BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001E06

Length=514
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ACT82771.1|  actin                                                   295   3e-99   Nicotiana tabacum [American tobacco]
gb|AFW82913.1|  putative actin family protein                           294   8e-99   
gb|AFW82903.1|  putative actin family protein isoform 1                 294   9e-99   
ref|XP_009594162.1|  PREDICTED: actin-104                               301   1e-98   Nicotiana tomentosiformis
ref|XP_009787561.1|  PREDICTED: actin-104                               301   2e-98   Nicotiana sylvestris
gb|KHG20063.1|  Actin-7 -like protein                                   295   2e-98   Gossypium arboreum [tree cotton]
emb|CDP11386.1|  unnamed protein product                                300   3e-98   Coffea canephora [robusta coffee]
gb|AFW82900.1|  putative actin family protein                           294   3e-98   
gb|AAS68183.1|  actin                                                   293   3e-98   Brassica napus var. napus [annual rape]
gb|AAK84080.1|AF326781_1  actin                                         293   3e-98   Triticum monococcum [einkorn wheat]
gb|KHG21354.1|  Actin-7 -like protein                                   297   3e-98   Gossypium arboreum [tree cotton]
ref|NP_001172758.1|  Os01g0964400                                       295   3e-98   
gb|AGE09575.1|  ACT-like protein                                        293   4e-98   Eucalyptus cladocalyx
ref|XP_010911102.1|  PREDICTED: actin-7-like                            291   6e-98   Elaeis guineensis
dbj|BAN08538.1|  actin                                                  291   6e-98   Solanum lycopersicum
gb|AFZ78528.1|  actin                                                   300   6e-98   Populus tomentosa [Chinese white poplar]
ref|XP_002298982.1|  actin family protein                               300   6e-98   Populus trichocarpa [western balsam poplar]
emb|CDY56544.1|  BnaA03g55890D                                          299   9e-98   Brassica napus [oilseed rape]
ref|XP_010485236.1|  PREDICTED: actin-4-like                            291   1e-97   Camelina sativa [gold-of-pleasure]
gb|ABY19575.1|  actin                                                   294   1e-97   Ipomoea batatas [batate]
ref|XP_011074742.1|  PREDICTED: actin-104                               299   1e-97   Sesamum indicum [beniseed]
ref|NP_001291342.1|  uncharacterized protein LOC105159390               299   1e-97   Sesamum indicum [beniseed]
gb|EEC78366.1|  hypothetical protein OsI_18129                          298   1e-97   Oryza sativa Indica Group [Indian rice]
gb|ACJ83287.1|  unknown                                                 292   2e-97   Medicago truncatula
gb|AFZ78529.1|  actin                                                   293   2e-97   Populus tomentosa [Chinese white poplar]
ref|XP_009390755.1|  PREDICTED: actin-7                                 298   2e-97   Musa acuminata subsp. malaccensis [pisang utan]
gb|AIH15193.1|  actin 1                                                 294   2e-97   Hedychium coronarium
gb|AFW75038.1|  putative actin family protein                           298   3e-97   
ref|XP_003578869.1|  PREDICTED: actin-3-like                            298   3e-97   Brachypodium distachyon [annual false brome]
gb|AFW82911.1|  putative actin family protein isoform 1                 298   3e-97   
gb|ACU18204.1|  unknown                                                 292   3e-97   Glycine max [soybeans]
gb|AIS84126.1|  actin                                                   291   3e-97   Fraxinus mandshurica [Manchurian ash]
gb|ADU52547.1|  actin 1                                                 298   3e-97   Morus alba
ref|XP_009413409.1|  PREDICTED: actin-7                                 298   3e-97   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADZ76112.1|  actin                                                   295   3e-97   Litchi chinensis [litchi]
gb|AFW75045.1|  putative actin family protein                           297   4e-97   
gb|KJB76087.1|  hypothetical protein B456_012G070300                    297   4e-97   Gossypium raimondii
ref|XP_009621805.1|  PREDICTED: actin-like                              297   4e-97   Nicotiana tomentosiformis
gb|AAN08622.1|  actin                                                   297   4e-97   Phalaenopsis hybrid cultivar
gb|AGR45356.1|  actin                                                   297   4e-97   Dendrobium officinale
gb|AAF71264.1|AF246714_1  actin-like protein                            297   4e-97   Phalaenopsis hybrid cultivar
gb|EPS67367.1|  hypothetical protein M569_07407                         297   4e-97   Genlisea aurea
ref|XP_009131124.1|  PREDICTED: actin-7-like                            297   5e-97   Brassica rapa
ref|XP_010258283.1|  PREDICTED: actin-3-like                            292   5e-97   
ref|XP_010257796.1|  PREDICTED: actin-3-like                            291   5e-97   Nelumbo nucifera [Indian lotus]
gb|AFK41489.1|  unknown                                                 290   5e-97   Medicago truncatula
ref|XP_010542288.1|  PREDICTED: actin-2-like                            297   6e-97   Tarenaya hassleriana [spider flower]
tpg|DAA51874.1|  TPA: putative actin family protein isoform 1           289   6e-97   
gb|ABW71681.1|  actin                                                   297   6e-97   Glycyrrhiza uralensis [Chinese licorice]
ref|XP_009801998.1|  PREDICTED: actin-97-like                           297   6e-97   Nicotiana sylvestris
ref|XP_011091473.1|  PREDICTED: actin-11                                297   6e-97   Sesamum indicum [beniseed]
ref|XP_010053990.1|  PREDICTED: actin-7-like                            297   6e-97   Eucalyptus grandis [rose gum]
dbj|BAK57343.1|  actin1                                                 297   6e-97   Morella rubra [Chinese arbutus]
gb|AEY76080.1|  actin                                                   291   7e-97   Petunia integrifolia subsp. inflata
gb|ADY38689.1|  actin                                                   297   7e-97   Camellia sinensis [black tea]
gb|AFK39620.1|  unknown                                                 292   7e-97   Medicago truncatula
ref|XP_001782687.1|  predicted protein                                  297   7e-97   
ref|XP_009591335.1|  PREDICTED: actin-97                                297   7e-97   Nicotiana tomentosiformis
ref|XP_004971370.1|  PREDICTED: actin-7-like isoform X3                 297   7e-97   
ref|XP_008654246.1|  PREDICTED: putative actin family protein iso...    297   7e-97   
gb|AGZ90152.1|  actin 11                                                297   7e-97   Litsea cubeba [may chang]
gb|AFN53639.1|  putative actin-97 protein                               297   7e-97   Linum usitatissimum
gb|ADJ95345.1|  actin                                                   297   7e-97   Pogonatherum paniceum
emb|CDP00088.1|  unnamed protein product                                297   7e-97   Coffea canephora [robusta coffee]
ref|XP_010446199.1|  PREDICTED: actin-85C                               293   8e-97   Camelina sativa [gold-of-pleasure]
ref|XP_002530852.1|  actin, putative                                    294   8e-97   
ref|NP_196543.1|  actin 7                                               296   8e-97   Arabidopsis thaliana [mouse-ear cress]
gb|ACJ04738.1|  actin                                                   296   8e-97   Sedum alfredii
dbj|BAD27408.1|  actin                                                  296   8e-97   Nicotiana tabacum [American tobacco]
gb|EMS60494.1|  Actin-3                                                 297   8e-97   Triticum urartu
gb|ACJ85292.1|  unknown                                                 291   8e-97   Medicago truncatula
ref|NP_001130463.1|  putative actin family protein isoform 1            296   9e-97   Zea mays [maize]
ref|XP_002449040.1|  hypothetical protein SORBIDRAFT_05g003880          296   9e-97   Sorghum bicolor [broomcorn]
gb|ADU52548.1|  actin 2                                                 296   9e-97   Morus alba
gb|AEZ51866.1|  actin                                                   296   9e-97   Cymbidium ensifolium
ref|XP_003569118.1|  PREDICTED: actin-97                                296   9e-97   
dbj|BAB63635.1|  putative actin                                         296   9e-97   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010937718.1|  PREDICTED: actin-3                                 296   9e-97   Elaeis guineensis
gb|AHE41423.1|  actin                                                   296   9e-97   Lycium chinense [Chinese boxthorn]
ref|XP_004960554.1|  PREDICTED: actin-97-like                           296   9e-97   Setaria italica
ref|NP_001054419.1|  Os05g0106600                                       296   9e-97   
gb|AAK82991.1|AF285176_1  actin                                         296   9e-97   Musa ABB Group [cooking banana]
emb|CDP10143.1|  unnamed protein product                                296   1e-96   Coffea canephora [robusta coffee]
ref|NP_001267747.1|  uncharacterized protein LOC101779009               296   1e-96   Setaria italica
ref|XP_006351346.1|  PREDICTED: actin-58-like                           296   1e-96   Solanum tuberosum [potatoes]
ref|XP_006345961.1|  PREDICTED: actin-58-like                           296   1e-96   Solanum tuberosum [potatoes]
ref|XP_004239790.1|  PREDICTED: actin-58                                296   1e-96   Solanum lycopersicum
gb|AFZ78525.1|  actin                                                   293   1e-96   Populus tomentosa [Chinese white poplar]
ref|XP_010111138.1|  hypothetical protein L484_010751                   296   1e-96   Morus notabilis
ref|XP_006287952.1|  hypothetical protein CARUB_v10001188mg             296   1e-96   Capsella rubella
ref|XP_003602545.1|  Actin                                              296   1e-96   
ref|XP_009125344.1|  PREDICTED: actin-7                                 296   1e-96   Brassica rapa
gb|AEN25580.1|  actin 7                                                 296   1e-96   Brassica rapa subsp. pekinensis [bai cai]
dbj|BAJ96385.1|  predicted protein                                      296   1e-96   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ADU52545.1|  actin 2                                                 296   1e-96   Morus alba
ref|XP_009406076.1|  PREDICTED: actin-3                                 296   1e-96   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001065830.1|  Os11g0163100                                       296   1e-96   
ref|XP_004978759.1|  PREDICTED: actin-7-like                            296   1e-96   Setaria italica
ref|XP_011075141.1|  PREDICTED: actin-97-like                           296   1e-96   Sesamum indicum [beniseed]
gb|ADY68784.1|  actin                                                   296   1e-96   Gossypium herbaceum subsp. africanum
gb|ABS11262.1|  actin                                                   296   1e-96   Musa acuminata AAA Group [Cavendish banana]
gb|KDO53391.1|  hypothetical protein CISIN_1g037845mg                   294   1e-96   Citrus sinensis [apfelsine]
emb|CEL26645.1|  Actin1                                                 288   1e-96   Ribes nigrum [European black currant]
ref|XP_004971371.1|  PREDICTED: actin-7-like isoform X4                 296   1e-96   Setaria italica
ref|XP_004235068.1|  PREDICTED: actin-7                                 296   1e-96   
ref|XP_009599876.1|  PREDICTED: actin-7-like                            296   1e-96   Nicotiana tomentosiformis
gb|AAP73456.1|  actin                                                   296   1e-96   Gossypium hirsutum [American cotton]
gb|EEE62039.1|  hypothetical protein OsJ_16821                          297   1e-96   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010690498.1|  PREDICTED: actin-1                                 296   1e-96   Beta vulgaris subsp. vulgaris [field beet]
gb|AGV75926.1|  actin                                                   296   1e-96   Gossypium hirsutum [American cotton]
gb|ACJ04737.1|  actin                                                   296   1e-96   Sedum alfredii
gb|AEN70754.1|  actin 1                                                 296   1e-96   Gossypium darwinii
ref|XP_008665584.1|  PREDICTED: actin isoform X1                        290   1e-96   Zea mays [maize]
gb|AJG03099.1|  actin                                                   296   1e-96   Brassica juncea [brown mustard]
ref|NP_001150248.1|  LOC100283878                                       296   1e-96   Zea mays [maize]
gb|AAP73449.1|  actin                                                   296   1e-96   Gossypium hirsutum [American cotton]
gb|KHG18648.1|  Actin-58                                                296   1e-96   Gossypium arboreum [tree cotton]
gb|AGV75927.1|  actin                                                   296   1e-96   Gossypium hirsutum [American cotton]
ref|XP_004249866.1|  PREDICTED: actin-7-like                            296   1e-96   
gb|KJB76085.1|  hypothetical protein B456_012G070300                    296   1e-96   Gossypium raimondii
ref|XP_006846523.1|  hypothetical protein AMTR_s00018p00188200          296   1e-96   Amborella trichopoda
gb|AAP73458.1|  actin                                                   296   1e-96   Gossypium hirsutum [American cotton]
ref|XP_006854536.1|  hypothetical protein AMTR_s00030p00045700          296   1e-96   Amborella trichopoda
gb|AFL70161.1|  actin                                                   296   1e-96   Agastache rugosa
ref|XP_009416898.1|  PREDICTED: actin-3                                 296   1e-96   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGN95065.1|  putative actin-7-like protein                           296   1e-96   Physaria fendleri
ref|XP_004156708.1|  PREDICTED: actin-97-like                           296   2e-96   
ref|XP_006855625.1|  hypothetical protein AMTR_s00044p00088410          296   2e-96   
emb|CDX87810.1|  BnaC06g08720D                                          296   2e-96   
gb|KJB75201.1|  hypothetical protein B456_012G030500                    296   2e-96   Gossypium raimondii
ref|XP_008665585.1|  PREDICTED: actin-1 isoform X2                      289   2e-96   
gb|ADX97326.1|  actin 9                                                 296   2e-96   Mangifera indica
ref|XP_010671378.1|  PREDICTED: actin-7                                 296   2e-96   Beta vulgaris subsp. vulgaris [field beet]
gb|AGI15325.1|  actin 1                                                 296   2e-96   Dionaea muscipula
dbj|BAK06400.1|  predicted protein                                      296   2e-96   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002283590.1|  PREDICTED: actin-1                                 296   2e-96   Vitis vinifera
sp|P30171.1|ACT11_SOLTU  RecName: Full=Actin-97                         296   2e-96   Solanum tuberosum [potatoes]
ref|XP_001783657.1|  predicted protein                                  296   2e-96   
ref|XP_007145688.1|  hypothetical protein PHAVU_007G260000g             295   2e-96   Phaseolus vulgaris [French bean]
ref|XP_003575839.1|  PREDICTED: actin-1-like                            295   2e-96   Brachypodium distachyon [annual false brome]
gb|AFJ04513.1|  actin7a                                                 295   2e-96   Vernicia fordii [tung oil tree]
gb|AFZ78523.1|  actin                                                   295   2e-96   Populus tomentosa [Chinese white poplar]
ref|XP_009802880.1|  PREDICTED: actin-like                              295   2e-96   Nicotiana sylvestris
dbj|BAJ07368.1|  actin                                                  288   3e-96   Hydatigera taeniaeformis
gb|ACZ04921.1|  actin 7-like protein                                    295   3e-96   Pelargonium x hortorum [bedding geranium]
ref|XP_006350765.1|  PREDICTED: actin-like                              295   3e-96   Solanum tuberosum [potatoes]
emb|CBI29476.3|  unnamed protein product                                292   3e-96   Vitis vinifera
ref|XP_003547582.1|  PREDICTED: actin-101-like                          295   3e-96   
ref|XP_009397437.1|  PREDICTED: actin-like                              295   3e-96   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009625006.1|  PREDICTED: actin-like                              295   3e-96   Nicotiana tomentosiformis
ref|XP_007132070.1|  hypothetical protein PHAVU_011G064500g             295   3e-96   Phaseolus vulgaris [French bean]
ref|XP_004236747.1|  PREDICTED: actin-97                                295   3e-96   
ref|XP_004230564.1|  PREDICTED: actin-101                               295   3e-96   
ref|XP_004485534.1|  PREDICTED: actin-101-like                          295   3e-96   Cicer arietinum [garbanzo]
ref|XP_004241231.1|  PREDICTED: actin-82                                295   3e-96   Solanum lycopersicum
gb|AAP73454.1|  actin                                                   295   3e-96   Gossypium hirsutum [American cotton]
sp|Q05214.1|ACT1_TOBAC  RecName: Full=Actin                             295   3e-96   Nicotiana tabacum [American tobacco]
ref|XP_002530711.1|  actin, putative                                    295   3e-96   Ricinus communis
ref|XP_009773924.1|  PREDICTED: actin                                   295   3e-96   Nicotiana sylvestris
ref|XP_011004375.1|  PREDICTED: actin-7-like isoform X1                 295   3e-96   Populus euphratica
gb|AHA84238.1|  actin                                                   295   3e-96   Phaseolus vulgaris [French bean]
ref|XP_007016432.1|  Actin-11 isoform 1                                 295   3e-96   Theobroma cacao [chocolate]
emb|CAJ44725.1|  actin                                                  292   3e-96   Capsicum chinense [bonnet pepper]
ref|XP_006359829.1|  PREDICTED: actin-like                              295   3e-96   Solanum tuberosum [potatoes]
ref|XP_006351818.1|  PREDICTED: actin-101-like                          295   3e-96   Solanum tuberosum [potatoes]
ref|XP_009618901.1|  PREDICTED: actin                                   295   3e-96   Nicotiana tomentosiformis
ref|XP_003539675.1|  PREDICTED: actin-like isoform X1                   295   3e-96   Glycine max [soybeans]
gb|KHN26715.1|  Actin-101                                               295   3e-96   Glycine soja [wild soybean]
ref|XP_003531566.1|  PREDICTED: actin-101                               295   3e-96   Glycine max [soybeans]
ref|XP_006858216.1|  hypothetical protein AMTR_s00062p00184900          295   3e-96   Amborella trichopoda
ref|XP_003537995.1|  PREDICTED: actin-like isoform X1                   295   3e-96   Glycine max [soybeans]
gb|ADN88106.1|  actin 1                                                 295   3e-96   Guzmania wittmackii x Guzmania lingulata
gb|EPS60057.1|  hypothetical protein M569_14747                         295   3e-96   Genlisea aurea
ref|XP_004981971.1|  PREDICTED: actin-1-like isoform X2                 295   3e-96   
gb|ACH69153.1|  actin                                                   295   3e-96   Nicotiana tabacum [American tobacco]
ref|XP_009773019.1|  PREDICTED: actin-97                                295   3e-96   Nicotiana sylvestris
gb|AAP73462.1|  actin                                                   295   3e-96   Gossypium hirsutum [American cotton]
ref|XP_004497894.1|  PREDICTED: actin-like                              295   3e-96   Cicer arietinum [garbanzo]
ref|XP_006297921.1|  hypothetical protein CARUB_v10013962mg             295   3e-96   Capsella rubella
ref|XP_009587904.1|  PREDICTED: actin-97-like                           295   3e-96   Nicotiana tomentosiformis
ref|XP_009410069.1|  PREDICTED: actin                                   295   3e-96   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002316289.1|  actin family protein                               295   3e-96   Populus trichocarpa [western balsam poplar]
gb|KHF99045.1|  Actin-7 -like protein                                   295   3e-96   Gossypium arboreum [tree cotton]
ref|XP_010257475.1|  PREDICTED: actin                                   295   4e-96   Nelumbo nucifera [Indian lotus]
ref|XP_009381444.1|  PREDICTED: actin-like                              295   4e-96   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008355144.1|  PREDICTED: actin                                   295   4e-96   Malus domestica [apple tree]
ref|XP_006435988.1|  hypothetical protein CICLE_v10031847mg             295   4e-96   Citrus clementina [clementine]
emb|CBI30014.3|  unnamed protein product                                292   4e-96   Vitis vinifera
gb|KJB76088.1|  hypothetical protein B456_012G070300                    297   4e-96   Gossypium raimondii
ref|XP_007009347.1|  Actin-11 isoform 2                                 295   4e-96   
ref|XP_002882767.1|  actin-11                                           295   4e-96   
ref|XP_004294508.1|  PREDICTED: actin-1                                 295   4e-96   Fragaria vesca subsp. vesca
emb|CDY01102.1|  BnaC05g40980D                                          295   4e-96   
gb|AHA84217.1|  actin-101-like                                          295   4e-96   Phaseolus vulgaris [French bean]
gb|EMT00396.1|  Actin-3                                                 295   4e-96   
gb|ACJ83274.1|  unknown                                                 288   4e-96   Medicago truncatula
ref|XP_007204362.1|  hypothetical protein PRUPE_ppa007228mg             295   4e-96   Prunus persica
ref|XP_007027035.1|  Actin 3                                            295   4e-96   Theobroma cacao [chocolate]
ref|XP_010036489.1|  PREDICTED: actin                                   295   4e-96   Eucalyptus grandis [rose gum]
ref|XP_002308365.1|  actin family protein                               295   4e-96   Populus trichocarpa [western balsam poplar]
emb|CDX79746.1|  BnaC03g20820D                                          295   4e-96   
ref|XP_009146643.1|  PREDICTED: actin-11                                295   4e-96   Brassica rapa
ref|XP_009600120.1|  PREDICTED: actin-like                              295   4e-96   Nicotiana tomentosiformis
gb|KDO67622.1|  hypothetical protein CISIN_1g017081mg                   295   4e-96   Citrus sinensis [apfelsine]
ref|XP_006407369.1|  hypothetical protein EUTSA_v10020950mg             295   4e-96   Eutrema salsugineum [saltwater cress]
gb|KDP24628.1|  hypothetical protein JCGZ_25544                         295   4e-96   Jatropha curcas
ref|XP_010111359.1|  hypothetical protein L484_028016                   295   4e-96   Morus notabilis
ref|XP_007039275.1|  Actin 7 isoform 1                                  295   4e-96   Theobroma cacao [chocolate]
ref|NP_187818.1|  actin-11                                              295   4e-96   Arabidopsis thaliana [mouse-ear cress]
gb|AFZ78526.1|  actin                                                   295   4e-96   Populus tomentosa [Chinese white poplar]
ref|NP_001159156.1|  putative actin family protein                      295   4e-96   Zea mays [maize]
ref|XP_009787806.1|  PREDICTED: actin-like                              295   4e-96   Nicotiana sylvestris
gb|ADK20401.1|  actin                                                   295   4e-96   Citrus maxima [buntan]
dbj|BAL14664.1|  actin                                                  295   4e-96   Chrysanthemum seticuspe f. boreale
gb|ACP19072.1|  actin 1                                                 295   4e-96   Picea abies
ref|XP_003562930.1|  PREDICTED: actin-3                                 295   4e-96   Brachypodium distachyon [annual false brome]
ref|XP_010498525.1|  PREDICTED: actin-11                                295   4e-96   Camelina sativa [gold-of-pleasure]
ref|XP_008793942.1|  PREDICTED: actin-2-like                            295   4e-96   Phoenix dactylifera
ref|XP_009407474.1|  PREDICTED: actin-7-like                            295   4e-96   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB76649.1|  hypothetical protein B456_012G100700                    295   4e-96   Gossypium raimondii
ref|XP_010927382.1|  PREDICTED: actin-2                                 295   4e-96   Elaeis guineensis
ref|XP_009403146.1|  PREDICTED: actin                                   295   4e-96   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009388742.1|  PREDICTED: actin-like                              295   4e-96   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008354115.1|  PREDICTED: actin-1                                 295   5e-96   
ref|XP_004309498.1|  PREDICTED: actin-7-like                            295   5e-96   Fragaria vesca subsp. vesca
gb|AFW82899.1|  LOW QUALITY PROTEIN: putative actin family protein      296   5e-96   
gb|KGN54250.1|  hypothetical protein Csa_4G296030                       293   5e-96   Cucumis sativus [cucumbers]
gb|AAF03692.1|AF172094_1  actin                                         295   5e-96   Picea rubens [red spruce]
gb|AFP44112.1|  actin                                                   295   5e-96   Lycoris longituba
gb|AFO65511.1|  actin 2                                                 295   5e-96   Narcissus tazetta
ref|XP_011080749.1|  PREDICTED: actin-1-like                            295   5e-96   Sesamum indicum [beniseed]
gb|ABI14668.1|  actin                                                   292   5e-96   Aegiceras corniculatum
emb|CBI37599.3|  unnamed protein product                                296   5e-96   Vitis vinifera
ref|XP_010682856.1|  PREDICTED: actin-11                                295   5e-96   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010553283.1|  PREDICTED: actin                                   295   5e-96   Tarenaya hassleriana [spider flower]
ref|XP_010251047.1|  PREDICTED: actin-3                                 295   5e-96   Nelumbo nucifera [Indian lotus]
ref|XP_008455254.1|  PREDICTED: actin-7-like                            295   5e-96   Cucumis melo [Oriental melon]
ref|XP_004136855.1|  PREDICTED: actin-like                              295   5e-96   Cucumis sativus [cucumbers]
sp|P30167.1|ACT3_SOLTU  RecName: Full=Actin-58                          295   5e-96   Solanum tuberosum [potatoes]
ref|XP_010912406.1|  PREDICTED: actin-101-like                          295   5e-96   Elaeis guineensis
gb|AAD41039.1|AF112538_1  actin                                         295   5e-96   Malva pusilla
ref|XP_008781400.1|  PREDICTED: actin-101-like                          295   5e-96   Phoenix dactylifera
gb|AET50987.1|  actin                                                   291   5e-96   Lactuca sativa [cultivated lettuce]
gb|EPS69960.1|  actin-97                                                295   6e-96   Genlisea aurea
gb|KHG29096.1|  Actin                                                   295   6e-96   Gossypium arboreum [tree cotton]
ref|XP_010260924.1|  PREDICTED: actin-101-like                          295   6e-96   Nelumbo nucifera [Indian lotus]
ref|XP_003574188.1|  PREDICTED: actin-2                                 295   6e-96   Brachypodium distachyon [annual false brome]
gb|AHE76167.1|  actin                                                   295   6e-96   Triticum aestivum [Canadian hard winter wheat]
gb|AFM38980.1|  actin                                                   295   6e-96   Sophora viciifolia
ref|XP_011075140.1|  PREDICTED: actin-97                                295   6e-96   Sesamum indicum [beniseed]
ref|XP_002265476.1|  PREDICTED: actin-101                               295   6e-96   Vitis vinifera
ref|XP_010030965.1|  PREDICTED: actin                                   295   6e-96   Eucalyptus grandis [rose gum]
ref|XP_004304361.1|  PREDICTED: actin-like                              295   6e-96   Fragaria vesca subsp. vesca
gb|KJB73913.1|  hypothetical protein B456_011G260600                    294   6e-96   Gossypium raimondii
ref|XP_010524532.1|  PREDICTED: actin-1-like                            295   6e-96   Tarenaya hassleriana [spider flower]
gb|KHF98170.1|  Actin                                                   295   6e-96   Gossypium arboreum [tree cotton]
ref|XP_009759480.1|  PREDICTED: actin-101                               295   6e-96   Nicotiana sylvestris
emb|CDY30846.1|  BnaC04g27010D                                          295   6e-96   Brassica napus [oilseed rape]
gb|ADA70361.1|  actin                                                   295   6e-96   Persea americana
ref|XP_010027698.1|  PREDICTED: actin-7                                 295   6e-96   Eucalyptus grandis [rose gum]
ref|XP_008776351.1|  PREDICTED: actin-101                               295   6e-96   Phoenix dactylifera
ref|XP_008382817.1|  PREDICTED: actin                                   295   6e-96   Malus domestica [apple tree]
ref|XP_003523242.1|  PREDICTED: actin-7-like isoform X1                 295   6e-96   Glycine max [soybeans]
gb|ADV17460.1|  actin                                                   295   6e-96   Litchi chinensis [litchi]
ref|XP_008794560.1|  PREDICTED: actin-101-like                          295   6e-96   Phoenix dactylifera
ref|XP_006432485.1|  hypothetical protein CICLE_v10001518mg             295   6e-96   Citrus clementina [clementine]
gb|ADV04491.1|  beta-actin                                              295   6e-96   Camellia sinensis [black tea]
gb|ADV91594.1|  actin                                                   295   6e-96   Ananas comosus
ref|XP_004173826.1|  PREDICTED: actin-7-like                            294   6e-96   
ref|XP_007009346.1|  Actin-11 isoform 1                                 295   6e-96   Theobroma cacao [chocolate]
ref|XP_010520298.1|  PREDICTED: actin-7                                 294   6e-96   Tarenaya hassleriana [spider flower]
gb|ADW83713.1|  actin 1                                                 294   6e-96   Musa acuminata AAA Group [Cavendish banana]
ref|XP_010528400.1|  PREDICTED: actin-1                                 294   6e-96   Tarenaya hassleriana [spider flower]
ref|NP_001266023.1|  uncharacterized protein LOC101503086               294   7e-96   Cicer arietinum [garbanzo]
gb|ACB88021.1|  actin                                                   294   7e-96   Betula platyphylla [Asian white birch]
ref|XP_002298710.1|  actin family protein                               294   7e-96   Populus trichocarpa [western balsam poplar]
sp|P46258.1|ACT3_PEA  RecName: Full=Actin-3                             294   7e-96   Pisum sativum [garden pea]
ref|XP_006427855.1|  hypothetical protein CICLE_v10025866mg             294   7e-96   Citrus clementina [clementine]
ref|XP_004147353.1|  PREDICTED: actin-7-like                            294   7e-96   Cucumis sativus [cucumbers]
gb|AEO45961.1|  actin 1                                                 294   7e-96   
ref|XP_010922415.1|  PREDICTED: actin-101-like isoform X1               294   7e-96   
ref|XP_008809027.1|  PREDICTED: actin-2                                 294   7e-96   
gb|AHB86961.1|  actin-2                                                 294   7e-96   
gb|AFB83349.1|  actin 2                                                 294   7e-96   
gb|AEN70759.1|  actin 1                                                 294   7e-96   
gb|KJB16973.1|  hypothetical protein B456_002G257900                    294   7e-96   
ref|XP_009420081.1|  PREDICTED: actin-2                                 294   7e-96   
ref|XP_009393674.1|  PREDICTED: actin-like                              294   7e-96   
ref|XP_003525105.1|  PREDICTED: actin-7-like                            294   7e-96   
ref|XP_008458880.1|  PREDICTED: actin-82-like isoform X3                296   7e-96   
ref|XP_010554872.1|  PREDICTED: actin-1                                 294   7e-96   
ref|XP_009383456.1|  PREDICTED: actin-7-like                            294   7e-96   
gb|AAB18641.1|  actin                                                   294   7e-96   
ref|NP_001289215.1|  actin-7                                            294   7e-96   
gb|ABR45727.1|  ACT1                                                    294   7e-96   
gb|AJG03097.1|  beta-actin 1                                            294   7e-96   
ref|XP_008788993.1|  PREDICTED: actin-101-like                          294   7e-96   
emb|CDP12785.1|  unnamed protein product                                294   7e-96   
gb|ACK87035.1|  actin                                                   294   7e-96   
gb|AAP73457.1|  actin                                                   294   7e-96   
dbj|BAA89214.1|  actin isoform B                                        294   7e-96   
ref|XP_007028993.1|  Actin-11                                           294   7e-96   
gb|AFK35945.1|  unknown                                                 294   7e-96   
gb|AAR15174.1|  actin                                                   294   7e-96   
ref|XP_003625265.1|  Actin                                              294   7e-96   
ref|XP_009388633.1|  PREDICTED: actin-101                               294   7e-96   
gb|ACJ38662.1|  actin                                                   294   8e-96   
gb|AAP73451.1|  actin                                                   294   8e-96   
gb|ADV72541.1|  actin 7b                                                294   8e-96   
gb|AAP73459.1|  actin                                                   294   8e-96   
ref|XP_001782688.1|  predicted protein                                  294   8e-96   
ref|XP_010671358.1|  PREDICTED: actin-7-like                            294   8e-96   
ref|XP_008363858.1|  PREDICTED: LOW QUALITY PROTEIN: actin-like         294   8e-96   
ref|XP_006371012.1|  hypothetical protein POPTR_0019s02630g             294   8e-96   
gb|EYU33199.1|  hypothetical protein MIMGU_mgv1a008335mg                294   8e-96   
gb|AGT96517.1|  actin                                                   291   8e-96   
ref|XP_010546369.1|  PREDICTED: actin-7                                 294   8e-96   
gb|KHG27347.1|  Actin                                                   294   8e-96   
gb|AEN70747.1|  actin 1                                                 294   8e-96   
ref|XP_010534357.1|  PREDICTED: actin-1-like                            294   8e-96   
ref|XP_004493592.1|  PREDICTED: actin-3-like                            294   8e-96   
gb|ADQ42773.2|  actin                                                   294   8e-96   
gb|AFU06383.1|  actin                                                   294   8e-96   
gb|KJB76650.1|  hypothetical protein B456_012G100700                    294   8e-96   
gb|AAP73450.1|  actin                                                   294   8e-96   
emb|CDP06619.1|  unnamed protein product                                294   9e-96   
ref|XP_009373687.1|  PREDICTED: actin-7-like                            294   9e-96   
ref|XP_009409104.1|  PREDICTED: actin-like                              294   9e-96   
ref|XP_009409006.1|  PREDICTED: actin-101-like                          294   9e-96   
ref|XP_004307518.1|  PREDICTED: actin-97-like                           294   9e-96   
gb|AAS78671.1|  actin                                                   286   9e-96   
gb|AFD62269.1|  actin 2                                                 294   9e-96   
ref|XP_010557948.1|  PREDICTED: actin-1-like                            294   9e-96   
gb|AHY94895.1|  actin                                                   294   9e-96   
gb|AIY25484.1|  actin isoform 3-1                                       294   9e-96   
ref|XP_002279672.1|  PREDICTED: actin-66                                294   1e-95   
gb|KJB76652.1|  hypothetical protein B456_012G100700                    295   1e-95   
sp|P30173.1|ACT13_SOLTU  RecName: Full=Actin-101                        294   1e-95   
gb|ABG49392.1|  actin 2                                                 294   1e-95   
ref|XP_008788057.1|  PREDICTED: actin-3-like                            294   1e-95   
ref|XP_006348992.1|  PREDICTED: actin-58-like                           294   1e-95   
ref|XP_008239281.1|  PREDICTED: actin-7-like                            294   1e-95   
gb|AGZ90151.1|  actin 7                                                 294   1e-95   
ref|XP_007209248.1|  hypothetical protein PRUPE_ppa007211mg             294   1e-95   
gb|AAN40685.1|  actin                                                   294   1e-95   
ref|XP_004306592.1|  PREDICTED: actin-7                                 294   1e-95   
gb|KJB76651.1|  hypothetical protein B456_012G100700                    294   1e-95   
ref|XP_004302738.1|  PREDICTED: actin                                   294   1e-95   
ref|XP_002879687.1|  hypothetical protein ARALYDRAFT_321465             293   1e-95   
gb|KJB20092.1|  hypothetical protein B456_003G132400                    294   1e-95   
gb|AIR74902.1|  beta-actin                                              294   1e-95   
gb|AAC49652.1|  actin                                                   294   1e-95   
ref|XP_003519037.1|  PREDICTED: actin-like isoform X1                   294   1e-95   
ref|XP_002282516.1|  PREDICTED: actin-7                                 294   1e-95   
gb|KHG03218.1|  Actin                                                   293   1e-95   
gb|KHF99778.1|  Actin                                                   293   1e-95   
ref|XP_004250955.1|  PREDICTED: actin-97-like                           293   1e-95   
ref|NP_001141313.1|  uncharacterized protein LOC100273404               293   1e-95   
gb|AEO45960.1|  actin 4                                                 293   1e-95   
ref|XP_009631892.1|  PREDICTED: actin-101                               293   1e-95   
ref|XP_003533915.1|  PREDICTED: actin-like isoform X1                   293   1e-95   
ref|XP_007205366.1|  hypothetical protein PRUPE_ppa007219mg             293   1e-95   
gb|AEM89276.1|  actin                                                   293   1e-95   
pir||T45915  actin (ACT3) - Arabidopsis thaliana                        295   1e-95
ref|XP_004142758.1|  PREDICTED: actin-1-like                            293   1e-95   
ref|XP_006418890.1|  hypothetical protein EUTSA_v10002572mg             293   1e-95   
ref|XP_002463566.1|  hypothetical protein SORBIDRAFT_01g002170          293   1e-95   
gb|EAY82369.1|  hypothetical protein OsI_37581                          293   1e-95   
ref|XP_004136568.1|  PREDICTED: actin-like                              293   1e-95   
gb|AAC49651.1|  actin                                                   293   1e-95   
ref|XP_006379593.1|  actin family protein                               293   1e-95   
gb|KJB36724.1|  hypothetical protein B456_006G173100                    293   1e-95   
gb|KHG15514.1|  Actin                                                   293   1e-95   
sp|O81221.1|ACT_GOSHI  RecName: Full=Actin                              293   1e-95   
ref|XP_006400969.1|  hypothetical protein EUTSA_v10013840mg             293   1e-95   
dbj|BAJ85474.1|  predicted protein                                      293   1e-95   
ref|XP_010454923.1|  PREDICTED: actin-12-like                           293   1e-95   
ref|XP_006282193.1|  hypothetical protein CARUB_v10028459mg             293   1e-95   
ref|XP_010520278.1|  PREDICTED: actin-like                              293   2e-95   
ref|NP_190236.1|  actin-12                                              293   2e-95   
ref|XP_003560589.1|  PREDICTED: actin-1                                 293   2e-95   
gb|AAO42312.1|  putative actin 4                                        293   2e-95   
ref|XP_007218136.1|  hypothetical protein PRUPE_ppa007236mg             293   2e-95   
ref|XP_009341422.1|  PREDICTED: actin-like                              293   2e-95   
ref|XP_006664254.1|  PREDICTED: actin-like                              288   2e-95   
emb|CDY07779.1|  BnaA03g17320D                                          293   2e-95   
gb|AGK27782.1|  actin 7                                                 290   2e-95   
gb|KEH39427.1|  actin-97                                                293   2e-95   
ref|XP_004487013.1|  PREDICTED: actin-like                              293   2e-95   
gb|AAM65657.1|  actin 4                                                 293   2e-95   
gb|ABN14926.1|  cytoskeletal actin 2                                    285   2e-95   
emb|CDX82985.1|  BnaA01g19850D                                          293   2e-95   
tpg|DAA51049.1|  TPA: putative actin family protein                     294   2e-95   
ref|XP_002876223.1|  hypothetical protein ARALYDRAFT_323914             295   2e-95   
gb|ACJ84857.1|  unknown                                                 293   2e-95   
ref|XP_009150339.1|  PREDICTED: actin-12-like                           293   2e-95   
ref|XP_009131999.1|  PREDICTED: actin-12-like                           293   2e-95   
ref|XP_007150318.1|  hypothetical protein PHAVU_005G143500g             293   2e-95   
ref|XP_010541399.1|  PREDICTED: actin-12-like                           293   2e-95   
gb|KHG29811.1|  Actin                                                   293   2e-95   
ref|NP_200745.1|  actin 4                                               293   2e-95   
dbj|BAL27711.1|  actin like 1                                           293   2e-95   
ref|XP_010936865.1|  PREDICTED: actin                                   293   2e-95   
ref|XP_011029076.1|  PREDICTED: actin-97-like                           293   2e-95   
emb|CDY38066.1|  BnaC03g75050D                                          293   2e-95   
ref|XP_008385127.1|  PREDICTED: actin                                   293   2e-95   
gb|AAA32727.1|  actin-1                                                 293   2e-95   
ref|NP_001239953.1|  uncharacterized protein LOC100798523               293   2e-95   
gb|AEF58501.1|  actin                                                   293   2e-95   
gb|KJB73912.1|  hypothetical protein B456_011G260600                    293   2e-95   
ref|XP_009150245.1|  PREDICTED: actin-12                                293   2e-95   
ref|NP_001051086.1|  Os03g0718100                                       293   2e-95   
ref|XP_004147692.1|  PREDICTED: actin-97-like                           293   2e-95   
ref|NP_001276160.1|  actin-11-like                                      293   2e-95   
ref|XP_010535499.1|  PREDICTED: actin-11                                293   2e-95   
ref|XP_010905701.1|  PREDICTED: actin-101-like                          293   2e-95   
ref|XP_010320070.1|  PREDICTED: actin-105                               293   2e-95   
gb|KHN13906.1|  Actin-11                                                293   2e-95   
ref|NP_566988.1|  actin 3                                               293   2e-95   
ref|XP_010067406.1|  PREDICTED: actin-1-like                            293   2e-95   
ref|XP_010106464.1|  hypothetical protein L484_025221                   293   2e-95   
gb|AAT72934.2|  stem cambial region actin protein                       293   2e-95   
ref|XP_009353688.1|  PREDICTED: actin                                   293   2e-95   
ref|XP_009141678.1|  PREDICTED: actin-1-like                            293   2e-95   
gb|AAF31643.1|AF143208_1  actin                                         293   2e-95   
ref|XP_008346992.1|  PREDICTED: actin-7                                 293   2e-95   
ref|XP_006650864.1|  PREDICTED: actin-3-like                            293   2e-95   
ref|XP_009143470.1|  PREDICTED: LOW QUALITY PROTEIN: actin-1            293   2e-95   
gb|ACL97685.1|  actin 2                                                 293   2e-95   
ref|XP_010520033.1|  PREDICTED: actin-1-like                            293   2e-95   
ref|XP_004489182.1|  PREDICTED: actin-like                              293   2e-95   
ref|XP_007162325.1|  hypothetical protein PHAVU_001G142500g             293   2e-95   
gb|AFK41203.1|  unknown                                                 293   2e-95   
emb|CDY53444.1|  BnaA02g07080D                                          293   2e-95   
ref|XP_003553313.1|  PREDICTED: actin-like                              293   2e-95   
gb|ADP09679.1|  actin isoform PEAc14-1                                  293   2e-95   
ref|XP_002879684.1|  hypothetical protein ARALYDRAFT_321462             293   2e-95   
gb|ADH82414.1|  actin                                                   293   2e-95   
ref|XP_008795328.1|  PREDICTED: actin-1                                 293   2e-95   
ref|NP_001051822.1|  Os03g0836000                                       293   2e-95   
ref|XP_008785821.1|  PREDICTED: actin-3-like                            293   2e-95   
ref|XP_009116071.1|  PREDICTED: actin-1-like                            293   2e-95   
gb|AGA63729.1|  actin                                                   293   2e-95   
ref|XP_004492148.1|  PREDICTED: actin-11-like                           293   2e-95   
ref|XP_003622019.1|  Actin                                              293   2e-95   
emb|CDX91373.1|  BnaC04g07770D                                          293   2e-95   
ref|NP_001241178.1|  uncharacterized protein LOC100807341               293   2e-95   
gb|AFK40690.1|  unknown                                                 293   2e-95   
ref|XP_009139296.1|  PREDICTED: actin-1                                 293   3e-95   
ref|NP_001150462.1|  LOC100284092                                       293   3e-95   
gb|AAQ74875.1|  actin                                                   293   3e-95   
ref|XP_009133195.1|  PREDICTED: actin-1-like                            293   3e-95   
ref|XP_007150869.1|  hypothetical protein PHAVU_004G001000g             293   3e-95   
emb|CDY08455.1|  BnaA05g26910D                                          293   3e-95   
ref|XP_008787899.1|  PREDICTED: actin-like                              293   3e-95   
emb|CAA33874.1|  actin                                                  293   3e-95   
ref|NP_001146931.1|  actin-2                                            293   3e-95   
gb|KEH24717.1|  actin-97                                                293   3e-95   
ref|XP_002977012.1|  hypothetical protein SELMODRAFT_175956             293   3e-95   
gb|AIC33035.1|  actin 1                                                 293   3e-95   
gb|ACJ84552.1|  unknown                                                 293   3e-95   
ref|XP_010933731.1|  PREDICTED: actin-101-like                          293   3e-95   
ref|XP_004142070.1|  PREDICTED: actin-like                              293   3e-95   
ref|XP_003521216.1|  PREDICTED: actin-3-like isoform X1                 293   3e-95   
dbj|BAJ85914.1|  predicted protein                                      293   3e-95   
gb|ACN54541.1|  actin                                                   293   3e-95   
ref|XP_006595018.1|  PREDICTED: actin-like isoform X1                   293   3e-95   
ref|XP_002466956.1|  hypothetical protein SORBIDRAFT_01g017380          293   3e-95   
ref|XP_010909197.1|  PREDICTED: actin-like                              293   3e-95   
ref|XP_008798327.1|  PREDICTED: actin                                   293   3e-95   
ref|XP_006429882.1|  hypothetical protein CICLE_v10011974mg             293   3e-95   
ref|XP_008241048.1|  PREDICTED: actin                                   293   3e-95   
sp|P53504.1|ACT1_SORBI  RecName: Full=Actin-1                           293   3e-95   
emb|CAA34356.1|  unnamed protein product                                293   3e-95   
ref|XP_009417581.1|  PREDICTED: actin-2-like                            293   3e-95   
ref|XP_003547359.1|  PREDICTED: actin-like isoform X1                   293   3e-95   
ref|XP_007041602.1|  Actin 7 isoform 2                                  291   3e-95   
gb|AFK42711.1|  unknown                                                 293   3e-95   
ref|NP_001167929.1|  putative actin family protein                      293   3e-95   
gb|AAP73460.1|  actin                                                   293   3e-95   
ref|XP_007205365.1|  hypothetical protein PRUPE_ppa007214mg             292   4e-95   
ref|NP_001239660.1|  uncharacterized protein LOC100781831               292   4e-95   
ref|XP_006661942.1|  PREDICTED: actin-2-like isoform X1                 292   4e-95   
ref|NP_001065034.1|  Os10g0510000                                       292   4e-95   
gb|AAP73455.1|  actin                                                   292   4e-95   
gb|AGS79174.1|  actin                                                   292   4e-95   
gb|AAP34631.1|  ubiquitin/actin fusion protein 1                        288   4e-95   
gb|KCW57041.1|  hypothetical protein EUGRSUZ_I02702                     294   4e-95   
gb|AIZ68149.1|  actin-2                                                 292   4e-95   
gb|KJB24093.1|  hypothetical protein B456_004G127500                    291   4e-95   
ref|XP_011099798.1|  PREDICTED: actin-1-like                            292   4e-95   
gb|AGV54465.1|  actin-3-like protein                                    292   4e-95   
ref|XP_008647047.1|  PREDICTED: actin-7-like                            285   4e-95   
dbj|BAJ07367.1|  beta-actin                                             286   4e-95   
gb|EYU20691.1|  hypothetical protein MIMGU_mgv1a008334mg                292   5e-95   
gb|ACL97684.1|  actin 1                                                 292   5e-95   
ref|XP_008810321.1|  PREDICTED: actin-2-like                            292   5e-95   
gb|ADU05553.1|  actin                                                   291   5e-95   
ref|XP_011078821.1|  PREDICTED: actin                                   292   5e-95   
gb|AGK63075.1|  actin 1                                                 292   5e-95   



>gb|ACT82771.1| actin, partial [Nicotiana tabacum]
Length=157

 Score =   295 bits (755),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAEGEE+QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEEIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYAS  147



>gb|AFW82913.1| putative actin family protein [Zea mays]
Length=154

 Score =   294 bits (752),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>gb|AFW82903.1| putative actin family protein isoform 1 [Zea mays]
 gb|AFW82904.1| putative actin family protein isoform 2 [Zea mays]
 gb|AFW82905.1| putative actin family protein isoform 3 [Zea mays]
Length=155

 Score =   294 bits (752),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|XP_009594162.1| PREDICTED: actin-104 [Nicotiana tomentosiformis]
Length=377

 Score =   301 bits (772),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 142/147 (97%), Positives = 145/147 (99%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAEGE++QPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDIQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|XP_009787561.1| PREDICTED: actin-104 [Nicotiana sylvestris]
 ref|XP_009787562.1| PREDICTED: actin-104 [Nicotiana sylvestris]
Length=377

 Score =   301 bits (771),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 142/147 (97%), Positives = 145/147 (99%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAEGE++QPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDIQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>gb|KHG20063.1| Actin-7 -like protein [Gossypium arboreum]
Length=222

 Score =   295 bits (755),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>emb|CDP11386.1| unnamed protein product [Coffea canephora]
Length=377

 Score =   300 bits (769),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 142/147 (97%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAEGEE+QPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEEIQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>gb|AFW82900.1| putative actin family protein [Zea mays]
Length=208

 Score =   294 bits (753),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 139/148 (94%), Positives = 144/148 (97%), Gaps = 0/148 (0%)
 Frame = +1

Query  70   KMAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDE  249
            +MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDE
Sbjct  53   EMADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDE  112

Query  250  AQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANRE  429
            AQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANRE
Sbjct  113  AQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE  172

Query  430  KMTQIMFETFNVPAMYVAIXAVLSLYAS  513
            KMTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  173  KMTQIMFETFNVPAMYVAIQAVLSLYAS  200



>gb|AAS68183.1| actin [Brassica napus var. napus]
Length=176

 Score =   293 bits (750),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>gb|AAK84080.1|AF326781_1 actin [Triticum monococcum]
Length=190

 Score =   293 bits (751),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>gb|KHG21354.1| Actin-7 -like protein [Gossypium arboreum]
Length=277

 Score =   297 bits (760),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|NP_001172758.1| Os01g0964400 [Oryza sativa Japonica Group]
 dbj|BAH91488.1| Os01g0964400 [Oryza sativa Japonica Group]
Length=222

 Score =   295 bits (754),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>gb|AGE09575.1| ACT-like protein, partial [Eucalyptus cladocalyx]
Length=181

 Score =   293 bits (750),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAE E++QPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAETEDIQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|XP_010911102.1| PREDICTED: actin-7-like, partial [Elaeis guineensis]
Length=150

 Score =   291 bits (746),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+ E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>dbj|BAN08538.1| actin, partial [Solanum lycopersicum]
Length=157

 Score =   291 bits (746),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 138/148 (93%), Positives = 142/148 (96%), Gaps = 0/148 (0%)
 Frame = +1

Query  70   KMAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDE  249
            KMA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVG PRH GVMVGMGQKDAYVGDE
Sbjct  2    KMADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGHPRHTGVMVGMGQKDAYVGDE  61

Query  250  AQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANRE  429
            AQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANRE
Sbjct  62   AQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE  121

Query  430  KMTQIMFETFNVPAMYVAIXAVLSLYAS  513
            KMTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  122  KMTQIMFETFNTPAMYVAIQAVLSLYAS  149



>gb|AFZ78528.1| actin [Populus tomentosa]
Length=377

 Score =   300 bits (767),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAEGEE+QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEEIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|XP_002298982.1| actin family protein [Populus trichocarpa]
 ref|XP_011038044.1| PREDICTED: actin-7-like [Populus euphratica]
 ref|XP_011038045.1| PREDICTED: actin-7-like [Populus euphratica]
 gb|EEE83787.1| actin family protein [Populus trichocarpa]
Length=377

 Score =   300 bits (767),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAEGEE+QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEEIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>emb|CDY56544.1| BnaA03g55890D [Brassica napus]
 emb|CDX81140.1| BnaC03g03940D [Brassica napus]
Length=377

 Score =   299 bits (766),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAEGEE+QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEEIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|XP_010485236.1| PREDICTED: actin-4-like [Camelina sativa]
Length=168

 Score =   291 bits (746),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>gb|ABY19575.1| actin [Ipomoea batatas]
Length=241

 Score =   294 bits (753),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+ E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|XP_011074742.1| PREDICTED: actin-104 [Sesamum indicum]
Length=377

 Score =   299 bits (765),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAEGE++QPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDIQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|NP_001291342.1| uncharacterized protein LOC105159390 [Sesamum indicum]
 ref|XP_011074741.1| PREDICTED: actin-7-like [Sesamum indicum]
 gb|AFJ42570.1| beta-actin [Sesamum indicum]
Length=377

 Score =   299 bits (765),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAEGE++QPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDIQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>gb|EEC78366.1| hypothetical protein OsI_18129 [Oryza sativa Indica Group]
Length=372

 Score =   298 bits (764),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 139/148 (94%), Positives = 144/148 (97%), Gaps = 0/148 (0%)
 Frame = +1

Query  70   KMAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDE  249
            +MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDE
Sbjct  57   EMADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDE  116

Query  250  AQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANRE  429
            AQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANRE
Sbjct  117  AQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE  176

Query  430  KMTQIMFETFNVPAMYVAIXAVLSLYAS  513
            KMTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  177  KMTQIMFETFNVPAMYVAIQAVLSLYAS  204



>gb|ACJ83287.1| unknown [Medicago truncatula]
Length=213

 Score =   292 bits (748),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+ E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>gb|AFZ78529.1| actin [Populus tomentosa]
Length=231

 Score =   293 bits (750),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAEGEE+QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEEIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPK NREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKVNREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            M QIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MAQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|XP_009390755.1| PREDICTED: actin-7 [Musa acuminata subsp. malaccensis]
Length=377

 Score =   298 bits (763),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GEE+QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEEIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>gb|AIH15193.1| actin 1, partial [Hedychium coronarium]
Length=260

 Score =   294 bits (752),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+ E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH +LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>gb|AFW75038.1| putative actin family protein [Zea mays]
Length=372

 Score =   298 bits (762),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|XP_003578869.1| PREDICTED: actin-3-like [Brachypodium distachyon]
Length=377

 Score =   298 bits (763),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GEE+QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEEIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>gb|AFW82911.1| putative actin family protein isoform 1 [Zea mays]
 gb|AFW82912.1| putative actin family protein isoform 2 [Zea mays]
Length=378

 Score =   298 bits (763),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>gb|ACU18204.1| unknown [Glycine max]
Length=213

 Score =   292 bits (747),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+ E++QPLVVDNGTGMVKAGFAGDDAPRAVFPSI+GRPRH GV+VGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVVDNGTGMVKAGFAGDDAPRAVFPSIIGRPRHTGVVVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>gb|AIS84126.1| actin, partial [Fraxinus mandshurica]
Length=201

 Score =   291 bits (746),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+ E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>gb|ADU52547.1| actin 1 [Morus alba]
Length=377

 Score =   298 bits (762),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GEE+QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEEIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|XP_009413409.1| PREDICTED: actin-7 [Musa acuminata subsp. malaccensis]
Length=377

 Score =   298 bits (762),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GEE+QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEEIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH +LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>gb|ADZ76112.1| actin [Litchi chinensis]
Length=316

 Score =   295 bits (756),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+ EE+QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADTEEIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>gb|AFW75045.1| putative actin family protein [Zea mays]
Length=368

 Score =   297 bits (761),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>gb|KJB76087.1| hypothetical protein B456_012G070300 [Gossypium raimondii]
Length=365

 Score =   297 bits (761),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAEGE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYAS  147



>ref|XP_009621805.1| PREDICTED: actin-like [Nicotiana tomentosiformis]
 ref|XP_009780859.1| PREDICTED: actin [Nicotiana sylvestris]
 ref|XP_009780860.1| PREDICTED: actin [Nicotiana sylvestris]
Length=377

 Score =   297 bits (761),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAEGEE+QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEEIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYAS  147



>gb|AAN08622.1| actin [Phalaenopsis hybrid cultivar]
Length=377

 Score =   297 bits (761),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAEGEE+QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEEIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH +LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYAS  147



>gb|AGR45356.1| actin [Dendrobium catenatum]
Length=377

 Score =   297 bits (761),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAE E++QPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAETEDIQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>gb|AAF71264.1|AF246714_1 actin-like protein [Phalaenopsis hybrid cultivar]
Length=377

 Score =   297 bits (761),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAEGEE+QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEEIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH +LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYAS  147



>gb|EPS67367.1| hypothetical protein M569_07407 [Genlisea aurea]
Length=377

 Score =   297 bits (761),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|XP_009131124.1| PREDICTED: actin-7-like [Brassica rapa]
Length=377

 Score =   297 bits (761),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAEGEE+QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEEIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTE PLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEVPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|XP_010258283.1| PREDICTED: actin-3-like [Nelumbo nucifera]
Length=227

 Score =   292 bits (747),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>ref|XP_010257796.1| PREDICTED: actin-3-like [Nelumbo nucifera]
Length=202

 Score =   291 bits (745),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>gb|AFK41489.1| unknown [Medicago truncatula]
Length=191

 Score =   290 bits (743),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+ E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYAS  147



>ref|XP_010542288.1| PREDICTED: actin-2-like [Tarenaya hassleriana]
Length=377

 Score =   297 bits (761),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAEGE++QPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDIQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHAGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETF+VPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFDVPAMYVAIQAVLSLYAS  147



>tpg|DAA51874.1| TPA: putative actin family protein isoform 1 [Zea mays]
 tpg|DAA51875.1| TPA: putative actin family protein isoform 2 [Zea mays]
Length=159

 Score =   289 bits (740),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 136/147 (93%), Positives = 140/147 (95%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+ E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI  VLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQTVLSLYAS  147



>gb|ABW71681.1| actin [Glycyrrhiza uralensis]
Length=377

 Score =   297 bits (760),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE+VQPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDVQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|XP_009801998.1| PREDICTED: actin-97-like [Nicotiana sylvestris]
Length=377

 Score =   297 bits (760),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAEGE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>ref|XP_011091473.1| PREDICTED: actin-11 [Sesamum indicum]
 ref|XP_011091474.1| PREDICTED: actin-11 [Sesamum indicum]
Length=377

 Score =   297 bits (760),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAEGE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>ref|XP_010053990.1| PREDICTED: actin-7-like [Eucalyptus grandis]
 gb|KCW78362.1| hypothetical protein EUGRSUZ_D02537 [Eucalyptus grandis]
 gb|KCW78363.1| hypothetical protein EUGRSUZ_D02537 [Eucalyptus grandis]
Length=377

 Score =   297 bits (760),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAE E++QPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAETEDIQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>dbj|BAK57343.1| actin1 [Morella rubra]
Length=377

 Score =   297 bits (760),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE+VQPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDVQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>gb|AEY76080.1| actin, partial [Petunia integrifolia subsp. inflata]
Length=215

 Score =   291 bits (745),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAE E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAEVEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYAS  147



>gb|ADY38689.1| actin [Camellia sinensis]
Length=377

 Score =   297 bits (760),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAEGE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>gb|AFK39620.1| unknown [Medicago truncatula]
Length=232

 Score =   292 bits (747),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+ E++QPLVVDNGTGMVKAGFAGDDAPRAVFPSI+GRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVVDNGTGMVKAGFAGDDAPRAVFPSIIGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            M QIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MAQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|XP_001782687.1| predicted protein [Physcomitrella patens]
 gb|AAQ88109.1| actin 1 [Physcomitrella patens]
 gb|EDQ52518.1| predicted protein [Physcomitrella patens]
Length=377

 Score =   297 bits (760),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GEEVQPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEEVQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHG+V+NWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGVVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|XP_009591335.1| PREDICTED: actin-97 [Nicotiana tomentosiformis]
Length=377

 Score =   297 bits (760),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAEGE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>ref|XP_004971370.1| PREDICTED: actin-7-like isoform X3 [Setaria italica]
Length=390

 Score =   297 bits (761),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|XP_008654246.1| PREDICTED: putative actin family protein isoform 1 isoform X1 
[Zea mays]
Length=377

 Score =   297 bits (760),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>gb|AGZ90152.1| actin 11, partial [Litsea cubeba]
Length=377

 Score =   297 bits (760),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAEGE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>gb|AFN53639.1| putative actin-97 protein [Linum usitatissimum]
Length=377

 Score =   297 bits (760),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAEGE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>gb|ADJ95345.1| actin [Pogonatherum paniceum]
Length=377

 Score =   297 bits (760),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>emb|CDP00088.1| unnamed protein product [Coffea canephora]
Length=377

 Score =   297 bits (760),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAEGE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>ref|XP_010446199.1| PREDICTED: actin-85C [Camelina sativa]
Length=287

 Score =   293 bits (751),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>ref|XP_002530852.1| actin, putative [Ricinus communis]
 gb|EEF31526.1| actin, putative [Ricinus communis]
Length=309

 Score =   294 bits (753),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+ E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>ref|NP_196543.1| actin 7 [Arabidopsis thaliana]
 ref|XP_002871386.1| hypothetical protein ARALYDRAFT_487803 [Arabidopsis lyrata subsp. 
lyrata]
 sp|P53492.1|ACT7_ARATH RecName: Full=Actin-7; AltName: Full=Actin-2 [Arabidopsis thaliana]
 gb|AAA80356.1| actin-2 [Arabidopsis thaliana]
 gb|AAB52506.1| actin7 [Arabidopsis thaliana]
 dbj|BAB09402.1| ACTIN 2/7 [Arabidopsis thaliana]
 gb|AAL32780.1| ACTIN 2/7 [Arabidopsis thaliana]
 gb|AAL36336.1| putative ACTIN 2/7 protein [Arabidopsis thaliana]
 gb|AAM20037.1| putative actin 2/7 protein [Arabidopsis thaliana]
 gb|AAM47998.1| ACTIN 2/7 [Arabidopsis thaliana]
 gb|AAM53337.1| actin 2/7 [Arabidopsis thaliana]
 gb|EFH47645.1| hypothetical protein ARALYDRAFT_487803 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AED91450.1| actin 7 [Arabidopsis thaliana]
Length=377

 Score =   296 bits (759),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>gb|ACJ04738.1| actin [Sedum alfredii]
Length=377

 Score =   296 bits (759),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>dbj|BAD27408.1| actin [Nicotiana tabacum]
Length=377

 Score =   296 bits (759),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>gb|EMS60494.1| Actin-3 [Triticum urartu]
Length=400

 Score =   297 bits (761),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 139/149 (93%), Positives = 145/149 (97%), Gaps = 0/149 (0%)
 Frame = +1

Query  67   DKMAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGD  246
            ++MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGD
Sbjct  22   NQMADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGD  81

Query  247  EAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANR  426
            EAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANR
Sbjct  82   EAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR  141

Query  427  EKMTQIMFETFNVPAMYVAIXAVLSLYAS  513
            EKMTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  142  EKMTQIMFETFNVPAMYVAIQAVLSLYAS  170



>gb|ACJ85292.1| unknown [Medicago truncatula]
Length=210

 Score =   291 bits (744),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 140/147 (95%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAE E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAESEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHH FYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHAFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>ref|NP_001130463.1| putative actin family protein isoform 1 [Zea mays]
 ref|XP_002440422.1| hypothetical protein SORBIDRAFT_09g000750 [Sorghum bicolor]
 ref|XP_008648673.1| PREDICTED: actin-97-like [Zea mays]
 ref|XP_008648674.1| PREDICTED: actin-97-like [Zea mays]
 ref|XP_008648675.1| PREDICTED: actin-97-like [Zea mays]
 ref|XP_008656564.1| PREDICTED: actin-97-like [Zea mays]
 ref|XP_008656565.1| PREDICTED: actin-97-like [Zea mays]
 gb|AAU93346.1| actin [Saccharum officinarum]
 gb|ACF78682.1| unknown [Zea mays]
 gb|ACF84243.1| unknown [Zea mays]
 gb|ACG33152.1| actin-97 [Zea mays]
 gb|ACG41639.1| actin-97 [Zea mays]
 gb|ACL53150.1| unknown [Zea mays]
 gb|ACN29086.1| unknown [Zea mays]
 gb|ACN33687.1| unknown [Zea mays]
 gb|EES18852.1| hypothetical protein SORBIDRAFT_09g000750 [Sorghum bicolor]
 gb|AFW75039.1| putative actin family protein isoform 1 [Zea mays]
 gb|AFW75040.1| putative actin family protein isoform 2 [Zea mays]
 gb|AFW75041.1| putative actin family protein isoform 3 [Zea mays]
 gb|AFW75046.1| putative actin family protein isoform 1 [Zea mays]
 gb|AFW75047.1| putative actin family protein isoform 2 [Zea mays]
 gb|AFW75048.1| putative actin family protein isoform 3 [Zea mays]
 gb|AFW75049.1| putative actin family protein isoform 4 [Zea mays]
 gb|AFW82907.1| putative actin family protein isoform 1 [Zea mays]
 gb|AFW82908.1| putative actin family protein isoform 2 [Zea mays]
 gb|AFW82909.1| putative actin family protein isoform 3 [Zea mays]
 gb|AFW82910.1| putative actin family protein isoform 4 [Zea mays]
Length=377

 Score =   296 bits (759),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|XP_002449040.1| hypothetical protein SORBIDRAFT_05g003880 [Sorghum bicolor]
 gb|EES08028.1| hypothetical protein SORBIDRAFT_05g003880 [Sorghum bicolor]
Length=377

 Score =   296 bits (759),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>gb|ADU52548.1| actin 2 [Morus alba]
Length=377

 Score =   296 bits (759),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GEE+QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEEIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>gb|AEZ51866.1| actin [Cymbidium ensifolium]
Length=377

 Score =   296 bits (759),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GEE+QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEEIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKA+REK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKASREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|XP_003569118.1| PREDICTED: actin-97 [Brachypodium distachyon]
 gb|AAN59956.1| actin [Hordeum vulgare]
 gb|AAW78911.1| actin [Triticum turgidum]
 gb|AAW78915.1| actin [Triticum aestivum]
 dbj|BAJ88055.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS61172.1| Actin-97 [Triticum urartu]
 gb|EMT15038.1| Actin-97 [Aegilops tauschii]
Length=377

 Score =   296 bits (759),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>dbj|BAB63635.1| putative actin [Oryza sativa Japonica Group]
 gb|EAY77344.1| hypothetical protein OsI_05327 [Oryza sativa Indica Group]
 gb|EAZ14938.1| hypothetical protein OsJ_04870 [Oryza sativa Japonica Group]
 dbj|BAH01694.1| unnamed protein product [Oryza sativa Japonica Group]
Length=377

 Score =   296 bits (759),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|XP_010937718.1| PREDICTED: actin-3 [Elaeis guineensis]
 ref|XP_010937719.1| PREDICTED: actin-3 [Elaeis guineensis]
Length=377

 Score =   296 bits (759),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>gb|AHE41423.1| actin [Lycium chinense]
Length=377

 Score =   296 bits (759),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|XP_004960554.1| PREDICTED: actin-97-like [Setaria italica]
Length=377

 Score =   296 bits (759),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|NP_001054419.1| Os05g0106600 [Oryza sativa Japonica Group]
 gb|AAU44177.1| putative actin [Oryza sativa Japonica Group]
 dbj|BAF16333.1| Os05g0106600 [Oryza sativa Japonica Group]
 dbj|BAG88048.1| unnamed protein product [Oryza sativa Japonica Group]
Length=377

 Score =   296 bits (759),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>gb|AAK82991.1|AF285176_1 actin [Musa ABB Group]
Length=377

 Score =   296 bits (759),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>emb|CDP10143.1| unnamed protein product [Coffea canephora]
Length=377

 Score =   296 bits (759),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GEE+QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEEIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>ref|NP_001267747.1| uncharacterized protein LOC101779009 [Setaria italica]
 gb|AAG10041.1|AF288226_1 actin [Setaria italica]
Length=377

 Score =   296 bits (759),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|XP_006351346.1| PREDICTED: actin-58-like [Solanum tuberosum]
 ref|XP_010312150.1| PREDICTED: actin-66 [Solanum lycopersicum]
 ref|XP_010312151.1| PREDICTED: actin-66 [Solanum lycopersicum]
Length=377

 Score =   296 bits (759),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAEGE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>ref|XP_006345961.1| PREDICTED: actin-58-like [Solanum tuberosum]
Length=377

 Score =   296 bits (759),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAEGE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>ref|XP_004239790.1| PREDICTED: actin-58 [Solanum lycopersicum]
Length=377

 Score =   296 bits (759),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAEGE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>gb|AFZ78525.1| actin [Populus tomentosa]
Length=269

 Score =   293 bits (749),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+ E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>ref|XP_010111138.1| hypothetical protein L484_010751 [Morus notabilis]
 gb|AGT97389.1| actin [Morus alba]
 gb|EXC30503.1| hypothetical protein L484_010751 [Morus notabilis]
Length=377

 Score =   296 bits (759),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GEE+QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEEIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>ref|XP_006287952.1| hypothetical protein CARUB_v10001188mg [Capsella rubella]
 ref|XP_006399463.1| hypothetical protein EUTSA_v10013834mg [Eutrema salsugineum]
 ref|XP_006399464.1| hypothetical protein EUTSA_v10013834mg [Eutrema salsugineum]
 ref|XP_010422938.1| PREDICTED: actin-7 [Camelina sativa]
 ref|XP_010452982.1| PREDICTED: actin-7 [Camelina sativa]
 ref|XP_010491624.1| PREDICTED: actin-7 [Camelina sativa]
 dbj|BAJ34498.1| unnamed protein product [Thellungiella halophila]
 gb|EOA20850.1| hypothetical protein CARUB_v10001188mg [Capsella rubella]
 gb|ESQ40916.1| hypothetical protein EUTSA_v10013834mg [Eutrema salsugineum]
 gb|ESQ40917.1| hypothetical protein EUTSA_v10013834mg [Eutrema salsugineum]
 gb|AJG03098.1| actin [Orychophragmus violaceus]
 gb|AJG03100.1| actin [Brassica napus]
Length=377

 Score =   296 bits (759),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|XP_003602545.1| Actin [Medicago truncatula]
Length=382

 Score =   296 bits (759),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/148 (94%), Positives = 143/148 (97%), Gaps = 0/148 (0%)
 Frame = +1

Query  70   KMAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDE  249
            KMA+ E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDE
Sbjct  5    KMADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDE  64

Query  250  AQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANRE  429
            AQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANRE
Sbjct  65   AQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE  124

Query  430  KMTQIMFETFNVPAMYVAIXAVLSLYAS  513
            KMTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  125  KMTQIMFETFNVPAMYVAIQAVLSLYAS  152



>ref|XP_009125344.1| PREDICTED: actin-7 [Brassica rapa]
 ref|XP_009125345.1| PREDICTED: actin-7 [Brassica rapa]
Length=377

 Score =   296 bits (759),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>gb|AEN25580.1| actin 7 [Brassica rapa subsp. pekinensis]
 emb|CDY21607.1| BnaC09g46850D [Brassica napus]
 emb|CDX69885.1| BnaA10g22340D [Brassica napus]
Length=377

 Score =   296 bits (759),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>dbj|BAJ96385.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93412.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=377

 Score =   296 bits (759),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>gb|ADU52545.1| actin 2 [Morus alba]
Length=377

 Score =   296 bits (759),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GEE+QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEEIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>ref|XP_009406076.1| PREDICTED: actin-3 [Musa acuminata subsp. malaccensis]
Length=377

 Score =   296 bits (759),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|NP_001065830.1| Os11g0163100 [Oryza sativa Japonica Group]
 ref|XP_006662759.1| PREDICTED: actin-7-like [Oryza brachyantha]
 gb|AAO62546.1| actin [Oryza sativa Japonica Group]
 gb|AAX95098.1| actin [Oryza sativa Japonica Group]
 gb|AAX95099.1| actin [Oryza sativa Japonica Group]
 gb|AAX95100.1| actin [Oryza sativa Japonica Group]
 gb|ABA91666.1| Actin-7, putative, expressed [Oryza sativa Japonica Group]
 gb|ABA91667.1| Actin-7, putative, expressed [Oryza sativa Japonica Group]
 gb|ABA91668.1| Actin-7, putative, expressed [Oryza sativa Japonica Group]
 gb|ABG22379.1| Actin-7, putative, expressed [Oryza sativa Japonica Group]
 gb|ABG22380.1| Actin-7, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF27675.1| Os11g0163100 [Oryza sativa Japonica Group]
 dbj|BAG87600.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC67736.1| hypothetical protein OsI_35242 [Oryza sativa Indica Group]
 gb|EEE51698.1| hypothetical protein OsJ_33069 [Oryza sativa Japonica Group]
Length=377

 Score =   296 bits (759),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|XP_004978759.1| PREDICTED: actin-7-like [Setaria italica]
Length=377

 Score =   296 bits (759),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|XP_011075141.1| PREDICTED: actin-97-like [Sesamum indicum]
Length=377

 Score =   296 bits (759),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAEGE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH +LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>gb|ADY68784.1| actin [Gossypium herbaceum subsp. africanum]
Length=377

 Score =   296 bits (759),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>gb|ABS11262.1| actin [Musa acuminata AAA Group]
Length=377

 Score =   296 bits (759),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>gb|KDO53391.1| hypothetical protein CISIN_1g037845mg [Citrus sinensis]
Length=314

 Score =   294 bits (753),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+ E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>emb|CEL26645.1| Actin1, partial [Ribes nigrum]
Length=156

 Score =   288 bits (738),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+ E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGD A
Sbjct  1    MADSEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDGA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|XP_004971371.1| PREDICTED: actin-7-like isoform X4 [Setaria italica]
 gb|ADB80031.1| beta-actin [Zoysia japonica]
 gb|ADB80032.1| beta-actin [Zoysia japonica]
Length=377

 Score =   296 bits (759),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|XP_004235068.1| PREDICTED: actin-7 [Solanum lycopersicum]
 ref|XP_006355138.1| PREDICTED: actin-7-like [Solanum tuberosum]
 ref|XP_009614631.1| PREDICTED: actin-7 [Nicotiana tomentosiformis]
 ref|XP_009760363.1| PREDICTED: actin-7 [Nicotiana sylvestris]
Length=377

 Score =   296 bits (759),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|XP_009599876.1| PREDICTED: actin-7-like [Nicotiana tomentosiformis]
 ref|XP_009795801.1| PREDICTED: actin-7 [Nicotiana sylvestris]
Length=377

 Score =   296 bits (759),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>gb|AAP73456.1| actin [Gossypium hirsutum]
Length=377

 Score =   296 bits (759),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>gb|EEE62039.1| hypothetical protein OsJ_16821 [Oryza sativa Japonica Group]
Length=389

 Score =   297 bits (760),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/148 (94%), Positives = 144/148 (97%), Gaps = 0/148 (0%)
 Frame = +1

Query  70   KMAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDE  249
            +MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDE
Sbjct  12   EMADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDE  71

Query  250  AQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANRE  429
            AQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANRE
Sbjct  72   AQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE  131

Query  430  KMTQIMFETFNVPAMYVAIXAVLSLYAS  513
            KMTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  132  KMTQIMFETFNVPAMYVAIQAVLSLYAS  159



>ref|XP_010690498.1| PREDICTED: actin-1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010690505.1| PREDICTED: actin-1 [Beta vulgaris subsp. vulgaris]
Length=377

 Score =   296 bits (758),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAEGE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYAS  147



>gb|AGV75926.1| actin [Gossypium hirsutum]
Length=377

 Score =   296 bits (758),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>gb|ACJ04737.1| actin [Sedum alfredii]
Length=377

 Score =   296 bits (758),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGI+SNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIISNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>gb|AEN70754.1| actin 1 [Gossypium darwinii]
Length=377

 Score =   296 bits (758),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|XP_008665584.1| PREDICTED: actin isoform X1 [Zea mays]
Length=189

 Score =   290 bits (741),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 136/147 (93%), Positives = 140/147 (95%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+ E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI  VLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQTVLSLYAS  147



>gb|AJG03099.1| actin [Brassica juncea]
Length=377

 Score =   296 bits (758),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|NP_001150248.1| LOC100283878 [Zea mays]
 ref|XP_008677313.1| PREDICTED: LOC100283878 isoform X1 [Zea mays]
 gb|ACF84721.1| unknown [Zea mays]
 gb|ACG38362.1| actin-7 [Zea mays]
 gb|ACG41397.1| actin-7 [Zea mays]
 gb|AFW65614.1| putative actin family protein isoform 1 [Zea mays]
 gb|AFW65615.1| putative actin family protein isoform 2 [Zea mays]
 gb|AFW65616.1| putative actin family protein isoform 3 [Zea mays]
Length=377

 Score =   296 bits (758),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>gb|AAP73449.1| actin [Gossypium hirsutum]
 gb|ADY68785.1| actin [Gossypium raimondii]
 gb|ADY68786.1| actin [Gossypium barbadense]
 gb|ADY68787.1| actin [Gossypium barbadense]
 gb|ADY68788.1| actin [Gossypium hirsutum]
 gb|ADY68789.1| actin [Gossypium hirsutum]
 gb|AEN70748.1| actin 1 [Gossypium laxum]
 gb|AEN70749.1| actin 1 [Gossypium schwendimanii]
 gb|AEN70750.1| actin 1 [Gossypium turneri]
 gb|AEN70751.1| actin 1 [Gossypium mustelinum]
 gb|AEN70752.1| actin 1 [Gossypium mustelinum]
 gb|AEN70755.1| actin 1 [Gossypium tomentosum]
 gb|AEN70756.1| actin 1 [Gossypium tomentosum]
 gb|AEN70760.1| actin 1 [Gossypium barbadense var. peruvianum]
 gb|AEN70761.1| actin 1 [Gossypium hirsutum subsp. latifolium]
 gb|AEN70762.1| actin 1 [Gossypium hirsutum subsp. latifolium]
 gb|AEN70763.1| actin 1 [Gossypium armourianum]
 gb|AEN70764.1| actin 1 [Gossypium harknessii]
 gb|AEN70765.1| actin 1 [Gossypium davidsonii]
 gb|AEN70766.1| actin 1 [Gossypium klotzschianum]
 gb|AEN70767.1| actin 1 [Gossypium aridum]
 gb|AEN70768.1| actin 1 [Gossypium gossypioides]
 gb|AEN70769.1| actin 1 [Gossypium lobatum]
 gb|AEN70770.1| actin 1 [Gossypium trilobum]
 gb|KJB40442.1| hypothetical protein B456_007G063600 [Gossypium raimondii]
 gb|KJB40443.1| hypothetical protein B456_007G063600 [Gossypium raimondii]
 gb|KJB40444.1| hypothetical protein B456_007G063600 [Gossypium raimondii]
Length=377

 Score =   296 bits (758),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>gb|KHG18648.1| Actin-58 [Gossypium arboreum]
Length=377

 Score =   296 bits (758),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAEGE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYAS  147



>gb|AGV75927.1| actin [Gossypium hirsutum]
Length=377

 Score =   296 bits (758),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHAGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|XP_004249866.1| PREDICTED: actin-7-like [Solanum lycopersicum]
 ref|XP_006351025.1| PREDICTED: actin-7-like [Solanum tuberosum]
Length=377

 Score =   296 bits (758),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>gb|KJB76085.1| hypothetical protein B456_012G070300 [Gossypium raimondii]
 gb|KJB76086.1| hypothetical protein B456_012G070300 [Gossypium raimondii]
 gb|KJB76089.1| hypothetical protein B456_012G070300 [Gossypium raimondii]
 gb|KJB76090.1| hypothetical protein B456_012G070300 [Gossypium raimondii]
Length=377

 Score =   296 bits (758),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAEGE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYAS  147



>ref|XP_006846523.1| hypothetical protein AMTR_s00018p00188200 [Amborella trichopoda]
 gb|ERN08198.1| hypothetical protein AMTR_s00018p00188200 [Amborella trichopoda]
Length=377

 Score =   296 bits (758),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAE E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAESEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>gb|AAP73458.1| actin [Gossypium hirsutum]
Length=377

 Score =   296 bits (758),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|XP_006854536.1| hypothetical protein AMTR_s00030p00045700 [Amborella trichopoda]
 gb|ERN16003.1| hypothetical protein AMTR_s00030p00045700 [Amborella trichopoda]
Length=377

 Score =   296 bits (758),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAE E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAEAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>gb|AFL70161.1| actin [Agastache rugosa]
Length=377

 Score =   296 bits (758),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRV P+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVGPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|XP_009416898.1| PREDICTED: actin-3 [Musa acuminata subsp. malaccensis]
Length=377

 Score =   296 bits (758),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH +LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>gb|AGN95065.1| putative actin-7-like protein [Physaria fendleri]
Length=377

 Score =   296 bits (758),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|XP_004156708.1| PREDICTED: actin-97-like [Cucumis sativus]
Length=382

 Score =   296 bits (758),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 138/148 (93%), Positives = 142/148 (96%), Gaps = 0/148 (0%)
 Frame = +1

Query  70   KMAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDE  249
            KMA+ E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDE
Sbjct  5    KMADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDE  64

Query  250  AQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANRE  429
            AQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANRE
Sbjct  65   AQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE  124

Query  430  KMTQIMFETFNVPAMYVAIXAVLSLYAS  513
            KMTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  125  KMTQIMFETFNTPAMYVAIQAVLSLYAS  152



>ref|XP_006855625.1| hypothetical protein AMTR_s00044p00088410 [Amborella trichopoda]
 gb|ERN17092.1| hypothetical protein AMTR_s00044p00088410 [Amborella trichopoda]
Length=398

 Score =   296 bits (759),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/148 (94%), Positives = 142/148 (96%), Gaps = 0/148 (0%)
 Frame = +1

Query  70   KMAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDE  249
            KMAE E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDE
Sbjct  21   KMAETEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDE  80

Query  250  AQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANRE  429
            AQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANRE
Sbjct  81   AQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE  140

Query  430  KMTQIMFETFNVPAMYVAIXAVLSLYAS  513
            KMTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  141  KMTQIMFETFNTPAMYVAIQAVLSLYAS  168



>emb|CDX87810.1| BnaC06g08720D [Brassica napus]
Length=377

 Score =   296 bits (757),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAE EE+QPLVVDNGTGMVKAGFAGDDAPRAVFPSI+GRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAEAEEIQPLVVDNGTGMVKAGFAGDDAPRAVFPSIIGRPRHAGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETF+VPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFDVPAMYVAIQAVLSLYAS  147



>gb|KJB75201.1| hypothetical protein B456_012G030500 [Gossypium raimondii]
Length=371

 Score =   296 bits (757),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+ EE+QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADTEEIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|XP_008665585.1| PREDICTED: actin-1 isoform X2 [Zea mays]
Length=182

 Score =   289 bits (739),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 136/147 (93%), Positives = 140/147 (95%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+ E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI  VLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQTVLSLYAS  147



>gb|ADX97326.1| actin 9 [Mangifera indica]
Length=377

 Score =   296 bits (757),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+ EE+QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADSEEIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|XP_010671378.1| PREDICTED: actin-7 [Beta vulgaris subsp. vulgaris]
 gb|ADX01226.1| actin 1 [Celosia argentea]
 gb|AET43294.1| actin [Beta vulgaris]
Length=377

 Score =   296 bits (757),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+ EE+QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADAEEIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>gb|AGI15325.1| actin 1 [Dionaea muscipula]
Length=377

 Score =   296 bits (757),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+ EE+QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADAEEIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>dbj|BAK06400.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=377

 Score =   296 bits (757),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>ref|XP_002283590.1| PREDICTED: actin-1 [Vitis vinifera]
 ref|XP_010658578.1| PREDICTED: actin-1 [Vitis vinifera]
 ref|XP_010658579.1| PREDICTED: actin-1 [Vitis vinifera]
 ref|XP_010658580.1| PREDICTED: actin-1 [Vitis vinifera]
 emb|CAN83697.1| hypothetical protein VITISV_027542 [Vitis vinifera]
 emb|CBI31677.3| unnamed protein product [Vitis vinifera]
Length=377

 Score =   296 bits (757),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE+VQPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDVQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>sp|P30171.1|ACT11_SOLTU RecName: Full=Actin-97 [Solanum tuberosum]
 emb|CAA39280.1| actin [Solanum tuberosum]
Length=377

 Score =   296 bits (757),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHSGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>ref|XP_001783657.1| predicted protein [Physcomitrella patens]
 gb|EDQ51552.1| predicted protein [Physcomitrella patens]
Length=377

 Score =   296 bits (757),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GEEVQPLV DNG+GMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEEVQPLVCDNGSGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHG+V+NWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGVVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|XP_007145688.1| hypothetical protein PHAVU_007G260000g [Phaseolus vulgaris]
 ref|XP_007145689.1| hypothetical protein PHAVU_007G260000g [Phaseolus vulgaris]
 gb|ESW17682.1| hypothetical protein PHAVU_007G260000g [Phaseolus vulgaris]
 gb|ESW17683.1| hypothetical protein PHAVU_007G260000g [Phaseolus vulgaris]
Length=377

 Score =   295 bits (756),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>ref|XP_003575839.1| PREDICTED: actin-1-like [Brachypodium distachyon]
 gb|ACO87663.1| actin [Brachypodium sylvaticum]
Length=377

 Score =   295 bits (756),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>gb|AFJ04513.1| actin7a, partial [Vernicia fordii]
Length=356

 Score =   295 bits (755),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+ E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>gb|AFZ78523.1| actin [Populus tomentosa]
Length=377

 Score =   295 bits (756),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAE E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAESEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>ref|XP_009802880.1| PREDICTED: actin-like [Nicotiana sylvestris]
 ref|XP_009802881.1| PREDICTED: actin-like [Nicotiana sylvestris]
Length=377

 Score =   295 bits (756),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>dbj|BAJ07368.1| actin [Hydatigera taeniaeformis]
Length=168

 Score =   288 bits (737),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 135/147 (92%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            M+EGEE+  LVVDNG+GM KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD+YVGDEA
Sbjct  1    MSEGEEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNCPAMYVAIQAVLSLYAS  147



>gb|ACZ04921.1| actin 7-like protein [Pelargonium x hortorum]
Length=377

 Score =   295 bits (756),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAEGE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPA YVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAXYVAIQAVLSLYAS  147



>ref|XP_006350765.1| PREDICTED: actin-like [Solanum tuberosum]
Length=377

 Score =   295 bits (756),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>emb|CBI29476.3| unnamed protein product [Vitis vinifera]
Length=288

 Score =   292 bits (748),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+ E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|XP_003547582.1| PREDICTED: actin-101-like [Glycine max]
 ref|XP_003593122.1| Actin [Medicago truncatula]
 ref|XP_007148449.1| hypothetical protein PHAVU_006G209800g [Phaseolus vulgaris]
 ref|XP_007148450.1| hypothetical protein PHAVU_006G209900g [Phaseolus vulgaris]
 gb|AES63373.1| actin-related protein 4A [Medicago truncatula]
 gb|ESW20443.1| hypothetical protein PHAVU_006G209800g [Phaseolus vulgaris]
 gb|ESW20444.1| hypothetical protein PHAVU_006G209900g [Phaseolus vulgaris]
 gb|KHN33491.1| Actin-101 [Glycine soja]
Length=377

 Score =   295 bits (756),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+ E++QPLVVDNGTGMVKAGFAGDDAPRAVFPSI+GRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVVDNGTGMVKAGFAGDDAPRAVFPSIIGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|XP_009397437.1| PREDICTED: actin-like [Musa acuminata subsp. malaccensis]
 ref|XP_009397438.1| PREDICTED: actin-like [Musa acuminata subsp. malaccensis]
Length=377

 Score =   295 bits (756),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAEGE+VQPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDVQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAP+EH +LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYAS  147



>ref|XP_009625006.1| PREDICTED: actin-like [Nicotiana tomentosiformis]
 ref|XP_009625007.1| PREDICTED: actin-like [Nicotiana tomentosiformis]
Length=377

 Score =   295 bits (756),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>ref|XP_007132070.1| hypothetical protein PHAVU_011G064500g [Phaseolus vulgaris]
 gb|AGV54653.1| actin [Phaseolus vulgaris]
 gb|ESW04064.1| hypothetical protein PHAVU_011G064500g [Phaseolus vulgaris]
Length=377

 Score =   295 bits (756),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>ref|XP_004236747.1| PREDICTED: actin-97 [Solanum lycopersicum]
Length=377

 Score =   295 bits (756),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>ref|XP_004230564.1| PREDICTED: actin-101 [Solanum lycopersicum]
 ref|XP_010315037.1| PREDICTED: actin-101 [Solanum lycopersicum]
 ref|XP_010315039.1| PREDICTED: actin-101 [Solanum lycopersicum]
 ref|XP_010315043.1| PREDICTED: actin-101 [Solanum lycopersicum]
Length=377

 Score =   295 bits (756),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+ E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRV+PDEH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVSPDEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|XP_004485534.1| PREDICTED: actin-101-like [Cicer arietinum]
Length=377

 Score =   295 bits (756),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+ E++QPLVVDNGTGMVKAGFAGDDAPRAVFPSI+GRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVVDNGTGMVKAGFAGDDAPRAVFPSIIGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|XP_004241231.1| PREDICTED: actin-82 [Solanum lycopersicum]
Length=377

 Score =   295 bits (756),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>gb|AAP73454.1| actin [Gossypium hirsutum]
Length=377

 Score =   295 bits (756),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+ EE+QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADTEEIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>sp|Q05214.1|ACT1_TOBAC RecName: Full=Actin [Nicotiana tabacum]
 emb|CAA45149.1| actin [Nicotiana tabacum]
Length=377

 Score =   295 bits (756),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>ref|XP_002530711.1| actin, putative [Ricinus communis]
 gb|EEF31665.1| actin, putative [Ricinus communis]
Length=377

 Score =   295 bits (756),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>ref|XP_009773924.1| PREDICTED: actin [Nicotiana sylvestris]
 ref|XP_009773925.1| PREDICTED: actin [Nicotiana sylvestris]
Length=377

 Score =   295 bits (756),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>ref|XP_011004375.1| PREDICTED: actin-7-like isoform X1 [Populus euphratica]
 ref|XP_011004376.1| PREDICTED: actin-7-like isoform X1 [Populus euphratica]
Length=377

 Score =   295 bits (756),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+ EE+QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADDEEIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>gb|AHA84238.1| actin [Phaseolus vulgaris]
Length=377

 Score =   295 bits (756),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>ref|XP_007016432.1| Actin-11 isoform 1 [Theobroma cacao]
 ref|XP_007016433.1| Actin-11 isoform 1 [Theobroma cacao]
 gb|EOY34051.1| Actin-11 isoform 1 [Theobroma cacao]
 gb|EOY34052.1| Actin-11 isoform 1 [Theobroma cacao]
Length=377

 Score =   295 bits (756),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>emb|CAJ44725.1| actin [Capsicum chinense]
Length=291

 Score =   292 bits (748),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 136/147 (93%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            +A+ E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    LADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>ref|XP_006359829.1| PREDICTED: actin-like [Solanum tuberosum]
Length=383

 Score =   295 bits (756),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 137/148 (93%), Positives = 144/148 (97%), Gaps = 0/148 (0%)
 Frame = +1

Query  70   KMAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDE  249
            KMA+GE++QPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPR+ GVMVGMGQKDAYVGDE
Sbjct  6    KMADGEDIQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRYTGVMVGMGQKDAYVGDE  65

Query  250  AQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANRE  429
            AQSKRGILTLKYPI HGIV NWDDMEKIWHHTFYNELRVAP+EHS+LLTEAPLNPKANRE
Sbjct  66   AQSKRGILTLKYPIRHGIVDNWDDMEKIWHHTFYNELRVAPEEHSILLTEAPLNPKANRE  125

Query  430  KMTQIMFETFNVPAMYVAIXAVLSLYAS  513
            KMTQIMFETFNVPAMY+AI AVLSLYAS
Sbjct  126  KMTQIMFETFNVPAMYIAIQAVLSLYAS  153



>ref|XP_006351818.1| PREDICTED: actin-101-like [Solanum tuberosum]
Length=377

 Score =   295 bits (756),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+ E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRV+PDEH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVSPDEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|XP_009618901.1| PREDICTED: actin [Nicotiana tomentosiformis]
 ref|XP_009618902.1| PREDICTED: actin [Nicotiana tomentosiformis]
Length=377

 Score =   295 bits (756),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>ref|XP_003539675.1| PREDICTED: actin-like isoform X1 [Glycine max]
 ref|XP_006592200.1| PREDICTED: actin-like isoform X2 [Glycine max]
Length=377

 Score =   295 bits (756),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>gb|KHN26715.1| Actin-101 [Glycine soja]
Length=377

 Score =   295 bits (756),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+ E++QPLVVDNGTGMVKAGFAGDDAPRAVFPSI+GRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVVDNGTGMVKAGFAGDDAPRAVFPSIIGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|XP_003531566.1| PREDICTED: actin-101 [Glycine max]
Length=377

 Score =   295 bits (756),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+ E++QPLVVDNGTGMVKAGFAGDDAPRAVFPSI+GRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVVDNGTGMVKAGFAGDDAPRAVFPSIIGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|XP_006858216.1| hypothetical protein AMTR_s00062p00184900 [Amborella trichopoda]
 gb|ERN19683.1| hypothetical protein AMTR_s00062p00184900 [Amborella trichopoda]
Length=377

 Score =   295 bits (756),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>ref|XP_003537995.1| PREDICTED: actin-like isoform X1 [Glycine max]
 ref|XP_006590987.1| PREDICTED: actin-like isoform X2 [Glycine max]
 gb|KHN21957.1| Actin-97 [Glycine soja]
Length=377

 Score =   295 bits (756),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>gb|ADN88106.1| actin 1 [Guzmania wittmackii x Guzmania lingulata]
Length=377

 Score =   295 bits (756),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>gb|EPS60057.1| hypothetical protein M569_14747 [Genlisea aurea]
Length=377

 Score =   295 bits (756),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYAS  147



>ref|XP_004981971.1| PREDICTED: actin-1-like isoform X2 [Setaria italica]
Length=382

 Score =   295 bits (756),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/148 (93%), Positives = 142/148 (96%), Gaps = 0/148 (0%)
 Frame = +1

Query  70   KMAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDE  249
            KMA+ E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDE
Sbjct  5    KMADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDE  64

Query  250  AQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANRE  429
            AQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANRE
Sbjct  65   AQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE  124

Query  430  KMTQIMFETFNVPAMYVAIXAVLSLYAS  513
            KMTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  125  KMTQIMFETFNTPAMYVAIQAVLSLYAS  152



>gb|ACH69153.1| actin [Nicotiana tabacum]
Length=377

 Score =   295 bits (755),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>ref|XP_009773019.1| PREDICTED: actin-97 [Nicotiana sylvestris]
Length=377

 Score =   295 bits (755),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>gb|AAP73462.1| actin [Gossypium hirsutum]
Length=377

 Score =   295 bits (755),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+ EE+QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADTEEIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|XP_004497894.1| PREDICTED: actin-like [Cicer arietinum]
Length=377

 Score =   295 bits (755),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>ref|XP_006297921.1| hypothetical protein CARUB_v10013962mg [Capsella rubella]
 gb|EOA30819.1| hypothetical protein CARUB_v10013962mg [Capsella rubella]
Length=377

 Score =   295 bits (755),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>ref|XP_009587904.1| PREDICTED: actin-97-like [Nicotiana tomentosiformis]
Length=377

 Score =   295 bits (755),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>ref|XP_009410069.1| PREDICTED: actin [Musa acuminata subsp. malaccensis]
Length=377

 Score =   295 bits (755),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYAS  147



>ref|XP_002316289.1| actin family protein [Populus trichocarpa]
 ref|XP_011027194.1| PREDICTED: actin-97-like [Populus euphratica]
 ref|XP_011027195.1| PREDICTED: actin-97-like [Populus euphratica]
 gb|ABK92513.1| unknown [Populus trichocarpa]
 gb|EEF02460.1| actin family protein [Populus trichocarpa]
Length=377

 Score =   295 bits (755),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAE E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAEAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>gb|KHF99045.1| Actin-7 -like protein [Gossypium arboreum]
 gb|KJB75198.1| hypothetical protein B456_012G030500 [Gossypium raimondii]
 gb|KJB75199.1| hypothetical protein B456_012G030500 [Gossypium raimondii]
 gb|KJB75200.1| hypothetical protein B456_012G030500 [Gossypium raimondii]
Length=377

 Score =   295 bits (755),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+ EE+QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADTEEIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|XP_010257475.1| PREDICTED: actin [Nelumbo nucifera]
 ref|XP_010257476.1| PREDICTED: actin [Nelumbo nucifera]
Length=377

 Score =   295 bits (755),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAEGE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>ref|XP_009381444.1| PREDICTED: actin-like [Musa acuminata subsp. malaccensis]
Length=377

 Score =   295 bits (755),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYAS  147



>ref|XP_008355144.1| PREDICTED: actin [Malus domestica]
Length=377

 Score =   295 bits (755),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAE E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAEAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>ref|XP_006435988.1| hypothetical protein CICLE_v10031847mg [Citrus clementina]
 ref|XP_006435989.1| hypothetical protein CICLE_v10031847mg [Citrus clementina]
 ref|XP_006486101.1| PREDICTED: actin-like isoform X1 [Citrus sinensis]
 ref|XP_006486102.1| PREDICTED: actin-like isoform X2 [Citrus sinensis]
 gb|ESR49228.1| hypothetical protein CICLE_v10031847mg [Citrus clementina]
 gb|ESR49229.1| hypothetical protein CICLE_v10031847mg [Citrus clementina]
Length=377

 Score =   295 bits (755),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYAS  147



>emb|CBI30014.3| unnamed protein product [Vitis vinifera]
Length=289

 Score =   292 bits (747),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAE E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAETEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>gb|KJB76088.1| hypothetical protein B456_012G070300 [Gossypium raimondii]
Length=434

 Score =   297 bits (760),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAEGE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYAS  147



>ref|XP_007009347.1| Actin-11 isoform 2 [Theobroma cacao]
 gb|EOY18157.1| Actin-11 isoform 2 [Theobroma cacao]
Length=380

 Score =   295 bits (755),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAE E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAEAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>ref|XP_002882767.1| actin-11 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59026.1| actin-11 [Arabidopsis lyrata subsp. lyrata]
Length=377

 Score =   295 bits (755),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>ref|XP_004294508.1| PREDICTED: actin-1 [Fragaria vesca subsp. vesca]
Length=377

 Score =   295 bits (755),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAE E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAEAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>emb|CDY01102.1| BnaC05g40980D [Brassica napus]
Length=377

 Score =   295 bits (755),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>gb|AHA84217.1| actin-101-like [Phaseolus vulgaris]
Length=377

 Score =   295 bits (755),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+ E++QPLVVDNGTGMVKAGFAGDDAPRAVFPSI+GRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVVDNGTGMVKAGFAGDDAPRAVFPSIIGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>gb|EMT00396.1| Actin-3 [Aegilops tauschii]
Length=377

 Score =   295 bits (755),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYAS  147



>gb|ACJ83274.1| unknown [Medicago truncatula]
Length=184

 Score =   288 bits (737),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 136/147 (93%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+ E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            +TQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  VTQIMFETFNTPAMYVAIQAVLSLYAS  147



>ref|XP_007204362.1| hypothetical protein PRUPE_ppa007228mg [Prunus persica]
 ref|XP_008240928.1| PREDICTED: actin-like [Prunus mume]
 ref|XP_008240929.1| PREDICTED: actin-like [Prunus mume]
 ref|XP_008392069.1| PREDICTED: actin-like [Malus domestica]
 ref|XP_008360627.1| PREDICTED: actin [Malus domestica]
 gb|EMJ05561.1| hypothetical protein PRUPE_ppa007228mg [Prunus persica]
Length=377

 Score =   295 bits (755),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAE E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAESEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>ref|XP_007027035.1| Actin 3 [Theobroma cacao]
 gb|EOY07537.1| Actin 3 [Theobroma cacao]
Length=377

 Score =   295 bits (755),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYAS  147



>ref|XP_010036489.1| PREDICTED: actin [Eucalyptus grandis]
 gb|KCW48106.1| hypothetical protein EUGRSUZ_K01841 [Eucalyptus grandis]
Length=377

 Score =   295 bits (755),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAE E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAESEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>ref|XP_002308365.1| actin family protein [Populus trichocarpa]
 ref|XP_002322664.1| actin family protein [Populus trichocarpa]
 ref|XP_011033209.1| PREDICTED: actin [Populus euphratica]
 ref|XP_011004840.1| PREDICTED: actin [Populus euphratica]
 ref|XP_011013244.1| PREDICTED: actin [Populus euphratica]
 gb|ABK92789.1| unknown [Populus trichocarpa]
 gb|ABK93722.1| unknown [Populus trichocarpa]
 gb|ABK95521.1| unknown [Populus trichocarpa]
 gb|EEE91888.1| actin family protein [Populus trichocarpa]
 gb|EEF04425.1| actin family protein [Populus trichocarpa]
 gb|ADK70741.1| actin [Populus tomentosa]
 gb|ADK70742.1| actin [Populus tomentosa]
 gb|ADK70743.1| actin [Populus tomentosa]
 gb|ADK70744.1| actin [Populus tomentosa]
 gb|ADK70745.1| actin [Populus tomentosa]
 gb|ADK70746.1| actin [Populus tomentosa]
 gb|ADK70747.1| actin [Populus tomentosa]
 gb|ADK70748.1| actin [Populus tomentosa]
 gb|ADK70749.1| actin [Populus tomentosa]
 gb|ADK70750.1| actin [Populus tomentosa]
 gb|ADK70751.1| actin [Populus tomentosa]
 gb|ADK70752.1| actin [Populus tomentosa]
 gb|ADK70753.1| actin [Populus tomentosa]
 gb|ADK70754.1| actin [Populus tomentosa]
 gb|ADK70755.1| actin [Populus tomentosa]
 gb|ADK70756.1| actin [Populus tomentosa]
 gb|ADK70757.1| actin [Populus tomentosa]
 gb|ADK70758.1| actin [Populus tomentosa]
 gb|ADK70759.1| actin [Populus tomentosa]
 gb|ADK70760.1| actin [Populus tomentosa]
 gb|ADK70761.1| actin [Populus tomentosa]
 gb|ADK70762.1| actin [Populus tomentosa]
 gb|ADK70763.1| actin [Populus tomentosa]
 gb|ADK70764.1| actin [Populus tomentosa]
 gb|ADK70765.1| actin [Populus tomentosa]
 gb|ADK70766.1| actin [Populus tomentosa]
 gb|ADK70767.1| actin [Populus tomentosa]
 gb|ADK70768.1| actin [Populus tomentosa]
 gb|ADK70769.1| actin [Populus tomentosa]
 gb|ADK70770.1| actin [Populus tomentosa]
 gb|ADK70771.1| actin [Populus tomentosa]
 gb|ADK70772.1| actin [Populus tomentosa]
 gb|ADK70773.1| actin [Populus tomentosa]
 gb|ADK70774.1| actin [Populus tomentosa]
 gb|ADK70775.1| actin [Populus tomentosa]
 gb|ADK70776.1| actin [Populus tomentosa]
 gb|ADK70777.1| actin [Populus tomentosa]
 gb|ADK70778.1| actin [Populus tomentosa]
 gb|ADK70779.1| actin [Populus tomentosa]
 gb|ADK70780.1| actin [Populus tomentosa]
 gb|ADK70781.1| actin [Populus tomentosa]
 gb|AFZ78524.1| actin [Populus tomentosa]
Length=377

 Score =   295 bits (755),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAE E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAESEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>emb|CDX79746.1| BnaC03g20820D [Brassica napus]
Length=372

 Score =   295 bits (754),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 137/148 (93%), Positives = 143/148 (97%), Gaps = 0/148 (0%)
 Frame = +1

Query  70   KMAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDE  249
            KMA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDE
Sbjct  20   KMADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDE  79

Query  250  AQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANRE  429
            AQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAP+EH +LLTEAPLNPKANRE
Sbjct  80   AQSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANRE  139

Query  430  KMTQIMFETFNVPAMYVAIXAVLSLYAS  513
            KMTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  140  KMTQIMFETFNAPAMYVAIQAVLSLYAS  167



>ref|XP_009146643.1| PREDICTED: actin-11 [Brassica rapa]
 ref|XP_009146646.1| PREDICTED: actin-11 [Brassica rapa]
Length=377

 Score =   295 bits (755),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>ref|XP_009600120.1| PREDICTED: actin-like [Nicotiana tomentosiformis]
Length=377

 Score =   295 bits (755),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>gb|KDO67622.1| hypothetical protein CISIN_1g017081mg [Citrus sinensis]
 gb|KDO67623.1| hypothetical protein CISIN_1g017081mg [Citrus sinensis]
 gb|KDO67624.1| hypothetical protein CISIN_1g017081mg [Citrus sinensis]
Length=377

 Score =   295 bits (755),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYAS  147



>ref|XP_006407369.1| hypothetical protein EUTSA_v10020950mg [Eutrema salsugineum]
 ref|XP_006407370.1| hypothetical protein EUTSA_v10020950mg [Eutrema salsugineum]
 gb|ESQ48822.1| hypothetical protein EUTSA_v10020950mg [Eutrema salsugineum]
 gb|ESQ48823.1| hypothetical protein EUTSA_v10020950mg [Eutrema salsugineum]
Length=377

 Score =   295 bits (755),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>gb|KDP24628.1| hypothetical protein JCGZ_25544 [Jatropha curcas]
Length=377

 Score =   295 bits (755),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAEGE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>ref|XP_010111359.1| hypothetical protein L484_028016 [Morus notabilis]
 gb|EXC30837.1| hypothetical protein L484_028016 [Morus notabilis]
 gb|AID16085.1| actin [Morus alba]
Length=377

 Score =   295 bits (755),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAE E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAESEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>ref|XP_007039275.1| Actin 7 isoform 1 [Theobroma cacao]
 ref|XP_007039276.1| Actin 7 isoform 1 [Theobroma cacao]
 gb|EOY23776.1| Actin 7 isoform 1 [Theobroma cacao]
 gb|EOY23777.1| Actin 7 isoform 1 [Theobroma cacao]
Length=377

 Score =   295 bits (755),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+ E++QPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADTEDIQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|NP_187818.1| actin-11 [Arabidopsis thaliana]
 sp|P53496.1|ACT11_ARATH RecName: Full=Actin-11 [Arabidopsis thaliana]
 gb|AAG51045.1|AC069473_7 actin 11 (ACT11); 24016-22523 [Arabidopsis thaliana]
 gb|AAB39404.1| actin-11 [Arabidopsis thaliana]
 dbj|BAB01959.1| actin 11 [Arabidopsis thaliana]
 gb|AAM65277.1| actin 11 (ACT11) [Arabidopsis thaliana]
 dbj|BAC42968.1| unknown protein [Arabidopsis thaliana]
 gb|AAO64013.1| putative actin 11 (ACT11) [Arabidopsis thaliana]
 gb|AEE75151.1| actin-11 [Arabidopsis thaliana]
Length=377

 Score =   295 bits (755),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>gb|AFZ78526.1| actin [Populus tomentosa]
Length=377

 Score =   295 bits (755),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAE E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAEAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>ref|NP_001159156.1| putative actin family protein [Zea mays]
 gb|ACN25249.1| unknown [Zea mays]
 tpg|DAA39086.1| TPA: putative actin family protein [Zea mays]
Length=377

 Score =   295 bits (755),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|XP_009787806.1| PREDICTED: actin-like [Nicotiana sylvestris]
 ref|XP_009787807.1| PREDICTED: actin-like [Nicotiana sylvestris]
 ref|XP_009787808.1| PREDICTED: actin-like [Nicotiana sylvestris]
Length=377

 Score =   295 bits (755),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>gb|ADK20401.1| actin [Citrus maxima]
Length=377

 Score =   295 bits (755),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAE E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAEAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>dbj|BAL14664.1| actin [Chrysanthemum seticuspe f. boreale]
Length=377

 Score =   295 bits (755),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYAS  147



>gb|ACP19072.1| actin 1 [Picea abies]
Length=377

 Score =   295 bits (755),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+ E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|XP_003562930.1| PREDICTED: actin-3 [Brachypodium distachyon]
Length=377

 Score =   295 bits (755),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYAS  147



>ref|XP_010498525.1| PREDICTED: actin-11 [Camelina sativa]
 ref|XP_010464961.1| PREDICTED: actin-11 [Camelina sativa]
 ref|XP_010486900.1| PREDICTED: actin-11 [Camelina sativa]
Length=377

 Score =   295 bits (755),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>ref|XP_008793942.1| PREDICTED: actin-2-like [Phoenix dactylifera]
Length=377

 Score =   295 bits (755),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAE E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAEAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|XP_009407474.1| PREDICTED: actin-7-like [Musa acuminata subsp. malaccensis]
Length=377

 Score =   295 bits (755),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH +LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFE+FNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFESFNVPAMYVAIQAVLSLYAS  147



>gb|KJB76649.1| hypothetical protein B456_012G100700 [Gossypium raimondii]
Length=372

 Score =   295 bits (754),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAE E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAENEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYAS  147



>ref|XP_010927382.1| PREDICTED: actin-2 [Elaeis guineensis]
Length=377

 Score =   295 bits (755),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAE E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAEAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|XP_009403146.1| PREDICTED: actin [Musa acuminata subsp. malaccensis]
Length=377

 Score =   295 bits (755),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYAS  147



>ref|XP_009388742.1| PREDICTED: actin-like [Musa acuminata subsp. malaccensis]
 ref|XP_009388743.1| PREDICTED: actin-like [Musa acuminata subsp. malaccensis]
Length=377

 Score =   295 bits (755),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAEGE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAP+EH +LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYAS  147



>ref|XP_008354115.1| PREDICTED: actin-1 [Malus domestica]
 ref|XP_008354116.1| PREDICTED: actin-1 [Malus domestica]
 ref|XP_009343424.1| PREDICTED: actin-1 [Pyrus x bretschneideri]
Length=377

 Score =   295 bits (754),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAE E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAEAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>ref|XP_004309498.1| PREDICTED: actin-7-like [Fragaria vesca subsp. vesca]
 ref|XP_011470856.1| PREDICTED: actin-7-like [Fragaria vesca subsp. vesca]
 ref|XP_011470857.1| PREDICTED: actin-7-like [Fragaria vesca subsp. vesca]
 ref|XP_011470858.1| PREDICTED: actin-7-like [Fragaria vesca subsp. vesca]
 ref|XP_011470859.1| PREDICTED: actin-7-like [Fragaria vesca subsp. vesca]
Length=377

 Score =   295 bits (754),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+ E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADSEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>gb|AFW82899.1| LOW QUALITY PROTEIN: putative actin family protein [Zea mays]
 gb|AFW82901.1| putative actin family protein [Zea mays]
 gb|AFW82902.1| putative actin family protein [Zea mays]
Length=430

 Score =   296 bits (759),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 139/148 (94%), Positives = 144/148 (97%), Gaps = 0/148 (0%)
 Frame = +1

Query  70   KMAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDE  249
            +MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDE
Sbjct  53   EMADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDE  112

Query  250  AQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANRE  429
            AQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANRE
Sbjct  113  AQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE  172

Query  430  KMTQIMFETFNVPAMYVAIXAVLSLYAS  513
            KMTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  173  KMTQIMFETFNVPAMYVAIQAVLSLYAS  200



>gb|KGN54250.1| hypothetical protein Csa_4G296030 [Cucumis sativus]
Length=321

 Score =   293 bits (749),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+ E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADNEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYAS  147



>gb|AAF03692.1|AF172094_1 actin [Picea rubens]
 gb|ACN39888.1| unknown [Picea sitchensis]
 gb|AIZ74323.1| actin related protein 1 [Pinus massoniana]
Length=377

 Score =   295 bits (754),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+ E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>gb|AFP44112.1| actin [Lycoris longituba]
Length=377

 Score =   295 bits (754),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+ E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>gb|AFO65511.1| actin 2 [Narcissus tazetta]
Length=377

 Score =   295 bits (754),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+ E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|XP_011080749.1| PREDICTED: actin-1-like [Sesamum indicum]
 ref|XP_011101608.1| PREDICTED: actin-1-like [Sesamum indicum]
Length=377

 Score =   295 bits (754),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAE E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAEAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYAS  147



>gb|ABI14668.1| actin [Aegiceras corniculatum]
Length=292

 Score =   292 bits (747),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 136/147 (93%), Positives = 140/147 (95%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+ E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFE FN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFEAFNAPAMYVAIQAVLSLYAS  147



>emb|CBI37599.3| unnamed protein product [Vitis vinifera]
Length=408

 Score =   296 bits (757),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 139/151 (92%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = +1

Query  61   G*DKMAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYV  240
            G  +MA+ E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYV
Sbjct  28   GNKRMADTEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYV  87

Query  241  GDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKA  420
            GDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKA
Sbjct  88   GDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA  147

Query  421  NREKMTQIMFETFNVPAMYVAIXAVLSLYAS  513
            NREKMTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  148  NREKMTQIMFETFNVPAMYVAIQAVLSLYAS  178



>ref|XP_010682856.1| PREDICTED: actin-11 [Beta vulgaris subsp. vulgaris]
 ref|XP_010682857.1| PREDICTED: actin-11 [Beta vulgaris subsp. vulgaris]
Length=377

 Score =   295 bits (754),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYAS  147



>ref|XP_010553283.1| PREDICTED: actin [Tarenaya hassleriana]
Length=377

 Score =   295 bits (754),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH +LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYAS  147



>ref|XP_010251047.1| PREDICTED: actin-3 [Nelumbo nucifera]
Length=377

 Score =   295 bits (754),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+ E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADSEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|XP_008455254.1| PREDICTED: actin-7-like [Cucumis melo]
Length=377

 Score =   295 bits (754),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETF+VPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFDVPAMYVAIQAVLSLYAS  147



>ref|XP_004136855.1| PREDICTED: actin-like [Cucumis sativus]
 ref|XP_004168919.1| PREDICTED: actin-like [Cucumis sativus]
 gb|KGN43668.1| hypothetical protein Csa_7G056470 [Cucumis sativus]
Length=377

 Score =   295 bits (754),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETF+VPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFDVPAMYVAIQAVLSLYAS  147



>sp|P30167.1|ACT3_SOLTU RecName: Full=Actin-58 [Solanum tuberosum]
 emb|CAA39278.1| actin [Solanum tuberosum]
Length=377

 Score =   295 bits (754),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAEGE++QPLV DNGTGMVKAGFAGDDAPRAVFP IVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPRIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>ref|XP_010912406.1| PREDICTED: actin-101-like [Elaeis guineensis]
 ref|XP_010912407.1| PREDICTED: actin-101-like [Elaeis guineensis]
Length=377

 Score =   295 bits (754),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+ E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>gb|AAD41039.1|AF112538_1 actin [Malva pusilla]
Length=377

 Score =   295 bits (754),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVRNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|XP_008781400.1| PREDICTED: actin-101-like [Phoenix dactylifera]
 ref|XP_008781401.1| PREDICTED: actin-101-like [Phoenix dactylifera]
 ref|XP_008784142.1| PREDICTED: actin-101-like [Phoenix dactylifera]
 ref|XP_008784143.1| PREDICTED: actin-101-like [Phoenix dactylifera]
 ref|XP_008784144.1| PREDICTED: actin-101-like [Phoenix dactylifera]
 ref|XP_010241722.1| PREDICTED: actin-101 [Nelumbo nucifera]
 ref|XP_010930993.1| PREDICTED: actin-101 [Elaeis guineensis]
 ref|XP_010930994.1| PREDICTED: actin-101 [Elaeis guineensis]
Length=377

 Score =   295 bits (754),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+ E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>gb|AET50987.1| actin [Lactuca sativa]
Length=288

 Score =   291 bits (746),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 136/147 (93%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+ E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADSEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYAS  147



>gb|EPS69960.1| actin-97 [Genlisea aurea]
Length=377

 Score =   295 bits (754),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH +LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



>gb|KHG29096.1| Actin [Gossypium arboreum]
Length=377

 Score =   295 bits (754),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MAEGE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAP+EH +LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYAS  147



>ref|XP_010260924.1| PREDICTED: actin-101-like [Nelumbo nucifera]
Length=377

 Score =   295 bits (754),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+ E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|XP_003574188.1| PREDICTED: actin-2 [Brachypodium distachyon]
Length=377

 Score =   295 bits (754),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETF+VPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFSVPAMYVAIQAVLSLYAS  147



>gb|AHE76167.1| actin [Triticum aestivum]
Length=377

 Score =   295 bits (754),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETF+VPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFSVPAMYVAIQAVLSLYAS  147



>gb|AFM38980.1| actin [Sophora viciifolia]
Length=377

 Score =   295 bits (754),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+ E++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH VLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFNVPAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYAS  147



>ref|XP_011075140.1| PREDICTED: actin-97 [Sesamum indicum]
Length=377

 Score =   295 bits (754),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MAEGEEVQPLVVDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEA  252
            MA+GE++QPLV DNGTGMVKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  253  QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPDEHSVLLTEAPLNPKANREK  432
            QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP+EH +LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  433  MTQIMFETFNVPAMYVAIXAVLSLYAS  513
            MTQIMFETFN PAMYVAI AVLSLYAS
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYAS  147



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 554939364720