BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001E13

Length=447
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP11417.1|  unnamed protein product                                212   1e-60   Coffea canephora [robusta coffee]
ref|XP_004138382.1|  PREDICTED: cellulose synthase A catalytic su...    212   1e-60   Cucumis sativus [cucumbers]
ref|XP_002265955.1|  PREDICTED: cellulose synthase A catalytic su...    212   1e-60   Vitis vinifera
ref|XP_008463088.1|  PREDICTED: cellulose synthase A catalytic su...    212   1e-60   Cucumis melo [Oriental melon]
ref|XP_008463087.1|  PREDICTED: cellulose synthase A catalytic su...    212   2e-60   Cucumis melo [Oriental melon]
emb|CBI18221.3|  unnamed protein product                                211   3e-60   Vitis vinifera
ref|XP_006364140.1|  PREDICTED: cellulose synthase A catalytic su...    211   3e-60   Solanum tuberosum [potatoes]
gb|AIA61439.1|  cellulose synthase                                      211   5e-60   Boehmeria nivea [Chinese silk-plant]
ref|XP_011074751.1|  PREDICTED: cellulose synthase A catalytic su...    210   6e-60   Sesamum indicum [beniseed]
ref|XP_004252570.1|  PREDICTED: cellulose synthase A catalytic su...    210   8e-60   Solanum lycopersicum
ref|XP_011101270.1|  PREDICTED: cellulose synthase A catalytic su...    209   1e-59   Sesamum indicum [beniseed]
ref|XP_009765335.1|  PREDICTED: cellulose synthase A catalytic su...    209   1e-59   Nicotiana sylvestris
ref|XP_009599913.1|  PREDICTED: cellulose synthase A catalytic su...    209   1e-59   Nicotiana tomentosiformis
dbj|BAG06272.1|  cellulose synthase Z632                                209   2e-59   Zinnia elegans [garden zinnia]
ref|XP_007019545.1|  Cellulose synthase 6                               209   2e-59   
ref|XP_010106861.1|  Isoxaben-resistant protein 2                       207   7e-59   
gb|AFZ78561.1|  cellulose synthase                                      207   7e-59   Populus tomentosa [Chinese white poplar]
ref|XP_007199689.1|  hypothetical protein PRUPE_ppa000559mg             207   1e-58   Prunus persica
ref|XP_002302169.1|  CesA7A-like family protein                         207   1e-58   
gb|AAT09895.1|  cellulose synthase                                      207   1e-58   Populus tremula x Populus tremuloides
ref|XP_011042869.1|  PREDICTED: cellulose synthase A catalytic su...    206   1e-58   Populus euphratica
ref|XP_009339472.1|  PREDICTED: cellulose synthase A catalytic su...    206   2e-58   Pyrus x bretschneideri [bai li]
ref|XP_008381836.1|  PREDICTED: cellulose synthase A catalytic su...    206   2e-58   
ref|XP_008369157.1|  PREDICTED: cellulose synthase A catalytic su...    206   2e-58   
ref|XP_008358296.1|  PREDICTED: cellulose synthase A catalytic su...    206   2e-58   
ref|XP_011044242.1|  PREDICTED: cellulose synthase A catalytic su...    206   2e-58   Populus euphratica
gb|AFB18634.1|  CESA5                                                   206   2e-58   Gossypium hirsutum [American cotton]
gb|KJB66303.1|  hypothetical protein B456_010G134500                    206   2e-58   Gossypium raimondii
ref|XP_002306707.1|  CesA7A-like family protein                         206   2e-58   Populus trichocarpa [western balsam poplar]
gb|KJB59451.1|  hypothetical protein B456_009G255100                    206   2e-58   Gossypium raimondii
gb|AGV22110.1|  cellulose synthase 8                                    206   3e-58   Betula luminifera [liang ye hua]
gb|KJB14950.1|  hypothetical protein B456_002G150300                    206   3e-58   Gossypium raimondii
gb|KJB59449.1|  hypothetical protein B456_009G255100                    206   3e-58   Gossypium raimondii
gb|KHG29218.1|  Cellulose synthase A catalytic subunit 6 [UDP-for...    206   3e-58   Gossypium arboreum [tree cotton]
ref|XP_009782822.1|  PREDICTED: cellulose synthase A catalytic su...    204   8e-58   Nicotiana sylvestris
gb|AFY06685.1|  cellulose synthase                                      204   8e-58   Nicotiana tabacum [American tobacco]
ref|XP_009758840.1|  PREDICTED: cellulose synthase A catalytic su...    204   9e-58   Nicotiana sylvestris
ref|XP_009609627.1|  PREDICTED: cellulose synthase A catalytic su...    204   9e-58   Nicotiana tomentosiformis
ref|XP_004290503.1|  PREDICTED: cellulose synthase A catalytic su...    204   9e-58   Fragaria vesca subsp. vesca
gb|KHG02518.1|  Cellulose synthase A catalytic subunit 2 [UDP-for...    204   1e-57   Gossypium arboreum [tree cotton]
gb|AEI87569.1|  cellulose synthase catalytic subunit protein            204   1e-57   Nicotiana tabacum [American tobacco]
gb|KJB59452.1|  hypothetical protein B456_009G255100                    204   1e-57   Gossypium raimondii
ref|XP_010241683.1|  PREDICTED: cellulose synthase A catalytic su...    204   1e-57   Nelumbo nucifera [Indian lotus]
gb|EYU17481.1|  hypothetical protein MIMGU_mgv1a000527mg                204   1e-57   Erythranthe guttata [common monkey flower]
ref|XP_006367803.1|  PREDICTED: cellulose synthase A catalytic su...    204   1e-57   Solanum tuberosum [potatoes]
ref|XP_004237809.1|  PREDICTED: cellulose synthase A catalytic su...    204   1e-57   Solanum lycopersicum
ref|XP_007048203.1|  Cellulose synthase 6                               203   2e-57   
gb|EYU36833.1|  hypothetical protein MIMGU_mgv1a000540mg                203   2e-57   Erythranthe guttata [common monkey flower]
ref|XP_009629755.1|  PREDICTED: cellulose synthase A catalytic su...    203   2e-57   Nicotiana tomentosiformis
gb|KJB18370.1|  hypothetical protein B456_003G049300                    203   2e-57   Gossypium raimondii
gb|KJB18373.1|  hypothetical protein B456_003G049300                    203   3e-57   Gossypium raimondii
ref|XP_009376550.1|  PREDICTED: cellulose synthase A catalytic su...    203   3e-57   Pyrus x bretschneideri [bai li]
gb|AAK49454.1|AF304374_1  cellulose synthase catalytic subunit          203   3e-57   Nicotiana alata [flowering tobacco]
ref|XP_002307145.1|  cellulose synthase family protein                  202   3e-57   Populus trichocarpa [western balsam poplar]
gb|AFZ78560.1|  cellulose synthase                                      202   4e-57   Populus tomentosa [Chinese white poplar]
ref|XP_002524299.1|  Cellulose synthase A catalytic subunit 6 [UD...    202   5e-57   Ricinus communis
gb|AFB18639.1|  CESA9                                                   202   6e-57   Gossypium hirsutum [American cotton]
gb|KJB59450.1|  hypothetical protein B456_009G255100                    201   6e-57   Gossypium raimondii
gb|KDP35302.1|  hypothetical protein JCGZ_09461                         202   8e-57   Jatropha curcas
gb|AAO25581.1|  cellulose synthase                                      202   8e-57   Populus tremuloides
ref|XP_008232182.1|  PREDICTED: cellulose synthase A catalytic su...    202   8e-57   Prunus mume [ume]
gb|KHG24947.1|  Cellulose synthase A catalytic subunit 2 [UDP-for...    201   8e-57   Gossypium arboreum [tree cotton]
ref|XP_007213713.1|  hypothetical protein PRUPE_ppa000567mg             201   9e-57   Prunus persica
ref|XP_011021978.1|  PREDICTED: cellulose synthase A catalytic su...    201   9e-57   Populus euphratica
ref|XP_011013552.1|  PREDICTED: cellulose synthase A catalytic su...    201   9e-57   Populus euphratica
ref|XP_011021980.1|  PREDICTED: cellulose synthase A catalytic su...    201   9e-57   Populus euphratica
ref|XP_011013550.1|  PREDICTED: cellulose synthase A catalytic su...    201   9e-57   Populus euphratica
ref|XP_007159799.1|  hypothetical protein PHAVU_002G268200g             201   9e-57   Phaseolus vulgaris [French bean]
gb|AAT09898.1|  cellulose synthase                                      201   9e-57   Populus tremula x Populus tremuloides
ref|XP_006473074.1|  PREDICTED: cellulose synthase A catalytic su...    201   1e-56   Citrus sinensis [apfelsine]
ref|XP_006434481.1|  hypothetical protein CICLE_v10000103mg             201   1e-56   Citrus clementina [clementine]
gb|KDO83761.1|  hypothetical protein CISIN_1g001373mg                   201   1e-56   Citrus sinensis [apfelsine]
gb|KDO83760.1|  hypothetical protein CISIN_1g001373mg                   201   1e-56   Citrus sinensis [apfelsine]
gb|KJB18372.1|  hypothetical protein B456_003G049300                    201   1e-56   Gossypium raimondii
gb|AEE60899.1|  cellulose synthase                                      201   1e-56   Populus tomentosa [Chinese white poplar]
emb|CDP12843.1|  unnamed protein product                                201   2e-56   Coffea canephora [robusta coffee]
gb|KDP30751.1|  hypothetical protein JCGZ_15180                         201   2e-56   Jatropha curcas
ref|XP_003531396.1|  PREDICTED: cellulose synthase A catalytic su...    201   2e-56   Glycine max [soybeans]
ref|XP_010526630.1|  PREDICTED: cellulose synthase A catalytic su...    200   2e-56   Tarenaya hassleriana [spider flower]
gb|AFZ78553.1|  cellulose synthase                                      200   3e-56   Populus tomentosa [Chinese white poplar]
ref|XP_002310628.1|  cellulose synthase family protein                  199   5e-56   Populus trichocarpa [western balsam poplar]
gb|EPS58530.1|  hypothetical protein M569_16283                         190   5e-56   Genlisea aurea
ref|XP_002310629.1|  hypothetical protein POPTR_0007s07120g             199   5e-56   Populus trichocarpa [western balsam poplar]
ref|XP_010520165.1|  PREDICTED: cellulose synthase A catalytic su...    198   1e-55   Tarenaya hassleriana [spider flower]
gb|KHN41284.1|  Cellulose synthase A catalytic subunit 6 [UDP-for...    195   4e-55   Glycine soja [wild soybean]
ref|XP_010547636.1|  PREDICTED: cellulose synthase A catalytic su...    197   4e-55   Tarenaya hassleriana [spider flower]
ref|XP_002864919.1|  hypothetical protein ARALYDRAFT_496689             197   4e-55   
ref|NP_201279.1|  cellulose synthase A catalytic subunit 6 [UDP-f...    196   6e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003630174.1|  Cellulose synthase A catalytic subunit             196   6e-55   Medicago truncatula
ref|XP_006279743.1|  hypothetical protein CARUB_v10027598mg             196   8e-55   Capsella rubella
ref|XP_010260984.1|  PREDICTED: cellulose synthase A catalytic su...    196   9e-55   Nelumbo nucifera [Indian lotus]
ref|XP_003536418.1|  PREDICTED: cellulose synthase A catalytic su...    196   1e-54   Glycine max [soybeans]
ref|XP_009350645.1|  PREDICTED: cellulose synthase A catalytic su...    196   1e-54   
ref|XP_009350646.1|  PREDICTED: cellulose synthase A catalytic su...    196   1e-54   Pyrus x bretschneideri [bai li]
ref|XP_010444419.1|  PREDICTED: cellulose synthase A catalytic su...    195   2e-54   Camelina sativa [gold-of-pleasure]
ref|XP_008440995.1|  PREDICTED: cellulose synthase A catalytic su...    195   2e-54   Cucumis melo [Oriental melon]
ref|XP_002871389.1|  hypothetical protein ARALYDRAFT_908936             195   2e-54   Arabidopsis lyrata subsp. lyrata
ref|XP_007143558.1|  hypothetical protein PHAVU_007G081700g             195   2e-54   Phaseolus vulgaris [French bean]
ref|XP_010462809.1|  PREDICTED: cellulose synthase A catalytic su...    195   2e-54   Camelina sativa [gold-of-pleasure]
ref|XP_007151999.1|  hypothetical protein PHAVU_004G093300g             195   2e-54   Phaseolus vulgaris [French bean]
emb|CDY08854.1|  BnaA06g23700D                                          194   3e-54   Brassica napus [oilseed rape]
ref|XP_008338760.1|  PREDICTED: cellulose synthase A catalytic su...    195   3e-54   
ref|NP_196549.1|  cellulose synthase A catalytic subunit 5 [UDP-f...    194   3e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004141979.1|  PREDICTED: probable cellulose synthase A cat...    194   3e-54   Cucumis sativus [cucumbers]
emb|CDY14504.1|  BnaC03g49550D                                          194   3e-54   Brassica napus [oilseed rape]
gb|KEH43649.1|  cellulose synthase-like protein                         194   3e-54   Medicago truncatula
gb|AES62337.2|  cellulose synthase-like protein                         194   3e-54   Medicago truncatula
ref|XP_009150553.1|  PREDICTED: cellulose synthase A catalytic su...    194   3e-54   Brassica rapa
gb|KDO57137.1|  hypothetical protein CISIN_1g001369mg                   194   4e-54   Citrus sinensis [apfelsine]
ref|XP_011042923.1|  PREDICTED: cellulose synthase A catalytic su...    193   4e-54   Populus euphratica
ref|XP_006427904.1|  hypothetical protein CICLE_v10024766mg             194   4e-54   Citrus clementina [clementine]
ref|XP_009112155.1|  PREDICTED: cellulose synthase A catalytic su...    194   4e-54   Brassica rapa
emb|CDX81249.1|  BnaC09g06600D                                          194   4e-54   
emb|CDY18696.1|  BnaA09g06990D                                          194   4e-54   Brassica napus [oilseed rape]
gb|KHN00756.1|  Cellulose synthase A catalytic subunit 6 [UDP-for...    194   4e-54   Glycine soja [wild soybean]
ref|XP_003518592.1|  PREDICTED: cellulose synthase A catalytic su...    194   5e-54   Glycine max [soybeans]
gb|EYU17480.1|  hypothetical protein MIMGU_mgv1a000527mg                193   5e-54   Erythranthe guttata [common monkey flower]
ref|XP_010491630.1|  PREDICTED: cellulose synthase A catalytic su...    194   6e-54   Camelina sativa [gold-of-pleasure]
gb|ACS68196.1|  cellulose synthase 6.1 catalytic subunit                194   6e-54   Brassica napus [oilseed rape]
ref|XP_010452989.1|  PREDICTED: cellulose synthase A catalytic su...    193   6e-54   Camelina sativa [gold-of-pleasure]
gb|KHN34038.1|  Cellulose synthase A catalytic subunit 6 [UDP-for...    193   7e-54   Glycine soja [wild soybean]
ref|XP_003525098.1|  PREDICTED: cellulose synthase A catalytic su...    193   7e-54   Glycine max [soybeans]
gb|KJB18371.1|  hypothetical protein B456_003G049300                    192   8e-54   Gossypium raimondii
ref|XP_010484268.1|  PREDICTED: cellulose synthase A catalytic su...    193   9e-54   Camelina sativa [gold-of-pleasure]
gb|AEK86669.1|  cellulose synthase 5                                    192   9e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002866842.1|  hypothetical protein ARALYDRAFT_490712             193   9e-54   
ref|XP_010546378.1|  PREDICTED: cellulose synthase A catalytic su...    193   1e-53   Tarenaya hassleriana [spider flower]
gb|AGV22108.1|  cellulose synthase 6                                    192   2e-53   Betula luminifera [liang ye hua]
gb|KHG03006.1|  Cellulose synthase A catalytic subunit 2 [UDP-for...    192   2e-53   Gossypium arboreum [tree cotton]
ref|XP_006411737.1|  hypothetical protein EUTSA_v10024277mg             192   2e-53   Eutrema salsugineum [saltwater cress]
gb|EYU31127.1|  hypothetical protein MIMGU_mgv1a000549mg                192   2e-53   Erythranthe guttata [common monkey flower]
ref|XP_003548102.1|  PREDICTED: cellulose synthase A catalytic su...    192   2e-53   Glycine max [soybeans]
ref|XP_004503981.1|  PREDICTED: cellulose synthase A catalytic su...    192   2e-53   Cicer arietinum [garbanzo]
gb|KFK25282.1|  hypothetical protein AALP_AA8G091900                    191   3e-53   Arabis alpina [alpine rockcress]
gb|AHL45029.1|  cellulose synthase 6C                                   192   3e-53   Linum usitatissimum
gb|AHL45030.1|  cellulose synthase 6D                                   191   3e-53   Linum usitatissimum
ref|XP_006399471.1|  hypothetical protein EUTSA_v10012521mg             191   3e-53   Eutrema salsugineum [saltwater cress]
ref|XP_007213712.1|  hypothetical protein PRUPE_ppa000567mg             189   4e-53   
ref|XP_011090445.1|  PREDICTED: cellulose synthase A catalytic su...    191   7e-53   Sesamum indicum [beniseed]
ref|XP_010680991.1|  PREDICTED: cellulose synthase A catalytic su...    191   8e-53   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO83763.1|  hypothetical protein CISIN_1g001373mg                   188   9e-53   Citrus sinensis [apfelsine]
ref|NP_195645.1|  cellulose synthase A catalytic subunit 2 [UDP-f...    190   1e-52   Arabidopsis thaliana [mouse-ear cress]
emb|CDY31305.1|  BnaA02g34360D                                          190   1e-52   Brassica napus [oilseed rape]
gb|AAC29067.1|  cellulose synthase                                      190   1e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006283042.1|  hypothetical protein CARUB_v10004034mg             190   1e-52   Capsella rubella
ref|XP_006286951.1|  hypothetical protein CARUB_v10000099mg             190   1e-52   Capsella rubella
emb|CDY42621.1|  BnaC01g00330D                                          190   1e-52   Brassica napus [oilseed rape]
ref|XP_009115076.1|  PREDICTED: cellulose synthase A catalytic su...    190   1e-52   Brassica rapa
emb|CDY41973.1|  BnaA01g05450D                                          190   1e-52   Brassica napus [oilseed rape]
ref|XP_010088737.1|  Isoxaben-resistant protein 2                       189   2e-52   Morus notabilis
gb|ACS68191.1|  cellulose synthase 2.1 catalytic subunit                189   2e-52   Brassica napus [oilseed rape]
ref|XP_009131129.1|  PREDICTED: cellulose synthase A catalytic su...    189   2e-52   Brassica rapa
ref|XP_010678670.1|  PREDICTED: cellulose synthase A catalytic su...    189   2e-52   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY56540.1|  BnaA03g55860D                                          189   2e-52   Brassica napus [oilseed rape]
ref|XP_009130469.1|  PREDICTED: cellulose synthase A catalytic su...    189   2e-52   Brassica rapa
gb|KDO83762.1|  hypothetical protein CISIN_1g001373mg                   188   3e-52   Citrus sinensis [apfelsine]
ref|XP_010437052.1|  PREDICTED: cellulose synthase A catalytic su...    189   3e-52   Camelina sativa [gold-of-pleasure]
emb|CDX81145.1|  BnaC03g03990D                                          188   4e-52   
gb|ACS68195.1|  cellulose synthase 5.1 catalytic subunit                188   4e-52   Brassica napus [oilseed rape]
ref|XP_010431901.1|  PREDICTED: cellulose synthase A catalytic su...    188   4e-52   Camelina sativa [gold-of-pleasure]
emb|CDY46820.1|  BnaC02g43280D                                          188   4e-52   Brassica napus [oilseed rape]
ref|XP_002878571.1|  hypothetical protein ARALYDRAFT_900606             188   4e-52   Arabidopsis lyrata subsp. lyrata
gb|AHL45027.1|  cellulose synthase 6A                                   188   6e-52   Linum usitatissimum
gb|AHL45028.1|  cellulose synthase 6B                                   188   7e-52   Linum usitatissimum
ref|XP_010027732.1|  PREDICTED: cellulose synthase A catalytic su...    187   8e-52   Eucalyptus grandis [rose gum]
ref|XP_003592086.1|  Cellulose synthase                                 187   1e-51   
ref|XP_006394118.1|  hypothetical protein EUTSA_v100035740mg            184   2e-51   
dbj|BAF01335.1|  cellulose synthase                                     184   2e-51   Arabidopsis thaliana [mouse-ear cress]
gb|KDO57138.1|  hypothetical protein CISIN_1g001369mg                   183   5e-51   Citrus sinensis [apfelsine]
ref|XP_002277635.1|  PREDICTED: cellulose synthase A catalytic su...    185   8e-51   Vitis vinifera
ref|XP_006847152.1|  hypothetical protein AMTR_s00017p00239550          184   2e-50   Amborella trichopoda
ref|XP_006427905.1|  hypothetical protein CICLE_v10024766mg             182   2e-50   
emb|CBI21555.3|  unnamed protein product                                183   2e-50   Vitis vinifera
ref|NP_179768.1|  cellulose synthase A9                                 183   3e-50   Arabidopsis thaliana [mouse-ear cress]
gb|EPS71230.1|  hypothetical protein M569_03522                         183   3e-50   Genlisea aurea
ref|XP_010446473.1|  PREDICTED: cellulose synthase A catalytic su...    180   5e-49   Camelina sativa [gold-of-pleasure]
gb|EPS66740.1|  hypothetical protein M569_08032                         179   8e-49   Genlisea aurea
ref|XP_004502891.1|  PREDICTED: cellulose synthase A catalytic su...    178   2e-48   Cicer arietinum [garbanzo]
ref|XP_006351001.1|  PREDICTED: cellulose synthase A catalytic su...    177   5e-48   Solanum tuberosum [potatoes]
ref|XP_010312466.1|  PREDICTED: cellulose synthase A catalytic su...    174   5e-47   Solanum lycopersicum
gb|KHG02517.1|  Cellulose synthase A catalytic subunit 2 [UDP-for...    173   1e-46   Gossypium arboreum [tree cotton]
ref|XP_010063851.1|  PREDICTED: cellulose synthase A catalytic su...    169   2e-45   Eucalyptus grandis [rose gum]
ref|XP_010063847.1|  PREDICTED: cellulose synthase A catalytic su...    169   2e-45   Eucalyptus grandis [rose gum]
gb|AFD33697.1|  cellulose synthase A                                    167   1e-44   Eucalyptus camaldulensis
ref|XP_010927397.1|  PREDICTED: cellulose synthase A catalytic su...    160   3e-42   Elaeis guineensis
ref|XP_011079381.1|  PREDICTED: cellulose synthase A catalytic su...    159   9e-42   
ref|XP_011079380.1|  PREDICTED: cellulose synthase A catalytic su...    159   9e-42   Sesamum indicum [beniseed]
ref|XP_011079382.1|  PREDICTED: cellulose synthase A catalytic su...    159   1e-41   
ref|XP_011083940.1|  PREDICTED: cellulose synthase A catalytic su...    157   3e-41   Sesamum indicum [beniseed]
gb|EYU35355.1|  hypothetical protein MIMGU_mgv1a000638mg                157   4e-41   Erythranthe guttata [common monkey flower]
ref|XP_010687624.1|  PREDICTED: cellulose synthase A catalytic su...    156   1e-40   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009622821.1|  PREDICTED: cellulose synthase A catalytic su...    155   2e-40   Nicotiana tomentosiformis
ref|XP_009777624.1|  PREDICTED: cellulose synthase A catalytic su...    155   2e-40   Nicotiana sylvestris
ref|XP_009622822.1|  PREDICTED: cellulose synthase A catalytic su...    155   2e-40   Nicotiana tomentosiformis
ref|XP_004242614.1|  PREDICTED: cellulose synthase A catalytic su...    155   2e-40   Solanum lycopersicum
gb|AFW69155.1|  putative cellulose synthase family protein              154   3e-40   
ref|XP_006343620.1|  PREDICTED: cellulose synthase A catalytic su...    154   3e-40   Solanum tuberosum [potatoes]
ref|XP_009414591.1|  PREDICTED: cellulose synthase A catalytic su...    154   5e-40   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFR38707.1|  cellulose synthase                                      141   5e-40   Populus trichocarpa [western balsam poplar]
gb|AFR38732.1|  cellulose synthase                                      141   5e-40   Populus fremontii
gb|AFR38726.1|  cellulose synthase                                      141   6e-40   Populus alba [abele]
gb|AFR38730.1|  cellulose synthase                                      141   6e-40   Populus fremontii
gb|AFR38723.1|  cellulose synthase                                      141   6e-40   Populus alba [abele]
gb|AFR38724.1|  cellulose synthase                                      141   6e-40   Populus alba [abele]
ref|XP_004956855.1|  PREDICTED: cellulose synthase A catalytic su...    154   8e-40   Setaria italica
ref|XP_008450511.1|  PREDICTED: cellulose synthase A catalytic su...    154   8e-40   Cucumis melo [Oriental melon]
ref|XP_002460229.1|  hypothetical protein SORBIDRAFT_02g025020          153   8e-40   Sorghum bicolor [broomcorn]
ref|NP_001105532.1|  cellulose synthase catalytic subunit 12            153   9e-40   Zea mays [maize]
gb|KHG11460.1|  Cellulose synthase A catalytic subunit 7 [UDP-for...    153   9e-40   Gossypium arboreum [tree cotton]
ref|XP_006660635.1|  PREDICTED: cellulose synthase A catalytic su...    153   1e-39   Oryza brachyantha
emb|CDP02834.1|  unnamed protein product                                153   1e-39   Coffea canephora [robusta coffee]
ref|XP_008794369.1|  PREDICTED: cellulose synthase A catalytic su...    153   1e-39   Phoenix dactylifera
gb|KCW78813.1|  hypothetical protein EUGRSUZ_C00246                     153   1e-39   Eucalyptus grandis [rose gum]
gb|AFB18637.1|  CESA8                                                   153   1e-39   Gossypium hirsutum [American cotton]
gb|KJB53884.1|  hypothetical protein B456_009G009700                    153   1e-39   Gossypium raimondii
ref|XP_008670200.1|  PREDICTED: cellulose synthase A catalytic su...    153   1e-39   
gb|KHG19749.1|  Cellulose synthase A catalytic subunit 7 [UDP-for...    153   1e-39   Gossypium arboreum [tree cotton]
gb|AFR58756.2|  cellulose synthase 3                                    153   1e-39   Eucalyptus tereticornis [red ironbark]
gb|AGE09566.1|  cellulose synthase-like protein                         153   1e-39   Eucalyptus cladocalyx
ref|XP_010929171.1|  PREDICTED: cellulose synthase A catalytic su...    153   1e-39   Elaeis guineensis
gb|KCW78814.1|  hypothetical protein EUGRSUZ_C00246                     153   1e-39   Eucalyptus grandis [rose gum]
gb|AEK31217.1|  cellulose synthase A                                    153   1e-39   Eucalyptus camaldulensis
gb|KCW78815.1|  hypothetical protein EUGRSUZ_C00246                     153   1e-39   Eucalyptus grandis [rose gum]
ref|XP_010265522.1|  PREDICTED: cellulose synthase A catalytic su...    152   2e-39   Nelumbo nucifera [Indian lotus]
gb|KCW78812.1|  hypothetical protein EUGRSUZ_C00246                     152   2e-39   Eucalyptus grandis [rose gum]
gb|AGJ71354.1|  cellulose synthase 3                                    152   2e-39   Eucalyptus urophylla
ref|NP_001289644.1|  cellulose synthase A catalytic subunit 7           152   2e-39   Eucalyptus grandis [rose gum]
gb|AFB18636.1|  CESA7                                                   152   2e-39   Gossypium hirsutum [American cotton]
gb|KJB07762.1|  hypothetical protein B456_001G044700                    152   2e-39   Gossypium raimondii
gb|KJB07761.1|  hypothetical protein B456_001G044700                    152   2e-39   Gossypium raimondii
ref|XP_009410192.1|  PREDICTED: cellulose synthase A catalytic su...    152   2e-39   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGX27214.1|  cellulose synthase 7                                    152   2e-39   Populus tomentosa [Chinese white poplar]
gb|AAM26299.1|  cellulose synthase                                      152   2e-39   Populus tremuloides
ref|XP_002325122.1|  cellulose synthase family protein                  152   2e-39   
ref|XP_008790154.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    152   2e-39   Phoenix dactylifera
gb|EPS60781.1|  hypothetical protein M569_14019                         152   2e-39   Genlisea aurea
gb|AFR38984.1|  cellulose synthase                                      139   2e-39   Populus trichocarpa [western balsam poplar]
ref|XP_007013859.1|  Cellulose synthase family protein isoform 1        152   2e-39   
ref|XP_002963550.1|  family 2 glycosyltransferase                       152   3e-39   
dbj|BAJ85783.1|  predicted protein                                      152   3e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009417280.1|  PREDICTED: probable cellulose synthase A cat...    152   3e-39   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFZ78551.1|  cellulose synthase                                      152   3e-39   Populus tomentosa [Chinese white poplar]
tpg|DAA61529.1|  TPA: putative cellulose synthase family protein        152   3e-39   
ref|XP_011033387.1|  PREDICTED: cellulose synthase A catalytic su...    152   3e-39   Populus euphratica
ref|XP_011018058.1|  PREDICTED: cellulose synthase A catalytic su...    152   3e-39   Populus euphratica
ref|XP_009408434.1|  PREDICTED: probable cellulose synthase A cat...    152   3e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004152851.1|  PREDICTED: cellulose synthase A catalytic su...    151   4e-39   Cucumis sativus [cucumbers]
dbj|BAM05574.1|  cellulose synthase 3                                   148   4e-39   Eucalyptus pyrocarpa
gb|AEE60897.1|  cellulose synthase                                      151   5e-39   Populus tomentosa [Chinese white poplar]
dbj|BAJ05813.1|  cellulose synthase catalytic subunit                   151   5e-39   Oryza sativa Indica Group [Indian rice]
ref|NP_001063207.1|  Os09g0422500                                       151   5e-39   
gb|ACJ38667.1|  cellulose synthase                                      151   6e-39   Betula luminifera [liang ye hua]
ref|XP_004287144.1|  PREDICTED: cellulose synthase A catalytic su...    150   8e-39   Fragaria vesca subsp. vesca
ref|XP_010273667.1|  PREDICTED: cellulose synthase A catalytic su...    150   8e-39   Nelumbo nucifera [Indian lotus]
ref|XP_009385959.1|  PREDICTED: probable cellulose synthase A cat...    150   8e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006826669.1|  hypothetical protein AMTR_s00137p00043990          150   8e-39   
gb|AGX27222.1|  cellulose synthase 7                                    150   9e-39   Populus tomentosa [Chinese white poplar]
gb|AGX27212.1|  cellulose synthase 7                                    150   9e-39   Populus tomentosa [Chinese white poplar]
gb|AGX27236.1|  cellulose synthase 7                                    150   9e-39   Populus tomentosa [Chinese white poplar]
gb|AGX27231.1|  cellulose synthase 7                                    150   9e-39   Populus tomentosa [Chinese white poplar]
gb|AGX27229.1|  cellulose synthase 7                                    150   9e-39   Populus tomentosa [Chinese white poplar]
gb|AGX27219.1|  cellulose synthase 7                                    150   9e-39   Populus tomentosa [Chinese white poplar]
gb|AGX27205.1|  cellulose synthase 7                                    150   9e-39   Populus tomentosa [Chinese white poplar]
gb|AGX27203.1|  cellulose synthase 7                                    150   9e-39   Populus tomentosa [Chinese white poplar]
gb|AGX27199.1|  cellulose synthase 7                                    150   9e-39   Populus tomentosa [Chinese white poplar]
gb|AFZ78559.1|  cellulose synthase                                      150   9e-39   Populus tomentosa [Chinese white poplar]
gb|AGX27233.1|  cellulose synthase 7                                    150   1e-38   Populus tomentosa [Chinese white poplar]
gb|AGX27223.1|  cellulose synthase 7                                    150   1e-38   Populus tomentosa [Chinese white poplar]
gb|AGX27220.1|  cellulose synthase 7                                    150   1e-38   Populus tomentosa [Chinese white poplar]
gb|AGX27216.1|  cellulose synthase 7                                    150   1e-38   Populus tomentosa [Chinese white poplar]
gb|AGX27215.1|  cellulose synthase 7                                    150   1e-38   Populus tomentosa [Chinese white poplar]
gb|AGX27201.1|  cellulose synthase 7                                    150   1e-38   Populus tomentosa [Chinese white poplar]
gb|AGX27238.1|  cellulose synthase 7                                    150   1e-38   Populus tomentosa [Chinese white poplar]
gb|AGX27235.1|  cellulose synthase 7                                    150   1e-38   Populus tomentosa [Chinese white poplar]
gb|AGX27211.1|  cellulose synthase 7                                    150   1e-38   Populus tomentosa [Chinese white poplar]
gb|AGX27206.1|  cellulose synthase 7                                    150   1e-38   Populus tomentosa [Chinese white poplar]
gb|AGX27202.1|  cellulose synthase 7                                    150   1e-38   Populus tomentosa [Chinese white poplar]
gb|KEH32618.1|  cellulose synthase-like protein                         150   1e-38   Medicago truncatula
ref|XP_004507755.1|  PREDICTED: cellulose synthase A catalytic su...    150   1e-38   Cicer arietinum [garbanzo]
ref|XP_006381880.1|  hypothetical protein POPTR_0006s19580g             150   1e-38   
ref|XP_002308412.1|  cellulose synthase family protein                  150   1e-38   
gb|AFP93559.1|  cellulose synthase A1                                   150   1e-38   
ref|XP_003610282.1|  Cellulose synthase catalytic subunit               150   1e-38   
ref|XP_002533228.1|  Cellulose synthase A catalytic subunit 3 [UD...    150   1e-38   
ref|XP_010545449.1|  PREDICTED: cellulose synthase A catalytic su...    150   1e-38   
gb|AII73574.1|  cellulose synthase 7-A                                  150   1e-38   
ref|XP_010250039.1|  PREDICTED: probable cellulose synthase A cat...    150   1e-38   
gb|ACJ38665.1|  cellulose synthase                                      150   1e-38   
ref|XP_006474027.1|  PREDICTED: cellulose synthase A catalytic su...    150   2e-38   
ref|XP_006842872.1|  hypothetical protein AMTR_s00081p00171100          150   2e-38   
ref|XP_006474028.1|  PREDICTED: cellulose synthase A catalytic su...    150   2e-38   
gb|KDO62270.1|  hypothetical protein CISIN_1g039060mg                   150   2e-38   
ref|XP_009366208.1|  PREDICTED: cellulose synthase A catalytic su...    150   2e-38   
ref|XP_008243020.1|  PREDICTED: cellulose synthase A catalytic su...    150   2e-38   
ref|XP_007204670.1|  hypothetical protein PRUPE_ppa000618mg             150   2e-38   
gb|ACC59196.1|  cellulose synthase                                      150   2e-38   
ref|XP_006453581.1|  hypothetical protein CICLE_v10007321mg             150   2e-38   
ref|XP_010091161.1|  OsCesA7 protein                                    150   2e-38   
gb|KHG19971.1|  Cellulose synthase A catalytic subunit 9 [UDP-for...    142   2e-38   
gb|KHG22630.1|  Cellulose synthase A catalytic subunit 9 [UDP-for...    142   2e-38   
ref|XP_003522926.1|  PREDICTED: cellulose synthase A catalytic su...    149   2e-38   
gb|ACT67415.1|  cellulose synthase                                      149   2e-38   
emb|CAN73700.1|  hypothetical protein VITISV_013112                     149   3e-38   
dbj|BAM05571.1|  cellulose synthase 3                                   141   3e-38   
dbj|BAG06269.1|  cellulose synthase Z811                                148   3e-38   
ref|XP_008362868.1|  PREDICTED: cellulose synthase A catalytic su...    149   3e-38   
gb|AHH81946.1|  cellulose synthase                                      149   3e-38   
ref|XP_009358418.1|  PREDICTED: cellulose synthase A catalytic su...    149   4e-38   
gb|KHN17507.1|  Cellulose synthase A catalytic subunit 7 [UDP-for...    149   4e-38   
gb|EYU17477.1|  hypothetical protein MIMGU_mgv1a016004mg                137   4e-38   
gb|AFR38735.1|  cellulose synthase                                      136   4e-38   
gb|AEE60896.1|  cellulose synthase                                      149   4e-38   
ref|XP_002276890.2|  PREDICTED: cellulose synthase A catalytic su...    149   4e-38   
ref|XP_003598145.1|  Cellulose synthase                                 149   4e-38   
gb|KHN14136.1|  Cellulose synthase A catalytic subunit 7 [UDP-for...    148   5e-38   
ref|XP_003519160.1|  PREDICTED: cellulose synthase A catalytic su...    148   5e-38   
gb|AGX27207.1|  cellulose synthase 7                                    148   5e-38   
ref|XP_007018605.1|  Cellulose synthase 6                               149   5e-38   
ref|XP_003549532.1|  PREDICTED: cellulose synthase A catalytic su...    148   5e-38   
ref|XP_006600535.1|  PREDICTED: cellulose synthase A catalytic su...    148   5e-38   
ref|XP_010905024.1|  PREDICTED: cellulose synthase A catalytic su...    148   6e-38   
gb|KJB49074.1|  hypothetical protein B456_008G100100                    140   6e-38   
ref|XP_003578137.1|  PREDICTED: cellulose synthase A catalytic su...    148   6e-38   
ref|XP_007138395.1|  hypothetical protein PHAVU_009G205100g             148   6e-38   
ref|XP_010254360.1|  PREDICTED: probable cellulose synthase A cat...    148   7e-38   
dbj|BAF93202.1|  cellulose synthase catalytic subunit                   148   7e-38   
ref|XP_006849886.1|  hypothetical protein AMTR_s00022p00086120          148   7e-38   
gb|ADD71499.1|  cellulose synthase catalytic subunit                    148   8e-38   
ref|XP_003568832.2|  PREDICTED: probable cellulose synthase A cat...    147   1e-37   
ref|XP_006400279.1|  hypothetical protein EUTSA_v10012538mg             147   1e-37   
ref|XP_003527198.1|  PREDICTED: cellulose synthase A catalytic su...    147   1e-37   
ref|XP_010912005.1|  PREDICTED: cellulose synthase A catalytic su...    147   1e-37   
ref|XP_002873827.1|  hypothetical protein ARALYDRAFT_909737             147   1e-37   
emb|CDP13491.1|  unnamed protein product                                147   1e-37   
ref|XP_008784981.1|  PREDICTED: probable cellulose synthase A cat...    147   1e-37   
ref|XP_010925238.1|  PREDICTED: probable cellulose synthase A cat...    147   1e-37   
gb|KEH32617.1|  cellulose synthase-like protein                         147   1e-37   
ref|XP_004238519.1|  PREDICTED: probable cellulose synthase A cat...    147   2e-37   
ref|XP_010932185.1|  PREDICTED: probable cellulose synthase A cat...    147   2e-37   
ref|XP_006286973.1|  hypothetical protein CARUB_v10000119mg             147   2e-37   
ref|XP_006354075.1|  PREDICTED: probable cellulose synthase A cat...    147   2e-37   
gb|EMT30130.1|  Cellulose synthase A catalytic subunit 9 (UDP-for...    146   2e-37   
gb|KEH32616.1|  cellulose synthase-like protein                         145   3e-37   
gb|AFW81389.1|  cellulose synthase1                                     146   3e-37   
gb|AFW81388.1|  cellulose synthase1                                     146   3e-37   
gb|ACS68197.1|  cellulose synthase 7.1 catalytic subunit                146   3e-37   
ref|XP_009131595.1|  PREDICTED: cellulose synthase A catalytic su...    146   3e-37   
gb|AAX18649.1|  cellulose synthase catalytic subunit                    146   3e-37   
ref|XP_008785840.1|  PREDICTED: cellulose synthase A catalytic su...    146   4e-37   
ref|XP_010453933.1|  PREDICTED: cellulose synthase A catalytic su...    146   4e-37   
gb|AAT57672.1|  cellulose synthase catalytic subunit                    146   4e-37   
ref|XP_010453934.1|  PREDICTED: cellulose synthase A catalytic su...    146   4e-37   
ref|XP_010492694.1|  PREDICTED: cellulose synthase A catalytic su...    145   4e-37   
ref|XP_010914890.1|  PREDICTED: probable cellulose synthase A cat...    146   4e-37   
ref|XP_002277713.1|  PREDICTED: probable cellulose synthase A cat...    146   4e-37   
ref|XP_006435515.1|  hypothetical protein CICLE_v10000117mg             146   4e-37   
ref|XP_010420462.1|  PREDICTED: cellulose synthase A catalytic su...    145   4e-37   
ref|XP_010420461.1|  PREDICTED: cellulose synthase A catalytic su...    145   4e-37   
gb|KFK25952.1|  hypothetical protein AALP_AA8G184200                    145   4e-37   
gb|KFK25953.1|  hypothetical protein AALP_AA8G184200                    145   4e-37   
ref|NP_001104954.1|  cellulose synthase-1                               145   4e-37   
ref|XP_008366693.1|  PREDICTED: cellulose synthase A catalytic su...    145   5e-37   
gb|AAD32031.1|AF088917_1  cellulose synthase catalytic subunit          145   5e-37   
gb|AFM37966.1|  cellulose synthase catalytic subunit                    145   5e-37   
ref|XP_008394301.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    145   5e-37   
gb|KDO85323.1|  hypothetical protein CISIN_1g045222mg                   145   5e-37   
ref|NP_197244.1|  cellulose synthase A catalytic subunit 7 [UDP-f...    145   5e-37   
ref|XP_008394069.1|  PREDICTED: cellulose synthase A catalytic su...    145   5e-37   
ref|XP_008796456.1|  PREDICTED: probable cellulose synthase A cat...    145   6e-37   
ref|XP_007154868.1|  hypothetical protein PHAVU_003G154600g             145   6e-37   
ref|XP_009126184.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    145   6e-37   
gb|AGC97433.2|  cellulose synthase                                      145   7e-37   
gb|AAY43217.1|  cellulose synthase BoCesA1                              145   7e-37   
ref|XP_009355721.1|  PREDICTED: cellulose synthase A catalytic su...    145   7e-37   
ref|XP_002319002.2|  cellulose synthase 6 family protein                145   7e-37   
gb|KDP36709.1|  hypothetical protein JCGZ_08000                         145   7e-37   
gb|AHL45024.1|  cellulose synthase 1B                                   145   8e-37   
gb|KCW81421.1|  hypothetical protein EUGRSUZ_C02801                     145   8e-37   
gb|AFR39009.1|  cellulose synthase                                      133   8e-37   
gb|AGV22109.1|  cellulose synthase 7                                    145   9e-37   
emb|CDX85455.1|  BnaA02g03580D                                          145   9e-37   
gb|KCW70399.1|  hypothetical protein EUGRSUZ_F03635                     145   9e-37   
ref|NP_001289657.1|  cellulose synthase A catalytic subunit 1           145   1e-36   
ref|NP_001051830.1|  Os03g0837100                                       145   1e-36   
ref|NP_001289648.1|  probable cellulose synthase A catalytic subu...    145   1e-36   
gb|AEK31219.1|  cellulose synthase A                                    145   1e-36   
gb|KCW70400.1|  hypothetical protein EUGRSUZ_F03635                     144   1e-36   
ref|XP_006494425.1|  PREDICTED: probable cellulose synthase A cat...    144   1e-36   
gb|AFI71895.1|  cellulose synthase 6                                    144   2e-36   
ref|XP_002440694.1|  hypothetical protein SORBIDRAFT_09g005280          144   2e-36   
ref|XP_010927484.1|  PREDICTED: probable cellulose synthase A cat...    144   2e-36   
ref|XP_008792060.1|  PREDICTED: probable cellulose synthase A cat...    144   2e-36   
ref|XP_010648652.1|  PREDICTED: cellulose synthase A catalytic su...    144   2e-36   
gb|KJB07760.1|  hypothetical protein B456_001G044700                    143   2e-36   
ref|XP_010270654.1|  PREDICTED: probable cellulose synthase A cat...    144   2e-36   
ref|XP_008796554.1|  PREDICTED: probable cellulose synthase A cat...    144   2e-36   
gb|AHL45023.1|  cellulose synthase 1A                                   144   2e-36   
gb|AAP40636.1|  cellulose synthase 6                                    144   3e-36   
ref|XP_004291468.1|  PREDICTED: cellulose synthase A catalytic su...    143   3e-36   
ref|XP_011459196.1|  PREDICTED: cellulose synthase A catalytic su...    143   3e-36   
ref|XP_007013860.1|  Cellulose synthase family protein isoform 2        142   3e-36   
ref|XP_011023647.1|  PREDICTED: probable cellulose synthase A cat...    143   3e-36   
gb|ADV58936.1|  cellulose synthase                                      143   3e-36   
gb|ADR74043.1|  cellulose synthase                                      143   3e-36   
emb|CBI40805.3|  unnamed protein product                                143   4e-36   
ref|NP_001105574.1|  cellulose synthase2                                143   4e-36   
gb|EYU32338.1|  hypothetical protein MIMGU_mgv1a000544mg                143   4e-36   
ref|XP_010255732.1|  PREDICTED: probable cellulose synthase A cat...    143   5e-36   
ref|XP_010255731.1|  PREDICTED: probable cellulose synthase A cat...    143   5e-36   
ref|XP_004965873.1|  PREDICTED: probable cellulose synthase A cat...    143   5e-36   
gb|AAY43224.2|  cellulose synthase BoCesA7                              143   5e-36   
ref|XP_006654097.1|  PREDICTED: probable cellulose synthase A cat...    143   5e-36   
ref|XP_002960719.1|  hypothetical protein SELMODRAFT_73698              142   6e-36   
ref|XP_002983952.1|  family 2 glycosyltransferase                       142   6e-36   
ref|XP_004955913.1|  PREDICTED: probable cellulose synthase A cat...    142   6e-36   
ref|XP_008219478.1|  PREDICTED: cellulose synthase A catalytic su...    142   6e-36   
ref|XP_007221583.1|  hypothetical protein PRUPE_ppa000611mg             142   6e-36   
gb|AFZ78555.1|  cellulose synthase                                      142   7e-36   
ref|XP_010270659.1|  PREDICTED: probable cellulose synthase A cat...    142   7e-36   
ref|XP_010238067.1|  PREDICTED: probable cellulose synthase A cat...    142   8e-36   
ref|XP_010238134.1|  PREDICTED: probable cellulose synthase A cat...    142   8e-36   
ref|XP_006651997.1|  PREDICTED: probable cellulose synthase A cat...    142   9e-36   
gb|ABI78958.1|  cellulose synthase 5                                    142   9e-36   
ref|XP_006450469.1|  hypothetical protein CICLE_v10007296mg             142   1e-35   
ref|XP_001757887.1|  cellulose synthase 5, glycosyltransferase fa...    142   1e-35   
ref|XP_010645442.1|  PREDICTED: probable cellulose synthase A cat...    142   1e-35   
ref|XP_009617929.1|  PREDICTED: probable cellulose synthase A cat...    141   1e-35   
ref|XP_009617930.1|  PREDICTED: probable cellulose synthase A cat...    141   1e-35   
ref|XP_002960291.1|  family 2 glycosyltransferase                       141   2e-35   
ref|XP_002967423.1|  hypothetical protein SELMODRAFT_86720              141   2e-35   
gb|AFS95066.1|  cellulose synthase                                      141   2e-35   
ref|XP_006382504.1|  cellulose synthase 6 family protein                141   2e-35   
ref|XP_007013842.1|  Cellulose synthase 1                               141   2e-35   
gb|AFZ78563.1|  cellulose synthase                                      141   2e-35   
ref|XP_011036833.1|  PREDICTED: probable cellulose synthase A cat...    141   2e-35   
ref|XP_006664834.1|  PREDICTED: probable cellulose synthase A cat...    141   2e-35   
emb|CAN60659.1|  hypothetical protein VITISV_018069                     141   2e-35   
ref|XP_010238033.1|  PREDICTED: probable cellulose synthase A cat...    141   2e-35   
ref|XP_003562886.1|  PREDICTED: probable cellulose synthase A cat...    141   2e-35   
ref|XP_010266321.1|  PREDICTED: probable cellulose synthase A cat...    141   2e-35   
gb|ACQ99194.1|  cellulose synthase                                      141   2e-35   
gb|KDP33612.1|  hypothetical protein JCGZ_07183                         141   2e-35   
ref|XP_004499618.1|  PREDICTED: probable cellulose synthase A cat...    140   3e-35   
ref|XP_011036830.1|  PREDICTED: probable cellulose synthase A cat...    140   3e-35   
ref|XP_010525969.1|  PREDICTED: cellulose synthase A catalytic su...    140   3e-35   
gb|AAR29967.1|  putative cellulose synthase catalytic subunit           140   3e-35   
ref|XP_004136343.1|  PREDICTED: cellulose synthase A catalytic su...    140   3e-35   
ref|XP_002515536.1|  Cellulose synthase A catalytic subunit 6 [UD...    140   3e-35   
gb|KGN60109.1|  hypothetical protein Csa_3G878780                       140   3e-35   
gb|ACL36367.1|  cellulose synthase CesA9                                134   3e-35   
ref|XP_011081578.1|  PREDICTED: cellulose synthase A catalytic su...    140   3e-35   
ref|XP_010110357.1|  Protein radially swollen 1                         140   4e-35   
ref|XP_004956059.1|  PREDICTED: probable cellulose synthase A cat...    140   4e-35   
ref|XP_004956058.1|  PREDICTED: probable cellulose synthase A cat...    140   4e-35   
ref|XP_004981133.1|  PREDICTED: probable cellulose synthase A cat...    140   5e-35   
ref|XP_009411928.1|  PREDICTED: cellulose synthase A catalytic su...    140   5e-35   
gb|KHN07088.1|  Cellulose synthase A catalytic subunit 1 [UDP-for...    140   5e-35   
ref|XP_003526416.1|  PREDICTED: cellulose synthase A catalytic su...    140   5e-35   
ref|NP_001059487.1|  Os07g0424400                                       140   5e-35   
ref|NP_001054788.1|  Os05g0176100                                       140   5e-35   
ref|NP_001104958.1|  cellulose synthase8                                140   6e-35   
ref|XP_004509860.1|  PREDICTED: cellulose synthase A catalytic su...    139   6e-35   
gb|ACL36368.1|  cellulose synthase CesA10                               133   6e-35   
ref|XP_004956061.1|  PREDICTED: probable cellulose synthase A cat...    140   6e-35   
ref|XP_004956060.1|  PREDICTED: probable cellulose synthase A cat...    140   6e-35   
ref|XP_007137035.1|  hypothetical protein PHAVU_009G094200g             140   6e-35   
gb|EEE67058.1|  hypothetical protein OsJ_24012                          140   6e-35   
ref|XP_008466397.1|  PREDICTED: cellulose synthase A catalytic su...    139   7e-35   
emb|CBI37703.3|  unnamed protein product                                139   7e-35   
gb|KHN08123.1|  Cellulose synthase A catalytic subunit 1 [UDP-for...    139   7e-35   
ref|XP_003522623.1|  PREDICTED: cellulose synthase A catalytic su...    139   7e-35   
ref|XP_001757832.1|  predicted protein                                  139   7e-35   
ref|XP_004981131.1|  PREDICTED: probable cellulose synthase A cat...    139   8e-35   
ref|XP_010048223.1|  PREDICTED: cellulose synthase A catalytic su...    139   9e-35   
ref|XP_007210416.1|  hypothetical protein PRUPE_ppa000557mg             139   1e-34   
ref|XP_002308657.1|  cellulose synthase family protein                  139   1e-34   
gb|EMT03676.1|  Putative cellulose synthase A catalytic subunit 1...    139   1e-34   
ref|XP_004300066.1|  PREDICTED: probable cellulose synthase A cat...    139   1e-34   
ref|XP_002324291.1|  TGACG-motif binding family protein                 139   1e-34   
ref|XP_011071168.1|  PREDICTED: cellulose synthase A catalytic su...    139   1e-34   
gb|AFZ78556.1|  cellulose synthase                                      139   1e-34   
ref|XP_007148742.1|  hypothetical protein PHAVU_005G010400g             139   1e-34   
ref|XP_008337190.1|  PREDICTED: cellulose synthase A catalytic su...    130   1e-34   
ref|XP_011026459.1|  PREDICTED: cellulose synthase A catalytic su...    139   1e-34   
ref|XP_008233413.1|  PREDICTED: probable cellulose synthase A cat...    139   1e-34   
ref|XP_007148743.1|  hypothetical protein PHAVU_005G010400g             139   1e-34   
ref|XP_011039709.1|  PREDICTED: cellulose synthase A catalytic su...    139   1e-34   
gb|AAO25536.1|  cellulose synthase                                      139   2e-34   
ref|XP_004245031.1|  PREDICTED: cellulose synthase A catalytic su...    138   2e-34   
ref|XP_010266322.1|  PREDICTED: probable cellulose synthase A cat...    138   2e-34   
ref|XP_010526207.1|  PREDICTED: cellulose synthase A catalytic su...    138   2e-34   
ref|XP_009399755.1|  PREDICTED: probable cellulose synthase A cat...    138   2e-34   
gb|AAT66940.1|  CesA1                                                   138   2e-34   
gb|ACR38558.1|  unknown                                                 135   2e-34   
ref|XP_010047060.1|  PREDICTED: cellulose synthase A catalytic su...    138   2e-34   
ref|NP_001104957.1|  cellulose synthase7                                138   2e-34   
ref|XP_004960821.1|  PREDICTED: probable cellulose synthase A cat...    138   2e-34   
ref|XP_007148741.1|  hypothetical protein PHAVU_005G010400g             138   2e-34   
ref|XP_004960820.1|  PREDICTED: probable cellulose synthase A cat...    138   3e-34   
ref|XP_009389939.1|  PREDICTED: probable cellulose synthase A cat...    138   3e-34   



>emb|CDP11417.1| unnamed protein product [Coffea canephora]
Length=1096

 Score =   212 bits (540),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 93/97 (96%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQ CQICGDEIE TVDGEPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEIEFTVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  97



>ref|XP_004138382.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like 
[Cucumis sativus]
 ref|XP_004160741.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like 
[Cucumis sativus]
Length=1090

 Score =   212 bits (540),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 93/97 (96%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDTKGRLIAGSHNRNEFVLINADE+ RVTSVKELSGQ CQICGDEIEITVDGEPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRV  97



>ref|XP_002265955.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
[Vitis vinifera]
Length=1096

 Score =   212 bits (540),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 93/97 (96%), Positives = 95/97 (98%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDTKGRL+AGSHNRNEFVLINADEIGRVTSVKELSGQ CQICGDEIEITVDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  97



>ref|XP_008463088.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
isoform X2 [Cucumis melo]
Length=1090

 Score =   212 bits (540),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 93/97 (96%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDTKGRLIAGSHNRNEFVLINADE+ RVTSVKELSGQ CQICGDEIEITVDGEPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRV  97



>ref|XP_008463087.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
isoform X1 [Cucumis melo]
Length=1091

 Score =   212 bits (540),  Expect = 2e-60, Method: Composition-based stats.
 Identities = 93/97 (96%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDTKGRLIAGSHNRNEFVLINADE+ RVTSVKELSGQ CQICGDEIEITVDGEPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRV  97



>emb|CBI18221.3| unnamed protein product [Vitis vinifera]
Length=1067

 Score =   211 bits (537),  Expect = 3e-60, Method: Composition-based stats.
 Identities = 93/97 (96%), Positives = 95/97 (98%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDTKGRL+AGSHNRNEFVLINADEIGRVTSVKELSGQ CQICGDEIEITVDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  97



>ref|XP_006364140.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
[Solanum tuberosum]
Length=1084

 Score =   211 bits (537),  Expect = 3e-60, Method: Composition-based stats.
 Identities = 92/97 (95%), Positives = 95/97 (98%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDTKGRLIAGSHNRNEFVLINADE+GRVTSVKELSGQ CQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVGRVTSVKELSGQICQICGDELEITVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  97



>gb|AIA61439.1| cellulose synthase [Boehmeria nivea]
Length=1090

 Score =   211 bits (536),  Expect = 5e-60, Method: Composition-based stats.
 Identities = 92/97 (95%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDTKGRLIAGSHNRNEFVLINADE+ RVTSVKELSGQ CQICGDEIE+TVDGEPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVSRVTSVKELSGQICQICGDEIEVTVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRV  97



>ref|XP_011074751.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Sesamum indicum]
Length=1092

 Score =   210 bits (535),  Expect = 6e-60, Method: Composition-based stats.
 Identities = 91/97 (94%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDTKGRL+AGSHNRNEFVLINADEIGRVTSVKEL+GQ CQICGDEIE TVDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEIGRVTSVKELTGQICQICGDEIEFTVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  97



>ref|XP_004252570.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Solanum lycopersicum]
Length=1083

 Score =   210 bits (534),  Expect = 8e-60, Method: Composition-based stats.
 Identities = 92/97 (95%), Positives = 95/97 (98%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDTKGRLIAGSHNRNEFVLINADE+GRVTSVKELSGQ CQICGDE+EITVDGEPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVGRVTSVKELSGQICQICGDELEITVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  97



>ref|XP_011101270.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Sesamum indicum]
Length=1084

 Score =   209 bits (533),  Expect = 1e-59, Method: Composition-based stats.
 Identities = 92/97 (95%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDTKGRL+AGSHNRNEFVLINADEIGRVTSVKELSGQ CQICGDEIE TVDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEIEFTVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  97



>ref|XP_009765335.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Nicotiana sylvestris]
Length=1084

 Score =   209 bits (533),  Expect = 1e-59, Method: Composition-based stats.
 Identities = 92/97 (95%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDTKGRLIAGSHNRNEFVLINADE+GRVTSVKELSGQ CQICGDEIEITVD EPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVGRVTSVKELSGQICQICGDEIEITVDEEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  97



>ref|XP_009599913.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Nicotiana tomentosiformis]
Length=1084

 Score =   209 bits (532),  Expect = 1e-59, Method: Composition-based stats.
 Identities = 92/97 (95%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDTKGRLIAGSHNRNEFVLINADE+GRVTSVKELSGQ CQICGDEIEITVD EPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVGRVTSVKELSGQICQICGDEIEITVDEEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  97



>dbj|BAG06272.1| cellulose synthase Z632 [Zinnia elegans]
Length=1090

 Score =   209 bits (532),  Expect = 2e-59, Method: Composition-based stats.
 Identities = 90/97 (93%), Positives = 95/97 (98%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDTKGRL+AGSHNRNEFVLINADE+GRVTSVKELSGQ CQICGDEIEITVDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEVGRVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFP+CRPCYEYERREGNQACPQCKTR+KR+KGSP V
Sbjct  61   CAFPICRPCYEYERREGNQACPQCKTRFKRIKGSPRV  97



>ref|XP_007019545.1| Cellulose synthase 6 [Theobroma cacao]
 gb|EOY16770.1| Cellulose synthase 6 [Theobroma cacao]
Length=1091

 Score =   209 bits (531),  Expect = 2e-59, Method: Composition-based stats.
 Identities = 91/98 (93%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDTKGRL+AGSHNRNEFVLINADEI RVTSVKELSGQ CQICGDEIEI+VDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEIARVTSVKELSGQICQICGDEIEISVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTVE  444
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KG P VE
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGCPRVE  98



>ref|XP_010106861.1| Isoxaben-resistant protein 2 [Morus notabilis]
 gb|EXC12321.1| Isoxaben-resistant protein 2 [Morus notabilis]
Length=1121

 Score =   207 bits (528),  Expect = 7e-59, Method: Composition-based stats.
 Identities = 90/97 (93%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDTKGRL+AGSHNRNEFV+INADE+ RVTSVKELSGQ CQICGDEIEITVDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVVINADEVSRVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  97



>gb|AFZ78561.1| cellulose synthase [Populus tomentosa]
Length=1097

 Score =   207 bits (528),  Expect = 7e-59, Method: Composition-based stats.
 Identities = 90/97 (93%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+TKGRLIAGSHNRNEFVLINADEI RVTSVKELSGQ C+ICGDEIEITVDGEPFVACNE
Sbjct  1    METKGRLIAGSHNRNEFVLINADEIARVTSVKELSGQICKICGDEIEITVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQC+TRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCRTRYKRIKGSPRV  97



>ref|XP_007199689.1| hypothetical protein PRUPE_ppa000559mg [Prunus persica]
 ref|XP_008237530.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Prunus mume]
 gb|EMJ00888.1| hypothetical protein PRUPE_ppa000559mg [Prunus persica]
Length=1096

 Score =   207 bits (526),  Expect = 1e-58, Method: Composition-based stats.
 Identities = 91/97 (94%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDTKGRL+AGSHNRNEFVLINADE+ RVTSVKELSGQ CQICGDEIEITVDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEVSRVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCR CYEYERREGNQACPQCKTRYKRLKGSP V
Sbjct  61   CAFPVCRSCYEYERREGNQACPQCKTRYKRLKGSPRV  97



>ref|XP_002302169.1| CesA7A-like family protein [Populus trichocarpa]
 gb|EEE81442.1| CesA7A-like family protein [Populus trichocarpa]
Length=1093

 Score =   207 bits (526),  Expect = 1e-58, Method: Composition-based stats.
 Identities = 89/97 (92%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+TKGRLIAGSHNRNEFVLINADEI RVTSVKELSGQ C+ICGDEIE+TVDGEPFVACNE
Sbjct  1    METKGRLIAGSHNRNEFVLINADEIARVTSVKELSGQICKICGDEIEVTVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQC+TRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCRTRYKRIKGSPRV  97



>gb|AAT09895.1| cellulose synthase [Populus tremula x Populus tremuloides]
Length=1095

 Score =   207 bits (526),  Expect = 1e-58, Method: Composition-based stats.
 Identities = 89/97 (92%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+TKGRLIAGSHNRNEFVLINADEI RVTSVKELSGQ C+ICGDEIE+TVDGEPFVACNE
Sbjct  1    METKGRLIAGSHNRNEFVLINADEIARVTSVKELSGQICKICGDEIEVTVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQC+TRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCRTRYKRIKGSPKV  97



>ref|XP_011042869.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Populus euphratica]
Length=1093

 Score =   206 bits (525),  Expect = 1e-58, Method: Composition-based stats.
 Identities = 89/97 (92%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+TKGRLIAGSHNRNEFVLINADEI RVTSVKELSGQ C+ICGDEIE+TVDGEPFVACNE
Sbjct  1    METKGRLIAGSHNRNEFVLINADEIARVTSVKELSGQICKICGDEIEVTVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQC+TRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCRTRYKRIKGSPRV  97



>ref|XP_009339472.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Pyrus x bretschneideri]
Length=1095

 Score =   206 bits (525),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 91/97 (94%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDTKGRLIAGSHNRNEFVLINADE+ RVTSVKELSGQ CQICGDEIEITVDGEPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVSRVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCR CYEYERREGNQACPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRSCYEYERREGNQACPQCKTRYKRIKGSPRV  97



>ref|XP_008381836.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Malus domestica]
Length=1095

 Score =   206 bits (525),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 91/97 (94%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDTKGRLIAGSHNRNEFVLINADE+ RVTSVKELSGQ CQICGDEIEITVDGEPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVSRVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCR CYEYERREGNQACPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRSCYEYERREGNQACPQCKTRYKRIKGSPRV  97



>ref|XP_008369157.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Malus domestica]
 ref|XP_008369158.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Malus domestica]
 ref|XP_008369159.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Malus domestica]
Length=1095

 Score =   206 bits (525),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 91/97 (94%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDTKGRLIAGSHNRNEFVLINADE+ RVTSVKELSGQ CQICGDEIEITVDGEPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVSRVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCR CYEYERREGNQACPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRSCYEYERREGNQACPQCKTRYKRIKGSPRV  97



>ref|XP_008358296.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Malus domestica]
Length=1095

 Score =   206 bits (525),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 91/97 (94%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDTKGRLIAGSHNRNEFVLINADE+ RVTSVKELSGQ CQICGDEIEITVDGEPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVSRVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCR CYEYERREGNQACPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRSCYEYERREGNQACPQCKTRYKRIKGSPRV  97



>ref|XP_011044242.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Populus euphratica]
Length=1095

 Score =   206 bits (524),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 89/97 (92%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+TKGRL+AGSHNRNEFVLINADEI RVTSVKELSGQ C+ICGDEIEITVDGEPFVACNE
Sbjct  1    METKGRLVAGSHNRNEFVLINADEIARVTSVKELSGQICKICGDEIEITVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQC+TRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCRTRYKRIKGSPRV  97



>gb|AFB18634.1| CESA5 [Gossypium hirsutum]
Length=1095

 Score =   206 bits (524),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 89/97 (92%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDT GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ+CQICGDEIEITVDGEPFVACNE
Sbjct  1    MDTGGRLIAGSHNRNEFVLINADENARIKSVKELSGQTCQICGDEIEITVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  97



>gb|KJB66303.1| hypothetical protein B456_010G134500 [Gossypium raimondii]
Length=1090

 Score =   206 bits (524),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 90/98 (92%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDTKGRL+AGSHNRNEFVLINADEI RVTSVKELSGQ CQICGDEIEI++DGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEIARVTSVKELSGQICQICGDEIEISLDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTVE  444
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KG P VE
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGCPRVE  98



>ref|XP_002306707.1| CesA7A-like family protein [Populus trichocarpa]
 gb|EEE93703.1| CesA7A-like family protein [Populus trichocarpa]
Length=1095

 Score =   206 bits (524),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 90/97 (93%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+TKGRLIAGSHNRNEFVLINADEI RVTSVKELSGQ C+ICGDEIEITVDGEPFVACNE
Sbjct  1    METKGRLIAGSHNRNEFVLINADEIARVTSVKELSGQICKICGDEIEITVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQC+TRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCRTRYKRIKGSPRV  97



>gb|KJB59451.1| hypothetical protein B456_009G255100 [Gossypium raimondii]
Length=1064

 Score =   206 bits (523),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 89/98 (91%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDTKGRL+AGSHNRNEFVLINADE+ RVTSVKELSGQ CQICGDEIEI+VDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEISVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTVE  444
            CAFPVCR CYEYERREGNQACPQCKTRYKR+KG P VE
Sbjct  61   CAFPVCRACYEYERREGNQACPQCKTRYKRIKGCPRVE  98



>gb|AGV22110.1| cellulose synthase 8 [Betula luminifera]
Length=1091

 Score =   206 bits (523),  Expect = 3e-58, Method: Composition-based stats.
 Identities = 89/97 (92%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDTKGRLIAGSHNRNEF+LINADE+ RVTSVKELSGQ CQICGDEIEITVDGEPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFILINADEVARVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTR+KR+KG P V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRFKRIKGCPRV  97



>gb|KJB14950.1| hypothetical protein B456_002G150300 [Gossypium raimondii]
 gb|KJB14951.1| hypothetical protein B456_002G150300 [Gossypium raimondii]
Length=1095

 Score =   206 bits (523),  Expect = 3e-58, Method: Composition-based stats.
 Identities = 89/97 (92%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDT GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ+CQICGDEIEITVDGEPFVACNE
Sbjct  1    MDTGGRLIAGSHNRNEFVLINADENARIKSVKELSGQTCQICGDEIEITVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  97



>gb|KJB59449.1| hypothetical protein B456_009G255100 [Gossypium raimondii]
Length=1090

 Score =   206 bits (523),  Expect = 3e-58, Method: Composition-based stats.
 Identities = 89/98 (91%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDTKGRL+AGSHNRNEFVLINADE+ RVTSVKELSGQ CQICGDEIEI+VDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEISVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTVE  444
            CAFPVCR CYEYERREGNQACPQCKTRYKR+KG P VE
Sbjct  61   CAFPVCRACYEYERREGNQACPQCKTRYKRIKGCPRVE  98



>gb|KHG29218.1| Cellulose synthase A catalytic subunit 6 [UDP-forming] -like 
protein [Gossypium arboreum]
Length=1090

 Score =   206 bits (523),  Expect = 3e-58, Method: Composition-based stats.
 Identities = 89/98 (91%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDTKGRL+AGSHNRNEFVLINADE+ RVTSVKELSGQ CQICGDEIEI+VDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEISVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTVE  444
            CAFPVCR CYEYERREGNQACPQCKTRYKR+KG P VE
Sbjct  61   CAFPVCRACYEYERREGNQACPQCKTRYKRIKGCPRVE  98



>ref|XP_009782822.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Nicotiana sylvestris]
Length=1091

 Score =   204 bits (520),  Expect = 8e-58, Method: Composition-based stats.
 Identities = 87/97 (90%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDTKGRL+AGSHNRNEFV+INADE+GRVTSVKELSGQ CQICGDEIE+TVDGEPF+ACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVVINADEVGRVTSVKELSGQICQICGDEIEVTVDGEPFIACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCR CYEYERREGNQACPQCKTR+KR+KGSP V
Sbjct  61   CAFPVCRQCYEYERREGNQACPQCKTRFKRIKGSPRV  97



>gb|AFY06685.1| cellulose synthase [Nicotiana tabacum]
Length=1091

 Score =   204 bits (520),  Expect = 8e-58, Method: Composition-based stats.
 Identities = 87/97 (90%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDTKGRL+AGSHNRNEFV+INADE+GRVTSVKELSGQ CQICGDEIE+TVDGEPF+ACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVVINADEVGRVTSVKELSGQICQICGDEIEVTVDGEPFIACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCR CYEYERREGNQACPQCKTR+KR+KGSP V
Sbjct  61   CAFPVCRQCYEYERREGNQACPQCKTRFKRIKGSPRV  97



>ref|XP_009758840.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Nicotiana sylvestris]
Length=1094

 Score =   204 bits (520),  Expect = 9e-58, Method: Composition-based stats.
 Identities = 89/97 (92%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADEIGR+ SV+ELSGQ CQICGDEIEITVDGEPFVACNE
Sbjct  3    MNTGGRLIAGSHNRNEFVLINADEIGRIKSVRELSGQVCQICGDEIEITVDGEPFVACNE  62

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP V
Sbjct  63   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  99



>ref|XP_009609627.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Nicotiana tomentosiformis]
Length=1087

 Score =   204 bits (520),  Expect = 9e-58, Method: Composition-based stats.
 Identities = 87/97 (90%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDTKGRL+AGSHNRNEFV+INADE+GRVTSVKELSGQ CQICGDEIE+TVDGEPF+ACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVVINADEVGRVTSVKELSGQICQICGDEIEVTVDGEPFIACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCR CYEYERREGNQACPQCKTR+KR+KGSP V
Sbjct  61   CAFPVCRQCYEYERREGNQACPQCKTRFKRIKGSPRV  97



>ref|XP_004290503.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Fragaria vesca subsp. vesca]
Length=1093

 Score =   204 bits (519),  Expect = 9e-58, Method: Composition-based stats.
 Identities = 89/97 (92%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDTKGRL+AGSHNRNEFVLINADE+ RVTSVKELSGQ CQICGDEIEITVDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEVSRVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCR CYEYERREGNQ+CPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRSCYEYERREGNQSCPQCKTRYKRVKGSPRV  97



>gb|KHG02518.1| Cellulose synthase A catalytic subunit 2 [UDP-forming] [Gossypium 
arboreum]
Length=1095

 Score =   204 bits (519),  Expect = 1e-57, Method: Composition-based stats.
 Identities = 89/97 (92%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDT GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ+CQICGDEIEITVDGEPFVACNE
Sbjct  1    MDTGGRLIAGSHNRNEFVLINADENARIKSVKELSGQTCQICGDEIEITVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  97



>gb|AEI87569.1| cellulose synthase catalytic subunit protein [Nicotiana tabacum]
Length=1091

 Score =   204 bits (519),  Expect = 1e-57, Method: Composition-based stats.
 Identities = 87/97 (90%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDTKGRL+AGSHNRNEFV+INADE+GRVTSVKELSGQ CQICGDEIE+TVDGEPF+ACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVVINADEVGRVTSVKELSGQICQICGDEIEVTVDGEPFIACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCR CYEYERREGNQACPQCKTR+KR+KGSP V
Sbjct  61   CAFPVCRQCYEYERREGNQACPQCKTRFKRIKGSPRV  97



>gb|KJB59452.1| hypothetical protein B456_009G255100 [Gossypium raimondii]
Length=1035

 Score =   204 bits (518),  Expect = 1e-57, Method: Composition-based stats.
 Identities = 89/98 (91%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDTKGRL+AGSHNRNEFVLINADE+ RVTSVKELSGQ CQICGDEIEI+VDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEISVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTVE  444
            CAFPVCR CYEYERREGNQACPQCKTRYKR+KG P VE
Sbjct  61   CAFPVCRACYEYERREGNQACPQCKTRYKRIKGCPRVE  98



>ref|XP_010241683.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Nelumbo nucifera]
Length=1095

 Score =   204 bits (519),  Expect = 1e-57, Method: Composition-based stats.
 Identities = 88/98 (90%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDT GRL+AGSHNRNEFVLINADEIGRV SV+ELSGQ CQICGDE+EIT DGEPFVACNE
Sbjct  1    MDTGGRLVAGSHNRNEFVLINADEIGRVKSVRELSGQICQICGDEVEITEDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTVE  444
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP V+
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVD  98



>gb|EYU17481.1| hypothetical protein MIMGU_mgv1a000527mg [Erythranthe guttata]
Length=1093

 Score =   204 bits (518),  Expect = 1e-57, Method: Composition-based stats.
 Identities = 87/97 (90%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDT GRL+AGSHNRNEFVLINADEIGRVTSVKELSGQ CQICGDE+E TVDGEPFVACNE
Sbjct  1    MDTNGRLVAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEFTVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFP+CRPCYEYERREGNQ+CPQCKTR+KR+KGSP V
Sbjct  61   CAFPICRPCYEYERREGNQSCPQCKTRFKRIKGSPRV  97



>ref|XP_006367803.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
[Solanum tuberosum]
Length=1091

 Score =   204 bits (518),  Expect = 1e-57, Method: Composition-based stats.
 Identities = 90/97 (93%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDTKGRLIAGSHNRNEFVLINADE+GRVTSVKELSGQ CQICGDEIE+TVDGE FVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVGRVTSVKELSGQICQICGDEIEVTVDGETFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGS  V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSQRV  97



>ref|XP_004237809.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Solanum lycopersicum]
Length=1090

 Score =   204 bits (518),  Expect = 1e-57, Method: Composition-based stats.
 Identities = 90/97 (93%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDTKGRLIAGSHNRNEFVLINADE+GRVTSVKELSGQ CQICGDEIE+TVDGE FVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVGRVTSVKELSGQICQICGDEIEVTVDGETFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGS  V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSQRV  97



>ref|XP_007048203.1| Cellulose synthase 6 [Theobroma cacao]
 gb|EOX92360.1| Cellulose synthase 6 [Theobroma cacao]
Length=1096

 Score =   203 bits (517),  Expect = 2e-57, Method: Composition-based stats.
 Identities = 89/97 (92%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDT GRLIAGSHNRNEFVLINADE GR+ SV+ELSGQ+CQICGDEIEITVDGEPFVACNE
Sbjct  1    MDTGGRLIAGSHNRNEFVLINADENGRIKSVQELSGQTCQICGDEIEITVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  97



>gb|EYU36833.1| hypothetical protein MIMGU_mgv1a000540mg [Erythranthe guttata]
Length=1087

 Score =   203 bits (517),  Expect = 2e-57, Method: Composition-based stats.
 Identities = 86/97 (89%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDT GRL+AGSHNRNEFVLINADEIGRVTSVKELSGQ CQICGDEIE + DGEPFVACNE
Sbjct  1    MDTNGRLVAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEIEFSADGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFP+CRPCYEYERREGNQ+CPQCKTR+KR+KGSP V
Sbjct  61   CAFPICRPCYEYERREGNQSCPQCKTRFKRIKGSPRV  97



>ref|XP_009629755.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Nicotiana tomentosiformis]
Length=1094

 Score =   203 bits (517),  Expect = 2e-57, Method: Composition-based stats.
 Identities = 88/97 (91%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADEIGR+ SV+ELSGQ CQICGDEIEITVDGEPFVACNE
Sbjct  3    MNTGGRLIAGSHNRNEFVLINADEIGRIKSVRELSGQVCQICGDEIEITVDGEPFVACNE  62

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFP+CRPCYEYERREGNQACPQCKTRYKR+KGSP V
Sbjct  63   CAFPICRPCYEYERREGNQACPQCKTRYKRIKGSPRV  99



>gb|KJB18370.1| hypothetical protein B456_003G049300 [Gossypium raimondii]
Length=1096

 Score =   203 bits (517),  Expect = 2e-57, Method: Composition-based stats.
 Identities = 89/98 (91%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDT GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ+CQICGDEIEITVDGEPFVACNE
Sbjct  1    MDTGGRLIAGSHNRNEFVLINADENARIKSVQELSGQTCQICGDEIEITVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTVE  444
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP VE
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVE  98



>gb|KJB18373.1| hypothetical protein B456_003G049300 [Gossypium raimondii]
Length=1082

 Score =   203 bits (516),  Expect = 3e-57, Method: Composition-based stats.
 Identities = 89/98 (91%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDT GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ+CQICGDEIEITVDGEPFVACNE
Sbjct  1    MDTGGRLIAGSHNRNEFVLINADENARIKSVQELSGQTCQICGDEIEITVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTVE  444
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP VE
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVE  98



>ref|XP_009376550.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Pyrus x bretschneideri]
Length=1095

 Score =   203 bits (516),  Expect = 3e-57, Method: Composition-based stats.
 Identities = 90/97 (93%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDTKGRLIAGSHNRNEFVLINADE+ RVTSVKELSGQ CQICGDEIEITVDGEPFVACNE
Sbjct  1    MDTKGRLIAGSHNRNEFVLINADEVSRVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCR CYEYERREGNQACPQCKTRYKR+KGS  V
Sbjct  61   CAFPVCRSCYEYERREGNQACPQCKTRYKRIKGSQRV  97



>gb|AAK49454.1|AF304374_1 cellulose synthase catalytic subunit [Nicotiana alata]
Length=1091

 Score =   203 bits (516),  Expect = 3e-57, Method: Composition-based stats.
 Identities = 86/97 (89%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDTKGRL+AGSHNRNEFV+INAD++GRVTSVKELSGQ CQICGDEIE+TVDGEPF+ACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVVINADDVGRVTSVKELSGQICQICGDEIEVTVDGEPFIACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCR CYEYERREGNQACPQCKTR+KR+KGSP V
Sbjct  61   CAFPVCRQCYEYERREGNQACPQCKTRFKRIKGSPRV  97



>ref|XP_002307145.1| cellulose synthase family protein [Populus trichocarpa]
 gb|EEE94141.1| cellulose synthase family protein [Populus trichocarpa]
Length=1096

 Score =   202 bits (515),  Expect = 3e-57, Method: Composition-based stats.
 Identities = 89/97 (92%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ CQICGDEIEITVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIKSVKELSGQVCQICGDEIEITVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRV  97



>gb|AFZ78560.1| cellulose synthase [Populus tomentosa]
Length=1093

 Score =   202 bits (515),  Expect = 4e-57, Method: Composition-based stats.
 Identities = 87/97 (90%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+TKGRLIAGSHNRNEFVLINADEI RVT  KELSGQ C+ICGDEIE+TVDGEPFVACNE
Sbjct  1    METKGRLIAGSHNRNEFVLINADEIARVTPFKELSGQICKICGDEIEVTVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQC+TRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCRTRYKRIKGSPRV  97



>ref|XP_002524299.1| Cellulose synthase A catalytic subunit 6 [UDP-forming], putative 
[Ricinus communis]
 gb|EEF38039.1| Cellulose synthase A catalytic subunit 6 [UDP-forming], putative 
[Ricinus communis]
Length=1095

 Score =   202 bits (514),  Expect = 5e-57, Method: Composition-based stats.
 Identities = 90/97 (93%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+TKGRLIAGSHNRNEFVLINADEI RVTSVKELSGQ CQICGDEIEITVDGEPFVACNE
Sbjct  1    METKGRLIAGSHNRNEFVLINADEIARVTSVKELSGQICQICGDEIEITVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGN+ACPQCKT YKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNRACPQCKTIYKRIKGSPRV  97



>gb|AFB18639.1| CESA9 [Gossypium hirsutum]
Length=1090

 Score =   202 bits (514),  Expect = 6e-57, Method: Composition-based stats.
 Identities = 88/98 (90%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDTKGRL+AG HNRNEFVLINADE+ RVTSVKELSGQ CQICGDEIEI+VDGEPFVACNE
Sbjct  1    MDTKGRLVAGPHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEISVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTVE  444
            CAFPVCR CYEYERREGNQACPQCKTRYKR+KG P VE
Sbjct  61   CAFPVCRACYEYERREGNQACPQCKTRYKRIKGCPRVE  98



>gb|KJB59450.1| hypothetical protein B456_009G255100 [Gossypium raimondii]
Length=902

 Score =   201 bits (510),  Expect = 6e-57, Method: Composition-based stats.
 Identities = 89/98 (91%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDTKGRL+AGSHNRNEFVLINADE+ RVTSVKELSGQ CQICGDEIEI+VDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEISVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTVE  444
            CAFPVCR CYEYERREGNQACPQCKTRYKR+KG P VE
Sbjct  61   CAFPVCRACYEYERREGNQACPQCKTRYKRIKGCPRVE  98



>gb|KDP35302.1| hypothetical protein JCGZ_09461 [Jatropha curcas]
Length=1097

 Score =   202 bits (513),  Expect = 8e-57, Method: Composition-based stats.
 Identities = 87/97 (90%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRL+AGSHNRNEFVLINADE GR+ SV+ELSGQ CQICGDEIEITVDGEPFVACNE
Sbjct  1    MNTGGRLVAGSHNRNEFVLINADESGRIKSVQELSGQVCQICGDEIEITVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  97



>gb|AAO25581.1| cellulose synthase [Populus tremuloides]
Length=1096

 Score =   202 bits (513),  Expect = 8e-57, Method: Composition-based stats.
 Identities = 89/97 (92%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ CQICGDEIEITVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIKSVKELSGQVCQICGDEIEITVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRV  97



>ref|XP_008232182.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
[Prunus mume]
Length=1095

 Score =   202 bits (513),  Expect = 8e-57, Method: Composition-based stats.
 Identities = 87/97 (90%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDT+GRL+AGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDEIEITVDGEPFVACNE
Sbjct  1    MDTRGRLVAGSHNRNEFVLINADENARIKSVQELSGQICQICGDEIEITVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  97



>gb|KHG24947.1| Cellulose synthase A catalytic subunit 2 [UDP-forming] -like 
protein [Gossypium arboreum]
Length=1071

 Score =   201 bits (512),  Expect = 8e-57, Method: Composition-based stats.
 Identities = 88/97 (91%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDT GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ+CQICGDEIEITVDGEPFVACNE
Sbjct  1    MDTGGRLIAGSHNRNEFVLINADENARIKSVQELSGQTCQICGDEIEITVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  97



>ref|XP_007213713.1| hypothetical protein PRUPE_ppa000567mg [Prunus persica]
 gb|EMJ14912.1| hypothetical protein PRUPE_ppa000567mg [Prunus persica]
Length=1095

 Score =   201 bits (512),  Expect = 9e-57, Method: Composition-based stats.
 Identities = 87/97 (90%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDT+GRL+AGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDEIEITVDGEPFVACNE
Sbjct  1    MDTRGRLVAGSHNRNEFVLINADENARIKSVQELSGQICQICGDEIEITVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  97



>ref|XP_011021978.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
isoform X1 [Populus euphratica]
 ref|XP_011021979.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
isoform X2 [Populus euphratica]
Length=1097

 Score =   201 bits (512),  Expect = 9e-57, Method: Composition-based stats.
 Identities = 89/97 (92%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ CQICGDEIEITVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIKSVKELSGQVCQICGDEIEITVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRV  97



>ref|XP_011013552.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
isoform X3 [Populus euphratica]
Length=1096

 Score =   201 bits (512),  Expect = 9e-57, Method: Composition-based stats.
 Identities = 89/97 (92%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ CQICGDEIEITVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIKSVKELSGQVCQICGDEIEITVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRV  97



>ref|XP_011021980.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
isoform X3 [Populus euphratica]
Length=1096

 Score =   201 bits (512),  Expect = 9e-57, Method: Composition-based stats.
 Identities = 89/97 (92%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ CQICGDEIEITVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIKSVKELSGQVCQICGDEIEITVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRV  97



>ref|XP_011013550.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
isoform X1 [Populus euphratica]
 ref|XP_011013551.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
isoform X2 [Populus euphratica]
Length=1097

 Score =   201 bits (512),  Expect = 9e-57, Method: Composition-based stats.
 Identities = 89/97 (92%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ CQICGDEIEITVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIKSVKELSGQVCQICGDEIEITVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRV  97



>ref|XP_007159799.1| hypothetical protein PHAVU_002G268200g [Phaseolus vulgaris]
 gb|ESW31793.1| hypothetical protein PHAVU_002G268200g [Phaseolus vulgaris]
Length=1097

 Score =   201 bits (512),  Expect = 9e-57, Method: Composition-based stats.
 Identities = 87/98 (89%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M T GRL+AGSHNRNEFVLINADE GR+ SV+ELSGQ CQICGDEIE+TVDGEPFVACNE
Sbjct  1    MHTGGRLVAGSHNRNEFVLINADENGRIKSVRELSGQICQICGDEIEVTVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTVE  444
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP VE
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVE  98



>gb|AAT09898.1| cellulose synthase [Populus tremula x Populus tremuloides]
Length=1096

 Score =   201 bits (512),  Expect = 9e-57, Method: Composition-based stats.
 Identities = 89/97 (92%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ CQICGDEIEITVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIKSVKELSGQVCQICGDEIEITVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRV  97



>ref|XP_006473074.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Citrus sinensis]
Length=1091

 Score =   201 bits (512),  Expect = 1e-56, Method: Composition-based stats.
 Identities = 87/97 (90%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M T GRL+AGSHNRNEFVLINADE+ RVTSVKELSGQ CQICGDEIEIT +GEPFVACNE
Sbjct  1    MATNGRLVAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEITDNGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  97



>ref|XP_006434481.1| hypothetical protein CICLE_v10000103mg [Citrus clementina]
 gb|ESR47721.1| hypothetical protein CICLE_v10000103mg [Citrus clementina]
Length=1091

 Score =   201 bits (512),  Expect = 1e-56, Method: Composition-based stats.
 Identities = 87/97 (90%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M T GRL+AGSHNRNEFVLINADE+ RVTSVKELSGQ CQICGDEIEIT +GEPFVACNE
Sbjct  1    MATNGRLVAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEITDNGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  97



>gb|KDO83761.1| hypothetical protein CISIN_1g001373mg [Citrus sinensis]
Length=1089

 Score =   201 bits (512),  Expect = 1e-56, Method: Composition-based stats.
 Identities = 87/97 (90%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M T GRL+AGSHNRNEFVLINADE+ RVTSVKELSGQ CQICGDEIEIT +GEPFVACNE
Sbjct  1    MATNGRLVAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEITDNGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  97



>gb|KDO83760.1| hypothetical protein CISIN_1g001373mg [Citrus sinensis]
Length=1091

 Score =   201 bits (512),  Expect = 1e-56, Method: Composition-based stats.
 Identities = 87/97 (90%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M T GRL+AGSHNRNEFVLINADE+ RVTSVKELSGQ CQICGDEIEIT +GEPFVACNE
Sbjct  1    MATNGRLVAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEITDNGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  97



>gb|KJB18372.1| hypothetical protein B456_003G049300 [Gossypium raimondii]
Length=1008

 Score =   201 bits (510),  Expect = 1e-56, Method: Composition-based stats.
 Identities = 89/98 (91%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDT GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ+CQICGDEIEITVDGEPFVACNE
Sbjct  1    MDTGGRLIAGSHNRNEFVLINADENARIKSVQELSGQTCQICGDEIEITVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTVE  444
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP VE
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVE  98



>gb|AEE60899.1| cellulose synthase [Populus tomentosa]
Length=1100

 Score =   201 bits (511),  Expect = 1e-56, Method: Composition-based stats.
 Identities = 90/102 (88%), Positives = 94/102 (92%), Gaps = 5/102 (5%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGR-----VTSVKELSGQSCQICGDEIEITVDGEPF  315
            M+TKGRLIAGSHNRNEFVLINADEI R     VTSVKELSGQ C+ICGDEIEITVDGEPF
Sbjct  1    METKGRLIAGSHNRNEFVLINADEIARLLSIPVTSVKELSGQICKICGDEIEITVDGEPF  60

Query  316  VACNECAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            VACNECAFPVCRPCYEYERREGNQACPQC+TRYKR+KGSP V
Sbjct  61   VACNECAFPVCRPCYEYERREGNQACPQCRTRYKRIKGSPRV  102



>emb|CDP12843.1| unnamed protein product [Coffea canephora]
Length=1093

 Score =   201 bits (510),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 86/98 (88%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDT GRLIAGSHNRNEFVLINAD+IG++ SV+ELSGQ CQICGDE+EITVDGE FVACNE
Sbjct  1    MDTGGRLIAGSHNRNEFVLINADDIGKIKSVQELSGQICQICGDEVEITVDGELFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTVE  444
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KG P VE
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGDPRVE  98



>gb|KDP30751.1| hypothetical protein JCGZ_15180 [Jatropha curcas]
Length=1092

 Score =   201 bits (510),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 88/97 (91%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+TKGRLIAGSHNRNEFVLINADEI RVTSV+ELSGQ CQICGDEIE T DGEPFVACNE
Sbjct  1    METKGRLIAGSHNRNEFVLINADEISRVTSVEELSGQICQICGDEIEFTRDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCR CYEYERREGNQACPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRHCYEYERREGNQACPQCKTRYKRIKGSPRV  97



>ref|XP_003531396.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Glycine max]
 gb|KHN29142.1| Cellulose synthase A catalytic subunit 6 [UDP-forming] [Glycine 
soja]
Length=1097

 Score =   201 bits (510),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 87/97 (90%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M T GRL+AGSHNRNEFVLINADE GR+ SV+ELSGQ CQICGDEIEITVDGEPFVACNE
Sbjct  1    MHTGGRLVAGSHNRNEFVLINADENGRIKSVRELSGQICQICGDEIEITVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  97



>ref|XP_010526630.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
[Tarenaya hassleriana]
Length=1073

 Score =   200 bits (509),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 87/98 (89%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRL+AGSHNRNEFVLINADE  R+ SV+ELSGQ+CQICGDEIE TVDGEPFVACNE
Sbjct  1    MNTGGRLVAGSHNRNEFVLINADETARIRSVQELSGQNCQICGDEIEFTVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTVE  444
            CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSP VE
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRVE  98



>gb|AFZ78553.1| cellulose synthase [Populus tomentosa]
Length=1096

 Score =   200 bits (508),  Expect = 3e-56, Method: Composition-based stats.
 Identities = 88/97 (91%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ CQICGDEIEITVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIKSVKELSGQVCQICGDEIEITVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQ CPQCKTRYKRLKGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQVCPQCKTRYKRLKGSPRV  97



>ref|XP_002310628.1| cellulose synthase family protein [Populus trichocarpa]
 gb|EEE91078.1| cellulose synthase family protein [Populus trichocarpa]
Length=1096

 Score =   199 bits (507),  Expect = 5e-56, Method: Composition-based stats.
 Identities = 87/97 (90%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ C ICGDEIEITVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIKSVQELSGQVCHICGDEIEITVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRV  97



>gb|EPS58530.1| hypothetical protein M569_16283, partial [Genlisea aurea]
Length=343

 Score =   190 bits (482),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MD  GRL+AGSHNRNEFVLINADEIG+VTSVKELSGQ CQICGDEIE  +DGEPFVACNE
Sbjct  1    MDATGRLVAGSHNRNEFVLINADEIGKVTSVKELSGQICQICGDEIEFKIDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQ+CPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQSCPQCKTRYKRIKGSPRV  97



>ref|XP_002310629.1| hypothetical protein POPTR_0007s07120g [Populus trichocarpa]
 gb|EEE91079.1| hypothetical protein POPTR_0007s07120g [Populus trichocarpa]
Length=1095

 Score =   199 bits (507),  Expect = 5e-56, Method: Composition-based stats.
 Identities = 87/97 (90%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ C ICGDEIEITVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIKSVQELSGQVCHICGDEIEITVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRV  97



>ref|XP_010520165.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming] 
[Tarenaya hassleriana]
Length=1066

 Score =   198 bits (504),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 86/98 (88%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRL+AGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDEIE+TVDGEPFVACNE
Sbjct  1    MNTGGRLVAGSHNRNEFVLINADENARIRSVQELSGQICQICGDEIELTVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTVE  444
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP VE
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVE  98



>gb|KHN41284.1| Cellulose synthase A catalytic subunit 6 [UDP-forming] [Glycine 
soja]
Length=847

 Score =   195 bits (496),  Expect = 4e-55, Method: Composition-based stats.
 Identities = 84/97 (87%), Positives = 90/97 (93%), Gaps = 1/97 (1%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDTKGRL+AGSHNRNEFVLINADE  RV +V ELSGQ CQICGDE+E+TV+GEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADETARV-AVTELSGQICQICGDELEVTVNGEPFVACNE  59

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQ CPQCKTRYKR+KGSP V
Sbjct  60   CAFPVCRPCYEYERREGNQVCPQCKTRYKRIKGSPRV  96



>ref|XP_010547636.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like 
[Tarenaya hassleriana]
Length=1068

 Score =   197 bits (500),  Expect = 4e-55, Method: Composition-based stats.
 Identities = 85/98 (87%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDEIE+TVDG+PFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSVQELSGQICQICGDEIELTVDGDPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTVE  444
            CAFPVCRPC+EYERREGNQACPQCKTRYKR+KGSP VE
Sbjct  61   CAFPVCRPCFEYERREGNQACPQCKTRYKRIKGSPRVE  98



>ref|XP_002864919.1| hypothetical protein ARALYDRAFT_496689 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41178.1| hypothetical protein ARALYDRAFT_496689 [Arabidopsis lyrata subsp. 
lyrata]
Length=1089

 Score =   197 bits (500),  Expect = 4e-55, Method: Composition-based stats.
 Identities = 85/97 (88%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ+CQIC DEIE+TVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSVQELSGQTCQICRDEIELTVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTR+KRLKGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRFKRLKGSPRV  97



>ref|NP_201279.1| cellulose synthase A catalytic subunit 6 [UDP-forming] [Arabidopsis 
thaliana]
 sp|Q94JQ6.2|CESA6_ARATH RecName: Full=Cellulose synthase A catalytic subunit 6 [UDP-forming]; 
Short=AtCesA6; AltName: Full=AraxCelA; AltName: Full=Isoxaben-resistant 
protein 2; AltName: Full=Protein PROCUSTE 
1; AltName: Full=Protein QUILL [Arabidopsis thaliana]
 dbj|BAB10307.1| cellulose synthase catalytic subunit [Arabidopsis thaliana]
 gb|AED97945.1| cellulose synthase A catalytic subunit 6 [UDP-forming] [Arabidopsis 
thaliana]
 gb|AID66000.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=1084

 Score =   196 bits (499),  Expect = 6e-55, Method: Composition-based stats.
 Identities = 85/97 (88%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ+CQIC DEIE+TVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSVQELSGQTCQICRDEIELTVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTR+KRLKGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRFKRLKGSPRV  97



>ref|XP_003630174.1| Cellulose synthase A catalytic subunit [Medicago truncatula]
 gb|AET04650.1| cellulose synthase-like protein [Medicago truncatula]
Length=1098

 Score =   196 bits (499),  Expect = 6e-55, Method: Composition-based stats.
 Identities = 85/97 (88%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M T GRLIAGSHNRNEFVLINA+E GR+ SV+ELSGQ C ICGDEIE+TVDGEPFVACNE
Sbjct  1    MHTGGRLIAGSHNRNEFVLINAEENGRIKSVRELSGQICMICGDEIEVTVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYER+EGNQACPQCKTRYKRLKGSP V
Sbjct  61   CAFPVCRPCYEYERKEGNQACPQCKTRYKRLKGSPRV  97



>ref|XP_006279743.1| hypothetical protein CARUB_v10027598mg [Capsella rubella]
 gb|EOA12641.1| hypothetical protein CARUB_v10027598mg [Capsella rubella]
Length=1084

 Score =   196 bits (498),  Expect = 8e-55, Method: Composition-based stats.
 Identities = 85/97 (88%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ+CQIC DEIE+TVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSVQELSGQTCQICRDEIELTVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTR+KRLKGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRFKRLKGSPRV  97



>ref|XP_010260984.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Nelumbo nucifera]
Length=1093

 Score =   196 bits (498),  Expect = 9e-55, Method: Composition-based stats.
 Identities = 85/98 (87%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M T GRL+AGSHNRNEFV+INADEIGRV SVKELSGQ CQICGDE+EIT DGEPFVACNE
Sbjct  1    MYTGGRLVAGSHNRNEFVVINADEIGRVKSVKELSGQICQICGDEVEITDDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTVE  444
            CAFPVCRPCYEYERREGNQ CPQCKTRYKR+KGS  V+
Sbjct  61   CAFPVCRPCYEYERREGNQICPQCKTRYKRIKGSARVD  98



>ref|XP_003536418.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Glycine max]
 gb|KHN17022.1| Cellulose synthase A catalytic subunit 6 [UDP-forming] [Glycine 
soja]
Length=1095

 Score =   196 bits (497),  Expect = 1e-54, Method: Composition-based stats.
 Identities = 85/97 (88%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDTKGRL+AGSHNRNEFVLINADE  RV +V ELSGQ CQICGDEIE+TVDGEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADETARVNAVTELSGQICQICGDEIEVTVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGN+ CPQCKT YKRLKGSP V
Sbjct  61   CAFPVCRPCYEYERREGNKICPQCKTIYKRLKGSPRV  97



>ref|XP_009350645.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
isoform X1 [Pyrus x bretschneideri]
Length=1099

 Score =   196 bits (497),  Expect = 1e-54, Method: Composition-based stats.
 Identities = 84/97 (87%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDT+GRL+AGSHNRNEFVLINADE  R+  V+ELSGQ CQICGDEIE+TVDGEPFVACNE
Sbjct  1    MDTRGRLVAGSHNRNEFVLINADENSRIQPVQELSGQICQICGDEIELTVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACP CKTRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPHCKTRYKRIKGSPRV  97



>ref|XP_009350646.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
isoform X2 [Pyrus x bretschneideri]
Length=1097

 Score =   196 bits (497),  Expect = 1e-54, Method: Composition-based stats.
 Identities = 84/97 (87%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDT+GRL+AGSHNRNEFVLINADE  R+  V+ELSGQ CQICGDEIE+TVDGEPFVACNE
Sbjct  1    MDTRGRLVAGSHNRNEFVLINADENSRIQPVQELSGQICQICGDEIELTVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACP CKTRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPHCKTRYKRIKGSPRV  97



>ref|XP_010444419.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like 
[Camelina sativa]
Length=1090

 Score =   195 bits (496),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 85/97 (88%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ+CQIC DEIE+TVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSVQELSGQTCQICRDEIELTVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGN+ACPQCKTRYKRLKGSP V
Sbjct  61   CAFPVCRPCYEYERREGNKACPQCKTRYKRLKGSPRV  97



>ref|XP_008440995.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Cucumis melo]
Length=1091

 Score =   195 bits (496),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 84/97 (87%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDT GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ+CQICGDE+E+T +GE FVACNE
Sbjct  1    MDTAGRLIAGSHNRNEFVLINADETARIKSVKELSGQTCQICGDEVELTAEGELFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  97



>ref|XP_002871389.1| hypothetical protein ARALYDRAFT_908936 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47648.1| hypothetical protein ARALYDRAFT_908936 [Arabidopsis lyrata subsp. 
lyrata]
Length=1069

 Score =   195 bits (495),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 83/97 (86%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ+CQICGDEIE++VDGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVEELSGQTCQICGDEIELSVDGESFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQ+CPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQSCPQCKTRYKRIKGSPRV  97



>ref|XP_007143558.1| hypothetical protein PHAVU_007G081700g [Phaseolus vulgaris]
 gb|ESW15552.1| hypothetical protein PHAVU_007G081700g [Phaseolus vulgaris]
Length=1093

 Score =   195 bits (495),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 83/97 (86%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDT GRL+A SHNRNEF++INAD+ GRV +V EL GQ CQICGDEIEIT DGEPFVACNE
Sbjct  1    MDTTGRLVASSHNRNEFIIINADQTGRVNAVTELCGQICQICGDEIEITADGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRV  97



>ref|XP_010462809.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like 
[Camelina sativa]
Length=1084

 Score =   195 bits (495),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 84/97 (87%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ+CQIC DEIE+TVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSVQELSGQTCQICRDEIELTVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGN+ACPQCKTR+KRLKGSP V
Sbjct  61   CAFPVCRPCYEYERREGNKACPQCKTRFKRLKGSPRV  97



>ref|XP_007151999.1| hypothetical protein PHAVU_004G093300g [Phaseolus vulgaris]
 gb|ESW23993.1| hypothetical protein PHAVU_004G093300g [Phaseolus vulgaris]
Length=1089

 Score =   195 bits (495),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 85/98 (87%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDT GRLIAGSHNRNEFVLINADE  RVT+V ELSGQ CQICGDE+E+TV GEPFVACNE
Sbjct  1    MDTNGRLIAGSHNRNEFVLINADETARVTAVTELSGQICQICGDELEVTVIGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTVE  444
            CAFPVCRPCYEYERREGNQ CPQCKTRYKR+KGS  VE
Sbjct  61   CAFPVCRPCYEYERREGNQVCPQCKTRYKRIKGSARVE  98



>emb|CDY08854.1| BnaA06g23700D [Brassica napus]
Length=1082

 Score =   194 bits (494),  Expect = 3e-54, Method: Composition-based stats.
 Identities = 83/97 (86%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRL+AGSHNRNEFVLINADE  R+ SV+ELSGQ+C+IC DEIE+TVDGEPFVACNE
Sbjct  1    MNTGGRLVAGSHNRNEFVLINADESARIRSVQELSGQTCKICRDEIELTVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  97



>ref|XP_008338760.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Malus domestica]
Length=1097

 Score =   195 bits (495),  Expect = 3e-54, Method: Composition-based stats.
 Identities = 83/97 (86%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDT+GRL+AGSHNRNEFVLINADE  R+  V+ELSGQ CQICGDEIE+TVDGEPFVACNE
Sbjct  1    MDTRGRLVAGSHNRNEFVLINADENSRIQPVQELSGQICQICGDEIELTVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACP CKTRYKR++GSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPHCKTRYKRIRGSPRV  97



>ref|NP_196549.1| cellulose synthase A catalytic subunit 5 [UDP-forming] [Arabidopsis 
thaliana]
 sp|Q8L778.2|CESA5_ARATH RecName: Full=Cellulose synthase A catalytic subunit 5 [UDP-forming]; 
Short=AtCesA5 [Arabidopsis thaliana]
 dbj|BAB09408.1| cellulose synthase catalytic subunit [Arabidopsis thaliana]
 gb|AED91458.1| cellulose synthase A catalytic subunit 5 [UDP-forming] [Arabidopsis 
thaliana]
Length=1069

 Score =   194 bits (494),  Expect = 3e-54, Method: Composition-based stats.
 Identities = 83/97 (86%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ+CQICGDEIE++VDGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVEELSGQTCQICGDEIELSVDGESFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQ+CPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQSCPQCKTRYKRIKGSPRV  97



>ref|XP_004141979.1| PREDICTED: probable cellulose synthase A catalytic subunit 9 
[UDP-forming]-like [Cucumis sativus]
 ref|XP_004160480.1| PREDICTED: probable cellulose synthase A catalytic subunit 9 
[UDP-forming]-like [Cucumis sativus]
 gb|KGN48397.1| hypothetical protein Csa_6G486700 [Cucumis sativus]
Length=1090

 Score =   194 bits (494),  Expect = 3e-54, Method: Composition-based stats.
 Identities = 84/97 (87%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDT GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ+CQICGDE+E+T +GE FVACNE
Sbjct  1    MDTAGRLIAGSHNRNEFVLINADETARIKSVKELSGQTCQICGDEVELTAEGELFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  97



>emb|CDY14504.1| BnaC03g49550D [Brassica napus]
Length=1082

 Score =   194 bits (494),  Expect = 3e-54, Method: Composition-based stats.
 Identities = 83/97 (86%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRL+AGSHNRNEFVLINADE  R+ SV+ELSGQ+C+IC DEIE+TVDGEPFVACNE
Sbjct  1    MNTGGRLVAGSHNRNEFVLINADESARIRSVQELSGQTCKICRDEIELTVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  97



>gb|KEH43649.1| cellulose synthase-like protein [Medicago truncatula]
Length=1097

 Score =   194 bits (494),  Expect = 3e-54, Method: Composition-based stats.
 Identities = 83/98 (85%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDT GRL+AGSHNRNEFVLINAD+  RV +V ELSGQ CQICGDEIE TVD EPFVACNE
Sbjct  5    MDTNGRLVAGSHNRNEFVLINADDTARVNAVTELSGQICQICGDEIEFTVDDEPFVACNE  64

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTVE  444
            CAFPVCRPCYEYERREGNQACP CKT+YKR+KGSP VE
Sbjct  65   CAFPVCRPCYEYERREGNQACPHCKTKYKRIKGSPRVE  102



>gb|AES62337.2| cellulose synthase-like protein [Medicago truncatula]
Length=1093

 Score =   194 bits (494),  Expect = 3e-54, Method: Composition-based stats.
 Identities = 83/98 (85%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDT GRL+AGSHNRNEFVLINAD+  RV +V ELSGQ CQICGDEIE TVD EPFVACNE
Sbjct  1    MDTNGRLVAGSHNRNEFVLINADDTARVNAVTELSGQICQICGDEIEFTVDDEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTVE  444
            CAFPVCRPCYEYERREGNQACP CKT+YKR+KGSP VE
Sbjct  61   CAFPVCRPCYEYERREGNQACPHCKTKYKRIKGSPRVE  98



>ref|XP_009150553.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming] 
[Brassica rapa]
Length=1082

 Score =   194 bits (494),  Expect = 3e-54, Method: Composition-based stats.
 Identities = 83/97 (86%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRL+AGSHNRNEFVLINADE  R+ SV+ELSGQ+C+IC DEIE+TVDGEPFVACNE
Sbjct  1    MNTGGRLVAGSHNRNEFVLINADESARIRSVQELSGQTCKICRDEIELTVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  97



>gb|KDO57137.1| hypothetical protein CISIN_1g001369mg [Citrus sinensis]
Length=1091

 Score =   194 bits (493),  Expect = 4e-54, Method: Composition-based stats.
 Identities = 86/97 (89%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M T GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ+CQIC DEIEIT +GEPFVACNE
Sbjct  1    MATGGRLIAGSHNRNEFVLINADETARIKSVKELSGQTCQICEDEIEITDNGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRV  97



>ref|XP_011042923.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Populus euphratica]
Length=943

 Score =   193 bits (491),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/97 (92%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+TKGRLIAGSHNRNEFVLINADEI RVTSVKELSGQ C+ICGDEIE+TVDGEPFVACNE
Sbjct  1    METKGRLIAGSHNRNEFVLINADEIARVTSVKELSGQICKICGDEIEVTVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQC+TRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCRTRYKRVKGSPRV  97



>ref|XP_006427904.1| hypothetical protein CICLE_v10024766mg [Citrus clementina]
 ref|XP_006464533.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Citrus sinensis]
 gb|ESR41144.1| hypothetical protein CICLE_v10024766mg [Citrus clementina]
Length=1091

 Score =   194 bits (493),  Expect = 4e-54, Method: Composition-based stats.
 Identities = 86/97 (89%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M T GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ+CQIC DEIEIT +GEPFVACNE
Sbjct  1    MATGGRLIAGSHNRNEFVLINADETARIKSVKELSGQTCQICEDEIEITDNGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRV  97



>ref|XP_009112155.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like 
[Brassica rapa]
Length=1083

 Score =   194 bits (493),  Expect = 4e-54, Method: Composition-based stats.
 Identities = 83/97 (86%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+EL GQ+C+IC DE+E+TVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVQELRGQTCEICRDEVELTVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRV  97



>emb|CDX81249.1| BnaC09g06600D [Brassica napus]
Length=1084

 Score =   194 bits (493),  Expect = 4e-54, Method: Composition-based stats.
 Identities = 83/97 (86%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+EL GQ+C+IC DE+E+TVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVQELRGQTCEICRDEVELTVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRV  97



>emb|CDY18696.1| BnaA09g06990D [Brassica napus]
Length=1084

 Score =   194 bits (493),  Expect = 4e-54, Method: Composition-based stats.
 Identities = 83/97 (86%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+EL GQ+C+IC DE+E+TVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVQELRGQTCEICRDEVELTVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRV  97



>gb|KHN00756.1| Cellulose synthase A catalytic subunit 6 [UDP-forming] [Glycine 
soja]
Length=1052

 Score =   194 bits (492),  Expect = 4e-54, Method: Composition-based stats.
 Identities = 85/98 (87%), Positives = 91/98 (93%), Gaps = 1/98 (1%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDTKGRL+AGSHNRNEFVLINADE  RV +V ELSGQ CQICGDE+E+TV+GEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADETARV-AVTELSGQICQICGDELEVTVNGEPFVACNE  59

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTVE  444
            CAFPVCRPCYEYERREGNQ CPQCKTRYKR+KGSP VE
Sbjct  60   CAFPVCRPCYEYERREGNQVCPQCKTRYKRIKGSPRVE  97



>ref|XP_003518592.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Glycine max]
Length=1078

 Score =   194 bits (492),  Expect = 5e-54, Method: Composition-based stats.
 Identities = 85/98 (87%), Positives = 91/98 (93%), Gaps = 1/98 (1%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDTKGRL+AGSHNRNEFVLINADE  RV +V ELSGQ CQICGDE+E+TV+GEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADETARV-AVTELSGQICQICGDELEVTVNGEPFVACNE  59

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTVE  444
            CAFPVCRPCYEYERREGNQ CPQCKTRYKR+KGSP VE
Sbjct  60   CAFPVCRPCYEYERREGNQVCPQCKTRYKRIKGSPRVE  97



>gb|EYU17480.1| hypothetical protein MIMGU_mgv1a000527mg [Erythranthe guttata]
Length=938

 Score =   193 bits (490),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDT GRL+AGSHNRNEFVLINADEIGRVTSVKELSGQ CQICGDE+E TVDGEPFVACNE
Sbjct  1    MDTNGRLVAGSHNRNEFVLINADEIGRVTSVKELSGQICQICGDEVEFTVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFP+CRPCYEYERREGNQ+CPQCKTR+KR+KGSP V
Sbjct  61   CAFPICRPCYEYERREGNQSCPQCKTRFKRIKGSPRV  97



>ref|XP_010491630.1| PREDICTED: cellulose synthase A catalytic subunit 5 [UDP-forming]-like 
[Camelina sativa]
Length=1068

 Score =   194 bits (492),  Expect = 6e-54, Method: Composition-based stats.
 Identities = 83/97 (86%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ+CQICGDEIE+ VDGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVEELSGQTCQICGDEIELGVDGESFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQ+CPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQSCPQCKTRYKRIKGSPRV  97



>gb|ACS68196.1| cellulose synthase 6.1 catalytic subunit [Brassica napus]
Length=1084

 Score =   194 bits (492),  Expect = 6e-54, Method: Composition-based stats.
 Identities = 83/97 (86%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+EL GQ+C+IC DE+E+TVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVQELRGQTCEICRDEVELTVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRV  97



>ref|XP_010452989.1| PREDICTED: cellulose synthase A catalytic subunit 5 [UDP-forming] 
[Camelina sativa]
Length=1068

 Score =   193 bits (491),  Expect = 6e-54, Method: Composition-based stats.
 Identities = 83/97 (86%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ+CQICGDEIE+ VDGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVEELSGQTCQICGDEIELGVDGESFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQ+CPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQSCPQCKTRYKRIKGSPRV  97



>gb|KHN34038.1| Cellulose synthase A catalytic subunit 6 [UDP-forming] [Glycine 
soja]
Length=1097

 Score =   193 bits (491),  Expect = 7e-54, Method: Composition-based stats.
 Identities = 84/97 (87%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M T GRL+AGSHNRNEFVLINAD+ GR+ SV+ELSGQ CQICGDEIEITVDGEPFVACNE
Sbjct  1    MHTGGRLVAGSHNRNEFVLINADDNGRIKSVRELSGQICQICGDEIEITVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREG QACPQC TRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGIQACPQCNTRYKRIKGSPRV  97



>ref|XP_003525098.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Glycine max]
Length=1097

 Score =   193 bits (491),  Expect = 7e-54, Method: Composition-based stats.
 Identities = 84/97 (87%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M T GRL+AGSHNRNEFVLINAD+ GR+ SV+ELSGQ CQICGDEIEITVDGEPFVACNE
Sbjct  1    MHTGGRLVAGSHNRNEFVLINADDNGRIKSVRELSGQICQICGDEIEITVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREG QACPQC TRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGIQACPQCNTRYKRIKGSPRV  97



>gb|KJB18371.1| hypothetical protein B456_003G049300 [Gossypium raimondii]
Length=925

 Score =   192 bits (488),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 89/98 (91%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDT GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ+CQICGDEIEITVDGEPFVACNE
Sbjct  1    MDTGGRLIAGSHNRNEFVLINADENARIKSVQELSGQTCQICGDEIEITVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTVE  444
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP VE
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVE  98



>ref|XP_010484268.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming] 
[Camelina sativa]
Length=1084

 Score =   193 bits (490),  Expect = 9e-54, Method: Composition-based stats.
 Identities = 84/97 (87%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ+CQIC DEIE+TV GEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSVQELSGQTCQICRDEIELTVGGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGN+ACPQCKTRYKRLKGSP V
Sbjct  61   CAFPVCRPCYEYERREGNKACPQCKTRYKRLKGSPRV  97



>gb|AEK86669.1| cellulose synthase 5 [Arabidopsis thaliana]
Length=996

 Score =   192 bits (489),  Expect = 9e-54, Method: Composition-based stats.
 Identities = 83/97 (86%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ+CQICGDEIE++VDGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVEELSGQTCQICGDEIELSVDGESFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQ+CPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQSCPQCKTRYKRIKGSPRV  97



>ref|XP_002866842.1| hypothetical protein ARALYDRAFT_490712 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43101.1| hypothetical protein ARALYDRAFT_490712 [Arabidopsis lyrata subsp. 
lyrata]
Length=1084

 Score =   193 bits (490),  Expect = 9e-54, Method: Composition-based stats.
 Identities = 84/97 (87%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ+CQICGDEIE+TV+GE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVQELSGQTCQICGDEIELTVNGELFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  97



>ref|XP_010546378.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming] 
[Tarenaya hassleriana]
Length=1075

 Score =   193 bits (490),  Expect = 1e-53, Method: Composition-based stats.
 Identities = 83/97 (86%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRL+AGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDEIE+TVDG+ FVACNE
Sbjct  1    MNTGGRLVAGSHNRNEFVLINADESARIRSVQELSGQICQICGDEIELTVDGDSFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  97



>gb|AGV22108.1| cellulose synthase 6 [Betula luminifera]
Length=1103

 Score =   192 bits (489),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 86/103 (83%), Positives = 91/103 (88%), Gaps = 6/103 (6%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGR------VTSVKELSGQSCQICGDEIEITVDGEP  312
            MDT+GRLIAGSHNRNE +LINADE GR      + SVKELSGQ CQICGDE+EITVDGE 
Sbjct  1    MDTRGRLIAGSHNRNELILINADENGRGDENGRIKSVKELSGQMCQICGDEVEITVDGEL  60

Query  313  FVACNECAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            FVACNECAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP V
Sbjct  61   FVACNECAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  103



>gb|KHG03006.1| Cellulose synthase A catalytic subunit 2 [UDP-forming] -like 
protein [Gossypium arboreum]
Length=1059

 Score =   192 bits (488),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 87/99 (88%), Positives = 89/99 (90%), Gaps = 2/99 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEI--TVDGEPFVAC  324
            MDT GRLIAGSHNRNEFVLINA E  R+ SVKELSGQSCQICGDEIEI  TVDGEPFVAC
Sbjct  1    MDTGGRLIAGSHNRNEFVLINAYENARIKSVKELSGQSCQICGDEIEIEITVDGEPFVAC  60

Query  325  NECAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            NECAFPVCR CYEY RREGNQACPQCKTRYKR+KGSP V
Sbjct  61   NECAFPVCRTCYEYGRREGNQACPQCKTRYKRIKGSPRV  99



>ref|XP_006411737.1| hypothetical protein EUTSA_v10024277mg [Eutrema salsugineum]
 gb|ESQ53190.1| hypothetical protein EUTSA_v10024277mg [Eutrema salsugineum]
Length=1084

 Score =   192 bits (488),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 84/97 (87%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ+CQICGDEIE+TV+GE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSVQELSGQTCQICGDEIELTVNGELFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  97



>gb|EYU31127.1| hypothetical protein MIMGU_mgv1a000549mg [Erythranthe guttata]
Length=1082

 Score =   192 bits (488),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 81/98 (83%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRL+AGSHNR EFVLINADEIG + SV+ELSGQ+C+ICGDE+EIT+DGE FVACNE
Sbjct  1    MNTGGRLVAGSHNRKEFVLINADEIGSIKSVQELSGQTCKICGDEVEITLDGELFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTVE  444
            CAFPVCRPCYEYER+EGNQ+CPQCKTRYKR+KGSP VE
Sbjct  61   CAFPVCRPCYEYERKEGNQSCPQCKTRYKRIKGSPRVE  98



>ref|XP_003548102.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Glycine max]
Length=1078

 Score =   192 bits (487),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 84/97 (87%), Positives = 90/97 (93%), Gaps = 1/97 (1%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDTKGRL+AGSHNRNEFVLINADE  RV +V ELSGQ CQICGDE+E+TV+GEPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADETARV-AVTELSGQICQICGDELEVTVNGEPFVACNE  59

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQ CPQCKTRYKR+KGSP V
Sbjct  60   CAFPVCRPCYEYERREGNQVCPQCKTRYKRIKGSPRV  96



>ref|XP_004503981.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like 
[Cicer arietinum]
Length=1096

 Score =   192 bits (487),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 83/97 (86%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M T GRLIAGSHNRNEFVLINA+E GR+ SV+ELSGQ CQICGDEIE+TVDGEPFVACNE
Sbjct  1    MHTGGRLIAGSHNRNEFVLINAEENGRIKSVRELSGQICQICGDEIEVTVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYER+EGNQACPQCKTR+KR+KGS  V
Sbjct  61   CAFPVCRPCYEYERKEGNQACPQCKTRFKRIKGSSRV  97



>gb|KFK25282.1| hypothetical protein AALP_AA8G091900 [Arabis alpina]
Length=1071

 Score =   191 bits (486),  Expect = 3e-53, Method: Composition-based stats.
 Identities = 83/97 (86%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDEIE++ DGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVEELSGQICQICGDEIELSDDGESFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  97



>gb|AHL45029.1| cellulose synthase 6C [Linum usitatissimum]
Length=1097

 Score =   192 bits (487),  Expect = 3e-53, Method: Composition-based stats.
 Identities = 85/97 (88%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE GR+ SV+ELSGQ CQICGDEIEITVDGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESGRIRSVQELSGQVCQICGDEIEITVDGELFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREG QACPQC+TRYKRLKG P V
Sbjct  61   CAFPVCRPCYEYERREGTQACPQCRTRYKRLKGCPRV  97



>gb|AHL45030.1| cellulose synthase 6D [Linum usitatissimum]
Length=1097

 Score =   191 bits (486),  Expect = 3e-53, Method: Composition-based stats.
 Identities = 85/97 (88%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE GR+ SV+ELSGQ CQICGDEIEITVDGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENGRIRSVQELSGQVCQICGDEIEITVDGELFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREG QACPQC+TRYKRLKG P V
Sbjct  61   CAFPVCRPCYEYERREGTQACPQCRTRYKRLKGCPRV  97



>ref|XP_006399471.1| hypothetical protein EUTSA_v10012521mg [Eutrema salsugineum]
 gb|ESQ40924.1| hypothetical protein EUTSA_v10012521mg [Eutrema salsugineum]
Length=1073

 Score =   191 bits (486),  Expect = 3e-53, Method: Composition-based stats.
 Identities = 83/97 (86%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDEIE+T DGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVEELSGQICQICGDEIELTDDGESFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQ+CPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQSCPQCKTRYKRIKGSPRV  97



>ref|XP_007213712.1| hypothetical protein PRUPE_ppa000567mg [Prunus persica]
 gb|EMJ14911.1| hypothetical protein PRUPE_ppa000567mg [Prunus persica]
Length=853

 Score =   189 bits (481),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDT+GRL+AGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDEIEITVDGEPFVACNE
Sbjct  1    MDTRGRLVAGSHNRNEFVLINADENARIKSVQELSGQICQICGDEIEITVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  97



>ref|XP_011090445.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
[Sesamum indicum]
Length=1090

 Score =   191 bits (484),  Expect = 7e-53, Method: Composition-based stats.
 Identities = 82/97 (85%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRL+AGSHNRNEFVLINADEIGR+ SV ELSGQ+CQICGDE+EITVDGE FVACNE
Sbjct  3    MNTGGRLVAGSHNRNEFVLINADEIGRIKSVHELSGQTCQICGDEVEITVDGELFVACNE  62

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCR CYEYER+EG Q CPQCKTRYKR+KGSP V
Sbjct  63   CAFPVCRTCYEYERKEGTQCCPQCKTRYKRIKGSPRV  99



>ref|XP_010680991.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Beta vulgaris subsp. vulgaris]
Length=1102

 Score =   191 bits (484),  Expect = 8e-53, Method: Composition-based stats.
 Identities = 84/97 (87%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDTKGRL+AGSHNRNEFVLINAD+IGRVTSVKELSGQ CQICGDEIE T + EPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADDIGRVTSVKELSGQLCQICGDEIENTKNDEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCY+YER EGNQACPQCKTRYKR+KG   V
Sbjct  61   CAFPVCRPCYDYERGEGNQACPQCKTRYKRIKGCARV  97



>gb|KDO83763.1| hypothetical protein CISIN_1g001373mg [Citrus sinensis]
 gb|KDO83764.1| hypothetical protein CISIN_1g001373mg [Citrus sinensis]
Length=786

 Score =   188 bits (478),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M T GRL+AGSHNRNEFVLINADE+ RVTSVKELSGQ CQICGDEIEIT +GEPFVACNE
Sbjct  1    MATNGRLVAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEITDNGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  97



>ref|NP_195645.1| cellulose synthase A catalytic subunit 2 [UDP-forming] [Arabidopsis 
thaliana]
 sp|O48947.1|CESA2_ARATH RecName: Full=Cellulose synthase A catalytic subunit 2 [UDP-forming]; 
Short=AtCesA2; Short=Ath-A [Arabidopsis thaliana]
 gb|AAC39335.1| cellulose synthase catalytic subunit [Arabidopsis thaliana]
 emb|CAB43650.1| cellulose synthase catalytic subunit (Ath-A) [Arabidopsis thaliana]
 emb|CAB80598.1| cellulose synthase catalytic subunit (Ath-A) [Arabidopsis thaliana]
 gb|AEE87059.1| cellulose synthase A catalytic subunit 2 [UDP-forming] [Arabidopsis 
thaliana]
 gb|AHL38978.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=1084

 Score =   190 bits (483),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 83/97 (86%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ+CQICGDEIE+TV  E FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVQELSGQTCQICGDEIELTVSSELFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  97



>emb|CDY31305.1| BnaA02g34360D [Brassica napus]
Length=1079

 Score =   190 bits (483),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 82/95 (86%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+EL GQ+C+IC DEIE TVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSVQELRGQTCEICRDEIESTVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSP  435
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSP  95



>gb|AAC29067.1| cellulose synthase [Arabidopsis thaliana]
Length=1081

 Score =   190 bits (483),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 82/92 (89%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = +1

Query  166  RLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNECAFPV  345
            RLIAGSHNRNEFVLINADE  R+ SV+ELSGQ+CQIC DEIE+TVDGEPFVACNECAFPV
Sbjct  3    RLIAGSHNRNEFVLINADENARIRSVQELSGQTCQICRDEIELTVDGEPFVACNECAFPV  62

Query  346  CRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CRPCYEYERREGNQACPQCKTR+KRLKGSP V
Sbjct  63   CRPCYEYERREGNQACPQCKTRFKRLKGSPRV  94



>ref|XP_006283042.1| hypothetical protein CARUB_v10004034mg [Capsella rubella]
 gb|EOA15940.1| hypothetical protein CARUB_v10004034mg [Capsella rubella]
Length=1084

 Score =   190 bits (482),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 83/97 (86%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ+CQICGDEIE+TV  E FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVQELSGQTCQICGDEIELTVTSELFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  97



>ref|XP_006286951.1| hypothetical protein CARUB_v10000099mg [Capsella rubella]
 gb|EOA19849.1| hypothetical protein CARUB_v10000099mg [Capsella rubella]
Length=1068

 Score =   190 bits (482),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 80/97 (82%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+EL+GQ+CQICGDEIE+ +DGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVEELTGQTCQICGDEIELNLDGESFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQ+CPQCKTRYKR++GSP V
Sbjct  61   CAFPVCRPCYEYERREGNQSCPQCKTRYKRIQGSPRV  97



>emb|CDY42621.1| BnaC01g00330D [Brassica napus]
Length=1069

 Score =   190 bits (482),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 81/98 (83%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE  R+ S++ELSGQ+CQICGD+IE++V+GE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSLQELSGQTCQICGDDIELSVNGELFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTVE  444
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP V+
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVQ  98



>ref|XP_009115076.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
[Brassica rapa]
Length=1074

 Score =   190 bits (482),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 81/98 (83%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE  R+ S++ELSGQ+CQICGD+IE++V+GE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSLQELSGQTCQICGDDIELSVNGELFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTVE  444
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP V+
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVQ  98



>emb|CDY41973.1| BnaA01g05450D [Brassica napus]
Length=1074

 Score =   190 bits (482),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 81/98 (83%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE  R+ S++ELSGQ+CQICGD+IE++V+GE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSLQELSGQTCQICGDDIELSVNGELFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTVE  444
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP V+
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVQ  98



>ref|XP_010088737.1| Isoxaben-resistant protein 2 [Morus notabilis]
 gb|EXB36918.1| Isoxaben-resistant protein 2 [Morus notabilis]
Length=1082

 Score =   189 bits (481),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 83/94 (88%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = +1

Query  163  GRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNECAFP  342
            GRL+AGSHNRNEFVLINADE  R+ SV+ELSGQ CQICGDEIEITVDGE FVACNECAFP
Sbjct  4    GRLVAGSHNRNEFVLINADENARIKSVQELSGQICQICGDEIEITVDGELFVACNECAFP  63

Query  343  VCRPCYEYERREGNQACPQCKTRYKRLKGSPTVE  444
            VCRPCYEYERREGNQACPQCKT+YKR+KGSP VE
Sbjct  64   VCRPCYEYERREGNQACPQCKTQYKRIKGSPRVE  97



>gb|ACS68191.1| cellulose synthase 2.1 catalytic subunit [Brassica napus]
Length=1074

 Score =   189 bits (481),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 81/98 (83%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE  R+ S++ELSGQ+CQICGD+IE++V+GE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSLQELSGQTCQICGDDIELSVNGELFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTVE  444
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP V+
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRVQ  98



>ref|XP_009131129.1| PREDICTED: cellulose synthase A catalytic subunit 5 [UDP-forming] 
[Brassica rapa]
Length=1072

 Score =   189 bits (481),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 82/97 (85%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQSCQICGDEIE++ DGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVEELSGQSCQICGDEIELSDDGESFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCR CYEYERREGNQ+CPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRTCYEYERREGNQSCPQCKTRYKRIKGSPRV  97



>ref|XP_010678670.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Beta vulgaris subsp. vulgaris]
Length=1102

 Score =   189 bits (481),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 83/97 (86%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDTKGRL+AGSHNRNEFVLINAD+IGRVTSVKELSGQ CQICGDEIE   + EPFVACNE
Sbjct  1    MDTKGRLVAGSHNRNEFVLINADDIGRVTSVKELSGQLCQICGDEIENIENNEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCY+YER EGNQACPQCKTRYKR+KG   V
Sbjct  61   CAFPVCRPCYDYEREEGNQACPQCKTRYKRIKGCARV  97



>emb|CDY56540.1| BnaA03g55860D [Brassica napus]
Length=1074

 Score =   189 bits (480),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 82/97 (85%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQSCQICGDEIE++ DGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVEELSGQSCQICGDEIELSDDGESFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCR CYEYERREGNQ+CPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRTCYEYERREGNQSCPQCKTRYKRIKGSPRV  97



>ref|XP_009130469.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like 
[Brassica rapa]
Length=1079

 Score =   189 bits (480),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 81/95 (85%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GR+IAGSHNRNEFVLINADE  R+ SV+EL GQ+C+IC DEIE TVDGEPFVACNE
Sbjct  1    MNTGGRVIAGSHNRNEFVLINADENARIRSVQELKGQTCEICRDEIESTVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSP  435
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSP  95



>gb|KDO83762.1| hypothetical protein CISIN_1g001373mg [Citrus sinensis]
Length=917

 Score =   188 bits (477),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M T GRL+AGSHNRNEFVLINADE+ RVTSVKELSGQ CQICGDEIEIT +GEPFVACNE
Sbjct  1    MATNGRLVAGSHNRNEFVLINADEVARVTSVKELSGQICQICGDEIEITDNGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  97



>ref|XP_010437052.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
[Camelina sativa]
Length=1074

 Score =   189 bits (479),  Expect = 3e-52, Method: Composition-based stats.
 Identities = 82/97 (85%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ+C+IC DEIE+TV+GE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVQELSGQTCKICRDEIELTVNGELFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  97



>emb|CDX81145.1| BnaC03g03990D [Brassica napus]
Length=1070

 Score =   188 bits (478),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 82/97 (85%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQSCQICGDEIE++ DGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVEELSGQSCQICGDEIELSDDGESFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCR CYEYERREGNQ+CPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRTCYEYERREGNQSCPQCKTRYKRIKGSPRV  97



>gb|ACS68195.1| cellulose synthase 5.1 catalytic subunit [Brassica napus]
Length=1070

 Score =   188 bits (478),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 82/97 (85%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQSCQICGDEIE++ DGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVEELSGQSCQICGDEIELSDDGESFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCR CYEYERREGNQ+CPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRTCYEYERREGNQSCPQCKTRYKRIKGSPRV  97



>ref|XP_010431901.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Camelina sativa]
Length=1074

 Score =   188 bits (478),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 82/97 (85%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ+C IC DEIE+TV+GE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVQELSGQTCHICRDEIELTVNGELFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  97



>emb|CDY46820.1| BnaC02g43280D [Brassica napus]
Length=1079

 Score =   188 bits (478),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 81/95 (85%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+EL GQ+C+IC DEIE TV+GEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSVQELRGQTCEICRDEIESTVEGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSP  435
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSP  95



>ref|XP_002878571.1| hypothetical protein ARALYDRAFT_900606 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54830.1| hypothetical protein ARALYDRAFT_900606 [Arabidopsis lyrata subsp. 
lyrata]
Length=1089

 Score =   188 bits (478),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 79/97 (81%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ+C+IC DEIE+T +GEPF+ACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADETARIRSVQELSGQTCKICRDEIELTENGEPFIACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYER+EGNQACPQC+TRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERKEGNQACPQCRTRYKRIKGSPRV  97



>gb|AHL45027.1| cellulose synthase 6A [Linum usitatissimum]
Length=1096

 Score =   188 bits (477),  Expect = 6e-52, Method: Composition-based stats.
 Identities = 83/97 (86%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE GR+ SV+ELSGQ CQICGDEIEIT DGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESGRIQSVRELSGQVCQICGDEIEITADGELFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREG QACPQC+TR+KRLKGS  V
Sbjct  61   CAFPVCRPCYEYERREGTQACPQCRTRFKRLKGSARV  97



>gb|AHL45028.1| cellulose synthase 6B [Linum usitatissimum]
Length=1096

 Score =   188 bits (477),  Expect = 7e-52, Method: Composition-based stats.
 Identities = 83/97 (86%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE GR+ SV+ELSGQ CQICGDEIEIT DGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESGRIRSVRELSGQVCQICGDEIEITADGELFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREG QACPQC+TR+KRLKGS  V
Sbjct  61   CAFPVCRPCYEYERREGTQACPQCRTRFKRLKGSARV  97



>ref|XP_010027732.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
[Eucalyptus grandis]
 gb|KCW54322.1| hypothetical protein EUGRSUZ_I00286 [Eucalyptus grandis]
Length=1092

 Score =   187 bits (476),  Expect = 8e-52, Method: Composition-based stats.
 Identities = 85/97 (88%), Positives = 88/97 (91%), Gaps = 1/97 (1%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ CQICGDE+EI  DGE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESSRIKSVKELSGQICQICGDEVEIA-DGELFVACNE  59

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSP V
Sbjct  60   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRV  96



>ref|XP_003592086.1| Cellulose synthase [Medicago truncatula]
Length=1135

 Score =   187 bits (475),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 80/100 (80%), Positives = 88/100 (88%), Gaps = 2/100 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVT--SVKELSGQSCQICGDEIEITVDGEPFVAC  324
            MDT GRL+AGSHNRNEFVLINAD+  RV+  +V ELSGQ CQICGDEIE TVD EPFVAC
Sbjct  1    MDTNGRLVAGSHNRNEFVLINADDTARVSVNAVTELSGQICQICGDEIEFTVDDEPFVAC  60

Query  325  NECAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTVE  444
            NECAFPVCRPCYEYERREGNQACP CKT+YKR+KG P+ +
Sbjct  61   NECAFPVCRPCYEYERREGNQACPHCKTKYKRIKGKPSTD  100



>ref|XP_006394118.1| hypothetical protein EUTSA_v100035740mg, partial [Eutrema salsugineum]
 gb|ESQ31404.1| hypothetical protein EUTSA_v100035740mg, partial [Eutrema salsugineum]
Length=798

 Score =   184 bits (468),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ+CQIC DEIE+TVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSVQELSGQTCQICRDEIELTVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  97



>dbj|BAF01335.1| cellulose synthase [Arabidopsis thaliana]
Length=771

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ+CQIC DEIE+TVDGEPFVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADENARIRSVQELSGQTCQICRDEIELTVDGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTR+KRLKGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRFKRLKGSPRV  97



>gb|KDO57138.1| hypothetical protein CISIN_1g001369mg [Citrus sinensis]
Length=791

 Score =   183 bits (465),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M T GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ+CQIC DEIEIT +GEPFVACNE
Sbjct  1    MATGGRLIAGSHNRNEFVLINADETARIKSVKELSGQTCQICEDEIEITDNGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRV  97



>ref|XP_002277635.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
[Vitis vinifera]
 emb|CAN72601.1| hypothetical protein VITISV_012984 [Vitis vinifera]
Length=1097

 Score =   185 bits (469),  Expect = 8e-51, Method: Composition-based stats.
 Identities = 79/97 (81%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M T GRL+AGSH+RNEFVLINAD+I R+ SV+ELSGQ C ICGD +EITVDGE FVACNE
Sbjct  1    MATGGRLVAGSHHRNEFVLINADDIARIKSVRELSGQICHICGDGVEITVDGELFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGN+ CPQCKTRYKR+KGSP V
Sbjct  61   CAFPVCRPCYEYERREGNKVCPQCKTRYKRMKGSPRV  97



>ref|XP_006847152.1| hypothetical protein AMTR_s00017p00239550 [Amborella trichopoda]
 gb|ERN08733.1| hypothetical protein AMTR_s00017p00239550 [Amborella trichopoda]
Length=1087

 Score =   184 bits (466),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 82/97 (85%), Positives = 87/97 (90%), Gaps = 3/97 (3%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDT GRL+AGSHNRNEFV+INADE      ++ELSGQ+CQICGDEIEITVDGE FVACNE
Sbjct  1    MDTNGRLVAGSHNRNEFVVINADE---PKPLRELSGQTCQICGDEIEITVDGEAFVACNE  57

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKR KGSP V
Sbjct  58   CAFPVCRPCYEYERREGNQACPQCKTRYKRHKGSPRV  94



>ref|XP_006427905.1| hypothetical protein CICLE_v10024766mg [Citrus clementina]
 gb|ESR41145.1| hypothetical protein CICLE_v10024766mg [Citrus clementina]
Length=918

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M T GRLIAGSHNRNEFVLINADE  R+ SVKELSGQ+CQIC DEIEIT +GEPFVACNE
Sbjct  1    MATGGRLIAGSHNRNEFVLINADETARIKSVKELSGQTCQICEDEIEITDNGEPFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSP V
Sbjct  61   CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPRV  97



>emb|CBI21555.3| unnamed protein product [Vitis vinifera]
Length=1097

 Score =   183 bits (465),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 78/97 (80%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M T GRL+AGSH+RNEFVLINAD+I R+ SV+ELSGQ C ICGD +EITVDGE FVACNE
Sbjct  1    MATGGRLVAGSHHRNEFVLINADDIARIKSVRELSGQICHICGDGVEITVDGELFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYERREGN+ CPQCKTRYKR+KG+P V
Sbjct  61   CAFPVCRPCYEYERREGNKVCPQCKTRYKRMKGNPRV  97



>ref|NP_179768.1| cellulose synthase A9 [Arabidopsis thaliana]
 sp|Q9SJ22.1|CESA9_ARATH RecName: Full=Probable cellulose synthase A catalytic subunit 
9 [UDP-forming]; Short=AtCesA9 [Arabidopsis thaliana]
 gb|AAD20396.1| putative cellulose synthase catalytic subunit [Arabidopsis thaliana]
 gb|AEC07220.1| cellulose synthase A9 [Arabidopsis thaliana]
Length=1088

 Score =   183 bits (465),  Expect = 3e-50, Method: Composition-based stats.
 Identities = 77/97 (79%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINAD+  R+ S +ELSGQ+C+IC DEIE+T +GEPF+ACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADDTARIRSAEELSGQTCKICRDEIELTDNGEPFIACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFP CRPCYEYERREGNQACPQC TRYKR+KGSP V
Sbjct  61   CAFPTCRPCYEYERREGNQACPQCGTRYKRIKGSPRV  97



>gb|EPS71230.1| hypothetical protein M569_03522 [Genlisea aurea]
Length=1086

 Score =   183 bits (464),  Expect = 3e-50, Method: Composition-based stats.
 Identities = 79/97 (81%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRL+AGSHNRNEFVLINADEIGR+ SV ELS Q+CQICGDE+EIT D E FVACNE
Sbjct  3    MNTGGRLVAGSHNRNEFVLINADEIGRIKSVHELSDQTCQICGDELEITADRELFVACNE  62

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCR CYEYERREG+Q CPQC+TRYKR+KGSP V
Sbjct  63   CAFPVCRTCYEYERREGSQCCPQCRTRYKRIKGSPRV  99



>ref|XP_010446473.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Camelina sativa]
Length=1075

 Score =   180 bits (456),  Expect = 5e-49, Method: Composition-based stats.
 Identities = 79/97 (81%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADE  R+ SV+ELSGQ+C+IC DEIE+TV GE FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADESARIRSVQELSGQTCKICRDEIELTVTGELFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYE ERREG QACPQCKTR+KR+KGSP V
Sbjct  61   CAFPVCRPCYEDERREGKQACPQCKTRFKRIKGSPRV  97



>gb|EPS66740.1| hypothetical protein M569_08032, partial [Genlisea aurea]
Length=1015

 Score =   179 bits (454),  Expect = 8e-49, Method: Composition-based stats.
 Identities = 79/97 (81%), Positives = 88/97 (91%), Gaps = 1/97 (1%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRLIAGSHNRNEFVLINADEIGR+ SV+ELSGQ+CQICGDE+EI+  G+ FVACNE
Sbjct  1    MNTGGRLIAGSHNRNEFVLINADEIGRIKSVQELSGQTCQICGDEVEISA-GDLFVACNE  59

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCR CYEYERREG Q CPQC+TRYKR+KGSP V
Sbjct  60   CAFPVCRTCYEYERREGTQCCPQCQTRYKRIKGSPRV  96



>ref|XP_004502891.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Cicer arietinum]
Length=1084

 Score =   178 bits (452),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 77/98 (79%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+T GRL+AGSHNRNE VLINA+E G++ SV+ELSGQ CQICGDEIEI   GE FVACNE
Sbjct  1    MNTGGRLVAGSHNRNELVLINAEENGKIKSVQELSGQICQICGDEIEIMDQGEIFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTVE  444
            CAFP+CRPCYEYER EGNQACPQCKTR+KR++GSP VE
Sbjct  61   CAFPICRPCYEYERLEGNQACPQCKTRFKRIRGSPRVE  98



>ref|XP_006351001.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Solanum tuberosum]
Length=1090

 Score =   177 bits (449),  Expect = 5e-48, Method: Composition-based stats.
 Identities = 81/99 (82%), Positives = 85/99 (86%), Gaps = 1/99 (1%)
 Frame = +1

Query  145  SQMDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVAC  324
            + MDT GRLIAGSH RNEFVLI ADE GRV SV  LS + CQICGDE+EIT DGE FVAC
Sbjct  2    ATMDTSGRLIAGSHIRNEFVLIKADEFGRVESVHALSARMCQICGDELEIT-DGELFVAC  60

Query  325  NECAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            NECAFPVCR CYEYERREGNQACPQCKTRYKR+KGSP V
Sbjct  61   NECAFPVCRLCYEYERREGNQACPQCKTRYKRIKGSPRV  99



>ref|XP_010312466.1| PREDICTED: cellulose synthase A catalytic subunit 5 [UDP-forming] 
[Solanum lycopersicum]
Length=1086

 Score =   174 bits (441),  Expect = 5e-47, Method: Composition-based stats.
 Identities = 81/99 (82%), Positives = 84/99 (85%), Gaps = 1/99 (1%)
 Frame = +1

Query  145  SQMDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVAC  324
            + MDT GRLIAGSH RNEFVLI ADE GRV SV ELS Q CQICGDE+E T DGE FVAC
Sbjct  2    AMMDTGGRLIAGSHIRNEFVLIKADEFGRVESVHELSEQMCQICGDELE-TSDGELFVAC  60

Query  325  NECAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            NECAFPVCR CYEYERREG QACPQCKTRYKR+KGSP V
Sbjct  61   NECAFPVCRLCYEYERREGTQACPQCKTRYKRIKGSPRV  99



>gb|KHG02517.1| Cellulose synthase A catalytic subunit 2 [UDP-forming] [Gossypium 
arboreum]
Length=1106

 Score =   173 bits (438),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 81/108 (75%), Positives = 85/108 (79%), Gaps = 11/108 (10%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELS-GQSC----------QICGDEIEIT  297
            MDT GRLIAGSHNRNEFVLINADE  R  + +  +    C          QICGDEIEIT
Sbjct  1    MDTGGRLIAGSHNRNEFVLINADENARDCANRTFTTALVCTGFVVLAFHNQICGDEIEIT  60

Query  298  VDGEPFVACNECAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            VDGEPFVACNECAFPVCRPCYEYERREGNQACPQCKTRYKR+KGSP V
Sbjct  61   VDGEPFVACNECAFPVCRPCYEYERREGNQACPQCKTRYKRIKGSPRV  108



>ref|XP_010063851.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like 
[Eucalyptus grandis]
 gb|KCW71112.1| hypothetical protein EUGRSUZ_F04212 [Eucalyptus grandis]
Length=1091

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 85/98 (87%), Gaps = 1/98 (1%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDT GRL+ GSHNRNE +LINADE+GRVT VK LSG+ CQIC DEIEIT DGEPFVACNE
Sbjct  1    MDT-GRLVTGSHNRNEIILINADEVGRVTCVKHLSGKICQICADEIEITGDGEPFVACNE  59

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTVE  444
            CAFPVCR CYEYER EG QACP CKTRYKR+KGSP VE
Sbjct  60   CAFPVCRHCYEYERSEGTQACPHCKTRYKRIKGSPRVE  97



>ref|XP_010063847.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like 
[Eucalyptus grandis]
 gb|KCW71116.1| hypothetical protein EUGRSUZ_F04216 [Eucalyptus grandis]
Length=1092

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 85/98 (87%), Gaps = 1/98 (1%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDT GRL+ GSHNRNE +LINADE+GRVT VK LSG+ CQIC DEIEIT DGEPFVACNE
Sbjct  1    MDT-GRLVTGSHNRNEIILINADEVGRVTCVKHLSGKICQICADEIEITGDGEPFVACNE  59

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTVE  444
            CAFPVCR CYEYER EG QACP CKTRYKR+KGSP VE
Sbjct  60   CAFPVCRHCYEYERSEGTQACPHCKTRYKRIKGSPRVE  97



>gb|AFD33697.1| cellulose synthase A [Eucalyptus camaldulensis]
Length=1092

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 85/98 (87%), Gaps = 1/98 (1%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDT GRL+ GSHNRNE +LINADE+GRVT VK LSG+ C+IC DEIEIT DGEPFVACNE
Sbjct  1    MDT-GRLVTGSHNRNEIILINADEVGRVTCVKHLSGKICRICADEIEITGDGEPFVACNE  59

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTVE  444
            CAFPVCR CYEYER EG QACP CKTRYKR+KGSP VE
Sbjct  60   CAFPVCRHCYEYERSEGTQACPHCKTRYKRIKGSPRVE  97



>ref|XP_010927397.1| PREDICTED: cellulose synthase A catalytic subunit 5 [UDP-forming]-like 
[Elaeis guineensis]
Length=1097

 Score =   160 bits (406),  Expect = 3e-42, Method: Composition-based stats.
 Identities = 71/98 (72%), Positives = 83/98 (85%), Gaps = 1/98 (1%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEI-TVDGEPFVACN  327
            MDT GRL+AGS NRNEFV+INAD+ GR  SV++ +G +CQICGD+IEI   + EPFVACN
Sbjct  1    MDTGGRLVAGSRNRNEFVVINADDFGRSKSVQDSNGLNCQICGDDIEILEEEKEPFVACN  60

Query  328  ECAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            ECAFPVCR CYEYERREG+Q+CPQC+TRYKR KGS  V
Sbjct  61   ECAFPVCRTCYEYERREGSQSCPQCRTRYKRHKGSARV  98



>ref|XP_011079381.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
isoform X2 [Sesamum indicum]
Length=1036

 Score =   159 bits (402),  Expect = 9e-42, Method: Composition-based stats.
 Identities = 70/98 (71%), Positives = 78/98 (80%), Gaps = 2/98 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE V+I+  E      +K L+GQ C+ICGDEI +TVDGE FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKPLKNLTGQVCEICGDEIGLTVDGELFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTVE  444
            C FPVCRPCYEYERREGNQ CPQCKTRYKRLKGSP VE
Sbjct  59   CGFPVCRPCYEYERREGNQQCPQCKTRYKRLKGSPRVE  96



>ref|XP_011079380.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
isoform X1 [Sesamum indicum]
Length=1037

 Score =   159 bits (402),  Expect = 9e-42, Method: Composition-based stats.
 Identities = 70/98 (71%), Positives = 78/98 (80%), Gaps = 2/98 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE V+I+  E      +K L+GQ C+ICGDEI +TVDGE FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKPLKNLTGQVCEICGDEIGLTVDGELFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTVE  444
            C FPVCRPCYEYERREGNQ CPQCKTRYKRLKGSP VE
Sbjct  59   CGFPVCRPCYEYERREGNQQCPQCKTRYKRLKGSPRVE  96



>ref|XP_011079382.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
isoform X3 [Sesamum indicum]
Length=1029

 Score =   159 bits (401),  Expect = 1e-41, Method: Composition-based stats.
 Identities = 70/98 (71%), Positives = 78/98 (80%), Gaps = 2/98 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE V+I+  E      +K L+GQ C+ICGDEI +TVDGE FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKPLKNLTGQVCEICGDEIGLTVDGELFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTVE  444
            C FPVCRPCYEYERREGNQ CPQCKTRYKRLKGSP VE
Sbjct  59   CGFPVCRPCYEYERREGNQQCPQCKTRYKRLKGSPRVE  96



>ref|XP_011083940.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like 
[Sesamum indicum]
Length=1041

 Score =   157 bits (398),  Expect = 3e-41, Method: Composition-based stats.
 Identities = 70/98 (71%), Positives = 78/98 (80%), Gaps = 2/98 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE V+I+  E      +K LSGQ C+ICGDEI +TVDGE FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKPLKNLSGQVCEICGDEIGLTVDGELFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTVE  444
            C FPVCRPCYEYERREG+Q CPQCKTRYKRLKGSP VE
Sbjct  59   CGFPVCRPCYEYERREGSQLCPQCKTRYKRLKGSPRVE  96



>gb|EYU35355.1| hypothetical protein MIMGU_mgv1a000638mg [Erythranthe guttata]
Length=1036

 Score =   157 bits (397),  Expect = 4e-41, Method: Composition-based stats.
 Identities = 68/97 (70%), Positives = 78/97 (80%), Gaps = 2/97 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE V+I+  E     ++K LSGQ C+ICGDE+ +TVDGE FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKTLKNLSGQDCEICGDEVGLTVDGELFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            C FPVCRPCYEYERREGNQ CPQCKTR+KRLKGSP V
Sbjct  59   CGFPVCRPCYEYERREGNQLCPQCKTRFKRLKGSPRV  95



>ref|XP_010687624.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
[Beta vulgaris subsp. vulgaris]
Length=1036

 Score =   156 bits (394),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 68/98 (69%), Positives = 78/98 (80%), Gaps = 2/98 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE V+I   E      +K+LSGQ C+ICGDEI ++VDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIQGHE--EPKPLKDLSGQVCEICGDEIGLSVDGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTVE  444
            C FPVCRPCYEYERREG+Q CPQCKTRYKRLKGSP VE
Sbjct  59   CGFPVCRPCYEYERREGSQNCPQCKTRYKRLKGSPRVE  96



>ref|XP_009622821.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
isoform X1 [Nicotiana tomentosiformis]
Length=1079

 Score =   155 bits (393),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 68/97 (70%), Positives = 78/97 (80%), Gaps = 2/97 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE V+I+  E  +   +K+LSGQ C+ICGDEI +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHEEHK--PLKDLSGQVCEICGDEIGLTVDGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            C FPVCRPCYEYERREG Q CPQCKTRYKRLKGSP V
Sbjct  59   CGFPVCRPCYEYERREGTQQCPQCKTRYKRLKGSPRV  95



>ref|XP_009777624.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
[Nicotiana sylvestris]
Length=1041

 Score =   155 bits (392),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 68/97 (70%), Positives = 78/97 (80%), Gaps = 2/97 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE V+I+  E  +   +K+LSGQ C+ICGDEI +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHEEHK--PLKDLSGQVCEICGDEIGLTVDGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            C FPVCRPCYEYERREG Q CPQCKTRYKRLKGSP V
Sbjct  59   CGFPVCRPCYEYERREGTQQCPQCKTRYKRLKGSPRV  95



>ref|XP_009622822.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
isoform X2 [Nicotiana tomentosiformis]
Length=1041

 Score =   155 bits (392),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 68/97 (70%), Positives = 78/97 (80%), Gaps = 2/97 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE V+I+  E  +   +K+LSGQ C+ICGDEI +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHEEHK--PLKDLSGQVCEICGDEIGLTVDGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            C FPVCRPCYEYERREG Q CPQCKTRYKRLKGSP V
Sbjct  59   CGFPVCRPCYEYERREGTQQCPQCKTRYKRLKGSPRV  95



>ref|XP_004242614.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
[Solanum lycopersicum]
Length=1041

 Score =   155 bits (392),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 68/97 (70%), Positives = 77/97 (79%), Gaps = 2/97 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE V+I+  E  +   +K+LSGQ C ICGDEI +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHEEHK--PLKDLSGQVCDICGDEIGLTVDGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            C FPVCRPCYEYERREG Q CPQCKTRYKRLKGSP V
Sbjct  59   CGFPVCRPCYEYERREGTQQCPQCKTRYKRLKGSPRV  95



>gb|AFW69155.1| putative cellulose synthase family protein [Zea mays]
Length=981

 Score =   154 bits (390),  Expect = 3e-40, Method: Composition-based stats.
 Identities = 67/97 (69%), Positives = 76/97 (78%), Gaps = 2/97 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE VLI   E  +   ++ LSGQ C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEANAGLVAGSHNRNELVLIRGHEDPK--PLRALSGQVCEICGDEVGLTVDGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            C FPVCRPCYEYERREG Q CPQCKTRYKRLKGSP V
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCKTRYKRLKGSPRV  95



>ref|XP_006343620.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like 
[Solanum tuberosum]
Length=1041

 Score =   154 bits (390),  Expect = 3e-40, Method: Composition-based stats.
 Identities = 68/97 (70%), Positives = 77/97 (79%), Gaps = 2/97 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE V+I+  E  +   +K+LSGQ C ICGDEI +TVDG+ FVACNE
Sbjct  1    MEAGAGLVAGSHNRNELVVIHGHEEHK--PLKDLSGQVCDICGDEIGLTVDGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            C FPVCRPCYEYERREG Q CPQCKTRYKRLKGSP V
Sbjct  59   CGFPVCRPCYEYERREGTQQCPQCKTRYKRLKGSPRV  95



>ref|XP_009414591.1| PREDICTED: cellulose synthase A catalytic subunit 5 [UDP-forming]-like 
[Musa acuminata subsp. malaccensis]
Length=1097

 Score =   154 bits (389),  Expect = 5e-40, Method: Composition-based stats.
 Identities = 70/97 (72%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            MDT  RL+AGS NRNEFV+INAD+  R    +  S Q CQICGD+IE+ V+ E FVACNE
Sbjct  1    MDTGRRLVAGSRNRNEFVVINADDFERPKFAQVSSRQICQICGDDIEVLVEEEFFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCR CYEYERREG QACPQCKTRYKR KGSP V
Sbjct  61   CAFPVCRTCYEYERREGTQACPQCKTRYKRHKGSPRV  97



>gb|AFR38707.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38708.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38709.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38710.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38711.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38712.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38713.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38714.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38715.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38716.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38717.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38718.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38719.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38720.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38721.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38722.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38731.1| cellulose synthase, partial [Populus fremontii]
 gb|AFR38733.1| cellulose synthase, partial [Populus fremontii]
 gb|AFR38734.1| cellulose synthase, partial [Populus fremontii]
 gb|AFR38738.1| cellulose synthase, partial [Populus fremontii]
 gb|AFR38742.1| cellulose synthase, partial [Populus fremontii]
 gb|AFR38743.1| cellulose synthase, partial [Populus nigra]
 gb|AFR38744.1| cellulose synthase, partial [Populus nigra]
 gb|AFR38745.1| cellulose synthase, partial [Populus nigra]
 gb|AFR38746.1| cellulose synthase, partial [Populus nigra]
 gb|AFR38747.1| cellulose synthase, partial [Populus nigra]
 gb|AFR38748.1| cellulose synthase, partial [Populus nigra]
 gb|AFR38749.1| cellulose synthase, partial [Populus nigra]
 gb|AFR38750.1| cellulose synthase, partial [Populus nigra]
Length=98

 Score =   141 bits (356),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 77/98 (79%), Gaps = 2/98 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ C+ICGDEI +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHEEHK--PLKNLDGQVCEICGDEIGVTVDGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTVE  444
            C FPVCRPCYEYERREG Q CPQCKTRYKRLKGSP VE
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCKTRYKRLKGSPRVE  96



>gb|AFR38732.1| cellulose synthase, partial [Populus fremontii]
 gb|AFR38736.1| cellulose synthase, partial [Populus fremontii]
 gb|AFR38737.1| cellulose synthase, partial [Populus fremontii]
 gb|AFR38739.1| cellulose synthase, partial [Populus fremontii]
 gb|AFR38740.1| cellulose synthase, partial [Populus fremontii]
 gb|AFR38741.1| cellulose synthase, partial [Populus fremontii]
Length=97

 Score =   141 bits (355),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 77/98 (79%), Gaps = 2/98 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ C+ICGDEI +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHEEHK--PLKNLDGQVCEICGDEIGVTVDGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTVE  444
            C FPVCRPCYEYERREG Q CPQCKTRYKRLKGSP VE
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCKTRYKRLKGSPRVE  96



>gb|AFR38726.1| cellulose synthase, partial [Populus alba]
 gb|AFR38728.1| cellulose synthase, partial [Populus alba]
Length=97

 Score =   141 bits (355),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 77/98 (79%), Gaps = 2/98 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ C+ICGDEI +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHEEHK--PLKNLDGQVCEICGDEIGLTVDGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTVE  444
            C FPVCRPCYEYERREG Q CPQCKTRYKRLKGSP VE
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCKTRYKRLKGSPRVE  96



>gb|AFR38730.1| cellulose synthase, partial [Populus fremontii]
Length=96

 Score =   141 bits (355),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 77/98 (79%), Gaps = 2/98 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ C+ICGDEI +TVDG+ FVACNE
Sbjct  1    MEAXAGLVAGSHNRNELVVIHGHEEHK--PLKNLDGQVCEICGDEIGVTVDGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTVE  444
            C FPVCRPCYEYERREG Q CPQCKTRYKRLKGSP VE
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCKTRYKRLKGSPRVE  96



>gb|AFR38723.1| cellulose synthase, partial [Populus alba]
 gb|AFR38729.1| cellulose synthase, partial [Populus alba]
Length=96

 Score =   141 bits (355),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 77/98 (79%), Gaps = 2/98 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ C+ICGDEI +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHEEHK--PLKNLDGQVCEICGDEIGLTVDGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTVE  444
            C FPVCRPCYEYERREG Q CPQCKTRYKRLKGSP VE
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCKTRYKRLKGSPRVE  96



>gb|AFR38724.1| cellulose synthase, partial [Populus alba]
 gb|AFR38725.1| cellulose synthase, partial [Populus alba]
 gb|AFR38727.1| cellulose synthase, partial [Populus alba]
Length=98

 Score =   141 bits (355),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 77/98 (79%), Gaps = 2/98 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ C+ICGDEI +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHEEHK--PLKNLDGQVCEICGDEIGLTVDGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTVE  444
            C FPVCRPCYEYERREG Q CPQCKTRYKRLKGSP VE
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCKTRYKRLKGSPRVE  96



>ref|XP_004956855.1| PREDICTED: cellulose synthase A catalytic subunit 9 [UDP-forming]-like 
[Setaria italica]
Length=1050

 Score =   154 bits (388),  Expect = 8e-40, Method: Composition-based stats.
 Identities = 67/97 (69%), Positives = 76/97 (78%), Gaps = 2/97 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE VLI   E  +   ++ LSGQ C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVLIRGHEDPK--PLRALSGQVCEICGDEVGLTVDGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            C FPVCRPCYEYERREG Q CPQCKTRYKRLKGSP V
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCKTRYKRLKGSPRV  95



>ref|XP_008450511.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
[Cucumis melo]
Length=1068

 Score =   154 bits (388),  Expect = 8e-40, Method: Composition-based stats.
 Identities = 67/98 (68%), Positives = 77/98 (79%), Gaps = 2/98 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE V+I+  E      +K L GQ C+ICGDE+ +TVDG+ FVACNE
Sbjct  37   MEASAGLVAGSHNRNELVVIHGHE--EPKPLKNLDGQVCEICGDEVGLTVDGDLFVACNE  94

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTVE  444
            C FPVCRPCYEYERREG+Q CPQCKTRYKRLKGSP VE
Sbjct  95   CGFPVCRPCYEYERREGSQNCPQCKTRYKRLKGSPRVE  132



>ref|XP_002460229.1| hypothetical protein SORBIDRAFT_02g025020 [Sorghum bicolor]
 gb|EER96750.1| hypothetical protein SORBIDRAFT_02g025020 [Sorghum bicolor]
Length=1049

 Score =   153 bits (387),  Expect = 8e-40, Method: Composition-based stats.
 Identities = 67/97 (69%), Positives = 76/97 (78%), Gaps = 2/97 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE VLI   E  +   ++ LSGQ C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVLIRGHEDPK--PLRALSGQVCEICGDEVGLTVDGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            C FPVCRPCYEYERREG Q CPQCKTRYKRLKGSP V
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCKTRYKRLKGSPRV  95



>ref|NP_001105532.1| cellulose synthase catalytic subunit 12 [Zea mays]
 gb|AAR23312.1| cellulose synthase catalytic subunit 12 [Zea mays]
 tpg|DAA61528.1| TPA: putative cellulose synthase family protein [Zea mays]
Length=1052

 Score =   153 bits (387),  Expect = 9e-40, Method: Composition-based stats.
 Identities = 67/97 (69%), Positives = 76/97 (78%), Gaps = 2/97 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE VLI   E  +   ++ LSGQ C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVLIRGHEDPK--PLRALSGQVCEICGDEVGLTVDGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            C FPVCRPCYEYERREG Q CPQCKTRYKRLKGSP V
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCKTRYKRLKGSPRV  95



>gb|KHG11460.1| Cellulose synthase A catalytic subunit 7 [UDP-forming] -like 
protein [Gossypium arboreum]
Length=996

 Score =   153 bits (387),  Expect = 9e-40, Method: Composition-based stats.
 Identities = 67/97 (69%), Positives = 76/97 (78%), Gaps = 2/97 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE V+I+  E      +K L GQ C+ICGDEI +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKPLKNLDGQVCEICGDEIGLTVDGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            C FPVCRPCYEYERREG+Q CPQCKTRYKRLKGSP V
Sbjct  59   CGFPVCRPCYEYERREGSQQCPQCKTRYKRLKGSPRV  95



>ref|XP_006660635.1| PREDICTED: cellulose synthase A catalytic subunit 9 [UDP-forming]-like 
[Oryza brachyantha]
Length=1053

 Score =   153 bits (387),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 67/97 (69%), Positives = 75/97 (77%), Gaps = 2/97 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE VLI   E      ++ LSGQ C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVLIRGHE--EPKPLRALSGQVCEICGDEVGLTVDGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            C FPVCRPCYEYERREG Q CPQCKTRYKRLKGSP V
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCKTRYKRLKGSPRV  95



>emb|CDP02834.1| unnamed protein product [Coffea canephora]
Length=1041

 Score =   153 bits (387),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 67/98 (68%), Positives = 77/98 (79%), Gaps = 2/98 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE V+I+  E      +K+L+GQ C+ICGDEI +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKPLKDLTGQVCEICGDEIGLTVDGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTVE  444
            C FPVCRPCYEYERREG Q CPQCKTRYKRLKG P VE
Sbjct  59   CGFPVCRPCYEYERREGTQLCPQCKTRYKRLKGCPRVE  96



>ref|XP_008794369.1| PREDICTED: cellulose synthase A catalytic subunit 9 [UDP-forming]-like 
[Phoenix dactylifera]
Length=1049

 Score =   153 bits (387),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 68/97 (70%), Positives = 75/97 (77%), Gaps = 2/97 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE VLI   E      +K L+GQ C+ICGDEI +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVLIRGHE--EPKPLKALNGQVCEICGDEIGLTVDGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            C FPVCRPCYEYERREG Q CPQCKTRYKRLKGSP V
Sbjct  59   CGFPVCRPCYEYERREGTQLCPQCKTRYKRLKGSPRV  95



>gb|KCW78813.1| hypothetical protein EUGRSUZ_C00246 [Eucalyptus grandis]
Length=1012

 Score =   153 bits (386),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 66/97 (68%), Positives = 77/97 (79%), Gaps = 2/97 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEAGAGLVAGSHNRNELVVIHGHEESK--PLKNLDGQVCEICGDEVGLTVDGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            C FPVCRPCYEYERREG+Q CPQCKTRYKRLKGSP V
Sbjct  59   CGFPVCRPCYEYERREGSQLCPQCKTRYKRLKGSPRV  95



>gb|AFB18637.1| CESA8 [Gossypium hirsutum]
Length=1039

 Score =   153 bits (387),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 67/97 (69%), Positives = 76/97 (78%), Gaps = 2/97 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE V+I+  E      +K L GQ C+ICGDEI +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKPLKNLDGQVCEICGDEIGLTVDGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            C FPVCRPCYEYERREG+Q CPQCKTRYKRLKGSP V
Sbjct  59   CGFPVCRPCYEYERREGSQQCPQCKTRYKRLKGSPRV  95



>gb|KJB53884.1| hypothetical protein B456_009G009700 [Gossypium raimondii]
Length=1039

 Score =   153 bits (386),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 67/97 (69%), Positives = 76/97 (78%), Gaps = 2/97 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE V+I+  E      +K L GQ C+ICGDEI +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKPLKNLDGQVCEICGDEIGLTVDGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            C FPVCRPCYEYERREG+Q CPQCKTRYKRLKGSP V
Sbjct  59   CGFPVCRPCYEYERREGSQQCPQCKTRYKRLKGSPRV  95



>ref|XP_008670200.1| PREDICTED: cellulose synthase A catalytic subunit 9 [UDP-forming] 
[Zea mays]
 tpg|DAA40096.1| TPA: putative cellulose synthase family protein [Zea mays]
 gb|AIL25252.1| cellulose synthase catalytic subunit 13 [Zea mays]
Length=1052

 Score =   153 bits (386),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 67/97 (69%), Positives = 76/97 (78%), Gaps = 2/97 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE VLI   E  +   ++ LSGQ C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEANAGLVAGSHNRNELVLIRGHEDPK--PLRALSGQVCEICGDEVGLTVDGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            C FPVCRPCYEYERREG Q CPQCKTRYKRLKGSP V
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCKTRYKRLKGSPRV  95



>gb|KHG19749.1| Cellulose synthase A catalytic subunit 7 [UDP-forming] -like 
protein [Gossypium arboreum]
Length=1057

 Score =   153 bits (386),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 67/97 (69%), Positives = 75/97 (77%), Gaps = 2/97 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE V+I+  E      +K L GQ C+ICGDEI +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKPLKNLDGQVCEICGDEIGVTVDGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            C FPVCRPCYEYERREG Q CPQCKTRYKRLKGSP V
Sbjct  59   CGFPVCRPCYEYERREGTQQCPQCKTRYKRLKGSPRV  95



>gb|AFR58756.2| cellulose synthase 3 [Eucalyptus tereticornis]
Length=1040

 Score =   153 bits (386),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 66/97 (68%), Positives = 77/97 (79%), Gaps = 2/97 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEAGAGLVAGSHNRNELVVIHGHEESK--PLKNLDGQVCEICGDEVGLTVDGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            C FPVCRPCYEYERREG+Q CPQCKTRYKRLKGSP V
Sbjct  59   CGFPVCRPCYEYERREGSQLCPQCKTRYKRLKGSPRV  95



>gb|AGE09566.1| cellulose synthase-like protein [Eucalyptus cladocalyx]
Length=1041

 Score =   153 bits (386),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 66/97 (68%), Positives = 77/97 (79%), Gaps = 2/97 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEAGAGLVAGSHNRNELVVIHGHEESK--PLKNLDGQVCEICGDEVGLTVDGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            C FPVCRPCYEYERREG+Q CPQCKTRYKRLKGSP V
Sbjct  59   CGFPVCRPCYEYERREGSQLCPQCKTRYKRLKGSPRV  95



>ref|XP_010929171.1| PREDICTED: cellulose synthase A catalytic subunit 9 [UDP-forming]-like 
[Elaeis guineensis]
Length=1048

 Score =   153 bits (386),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 68/97 (70%), Positives = 75/97 (77%), Gaps = 2/97 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE VLI   E      +K L+GQ C+ICGDEI +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVLIRGHE--EPKPLKALNGQVCEICGDEIGLTVDGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            C FPVCRPCYEYERREG Q CPQCKTRYKRLKGSP V
Sbjct  59   CGFPVCRPCYEYERREGTQLCPQCKTRYKRLKGSPRV  95



>gb|KCW78814.1| hypothetical protein EUGRSUZ_C00246 [Eucalyptus grandis]
Length=1040

 Score =   153 bits (386),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 66/97 (68%), Positives = 77/97 (79%), Gaps = 2/97 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEAGAGLVAGSHNRNELVVIHGHEESK--PLKNLDGQVCEICGDEVGLTVDGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            C FPVCRPCYEYERREG+Q CPQCKTRYKRLKGSP V
Sbjct  59   CGFPVCRPCYEYERREGSQLCPQCKTRYKRLKGSPRV  95



>gb|AEK31217.1| cellulose synthase A [Eucalyptus camaldulensis]
Length=1040

 Score =   153 bits (386),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 66/97 (68%), Positives = 77/97 (79%), Gaps = 2/97 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEAGAGLVAGSHNRNELVVIHGHEESK--PLKNLDGQVCEICGDEVGLTVDGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            C FPVCRPCYEYERREG+Q CPQCKTRYKRLKGSP V
Sbjct  59   CGFPVCRPCYEYERREGSQLCPQCKTRYKRLKGSPRV  95



>gb|KCW78815.1| hypothetical protein EUGRSUZ_C00246 [Eucalyptus grandis]
Length=1041

 Score =   153 bits (386),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 66/97 (68%), Positives = 77/97 (79%), Gaps = 2/97 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEAGAGLVAGSHNRNELVVIHGHEESK--PLKNLDGQVCEICGDEVGLTVDGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            C FPVCRPCYEYERREG+Q CPQCKTRYKRLKGSP V
Sbjct  59   CGFPVCRPCYEYERREGSQLCPQCKTRYKRLKGSPRV  95



>ref|XP_010265522.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like 
[Nelumbo nucifera]
Length=1034

 Score =   152 bits (385),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 66/97 (68%), Positives = 75/97 (77%), Gaps = 2/97 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE V+I+  E      +K L GQ C+ICGDE+ IT +G+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKPLKALDGQVCEICGDEVGITAEGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            C FPVCRPCYEYERREGNQ CPQCKTRYKRLKGSP V
Sbjct  59   CGFPVCRPCYEYERREGNQQCPQCKTRYKRLKGSPRV  95



>gb|KCW78812.1| hypothetical protein EUGRSUZ_C00246 [Eucalyptus grandis]
Length=1040

 Score =   152 bits (385),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 66/97 (68%), Positives = 77/97 (79%), Gaps = 2/97 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEAGAGLVAGSHNRNELVVIHGHEESK--PLKNLDGQVCEICGDEVGLTVDGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            C FPVCRPCYEYERREG+Q CPQCKTRYKRLKGSP V
Sbjct  59   CGFPVCRPCYEYERREGSQLCPQCKTRYKRLKGSPRV  95



>gb|AGJ71354.1| cellulose synthase 3 [Eucalyptus urophylla]
Length=1040

 Score =   152 bits (385),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 66/97 (68%), Positives = 77/97 (79%), Gaps = 2/97 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEAGAGLVAGSHNRNELVVIHGHEESK--PLKNLDGQVCEICGDEVGLTVDGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            C FPVCRPCYEYERREG+Q CPQCKTRYKRLKGSP V
Sbjct  59   CGFPVCRPCYEYERREGSQLCPQCKTRYKRLKGSPRV  95



>ref|NP_001289644.1| cellulose synthase A catalytic subunit 7 [Eucalyptus grandis]
 gb|AAY60845.1| cellulose synthase 3 [Eucalyptus grandis]
Length=1040

 Score =   152 bits (385),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 66/97 (68%), Positives = 77/97 (79%), Gaps = 2/97 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEAGAGLVAGSHNRNELVVIHGHEESK--PLKNLDGQVCEICGDEVGLTVDGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            C FPVCRPCYEYERREG+Q CPQCKTRYKRLKGSP V
Sbjct  59   CGFPVCRPCYEYERREGSQLCPQCKTRYKRLKGSPRV  95



>gb|AFB18636.1| CESA7 [Gossypium hirsutum]
 gb|AIE38017.1| cellulose synthase-7 [Gossypium hirsutum]
Length=1042

 Score =   152 bits (385),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 67/97 (69%), Positives = 75/97 (77%), Gaps = 2/97 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE V+I+  E      +K L GQ C+ICGDEI +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKPLKNLDGQVCEICGDEIGVTVDGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            C FPVCRPCYEYERREG Q CPQCKTRYKRLKGSP V
Sbjct  59   CGFPVCRPCYEYERREGTQQCPQCKTRYKRLKGSPRV  95



>gb|KJB07762.1| hypothetical protein B456_001G044700 [Gossypium raimondii]
Length=1043

 Score =   152 bits (385),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 67/97 (69%), Positives = 75/97 (77%), Gaps = 2/97 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE V+I+  E      +K L GQ C+ICGDEI +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKPLKNLDGQVCEICGDEIGVTVDGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            C FPVCRPCYEYERREG Q CPQCKTRYKRLKGSP V
Sbjct  59   CGFPVCRPCYEYERREGTQQCPQCKTRYKRLKGSPRV  95



>gb|KJB07761.1| hypothetical protein B456_001G044700 [Gossypium raimondii]
Length=1042

 Score =   152 bits (385),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 67/97 (69%), Positives = 75/97 (77%), Gaps = 2/97 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE V+I+  E      +K L GQ C+ICGDEI +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKPLKNLDGQVCEICGDEIGVTVDGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            C FPVCRPCYEYERREG Q CPQCKTRYKRLKGSP V
Sbjct  59   CGFPVCRPCYEYERREGTQQCPQCKTRYKRLKGSPRV  95



>ref|XP_009410192.1| PREDICTED: cellulose synthase A catalytic subunit 9 [UDP-forming] 
[Musa acuminata subsp. malaccensis]
Length=1047

 Score =   152 bits (385),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 67/97 (69%), Positives = 75/97 (77%), Gaps = 2/97 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE VLI   E      ++ L+GQ C+ICGDEI +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVLIRGHE--EPKPLRALNGQVCEICGDEIGLTVDGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            C FPVCRPCYEYERREG Q CPQCKTRYKRLKGSP V
Sbjct  59   CGFPVCRPCYEYERREGTQLCPQCKTRYKRLKGSPRV  95



>gb|AGX27214.1| cellulose synthase 7 [Populus tomentosa]
Length=1037

 Score =   152 bits (385),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 67/98 (68%), Positives = 77/98 (79%), Gaps = 2/98 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ C+ICGDEI +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHEEHK--PLKNLDGQVCEICGDEIGLTVDGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTVE  444
            C FP CRPCYEYERREG+Q CPQCKTRYKRLKGSP VE
Sbjct  59   CGFPACRPCYEYERREGSQNCPQCKTRYKRLKGSPRVE  96



>gb|AAM26299.1| cellulose synthase [Populus tremuloides]
Length=1032

 Score =   152 bits (385),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 67/97 (69%), Positives = 76/97 (78%), Gaps = 2/97 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ C+ICGDEI +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHEEHK--PLKNLDGQVCEICGDEIGLTVDGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            C FPVCRPCYEYERREG Q CPQCKTRYKRLKGSP V
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCKTRYKRLKGSPRV  95



>ref|XP_002325122.1| cellulose synthase family protein [Populus trichocarpa]
 gb|EEF03687.1| cellulose synthase family protein [Populus trichocarpa]
Length=1032

 Score =   152 bits (384),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 67/97 (69%), Positives = 76/97 (78%), Gaps = 2/97 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ C+ICGDEI +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHEEHK--PLKNLDGQVCEICGDEIGVTVDGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            C FPVCRPCYEYERREG Q CPQCKTRYKRLKGSP V
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCKTRYKRLKGSPRV  95



>ref|XP_008790154.1| PREDICTED: LOW QUALITY PROTEIN: cellulose synthase A catalytic 
subunit 9 [UDP-forming]-like [Phoenix dactylifera]
Length=1048

 Score =   152 bits (384),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 67/97 (69%), Positives = 75/97 (77%), Gaps = 2/97 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE VLI   E      ++ L+GQ C+ICGDEI +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVLIRGHE--EPKPLRALNGQVCEICGDEIGLTVDGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            C FPVCRPCYEYERREG Q CPQCKTRYKRLKGSP V
Sbjct  59   CGFPVCRPCYEYERREGTQLCPQCKTRYKRLKGSPRV  95



>gb|EPS60781.1| hypothetical protein M569_14019 [Genlisea aurea]
Length=1043

 Score =   152 bits (384),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 67/97 (69%), Positives = 75/97 (77%), Gaps = 2/97 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE V+I+  E     +VK LSGQ C+ICGD + +TV GE FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKAVKNLSGQVCEICGDRVGVTVGGELFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            C FPVCRPCYEYERREG Q CPQCKTRYKRLKGSP V
Sbjct  59   CGFPVCRPCYEYERREGTQLCPQCKTRYKRLKGSPRV  95



>gb|AFR38984.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38985.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38986.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38987.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38988.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38990.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38992.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38993.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38994.1| cellulose synthase, partial [Populus trichocarpa]
 gb|AFR38995.1| cellulose synthase, partial [Populus fremontii]
 gb|AFR38996.1| cellulose synthase, partial [Populus fremontii]
 gb|AFR38997.1| cellulose synthase, partial [Populus fremontii]
 gb|AFR38998.1| cellulose synthase, partial [Populus nigra]
 gb|AFR38999.1| cellulose synthase, partial [Populus nigra]
 gb|AFR39000.1| cellulose synthase, partial [Populus nigra]
 gb|AFR39001.1| cellulose synthase, partial [Populus nigra]
 gb|AFR39002.1| cellulose synthase, partial [Populus nigra]
 gb|AFR39003.1| cellulose synthase, partial [Populus nigra]
 gb|AFR39004.1| cellulose synthase, partial [Populus nigra]
 gb|AFR39005.1| cellulose synthase, partial [Populus nigra]
 gb|AFR39006.1| cellulose synthase, partial [Populus nigra]
 gb|AFR39007.1| cellulose synthase, partial [Populus nigra]
 gb|AFR39008.1| cellulose synthase, partial [Populus nigra]
 gb|AFR39010.1| cellulose synthase, partial [Populus nigra]
 gb|AFR39011.1| cellulose synthase, partial [Populus nigra]
Length=100

 Score =   139 bits (351),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 76/98 (78%), Gaps = 2/98 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ C+ICGDEI +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHEEHK--PLKNLDGQVCEICGDEIGLTVDGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTVE  444
            C FP CRPCYEYERREG Q CPQCKTRYKRLKGSP VE
Sbjct  59   CGFPACRPCYEYERREGTQNCPQCKTRYKRLKGSPRVE  96



>ref|XP_007013859.1| Cellulose synthase family protein isoform 1 [Theobroma cacao]
 gb|EOY31478.1| Cellulose synthase family protein isoform 1 [Theobroma cacao]
Length=1043

 Score =   152 bits (384),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 67/97 (69%), Positives = 75/97 (77%), Gaps = 2/97 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE V+I+  E      +K L GQ C+ICGDEI +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKPLKNLDGQVCEICGDEIGLTVDGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            C FPVCRPCYEYERREG Q CPQCKTRYKRLKGSP V
Sbjct  59   CGFPVCRPCYEYERREGTQQCPQCKTRYKRLKGSPRV  95



>ref|XP_002963550.1| family 2 glycosyltransferase [Selaginella moellendorffii]
 ref|XP_002981528.1| family 2 glycosyltransferase [Selaginella moellendorffii]
 gb|EFJ17343.1| family 2 glycosyltransferase [Selaginella moellendorffii]
 gb|EFJ35421.1| family 2 glycosyltransferase [Selaginella moellendorffii]
Length=1093

 Score =   152 bits (384),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 66/97 (68%), Positives = 78/97 (80%), Gaps = 1/97 (1%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE V+I  +  G V  +K L+GQ CQICGD++  TVDGE FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIRQEGDG-VKPLKHLNGQVCQICGDDVGCTVDGELFVACNE  59

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCRPCYEYER++GNQ+CPQCKTRY+R KGSP V
Sbjct  60   CAFPVCRPCYEYERKDGNQSCPQCKTRYRRHKGSPRV  96



>dbj|BAJ85783.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AIY30130.1| cellulose synthase 8 [Hordeum vulgare]
Length=1055

 Score =   152 bits (384),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 68/97 (70%), Positives = 75/97 (77%), Gaps = 2/97 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE VLI   E  +   V+ LSGQ C+ICGDE+  TVDG+ FVACNE
Sbjct  1    MEAGAGLVAGSHNRNELVLIRGHEDHK--PVRALSGQVCEICGDEVGRTVDGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            C FPVCRPCYEYERREG Q CPQCKTRYKRLKGSP V
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCKTRYKRLKGSPRV  95



>ref|XP_009417280.1| PREDICTED: probable cellulose synthase A catalytic subunit 5 
[UDP-forming] [Musa acuminata subsp. malaccensis]
Length=1091

 Score =   152 bits (384),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 65/97 (67%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE V+I  D       +++LSGQ CQICGD++ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIRRDGESGPKPLQQLSGQICQICGDDVGLTVDGDLFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFPVCR CYEYERREGNQ CPQCKTR+KRLKG P V
Sbjct  61   CAFPVCRTCYEYERREGNQVCPQCKTRFKRLKGCPRV  97



>gb|AFZ78551.1| cellulose synthase [Populus tomentosa]
Length=1032

 Score =   152 bits (383),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 67/97 (69%), Positives = 76/97 (78%), Gaps = 2/97 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ C+ICGDEI +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHEEHK--PLKNLDGQVCEICGDEIGLTVDGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            C FPVCRPCYEYERREG Q CPQCKTRYKRLKGSP V
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCKTRYKRLKGSPRV  95



>tpg|DAA61529.1| TPA: putative cellulose synthase family protein [Zea mays]
Length=1056

 Score =   152 bits (384),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 66/97 (68%), Positives = 76/97 (78%), Gaps = 2/97 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE VLI   E  +   ++ LSGQ C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVLIRGHEDPK--PLRALSGQVCEICGDEVGLTVDGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            C FPVCRPCYEYERREG Q CPQCKTRYKRLKG+P V
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCKTRYKRLKGTPRV  95



>ref|XP_011033387.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming] 
[Populus euphratica]
Length=1036

 Score =   152 bits (383),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 67/97 (69%), Positives = 76/97 (78%), Gaps = 2/97 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ C+ICGDEI +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHEEHK--PLKNLDGQVCEICGDEIGLTVDGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            C FPVCRPCYEYERREG Q CPQCKTRYKRLKGSP V
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCKTRYKRLKGSPRV  95



>ref|XP_011018058.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like 
[Populus euphratica]
Length=1032

 Score =   152 bits (383),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 67/97 (69%), Positives = 76/97 (78%), Gaps = 2/97 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ C+ICGDEI +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHEEHK--PLKNLDGQVCEICGDEIGLTVDGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            C FPVCRPCYEYERREG Q CPQCKTRYKRLKGSP V
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCKTRYKRLKGSPRV  95



>ref|XP_009408434.1| PREDICTED: probable cellulose synthase A catalytic subunit 5 
[UDP-forming] [Musa acuminata subsp. malaccensis]
Length=1091

 Score =   152 bits (383),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 64/97 (66%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE V+I  D       +++LSGQ CQICGD++ +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIRRDGESAPKPLQQLSGQICQICGDDVGLTVDGDLFVACNE  60

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            CAFP+CR CYEYERREGNQ CPQCKTR+KRLKG P V
Sbjct  61   CAFPICRTCYEYERREGNQVCPQCKTRFKRLKGCPRV  97



>ref|XP_004152851.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like 
[Cucumis sativus]
 ref|XP_004163057.1| PREDICTED: LOW QUALITY PROTEIN: cellulose synthase A catalytic 
subunit 7 [UDP-forming]-like [Cucumis sativus]
 gb|KGN61215.1| hypothetical protein Csa_2G070320 [Cucumis sativus]
Length=1032

 Score =   151 bits (382),  Expect = 4e-39, Method: Composition-based stats.
 Identities = 66/98 (67%), Positives = 76/98 (78%), Gaps = 2/98 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE V+I+  E      +K L GQ C+ICGD + +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHE--EPKPLKNLDGQVCEICGDAVGLTVDGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTVE  444
            C FPVCRPCYEYERREG+Q CPQCKTRYKRLKGSP VE
Sbjct  59   CGFPVCRPCYEYERREGSQNCPQCKTRYKRLKGSPRVE  96



>dbj|BAM05574.1| cellulose synthase 3, partial [Eucalyptus pyrocarpa]
 dbj|BAM05575.1| cellulose synthase 3, partial [Eucalyptus pilularis]
Length=473

 Score =   148 bits (373),  Expect = 4e-39, Method: Composition-based stats.
 Identities = 66/97 (68%), Positives = 77/97 (79%), Gaps = 2/97 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ C+ICGDE+ +TVDG+ FVACNE
Sbjct  1    MEAGAGLVAGSHNRNELVVIHGHEESK--PLKNLDGQVCEICGDEVGLTVDGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            C FPVCRPCYEYERREG+Q CPQCKTRYKRLKGSP V
Sbjct  59   CGFPVCRPCYEYERREGSQLCPQCKTRYKRLKGSPRV  95



>gb|AEE60897.1| cellulose synthase [Populus tomentosa]
Length=1032

 Score =   151 bits (382),  Expect = 5e-39, Method: Composition-based stats.
 Identities = 67/97 (69%), Positives = 76/97 (78%), Gaps = 2/97 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE V+I+  E  +   +K L GQ C+ICGDEI +TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVVIHGHEEHK--PLKNLDGQVCEICGDEIGLTVDGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            C FPVCRPCYEYERREG Q CPQCKTRYKRLKGSP V
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCKTRYKRLKGSPRV  95



>dbj|BAJ05813.1| cellulose synthase catalytic subunit [Oryza sativa Indica Group]
Length=1055

 Score =   151 bits (382),  Expect = 5e-39, Method: Composition-based stats.
 Identities = 67/97 (69%), Positives = 74/97 (76%), Gaps = 2/97 (2%)
 Frame = +1

Query  151  MDTKGRLIAGSHNRNEFVLINADEIGRVTSVKELSGQSCQICGDEIEITVDGEPFVACNE  330
            M+    L+AGSHNRNE VLI   E      ++ LSGQ C+ICGDE+  TVDG+ FVACNE
Sbjct  1    MEASAGLVAGSHNRNELVLIRGHE--EPKPLRALSGQVCEICGDEVGRTVDGDLFVACNE  58

Query  331  CAFPVCRPCYEYERREGNQACPQCKTRYKRLKGSPTV  441
            C FPVCRPCYEYERREG Q CPQCKTRYKRLKGSP V
Sbjct  59   CGFPVCRPCYEYERREGTQNCPQCKTRYKRLKGSPRV  95



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 555551523900