430D [Brassica napus]
Length=353

 Score =   212 bits (539),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/172 (60%), Positives = 127/172 (74%), Gaps = 1/172 (1%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA+I  GDS VD GNNN   T+ KA++PPYGRDF +H  TGRF NGKLA D TA+ 
Sbjct  22   QPLVPALIIMGDSVVDAGNNNLRLTLVKANFPPYGRDFLAHTATGRFSNGKLAIDFTAEN  81

Query  277  LGFSSYPVAYLSPQATGK-NLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGK  453
            LGF+SYPVAYLS  A  + NLL GANFAS ASGY + T+LL NAI L+QQVE YKEYQ K
Sbjct  82   LGFTSYPVAYLSQDAANETNLLTGANFASGASGYHDGTSLLYNAISLTQQVENYKEYQSK  141

Query  454  LAGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            +  + G  KA  I K A++++  GSSDFLQ+YY+NP LN + TPD++   L+
Sbjct  142  VTSIVGKDKANEIFKGAIHLLSTGSSDFLQSYYINPILNVIVTPDRFSDRLM  193



>ref|XP_004155946.1| PREDICTED: GDSL esterase/lipase APG-like [Cucumis sativus]
Length=366

 Score =   212 bits (540),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 135/169 (80%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            + PAI  FGDS++D+GNNN   T+FKA+Y PYG+DF +H+PTGRFCNGKL +DITA+TLG
Sbjct  40   IFPAIFTFGDSALDMGNNNNRFTMFKANYLPYGQDFTNHKPTGRFCNGKLVSDITAETLG  99

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F +YP  YLSP+A+G+NLLIG+ FASAA+GYDE+ ++ + AI LSQQ+  YKEYQ K+A 
Sbjct  100  FQTYPPPYLSPEASGRNLLIGSGFASAAAGYDEQASISNRAITLSQQLGNYKEYQRKVAM  159

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            V G ++A +I+ + L+I+  G+ D+L+NYY+NP + + +TP +Y S+LV
Sbjct  160  VVGDEEAGAIVANGLHILSCGTGDYLRNYYINPGVRRRFTPYEYSSFLV  208



>ref|XP_009130783.1| PREDICTED: GDSL esterase/lipase At5g03810-like isoform X1 [Brassica 
rapa]
Length=353

 Score =   212 bits (539),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/172 (60%), Positives = 127/172 (74%), Gaps = 1/172 (1%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA+I  GDS VD GNNN   T+ KA++PPYGRDF +H  TGRF NGKLA D TA+ 
Sbjct  22   QPLVPALIIMGDSVVDAGNNNLRLTLVKANFPPYGRDFLAHTATGRFSNGKLAIDFTAEN  81

Query  277  LGFSSYPVAYLSPQATGK-NLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGK  453
            LGF+SYPVAYLS  A  + NLL GANFAS ASGY + T+LL NAI L+QQVE YKEYQ K
Sbjct  82   LGFTSYPVAYLSQDAANETNLLTGANFASGASGYHDGTSLLYNAISLTQQVENYKEYQSK  141

Query  454  LAGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            +  + G  KA  I K A++++  GSSDFLQ+YY+NP LN + TPD++   L+
Sbjct  142  VTSMVGRDKANEIFKGAIHLLSTGSSDFLQSYYINPILNAIVTPDRFSDRLM  193



>ref|XP_009130784.1| PREDICTED: GDSL esterase/lipase At5g03810-like isoform X2 [Brassica 
rapa]
Length=353

 Score =   211 bits (538),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/172 (60%), Positives = 127/172 (74%), Gaps = 1/172 (1%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA+I  GDS VD GNNN   T+ KA++PPYGRDF +H  TGRF NGKLA D TA+ 
Sbjct  22   QPLVPALIIMGDSVVDAGNNNLRLTLVKANFPPYGRDFLAHTATGRFSNGKLAIDFTAEN  81

Query  277  LGFSSYPVAYLSPQATGK-NLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGK  453
            LGF+SYPVAYLS  A  + NLL GANFAS ASGY + T+LL NAI L+QQVE YKEYQ K
Sbjct  82   LGFTSYPVAYLSQDAANETNLLTGANFASGASGYHDGTSLLYNAISLTQQVENYKEYQSK  141

Query  454  LAGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            +  + G  KA  I K A++++  GSSDFLQ+YY+NP LN + TPD++   L+
Sbjct  142  VTSMVGRDKANEIFKGAIHLLSTGSSDFLQSYYINPILNAIVTPDRFSDRLM  193



>gb|KJB16732.1| hypothetical protein B456_002G245100 [Gossypium raimondii]
Length=352

 Score =   211 bits (538),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 134/170 (79%), Gaps = 0/170 (0%)
 Frame = +1

Query  100  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  279
            PLVPA+I FGDS VDVGNNN ++T+ K+++PPYGRDF +H+PTGRFCNGKLATD TA+ L
Sbjct  26   PLVPALIIFGDSVVDVGNNNNLNTLIKSNFPPYGRDFVNHRPTGRFCNGKLATDFTAEYL  85

Query  280  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  459
            GF+SYP AYLS  A G  LL GANFASAASG  + TA L  AI L+QQ+ YY+EYQ KL 
Sbjct  86   GFTSYPPAYLSRDAIGNALLTGANFASAASGLYDSTANLYRAITLTQQLNYYREYQTKLV  145

Query  460  GVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             +AG+  A +II  A++++  GSSD++QNYY+NP ++++YTPDQ+   L+
Sbjct  146  NMAGNNGANNIISGAIHLLSAGSSDYIQNYYINPLVSRIYTPDQFSDILI  195



>emb|CDP15327.1| unnamed protein product [Coffea canephora]
Length=352

 Score =   211 bits (536),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 100/170 (59%), Positives = 128/170 (75%), Gaps = 0/170 (0%)
 Frame = +1

Query  100  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  279
            PLVPA+  FGDS VDVGNNN + T+ KA++PPYGRDF  H+PTGRFCNGKLATD TA+ L
Sbjct  26   PLVPALCIFGDSVVDVGNNNNLPTLIKANFPPYGRDFLGHRPTGRFCNGKLATDYTAEYL  85

Query  280  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  459
            GF +YP AYLS +A G ++L G NFASAASGY + TA L  AI L+QQ++YYKE++ K+ 
Sbjct  86   GFRAYPPAYLSQEAKGSSILTGVNFASAASGYYDGTAQLYRAISLTQQLQYYKEWRTKVV  145

Query  460  GVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
               G  KA +II   ++++  GSSDF+Q YY+NP LN+ YTPDQ+   L+
Sbjct  146  NAVGKAKANTIISGGVHLLSAGSSDFIQYYYINPMLNRAYTPDQFSDILM  195



>ref|XP_004145774.1| PREDICTED: GDSL esterase/lipase At5g22810-like [Cucumis sativus]
 ref|XP_004160078.1| PREDICTED: GDSL esterase/lipase At5g22810-like [Cucumis sativus]
 gb|KGN46905.1| hypothetical protein Csa_6G149950 [Cucumis sativus]
Length=348

 Score =   211 bits (536),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 130/166 (78%), Gaps = 2/166 (1%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA+  FGDS +DVG NN++ T+ KA++ PYGRDF +H+PTGRFCNGKLA+D TA+ 
Sbjct  23   QPLVPALFTFGDSVLDVGINNHLKTLIKANFLPYGRDFITHKPTGRFCNGKLASDFTAEY  82

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+SYP AYL     GK+LLIGA+FASAASGY + TA L NA+  +QQ+E+YKEYQ K+
Sbjct  83   LGFTSYPQAYLG--GGGKDLLIGASFASAASGYLDTTAELYNALSFTQQLEHYKEYQNKV  140

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQY  594
            A VAG   A+SII  A+Y+V  GS+DFLQNYY+NP L K YT  Q+
Sbjct  141  AEVAGKSNASSIISGAIYLVSAGSNDFLQNYYINPLLYKKYTVSQF  186



>ref|XP_008458651.1| PREDICTED: GDSL esterase/lipase At5g22810 [Cucumis melo]
Length=348

 Score =   209 bits (533),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 129/166 (78%), Gaps = 2/166 (1%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA+  FGDS +DVG NN++ T+ KA++ PYGRDF +H+PTGRFCNGKLA+D TA+ 
Sbjct  23   QPLVPALFTFGDSVLDVGINNHLKTLIKANFLPYGRDFTTHKPTGRFCNGKLASDFTAEY  82

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+SYP AYL     GK+ L+GA+FASAASGY + TA L NA+  +QQ+EYYKEYQ K+
Sbjct  83   LGFTSYPQAYLG--GGGKDFLVGASFASAASGYLDTTAELYNALSFTQQLEYYKEYQNKV  140

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQY  594
            A VAG   A+SII  A+Y+V  GS+DFLQNYY+NP L K YT  Q+
Sbjct  141  AEVAGKPNASSIISGAIYLVSAGSNDFLQNYYINPLLYKKYTVSQF  186



>emb|CAB85501.1| putative protein [Arabidopsis thaliana]
Length=320

 Score =   208 bits (530),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/162 (59%), Positives = 124/162 (77%), Gaps = 0/162 (0%)
 Frame = +1

Query  124  FGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLGFSSYPVA  303
             GDS VD GNNN+  T+ KA++PPYGRDF +H  TGRF NGKLATD TA+ LGF+SYPVA
Sbjct  1    MGDSVVDAGNNNHRITLVKANFPPYGRDFVAHSATGRFSNGKLATDFTAENLGFTSYPVA  60

Query  304  YLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAGVAGSKKA  483
            YLS +A   NLL GANFAS ASG+D+ TA+  NAI LSQQ++ YKEYQ K+  + G ++A
Sbjct  61   YLSQEANETNLLTGANFASGASGFDDATAIFYNAITLSQQLKNYKEYQNKVTNIVGKERA  120

Query  484  ASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
              I   A++++  GSSDFLQ+YY+NP LN+++TPDQY  +L+
Sbjct  121  NEIFSGAIHLLSTGSSDFLQSYYINPILNRIFTPDQYSDHLL  162



>gb|KHN32662.1| GDSL esterase/lipase APG [Glycine soja]
Length=295

 Score =   207 bits (527),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            LVPAII FGDS+VD+GNN+Y+ T+FKA+YPPYGRDF++HQPTGRFCNGKLATDITA+TLG
Sbjct  27   LVPAIITFGDSAVDIGNNDYLPTLFKANYPPYGRDFSNHQPTGRFCNGKLATDITAETLG  86

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F S+  AYLSPQA+GKNLLIG NFASAASG DEK A+L++AIPLSQQ++YYKEYQGKLA 
Sbjct  87   FKSFAPAYLSPQASGKNLLIGGNFASAASGNDEKAAILNHAIPLSQQLKYYKEYQGKLAK  146

Query  463  VAGSKKA  483
            V G  +A
Sbjct  147  VVGHFQA  153



>ref|XP_010493512.1| PREDICTED: GDSL esterase/lipase At5g22810-like [Camelina sativa]
Length=341

 Score =   208 bits (529),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 134/174 (77%), Gaps = 3/174 (2%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVP++  FGDS VDV NNN ++TI KA++PPYGRDF +H+PTGRFCNGKLATD TA+ 
Sbjct  31   QPLVPSMFIFGDSVVDVANNNEIYTIVKANFPPYGRDFTTHKPTGRFCNGKLATDFTAEN  90

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+SYP AYLS +A G+NLL GANFASAASGY + TA L +AI L QQ+E+YK+Y  ++
Sbjct  91   LGFTSYPQAYLSKKAKGRNLLTGANFASAASGYYDGTAKLYSAISLPQQLEHYKDYISRI  150

Query  457  ---AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
               A    +  A++II D +YIV  GSSDF+QNYY+NP L KV +PD +  YL+
Sbjct  151  QEIAASNNNANASAIISDGIYIVSAGSSDFIQNYYINPLLYKVQSPDDFSDYLI  204



>emb|CDY11271.1| BnaA03g01070D [Brassica napus]
Length=367

 Score =   208 bits (530),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 126/172 (73%), Gaps = 1/172 (1%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA++  GDS VD GNNN   T+ KA++PPYGRDF +H  TGRF NGKLA D TA+ 
Sbjct  22   QPLVPALLIMGDSVVDAGNNNLRLTLVKANFPPYGRDFLAHTATGRFSNGKLAIDFTAEN  81

Query  277  LGFSSYPVAYLSPQATGK-NLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGK  453
            LGF+SYPVAYLS  A  + NLL GANFAS ASGY + T+LL NAI L+QQVE YKEYQ K
Sbjct  82   LGFTSYPVAYLSQDAANETNLLTGANFASGASGYHDGTSLLYNAISLTQQVENYKEYQSK  141

Query  454  LAGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            +  + G  KA  I K A++++  GSSDFLQ+YY+NP LN +  PD++   L+
Sbjct  142  VTSMVGRDKANEIFKGAIHLLSTGSSDFLQSYYINPILNAIVAPDRFSDRLM  193



>ref|XP_006403725.1| hypothetical protein EUTSA_v10010500mg [Eutrema salsugineum]
 gb|ESQ45178.1| hypothetical protein EUTSA_v10010500mg [Eutrema salsugineum]
Length=351

 Score =   207 bits (528),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 132/169 (78%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            +VPA+I FGDS VDVGNNN + +I K+++PPYGRDF +H+PTGRFCNGKLA D +A+ LG
Sbjct  26   VVPALIMFGDSIVDVGNNNNLFSIVKSNFPPYGRDFINHRPTGRFCNGKLAVDFSAEYLG  85

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            FSSYP A+LS +A+ ++LLIGANFASA+SGY + T++   AI L++Q+ YY+ YQ ++  
Sbjct  86   FSSYPPAFLSREASNEDLLIGANFASASSGYYDATSVPFGAISLTRQLSYYRTYQNRVTT  145

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            + G +KA  +   A++I+  GSSDFLQNYY+NP LN +YTPDQ+   L+
Sbjct  146  MIGKEKARVLFSKAIHILSAGSSDFLQNYYLNPLLNIIYTPDQFSDILM  194



>ref|XP_008387479.1| PREDICTED: GDSL esterase/lipase At5g03820-like [Malus domestica]
Length=350

 Score =   207 bits (526),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 94/170 (55%), Positives = 129/170 (76%), Gaps = 1/170 (1%)
 Frame = +1

Query  100  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  279
            PLVPA+I FGDS  D GNNN + T  KA++PPYGRDF +H+PTGRFCNGKL TD TA+ L
Sbjct  25   PLVPALIIFGDSVADXGNNNNLTTPIKANFPPYGRDFVTHRPTGRFCNGKLTTDFTAEYL  84

Query  280  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  459
            GF+SYP AYLSP+A G+NLL   NFASAASGY + T  L N + L++Q+ YY++YQ ++ 
Sbjct  85   GFTSYPPAYLSPEAEGQNLLTXVNFASAASGYLDYTPFLYNTLSLTRQLNYYRQYQNEVV  144

Query  460  GVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             + GS   ++I   A++++  G+SDF+QNYY+NP L ++Y+PDQ+ + L+
Sbjct  145  SMVGSNNTSAIFSGAIHLLSAGTSDFIQNYYINPLL-RIYSPDQFSNILI  193



>emb|CDP14394.1| unnamed protein product [Coffea canephora]
Length=350

 Score =   206 bits (525),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 128/172 (74%), Gaps = 1/172 (1%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA+  FGDS VDVGNNNY+ T+ KA++PPYGRDF +H+ TGRFCNGKLATD T + 
Sbjct  23   QPLVPALYLFGDSIVDVGNNNYLETLIKANFPPYGRDFINHEATGRFCNGKLATDFTGEN  82

Query  277  LGFSSYPVAYLSPQA-TGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGK  453
            LGF+ YP  YLS +A T KN+L+GANFASA SGY E TA + N + LS+Q+  YK+YQ +
Sbjct  83   LGFTDYPKPYLSNKAKTTKNMLLGANFASAGSGYYEATAKIYNTLSLSKQLALYKDYQNR  142

Query  454  LAGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            L  + G   A++ I  +++ +  GSSDF+QNYY+NP L K YTPDQ+   L+
Sbjct  143  LVVILGKVNASATINGSIHFLSDGSSDFVQNYYINPLLYKKYTPDQFSDILI  194



>ref|XP_011101470.1| PREDICTED: GDSL esterase/lipase At5g03820-like [Sesamum indicum]
Length=351

 Score =   206 bits (525),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 129/170 (76%), Gaps = 1/170 (1%)
 Frame = +1

Query  100  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  279
            PLVPA++ FGDS VDVGNNN + T+ KA++ PYGRDF +H+PTGRFCNGKLATD TA+ L
Sbjct  26   PLVPALLLFGDSVVDVGNNNNLQTLVKANFLPYGRDFVTHKPTGRFCNGKLATDFTAEYL  85

Query  280  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  459
            GF+SY  AYLS +A G+N+L G NFASAASGY E T  L  A+ L+QQ+EYY+++Q K+ 
Sbjct  86   GFTSYQPAYLSQEARGRNILTGVNFASAASGYYEPTGQLYRALTLAQQLEYYRDWQRKVV  145

Query  460  GVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             + G  KA +I    ++++  G+SDF+QNYY+NP L KVY+ DQ+   L+
Sbjct  146  SMVGRAKANAIFSGGIHLISAGTSDFIQNYYINPLL-KVYSLDQFSDILM  194



>gb|ABZ85648.1| At5g03810, partial [Arabidopsis thaliana]
 gb|ABZ85652.1| At5g03810, partial [Arabidopsis thaliana]
Length=252

 Score =   202 bits (515),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 121/157 (77%), Gaps = 0/157 (0%)
 Frame = +1

Query  139  VDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLGFSSYPVAYLSPQ  318
            VD GNNN+  T+ KA++PPYGRDF +H  TGRF NGKLATD TA+ LGF+SYPVAYLS +
Sbjct  2    VDAGNNNHRITLVKANFPPYGRDFVAHSATGRFSNGKLATDFTAENLGFTSYPVAYLSQE  61

Query  319  ATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAGVAGSKKAASIIK  498
            A   NLL GANFAS ASG+D+ TA+  NAI LSQQ++ YKEYQ K+  + G ++A  I  
Sbjct  62   ANETNLLTGANFASGASGFDDATAIFYNAITLSQQLKNYKEYQNKVTNIVGKERANEIFS  121

Query  499  DALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             A++++  GSSDFLQ+YY+NP LN+++TPDQY  +L+
Sbjct  122  GAIHLLSTGSSDFLQSYYINPILNRIFTPDQYSDHLL  158



>ref|XP_011018853.1| PREDICTED: GDSL esterase/lipase At5g03820 [Populus euphratica]
Length=351

 Score =   205 bits (522),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 131/170 (77%), Gaps = 0/170 (0%)
 Frame = +1

Query  100  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  279
            PLVPA+I FGDS VDVGNNN + T+ KA++ PYGRD+ +H+PTGRFCNGKLATD TA+ L
Sbjct  25   PLVPALIIFGDSVVDVGNNNNLTTLIKANFLPYGRDYVTHRPTGRFCNGKLATDFTAEYL  84

Query  280  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  459
            GF++YP AYLSP A+G+N+L GANFASAASG  + TA   +AI L++Q+ YY++YQ K+ 
Sbjct  85   GFTTYPPAYLSPDASGRNILTGANFASAASGLYDGTAQSYSAISLTRQLSYYRDYQMKVV  144

Query  460  GVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             +AG  +A  I   A++++  GSSDF+QNYY+NP L  +Y+ D++   L+
Sbjct  145  NMAGQARANDIFSGAIHLLSAGSSDFIQNYYINPVLRGLYSVDRFSDLLM  194



>emb|CDP17381.1| unnamed protein product [Coffea canephora]
Length=310

 Score =   204 bits (518),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 127/172 (74%), Gaps = 1/172 (1%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QPLVPA+  FGDS VDVGNNNY+ T+ KA++PPYGRDF +H+ TGRFCNGKLATD T + 
Sbjct  23   QPLVPALYLFGDSIVDVGNNNYLETLIKANFPPYGRDFINHEATGRFCNGKLATDFTGEN  82

Query  277  LGFSSYPVAYLSPQA-TGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGK  453
            LGF+ YP  YLS +A T KN+L+GANFASA SGY E TA +   + LS+Q+  YK+YQ +
Sbjct  83   LGFTDYPKPYLSNKAKTTKNMLLGANFASAGSGYYEATAKIYTTLSLSKQLALYKDYQNR  142

Query  454  LAGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            L  + G   A++ I  +++ +  GSSDF+QNYY+NP L K YTPDQ+   L+
Sbjct  143  LVVILGKVNASATINGSIHFLSDGSSDFVQNYYINPLLYKKYTPDQFSDILI  194



>gb|EYU41566.1| hypothetical protein MIMGU_mgv1a008897mg [Erythranthe guttata]
Length=359

 Score =   204 bits (520),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/171 (57%), Positives = 128/171 (75%), Gaps = 1/171 (1%)
 Frame = +1

Query  100  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  279
            PLVPA+I FGDS VDVGNNN + T+ KA++ PYGRDF +H+PTGRF NGKLATD TA+ L
Sbjct  32   PLVPALIIFGDSVVDVGNNNNLQTLIKANFLPYGRDFVTHKPTGRFSNGKLATDFTAEYL  91

Query  280  GFSSYPVAYLSPQA-TGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            GF+SYP AY S +A +GKN+L G NFASAASGY ++TA L  A+ L+QQ+  Y+++Q K+
Sbjct  92   GFNSYPPAYFSQEARSGKNILTGVNFASAASGYYDRTAQLYRALTLTQQLANYRDWQSKV  151

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
              + G  KA  I    ++++  GSSDF+QNYY+NP LN  YTPD++   L+
Sbjct  152  VNLVGRSKANDIFSGGIHLISAGSSDFIQNYYINPILNTAYTPDRFSDTLI  202



>gb|ABZ85655.1| At5g03810, partial [Arabidopsis thaliana]
 gb|ABZ85659.1| At5g03810, partial [Arabidopsis thaliana]
Length=252

 Score =   201 bits (512),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 120/157 (76%), Gaps = 0/157 (0%)
 Frame = +1

Query  139  VDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLGFSSYPVAYLSPQ  318
            VD GNNN+  T+ KA++PPYGRDF +H  TGRF NGKLATD TA+ LGF+SYPVAYLS +
Sbjct  2    VDAGNNNHRITLVKANFPPYGRDFVAHSATGRFSNGKLATDFTAENLGFTSYPVAYLSQE  61

Query  319  ATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAGVAGSKKAASIIK  498
            A   NLL GANFAS ASG+D+ TA+  NAI LSQQ++ YKEYQ K+  + G ++A  I  
Sbjct  62   ANETNLLTGANFASGASGFDDATAIFYNAITLSQQLKNYKEYQNKVTNIVGKERANEIFS  121

Query  499  DALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             A++++  GSSDFLQ+YY+NP LN+++TPDQY   L+
Sbjct  122  GAIHLLSTGSSDFLQSYYINPILNRIFTPDQYSDRLL  158



>ref|XP_006381340.1| hypothetical protein POPTR_0006s11970g [Populus trichocarpa]
 gb|ERP59137.1| hypothetical protein POPTR_0006s11970g [Populus trichocarpa]
Length=351

 Score =   204 bits (519),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 131/170 (77%), Gaps = 0/170 (0%)
 Frame = +1

Query  100  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  279
            PLVPA+I FGDS VDVGNNN + T+ KA++ PYGRD+ +H+PTGRFCNGKLATD TA+ L
Sbjct  25   PLVPALIIFGDSVVDVGNNNNLTTLIKANFLPYGRDYVTHRPTGRFCNGKLATDFTAEYL  84

Query  280  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  459
            GF++YP AYLSP A+G+N+L GANFASAASG  + TA   ++I L++Q+ YY++YQ K+ 
Sbjct  85   GFTTYPPAYLSPDASGRNILTGANFASAASGLYDGTAQSYSSISLTRQLSYYRDYQMKVV  144

Query  460  GVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             +AG  +A  I   A++++  GSSDF+QNYY+NP L  +Y+ D++   L+
Sbjct  145  NMAGQARANDIFSGAIHLLSAGSSDFIQNYYINPVLRGLYSVDRFSDLLM  194



>gb|ABZ85657.1| At5g03810, partial [Arabidopsis thaliana]
Length=252

 Score =   201 bits (510),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 120/157 (76%), Gaps = 0/157 (0%)
 Frame = +1

Query  139  VDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLGFSSYPVAYLSPQ  318
            VD GNNN+  T+ KA++PPYGRDF +H  TGRF NGKLATD TA+ LGF+SYPVAYLS  
Sbjct  2    VDAGNNNHRITLVKANFPPYGRDFVAHSATGRFSNGKLATDFTAENLGFTSYPVAYLSQD  61

Query  319  ATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAGVAGSKKAASIIK  498
            A   NLL GANFAS ASG+D+ TA+  NAI LSQQ++ YKEYQ K+  + G+++A  I  
Sbjct  62   ANETNLLTGANFASGASGFDDATAIFYNAITLSQQLKNYKEYQNKVTNIVGTERANEIFS  121

Query  499  DALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             A++++  GSSDFLQ+YY+NP LN+++TPDQY   L+
Sbjct  122  GAIHLLSTGSSDFLQSYYINPILNRIFTPDQYSDRLL  158



>gb|ACG42669.1| hypothetical protein [Zea mays]
Length=358

 Score =   204 bits (519),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 133/172 (77%), Gaps = 1/172 (1%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYV-HTIFKADYPPYGRDFASHQPTGRFCNGKLATDITAD  273
            QP+VPAII+FGDS+VDVGNNNY+   +FKADY PYG+ FA H+ TGRF +GK+ TDITA+
Sbjct  28   QPIVPAIISFGDSTVDVGNNNYLPGAVFKADYAPYGQGFARHKATGRFSDGKIVTDITAE  87

Query  274  TLGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGK  453
            TLGF SY   YLSPQA+GKNL  GANFASAAS Y + TA + +AI L+QQ++YYKEYQ K
Sbjct  88   TLGFESYAPPYLSPQASGKNLFTGANFASAASSYYDDTAAMYDAITLTQQLKYYKEYQSK  147

Query  454  LAGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            LA VAG  +A +I+ DALY+V  G+ DFLQNYY N  L++ Y  DQY   LV
Sbjct  148  LAAVAGRARARAILGDALYVVSTGTGDFLQNYYHNASLSRRYDVDQYTDLLV  199



>dbj|BAJ89672.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=365

 Score =   204 bits (519),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/174 (58%), Positives = 129/174 (74%), Gaps = 3/174 (2%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDF-ASHQPTGRFCNGKLATDITAD  273
            Q LVP ++ FGDS VD GNNN + T+ +AD+PPYGRDF A+H PTGRFCNGKLATD T +
Sbjct  31   QALVPGVMIFGDSVVDAGNNNRLATLVRADFPPYGRDFPATHAPTGRFCNGKLATDYTVE  90

Query  274  TLGFSSYPVAYLS--PQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQ  447
            +LG SSYP AYLS   Q+  K LL GANFAS A+GY + TA L  AI L +Q++Y+KEYQ
Sbjct  91   SLGLSSYPPAYLSGEAQSDNKTLLHGANFASGAAGYLDATAALYGAISLGRQLDYFKEYQ  150

Query  448  GKLAGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             K+A VAG K+AA++   ++Y+V  G+SD++QNYYVN  L   YTPDQ+   L+
Sbjct  151  SKVAAVAGEKRAAALTSGSIYLVSAGTSDYVQNYYVNAMLAAAYTPDQFADALM  204



>gb|KDO38512.1| hypothetical protein CISIN_1g018227mg [Citrus sinensis]
Length=302

 Score =   202 bits (513),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +1

Query  100  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  279
            PLVPAII FGDS+VDVGNNNY+ T+FKA+YPPYGRDF +HQPTGRFCNGKLATD TADTL
Sbjct  33   PLVPAIITFGDSAVDVGNNNYLATLFKANYPPYGRDFINHQPTGRFCNGKLATDFTADTL  92

Query  280  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  459
            GF +Y  AYLSPQATGKNLLIGANFASA SGYD++T+ L++AI L+QQ++YY+EYQ KLA
Sbjct  93   GFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLA  152



>gb|ABZ85649.1| At5g03810, partial [Arabidopsis thaliana]
 gb|ABZ85650.1| At5g03810, partial [Arabidopsis thaliana]
 gb|ABZ85651.1| At5g03810, partial [Arabidopsis thaliana]
 gb|ABZ85653.1| At5g03810, partial [Arabidopsis thaliana]
 gb|ABZ85656.1| At5g03810, partial [Arabidopsis thaliana]
 gb|ABZ85658.1| At5g03810, partial [Arabidopsis thaliana]
 gb|ABZ85660.1| At5g03810, partial [Arabidopsis thaliana]
 gb|ABZ85661.1| At5g03810, partial [Arabidopsis thaliana]
Length=252

 Score =   200 bits (509),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 119/157 (76%), Gaps = 0/157 (0%)
 Frame = +1

Query  139  VDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLGFSSYPVAYLSPQ  318
            VD GNNN+  T+ KA++PPYGRDF +H  TGRF NGKLATD TA+ LGF+SYPVAYLS  
Sbjct  2    VDAGNNNHRITLVKANFPPYGRDFVAHSATGRFSNGKLATDFTAENLGFTSYPVAYLSQD  61

Query  319  ATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAGVAGSKKAASIIK  498
            A   NLL GANFAS ASG+D+ TA+  NAI LSQQ++ YKEYQ K+  + G ++A  I  
Sbjct  62   ANETNLLTGANFASGASGFDDATAIFYNAITLSQQLKNYKEYQNKVTNIVGKERANEIFS  121

Query  499  DALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             A++++  GSSDFLQ+YY+NP LN+++TPDQY   L+
Sbjct  122  GAIHLLSTGSSDFLQSYYINPILNRIFTPDQYSDRLL  158



>ref|XP_003561180.2| PREDICTED: GDSL esterase/lipase APG-like [Brachypodium distachyon]
Length=430

 Score =   205 bits (522),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 104/172 (60%), Positives = 129/172 (75%), Gaps = 1/172 (1%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYV-HTIFKADYPPYGRDFASHQPTGRFCNGKLATDITAD  273
            QPLVPA+I FGDS++DVGNNNY+   +FKA+Y PYG +F  H+ TGRF +GK+ +DITA+
Sbjct  98   QPLVPAMILFGDSTIDVGNNNYLPGAVFKANYAPYGDNFRRHRATGRFSDGKIVSDITAE  157

Query  274  TLGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGK  453
            +LGF SY   YLSP A+GKNLL GANF SAAS Y + TA + +AI LSQQ++YYKEYQ K
Sbjct  158  SLGFVSYAPPYLSPLASGKNLLAGANFGSAASSYADDTAAMYDAITLSQQLKYYKEYQTK  217

Query  454  LAGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            LA VAG +KA SI+ DALY+V  G+ DFLQNYY N  L+  Y   +Y   LV
Sbjct  218  LAAVAGRRKARSILADALYVVSTGTGDFLQNYYHNASLSARYDVPRYCDLLV  269



>ref|NP_001140661.1| hypothetical protein precursor [Zea mays]
 gb|ACF84312.1| unknown [Zea mays]
 gb|ACF84726.1| unknown [Zea mays]
 gb|AFW75507.1| hypothetical protein ZEAMMB73_189087 [Zea mays]
Length=359

 Score =   202 bits (515),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 133/172 (77%), Gaps = 1/172 (1%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYV-HTIFKADYPPYGRDFASHQPTGRFCNGKLATDITAD  273
            QP+VPA+I+FGDS+VDVGNNNY+   +FKADY PYG+ FA H+ TGRF +GK+ TDITA+
Sbjct  30   QPIVPAVISFGDSTVDVGNNNYLPGAVFKADYAPYGQGFARHKATGRFSDGKIVTDITAE  89

Query  274  TLGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGK  453
            TLGF SY   YLSPQA+GKNLL GANFASAAS Y + TA + +AI L+QQ++YYKEYQ K
Sbjct  90   TLGFESYAPPYLSPQASGKNLLTGANFASAASSYYDDTAAMYDAITLTQQLKYYKEYQSK  149

Query  454  LAGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            LA VAG  +A +I+ DALY+V  G+ DFLQNYY N  L+  Y  +QY   LV
Sbjct  150  LAAVAGRARARAILGDALYVVSTGTGDFLQNYYHNASLSHRYDVEQYTDLLV  201



>ref|XP_002466664.1| hypothetical protein SORBIDRAFT_01g011850 [Sorghum bicolor]
 gb|EER93662.1| hypothetical protein SORBIDRAFT_01g011850 [Sorghum bicolor]
Length=362

 Score =   202 bits (514),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 128/174 (74%), Gaps = 3/174 (2%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDF-ASHQPTGRFCNGKLATDITAD  273
            Q LVP ++ FGDS VD GNNN + T+ +AD+PPYGRDF A+H PTGRFCNGKLATD T +
Sbjct  32   QALVPGVMIFGDSVVDAGNNNRLATLVRADFPPYGRDFPATHAPTGRFCNGKLATDYTVE  91

Query  274  TLGFSSYPVAYLSP--QATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQ  447
            +LG SSYP AYLS   Q+  K+LL GANFAS A+GY + TA L  AI L +Q EY++EYQ
Sbjct  92   SLGLSSYPPAYLSEEAQSNNKSLLHGANFASGAAGYLDATAGLYGAISLRRQAEYFREYQ  151

Query  448  GKLAGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             ++A  AG ++A  +   ++Y+V  G+SD++QNYYVNP L+  YTPDQ+   L+
Sbjct  152  SRVAASAGERRARELTSGSIYVVSAGTSDYVQNYYVNPMLSAAYTPDQFADALM  205



>ref|XP_008462404.1| PREDICTED: GDSL esterase/lipase APG isoform X5 [Cucumis melo]
Length=420

 Score =   203 bits (516),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 101/169 (60%), Positives = 135/169 (80%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            + PAI  FGDS++DVGNNN   T+FKA+Y PYGRDF +H+PTGRFCNGKL +DITA++LG
Sbjct  94   IFPAIFTFGDSALDVGNNNNRFTMFKANYLPYGRDFINHKPTGRFCNGKLVSDITAESLG  153

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F SYP AYLSP+A+G+ LLIGA FASAA+GYDE+ ++ + AI L QQ+  YKEYQGK+A 
Sbjct  154  FQSYPPAYLSPEASGRKLLIGAGFASAAAGYDEEASISNRAITLGQQLANYKEYQGKVAM  213

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            V G ++AA+I+ D L+I+  G+ D+LQNYY+N  + + +TP +Y S+LV
Sbjct  214  VVGDEEAAAIVADGLHILSCGTGDYLQNYYINATVRRRFTPYEYSSFLV  262



>gb|EMT26145.1| GDSL esterase/lipase APG [Aegilops tauschii]
Length=353

 Score =   201 bits (510),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 124/171 (73%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            QP VP ++ FGDS V VGNN+Y+ T+ KA+  PYGRDF  H  TGRF NGKL +DI  + 
Sbjct  25   QPAVPGVMLFGDSLVGVGNNDYIATLVKANKAPYGRDFKDHVATGRFGNGKLLSDIIGEK  84

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF+  P AYLSPQA+GKNLLIGANFASA SGY + T+ + + IPLS+Q+EY+KEYQ KL
Sbjct  85   LGFNGSPPAYLSPQASGKNLLIGANFASAGSGYYDPTSRMYHVIPLSRQLEYFKEYQSKL  144

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            + VAGS  A SII D+LYI+  GS+DF  NYY+NP L      DQ+   LV
Sbjct  145  SVVAGSNHARSIISDSLYIISAGSNDFGFNYYINPLLFLTENADQFSDRLV  195



>ref|XP_004506128.1| PREDICTED: GDSL esterase/lipase At5g22810-like [Cicer arietinum]
Length=356

 Score =   200 bits (509),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 122/171 (71%), Gaps = 0/171 (0%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  276
            +PLVPA   FGDSS DVGNNN + T  KA++PPYGRDF +H PTGRFCNGKL  D  ++ 
Sbjct  26   KPLVPAFFIFGDSSFDVGNNNNLPTTIKANFPPYGRDFMNHIPTGRFCNGKLTIDFASEF  85

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGF SY  AYL+    GKNLL GANFAS+ SGY E TA L  +I L+QQ+E+YK+ Q +L
Sbjct  86   LGFISYQPAYLNLYIKGKNLLNGANFASSGSGYHESTAKLYKSISLNQQLEFYKDSQNEL  145

Query  457  AGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
              +AG   A SII  A+Y+VG G+ DFL NYY+NP L  VYTPDQ+   +V
Sbjct  146  MKIAGRSDALSIIFGAVYLVGAGTGDFLLNYYMNPLLYNVYTPDQFSDIVV  196



>ref|XP_004982165.1| PREDICTED: GDSL esterase/lipase At5g03820-like isoform X2 [Setaria 
italica]
Length=357

 Score =   200 bits (508),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 127/174 (73%), Gaps = 3/174 (2%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDF-ASHQPTGRFCNGKLATDITAD  273
            Q LVP ++ FGDS VD GNNN + T+ +AD+PPYGRDF A+H PTGRFCNGKLA D T +
Sbjct  27   QALVPGVMIFGDSVVDAGNNNRLATLVRADFPPYGRDFPATHAPTGRFCNGKLAMDYTVE  86

Query  274  TLGFSSYPVAYLS--PQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQ  447
            +LG SSYP AYLS   Q+  K+LL GANFAS A+GY + TA L  AI LS+Q EY++EYQ
Sbjct  87   SLGLSSYPPAYLSQEAQSNNKSLLNGANFASGAAGYLDATAALYGAISLSRQAEYFREYQ  146

Query  448  GKLAGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             ++A  AG ++A S+   ++Y+V  G+SD++QNYYVNP L   YT DQ+   L+
Sbjct  147  SRVAASAGEQRAKSLTSGSIYVVSAGTSDYMQNYYVNPVLGAAYTSDQFADALM  200



>emb|CDX95394.1| BnaC04g27640D [Brassica napus]
Length=351

 Score =   199 bits (507),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 127/169 (75%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            +VPA+I FGDS VDVGNNN + +I K+++PPYGRDF +  PTGRFCNGKLA D +A+ LG
Sbjct  26   IVPALIMFGDSIVDVGNNNNLLSIVKSNFPPYGRDFTNRTPTGRFCNGKLAVDFSAEYLG  85

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            F SYP AYLS +A  ++ LIGANFASA+SGY + T++   AIPL +Q+ YY+ YQ ++  
Sbjct  86   FPSYPPAYLSREARNEDFLIGANFASASSGYYDATSVPFGAIPLPRQLSYYRTYQNRVRS  145

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            + G ++A ++   +++I+  GSSDFLQNYYVNP LN + TPDQ+   L+
Sbjct  146  MIGRERARTMFSKSIHILSAGSSDFLQNYYVNPLLNILNTPDQFSDILM  194



>ref|XP_003561182.1| PREDICTED: GDSL esterase/lipase APG-like [Brachypodium distachyon]
Length=359

 Score =   200 bits (508),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 129/172 (75%), Gaps = 2/172 (1%)
 Frame = +1

Query  100  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFAS-HQPTGRFCNGKLATDITADT  276
            P VPAI+ FGDS VDVGNN+Y++TI KA+  PYGRDF   H  TGRF NGKL +D   + 
Sbjct  30   PRVPAIMFFGDSLVDVGNNDYINTIVKANLSPYGRDFQEDHVATGRFGNGKLISDFIGEK  89

Query  277  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKL  456
            LGFS  P AYLSP+A+GKNLL+GANFASA SGY + TAL+ + IPLSQQ+E++KEY+ KL
Sbjct  90   LGFSVSPPAYLSPEASGKNLLLGANFASAGSGYYDPTALMYHVIPLSQQLEHFKEYRSKL  149

Query  457  AGVAGSK-KAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            A VAGS+ +A SI+ ++LYI+  GS+DF  NYY+NP L    T DQ+   L+
Sbjct  150  AAVAGSRQQAQSIVSNSLYIISAGSNDFGFNYYINPLLFSTQTADQFSDRLI  201



>ref|NP_001241778.1| anther-specific proline-rich protein APG precursor [Zea mays]
 gb|ACG38766.1| anther-specific proline-rich protein APG precursor [Zea mays]
Length=360

 Score =   199 bits (507),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 128/174 (74%), Gaps = 3/174 (2%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDF-ASHQPTGRFCNGKLATDITAD  273
            Q LVP ++ FGDS VD GNNN + T+ +AD+PPYGRDF A+H PTGRFCNGKLATD T +
Sbjct  30   QALVPGVMIFGDSVVDAGNNNRLATLVRADFPPYGRDFPATHAPTGRFCNGKLATDYTVE  89

Query  274  TLGFSSYPVAYLSP--QATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQ  447
            +LG SSYP AYLS   Q+  K+LL GANFAS A+GY + TA L  A+ LS+QV Y++EYQ
Sbjct  90   SLGLSSYPPAYLSEEAQSNNKSLLHGANFASGAAGYLDATAALYGAMSLSRQVGYFREYQ  149

Query  448  GKLAGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             ++   AG ++A  +   ++Y+V  G+SD++QNYYVNP L+  YTPDQ+   L+
Sbjct  150  SRVGASAGQQRARELTSGSIYVVSAGTSDYVQNYYVNPMLSAAYTPDQFADALM  203



>ref|XP_006656639.1| PREDICTED: GDSL esterase/lipase APG-like [Oryza brachyantha]
Length=356

 Score =   199 bits (507),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 128/170 (75%), Gaps = 1/170 (1%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYV-HTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  279
            +VPA+ +FGDS++DVGNNNY+   +FKA+Y PYG +F   +PTGRF +GK+ TDITA+TL
Sbjct  29   IVPAVFSFGDSTIDVGNNNYLPGAVFKANYVPYGVNFHRRRPTGRFSDGKIVTDITAETL  88

Query  280  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLA  459
            GF SY   YLSPQA+GKNLL+GANFASAAS Y + TA + +AI L+QQ++YY+EYQ KLA
Sbjct  89   GFESYAPPYLSPQASGKNLLLGANFASAASSYHDDTAAMYDAITLTQQLKYYREYQSKLA  148

Query  460  GVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             + G + A++I+ DALY+V  G+ DFLQNYY N  L+  Y    Y   LV
Sbjct  149  ALVGRENASAILSDALYVVSTGTGDFLQNYYHNASLSGRYDVSSYCDLLV  198



>ref|XP_010515794.1| PREDICTED: GDSL esterase/lipase At3g53100-like isoform X2 [Camelina 
sativa]
Length=208

 Score =   195 bits (495),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 124/169 (73%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            +VPA+I FGDS VDVGNNN + +I K+++PPYGRDF   +PTGRFCNGKLA D +A+ LG
Sbjct  26   IVPALIMFGDSIVDVGNNNNLLSIVKSNFPPYGRDFIDQRPTGRFCNGKLAVDFSAEYLG  85

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            FSSYP A+LS +A  +N  IGANFASA+SGY + T++   AI L++Q+ YY+ YQ ++  
Sbjct  86   FSSYPPAFLSREARNENFSIGANFASASSGYYDATSVPFGAISLTRQLSYYRAYQNRVTS  145

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            + G + A  +    ++I+  GSSDFLQNYY+NP LN + TPDQ+   L+
Sbjct  146  MIGRENARRLFSKGIHILSAGSSDFLQNYYINPLLNILNTPDQFSDILM  194



>ref|XP_006650413.1| PREDICTED: GDSL esterase/lipase At5g03810-like [Oryza brachyantha]
Length=361

 Score =   199 bits (507),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 129/174 (74%), Gaps = 3/174 (2%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDF-ASHQPTGRFCNGKLATDITAD  273
            Q LVP ++ FGDS VD GNNN + T+ +AD+PPYGRDF A+H PTGRFCNGKLATD T D
Sbjct  32   QALVPGVMIFGDSVVDAGNNNRLPTLVRADFPPYGRDFPATHAPTGRFCNGKLATDYTVD  91

Query  274  TLGFSSYPVAYLSPQATGKN--LLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQ  447
            +LG ++YP AYL  +A   N  LL GANFAS ASGY + TA L  AI LS+Q++Y++EY+
Sbjct  92   SLGLAAYPPAYLGQEARSDNRTLLHGANFASGASGYLDATAALYGAISLSRQLDYFREYK  151

Query  448  GKLAGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             K+A  AG +KAA++  +++Y+V  G+SD++QNYYVNP L   YT DQ+   L+
Sbjct  152  AKVAAGAGREKAAALTSESIYVVSAGTSDYVQNYYVNPVLAATYTSDQFADVLM  205



>ref|XP_009139436.1| PREDICTED: GDSL esterase/lipase At3g53100 isoform X2 [Brassica 
rapa]
Length=351

 Score =   199 bits (505),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/169 (53%), Positives = 129/169 (76%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            +VPA+I FGDS VDVGNNN + +I K+++PPYGRDF +  PTGRFCNGKLA D +A+ LG
Sbjct  26   IVPALIMFGDSIVDVGNNNNLLSIVKSNFPPYGRDFTNQTPTGRFCNGKLAVDFSAEYLG  85

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            FSSYP A+L+ +A  ++ LIGANFASA+SGY + T++   AIPL++Q+ YY+ YQ ++  
Sbjct  86   FSSYPPAFLNREARNEDFLIGANFASASSGYYDATSVPFGAIPLTRQLSYYRTYQNRVRS  145

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            + G ++A ++   +++I+  GSSDFLQNYY+NP LN + TP+Q+   L+
Sbjct  146  MIGRERARTMFSQSIHILSAGSSDFLQNYYINPLLNILNTPEQFSDTLM  194



>emb|CDX76226.1| BnaA04g04900D [Brassica napus]
Length=351

 Score =   198 bits (504),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/169 (53%), Positives = 129/169 (76%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            +VPA+I FGDS VDVGNNN + +I K+++PPYGRDF +  PTGRFCNGKLA D +A+ LG
Sbjct  26   IVPALIMFGDSIVDVGNNNNLLSIVKSNFPPYGRDFTNQTPTGRFCNGKLAVDFSAEYLG  85

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            FSSYP A+L+ +A  ++ LIGANFASA+SGY + T++   AIPL++Q+ YY+ YQ ++  
Sbjct  86   FSSYPPAFLNREARNEDFLIGANFASASSGYYDATSVPFGAIPLTRQLSYYRTYQNRVRS  145

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            + G ++A ++   +++I+  GSSDFLQNYY+NP LN + TP+Q+   L+
Sbjct  146  MIGRERARTMFSKSIHILSAGSSDFLQNYYINPLLNILNTPEQFSDTLM  194



>ref|XP_006291405.1| hypothetical protein CARUB_v10017544mg [Capsella rubella]
 gb|EOA24303.1| hypothetical protein CARUB_v10017544mg [Capsella rubella]
Length=351

 Score =   198 bits (504),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 126/169 (75%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            +VPA+I FGDS VDVGNNN + +I K+++PPYGRDF + +PTGRFCNGKLA D +A+ LG
Sbjct  26   IVPALIIFGDSIVDVGNNNNLLSIVKSNFPPYGRDFINQRPTGRFCNGKLAVDFSAEYLG  85

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            FSSYP A+LS +A  +N LIGANFASA+SGY + T++   AI L++Q+ YY+ YQ ++  
Sbjct  86   FSSYPPAFLSREARNENFLIGANFASASSGYYDATSVPFGAISLTRQLSYYRAYQNRVTR  145

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            + G + A  +    ++I+  GSSDFLQNYYVNP LN + TPDQ+   L+
Sbjct  146  MIGRENARMLFSRGIHILSAGSSDFLQNYYVNPLLNILNTPDQFSDILI  194



>ref|NP_001142139.1| uncharacterized protein LOC100274304 precursor [Zea mays]
 gb|ACF87746.1| unknown [Zea mays]
Length=359

 Score =   198 bits (503),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 127/174 (73%), Gaps = 3/174 (2%)
 Frame = +1

Query  97   QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDF-ASHQPTGRFCNGKLATDITAD  273
            Q LVP ++ FGDS VD GNNN + T+ +AD+PPYGRDF A+H PTGRFCNGKLATD T +
Sbjct  29   QALVPGVMIFGDSVVDAGNNNRLATLVRADFPPYGRDFPATHAPTGRFCNGKLATDYTVE  88

Query  274  TLGFSSYPVAYLSP--QATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQ  447
            +LG SSYP AYLS   Q+  K+LL GANFAS A+GY + TA L  A+ LS+Q  Y++EYQ
Sbjct  89   SLGLSSYPPAYLSEEAQSNNKSLLHGANFASGAAGYLDATAALYGAMSLSRQAGYFREYQ  148

Query  448  GKLAGVAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             ++   AG ++A  +   ++Y+V  G+SD++QNYYVNP L+  YTPDQ+   L+
Sbjct  149  SRVGASAGQQRARELTSGSIYVVSAGTSDYVQNYYVNPMLSAAYTPDQFADALM  202



>ref|XP_010109948.1| GDSL esterase/lipase [Morus notabilis]
 gb|EXC24924.1| GDSL esterase/lipase [Morus notabilis]
Length=363

 Score =   198 bits (503),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 99/168 (59%), Positives = 123/168 (73%), Gaps = 0/168 (0%)
 Frame = +1

Query  106  VPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLGF  285
            VPA+  FGDS VD GNNN + TI KA++PPYGRDF + + TGRF NG+L TDI A  +GF
Sbjct  35   VPALFIFGDSVVDAGNNNELLTIIKANFPPYGRDFMNQRATGRFTNGQLVTDIIARRIGF  94

Query  286  SSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAGV  465
              Y  AYLS +A  +NLLIGANFASAASGY + TA L  AIPLS+Q+E YKEYQGK+  +
Sbjct  95   PRYQAAYLSEEAEAENLLIGANFASAASGYYDATADLFLAIPLSKQLENYKEYQGKIVEL  154

Query  466  AGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
             G++ A+S+    ++IV  GSSDFLQNYYVNP +N  Y  DQ+ + LV
Sbjct  155  IGAENASSLFSRGIHIVSTGSSDFLQNYYVNPVVNIPYRIDQFSNMLV  202



>ref|XP_002877901.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH54160.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=351

 Score =   197 bits (502),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 126/169 (75%), Gaps = 0/169 (0%)
 Frame = +1

Query  103  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  282
            +VPA+I FGDS VDVGNNN + +I K+++PPYGRDF   +PTGRFCNGKLA D +A+ LG
Sbjct  26   IVPALIMFGDSIVDVGNNNNLLSIVKSNFPPYGRDFIDQRPTGRFCNGKLAVDFSAEYLG  85

Query  283  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLSNAIPLSQQVEYYKEYQGKLAG  462
            FSSYP A+LS +A+ + LLIGANFASA+SGY + T++   AI L++Q+ YY+ YQ ++  
Sbjct  86   FSSYPPAFLSREASNETLLIGANFASASSGYYDATSVPFGAISLTRQLSYYRAYQNRVTR  145

Query  463  VAGSKKAASIIKDALYIVGFGSSDFLQNYYVNPYLNKVYTPDQYGSYLV  609
            + G + A  +    ++I+  GSSDFLQNYY+NP LN + TPDQ+   L+
Sbjct  146  MIGRENARRLFSRGIHILSAGSSDFLQNYYINPLLNILNTPDQFADILM  194



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 829366762230