BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001E05

Length=560
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009625296.1|  PREDICTED: scarecrow-like protein 13             91.3    7e-18   Nicotiana tomentosiformis
ref|XP_009773976.1|  PREDICTED: scarecrow-like protein 13             87.8    9e-17   Nicotiana sylvestris
ref|XP_006352339.1|  PREDICTED: scarecrow-like protein 13-like        87.4    1e-16   Solanum tuberosum [potatoes]
ref|XP_010312439.1|  PREDICTED: GRAS1 protein isoform X1              86.7    3e-16   
ref|XP_009792736.1|  PREDICTED: scarecrow-like protein 13             86.3    3e-16   Nicotiana sylvestris
ref|NP_001234305.1|  GRAS1 protein                                    85.1    7e-16   
ref|XP_009594270.1|  PREDICTED: scarecrow-like protein 13             84.7    1e-15   Nicotiana tomentosiformis
ref|XP_006365847.1|  PREDICTED: scarecrow-like protein 13-like is...  75.1    2e-12   Solanum tuberosum [potatoes]
ref|XP_004239819.1|  PREDICTED: scarecrow-like protein 13             73.6    7e-12   Solanum lycopersicum
emb|CDP04504.1|  unnamed protein product                              72.8    1e-11   Coffea canephora [robusta coffee]
ref|XP_006346781.1|  PREDICTED: scarecrow-like protein 13-like is...  70.1    8e-11   Solanum tuberosum [potatoes]
gb|EYU27678.1|  hypothetical protein MIMGU_mgv1a003969mg              69.3    2e-10   Erythranthe guttata [common monkey flower]
ref|XP_009804066.1|  PREDICTED: scarecrow-like protein 13             68.9    2e-10   Nicotiana sylvestris
ref|XP_009629634.1|  PREDICTED: scarecrow-like protein 13             62.8    2e-08   Nicotiana tomentosiformis
ref|XP_010052945.1|  PREDICTED: scarecrow-like protein 13             61.2    8e-08   Eucalyptus grandis [rose gum]
ref|XP_008440083.1|  PREDICTED: scarecrow-like protein 13             60.5    1e-07   
gb|AGW99232.1|  scarecrow-like protein 13-like protein                60.5    1e-07   Cucumis melo [Oriental melon]
ref|XP_006449893.1|  hypothetical protein CICLE_v10014811mg           60.1    2e-07   Citrus clementina [clementine]
ref|XP_006467309.1|  PREDICTED: scarecrow-like protein 13-like        60.1    2e-07   Citrus sinensis [apfelsine]
ref|XP_007211536.1|  hypothetical protein PRUPE_ppa003910mg           58.2    7e-07   Prunus persica
ref|XP_008227448.1|  PREDICTED: scarecrow-like protein 13             58.2    7e-07   Prunus mume [ume]
ref|XP_004134801.1|  PREDICTED: scarecrow-like protein 13-like        58.2    8e-07   Cucumis sativus [cucumbers]
ref|XP_010094683.1|  hypothetical protein L484_004260                 58.2    8e-07   
ref|XP_003546192.1|  PREDICTED: scarecrow-like protein 13-like        55.8    4e-06   Glycine max [soybeans]
ref|XP_011040189.1|  PREDICTED: scarecrow-like protein 13             55.5    5e-06   Populus euphratica
ref|XP_002534218.1|  Chitin-inducible gibberellin-responsive prot...  55.5    6e-06   Ricinus communis
ref|XP_010686653.1|  PREDICTED: scarecrow-like protein 21             54.7    9e-06   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN40815.1|  Scarecrow-like protein 13                             54.3    1e-05   Glycine soja [wild soybean]
ref|XP_003534887.1|  PREDICTED: scarecrow-like protein 13-like        54.3    1e-05   Glycine max [soybeans]
ref|XP_002322514.1|  hypothetical protein POPTR_0016s01110g           54.3    2e-05   Populus trichocarpa [western balsam poplar]
ref|XP_004293381.1|  PREDICTED: scarecrow-like protein 13             53.9    2e-05   Fragaria vesca subsp. vesca
ref|XP_004236663.1|  PREDICTED: scarecrow-like protein 21             53.5    2e-05   Solanum lycopersicum
ref|XP_002308802.1|  hypothetical protein POPTR_0006s01720g           49.7    4e-04   Populus trichocarpa [western balsam poplar]
ref|XP_007147638.1|  hypothetical protein PHAVU_006G141700g           49.7    5e-04   Phaseolus vulgaris [French bean]
ref|XP_011004506.1|  PREDICTED: scarecrow-like protein 13             49.7    5e-04   Populus euphratica
gb|KDP40388.1|  hypothetical protein JCGZ_04207                       49.3    6e-04   Jatropha curcas
ref|XP_008370992.1|  PREDICTED: scarecrow-like protein 13             48.9    8e-04   Malus domestica [apple tree]
ref|XP_008366083.1|  PREDICTED: LOW QUALITY PROTEIN: scarecrow-li...  48.9    8e-04   



>ref|XP_009625296.1| PREDICTED: scarecrow-like protein 13 [Nicotiana tomentosiformis]
Length=542

 Score = 91.3 bits (225),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 57/85 (67%), Gaps = 9/85 (11%)
 Frame = +3

Query  324  QQYYAAFHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSN  503
            +QYYA +H  NN+ +N S     Q  FQ QNE FFTLDS PA  D V YDSPPA SVSSN
Sbjct  25   EQYYAPYHFKNNNCNNTSSVT--QFAFQTQNEHFFTLDSLPA-TDYVVYDSPPALSVSSN  81

Query  504  RSAFSPQCSQSYM------SDNTTC  560
            RS FSPQCSQSYM      SDN TC
Sbjct  82   RSPFSPQCSQSYMSDLHHSSDNNTC  106



>ref|XP_009773976.1| PREDICTED: scarecrow-like protein 13 [Nicotiana sylvestris]
Length=542

 Score = 87.8 bits (216),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 56/85 (66%), Gaps = 9/85 (11%)
 Frame = +3

Query  324  QQYYAAFHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSN  503
            +QYYA +H  NN+ +N S     Q  FQ QNE FFTLDS PA  D V YDSP A SVSSN
Sbjct  25   EQYYAPYHFKNNNCNNTSSVT--QFTFQTQNEHFFTLDSLPA-TDYVVYDSPTALSVSSN  81

Query  504  RSAFSPQCSQSYM------SDNTTC  560
            RS FSPQCSQSYM      SDN TC
Sbjct  82   RSPFSPQCSQSYMSDLHHSSDNNTC  106



>ref|XP_006352339.1| PREDICTED: scarecrow-like protein 13-like [Solanum tuberosum]
Length=534

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 55/75 (73%), Gaps = 2/75 (3%)
 Frame = +3

Query  324  QQYYAAFHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSN  503
            +QYY  ++VL N   +   S G Q  FQAQ+EQFFTLDS+PA  D V  DSPPA SVSSN
Sbjct  17   EQYYTPYNVLKNSCKDTRSS-GMQFSFQAQDEQFFTLDSSPA-TDYVVNDSPPALSVSSN  74

Query  504  RSAFSPQCSQSYMSD  548
            RS FSPQCSQSYMSD
Sbjct  75   RSPFSPQCSQSYMSD  89



>ref|XP_010312439.1| PREDICTED: GRAS1 protein isoform X1 [Solanum lycopersicum]
Length=542

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 54/75 (72%), Gaps = 2/75 (3%)
 Frame = +3

Query  324  QQYYAAFHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSN  503
            +QYYA + VL N   +   S G Q   QAQ+EQFFTLDS+PA  D V  DSPPA SVSSN
Sbjct  25   EQYYAPYDVLKNSCKDNRSS-GMQFSLQAQDEQFFTLDSSPA-TDYVVNDSPPALSVSSN  82

Query  504  RSAFSPQCSQSYMSD  548
            RS FSPQCSQSYMSD
Sbjct  83   RSPFSPQCSQSYMSD  97



>ref|XP_009792736.1| PREDICTED: scarecrow-like protein 13 [Nicotiana sylvestris]
Length=544

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +3

Query  324  QQYYAAFHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSN  503
            QQYY  +  ++N++ N+S S G Q  FQ QNEQ FTLDS PA  D   YD+ P+ SVSSN
Sbjct  25   QQYYTPYQAVDNNIYNDSSSSGTQFSFQTQNEQVFTLDSLPA-TDYAIYDAAPSVSVSSN  83

Query  504  RSAFSPQCSQSYMSD  548
            RS FSPQCSQSY+SD
Sbjct  84   RSPFSPQCSQSYISD  98



>ref|NP_001234305.1| GRAS1 protein [Solanum lycopersicum]
 gb|ABD72958.1| GRAS1 [Solanum lycopersicum]
Length=542

 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 54/75 (72%), Gaps = 2/75 (3%)
 Frame = +3

Query  324  QQYYAAFHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSN  503
            +QYYA + VL N   +   S G Q   QAQ+EQFFTLDS+PA  D V  DSPPA SVSSN
Sbjct  25   EQYYAPYDVLKNSCKDNRSS-GMQFSLQAQDEQFFTLDSSPA-TDYVVNDSPPALSVSSN  82

Query  504  RSAFSPQCSQSYMSD  548
            RS FSPQCS+SYMSD
Sbjct  83   RSPFSPQCSRSYMSD  97



>ref|XP_009594270.1| PREDICTED: scarecrow-like protein 13 [Nicotiana tomentosiformis]
Length=544

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 51/73 (70%), Gaps = 1/73 (1%)
 Frame = +3

Query  330  YYAAFHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRS  509
            YY  +   +N + N+S S G Q  FQ QNEQFFTLDS PA  D   YD+ P+ S+SSNRS
Sbjct  27   YYTPYRAFDNSIYNDSSSSGTQFSFQTQNEQFFTLDSLPA-TDYTVYDADPSVSISSNRS  85

Query  510  AFSPQCSQSYMSD  548
             FSPQCSQSYMSD
Sbjct  86   PFSPQCSQSYMSD  98



>ref|XP_006365847.1| PREDICTED: scarecrow-like protein 13-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006365848.1| PREDICTED: scarecrow-like protein 13-like isoform X2 [Solanum 
tuberosum]
Length=559

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 58/76 (76%), Gaps = 4/76 (5%)
 Frame = +3

Query  324  QQYYAAFHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAP-AGIDSVYYDSPPAASVSS  500
            +QYY+ +HV+NN+ S+ S S G Q  +Q QNE+FFTLDS P AG   V YDSPPA SVSS
Sbjct  25   EQYYSPYHVVNNNSSDTS-SSGTQLSYQTQNEKFFTLDSLPDAGY--VSYDSPPAVSVSS  81

Query  501  NRSAFSPQCSQSYMSD  548
            N S FSPQCSQSY+SD
Sbjct  82   NWSPFSPQCSQSYISD  97



>ref|XP_004239819.1| PREDICTED: scarecrow-like protein 13 [Solanum lycopersicum]
 ref|XP_004239821.1| PREDICTED: scarecrow-like protein 13 [Solanum lycopersicum]
 ref|XP_010321394.1| PREDICTED: scarecrow-like protein 13 [Solanum lycopersicum]
Length=559

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 58/76 (76%), Gaps = 4/76 (5%)
 Frame = +3

Query  324  QQYYAAFHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAP-AGIDSVYYDSPPAASVSS  500
            +QYY+ +HV+NN+ S+ S S G Q  +Q QN++FFTLDS P AG   V YDSPPA SVSS
Sbjct  25   EQYYSPYHVVNNNSSDTS-SSGTQLSYQTQNDKFFTLDSLPDAGY--VSYDSPPAVSVSS  81

Query  501  NRSAFSPQCSQSYMSD  548
            N S FSPQCSQSY+SD
Sbjct  82   NWSPFSPQCSQSYISD  97



>emb|CDP04504.1| unnamed protein product [Coffea canephora]
Length=544

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 48/69 (70%), Gaps = 1/69 (1%)
 Frame = +3

Query  342  FHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRSAFSP  521
            F VLN++V  ++ S G Q  FQA NEQF TL+S P   D V  DSP   S+SSNRS FSP
Sbjct  32   FQVLNSNVCADNSSQGAQVSFQACNEQFATLESLPM-TDYVNSDSPSTVSISSNRSPFSP  90

Query  522  QCSQSYMSD  548
            QCSQSYMSD
Sbjct  91   QCSQSYMSD  99



>ref|XP_006346781.1| PREDICTED: scarecrow-like protein 13-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006346782.1| PREDICTED: scarecrow-like protein 13-like isoform X2 [Solanum 
tuberosum]
Length=544

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 47/73 (64%), Gaps = 1/73 (1%)
 Frame = +3

Query  324  QQYYAAFHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSN  503
            QQYY   H  +N   N+  + G +   + QNE+FFT+DS PA  D   YD+ P+ SVSSN
Sbjct  25   QQYYTPCHASDNSSYNDGSNSGTEVSLKTQNEKFFTMDSFPA-TDCAIYDADPSISVSSN  83

Query  504  RSAFSPQCSQSYM  542
            RS FSPQCSQS M
Sbjct  84   RSPFSPQCSQSNM  96



>gb|EYU27678.1| hypothetical protein MIMGU_mgv1a003969mg [Erythranthe guttata]
Length=552

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 49/72 (68%), Gaps = 2/72 (3%)
 Frame = +3

Query  333  YAAFHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRSA  512
            +++   LNND S +S S G +  FQA NEQFFTL+S PA  D + Y+SP   SVSSNRS 
Sbjct  29   FSSLQALNND-STDSKSQGTEVTFQAYNEQFFTLESTPAA-DYIAYNSPSTISVSSNRSP  86

Query  513  FSPQCSQSYMSD  548
            FSPQ S SY SD
Sbjct  87   FSPQGSHSYASD  98



>ref|XP_009804066.1| PREDICTED: scarecrow-like protein 13 [Nicotiana sylvestris]
 ref|XP_009804067.1| PREDICTED: scarecrow-like protein 13 [Nicotiana sylvestris]
Length=524

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 55/75 (73%), Gaps = 2/75 (3%)
 Frame = +3

Query  324  QQYYAAFHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSN  503
            +QYY+ ++V NN+ ++ S S G Q  FQ+QNEQFFTLDS PA    V YDSPPA SVSSN
Sbjct  12   EQYYSPYYVFNNNSNDTS-SSGTQFSFQSQNEQFFTLDSLPAA-GYVIYDSPPAVSVSSN  69

Query  504  RSAFSPQCSQSYMSD  548
             S FSPQ SQS +SD
Sbjct  70   WSPFSPQYSQSTISD  84



>ref|XP_009629634.1| PREDICTED: scarecrow-like protein 13 [Nicotiana tomentosiformis]
Length=521

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 39/54 (72%), Gaps = 1/54 (2%)
 Frame = +3

Query  387  GEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRSAFSPQCSQSYMSD  548
            G Q   Q+QNEQFFTLDS PA    V YDSPPA SVSSN S FSPQ SQS +SD
Sbjct  29   GTQFSCQSQNEQFFTLDSLPAA-GYVIYDSPPAVSVSSNWSPFSPQYSQSTISD  81



>ref|XP_010052945.1| PREDICTED: scarecrow-like protein 13 [Eucalyptus grandis]
 gb|KCW77094.1| hypothetical protein EUGRSUZ_D01435 [Eucalyptus grandis]
 gb|KCW77095.1| hypothetical protein EUGRSUZ_D01435 [Eucalyptus grandis]
Length=548

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +3

Query  342  FHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRSAFSP  521
            F ++ N+VS + GS G     Q  + Q+FTLDSAPA      YDSP A SV+SNRS FS 
Sbjct  32   FQIMENNVSPDIGSQGTNFSIQGYDGQYFTLDSAPAVSSFGSYDSPSAVSVASNRSPFST  91

Query  522  QCSQSYMSD  548
            Q S SY+SD
Sbjct  92   QGSHSYVSD  100



>ref|XP_008440083.1| PREDICTED: scarecrow-like protein 13 [Cucumis melo]
Length=541

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = +3

Query  330  YYAAFHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRS  509
            Y + FHVL N VS+++ S G    F +  +QFFTL+S PA  D    +SP A SV S+RS
Sbjct  20   YLSRFHVLGNHVSSDASSQGNSVNFSSYKDQFFTLESFPATADLSGSNSPSAGSVLSSRS  79

Query  510  AFSPQCSQSYMSD  548
             FSPQ SQS  SD
Sbjct  80   PFSPQGSQSCSSD  92



>gb|AGW99232.1| scarecrow-like protein 13-like protein [Cucumis melo]
Length=541

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = +3

Query  330  YYAAFHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRS  509
            Y + FHVL N VS+++ S G    F +  +QFFTL+S PA  D    +SP A SV S+RS
Sbjct  20   YLSRFHVLGNHVSSDASSQGNSVNFSSYKDQFFTLESFPATADLSGSNSPSAGSVLSSRS  79

Query  510  AFSPQCSQSYMSD  548
             FSPQ SQS  SD
Sbjct  80   PFSPQGSQSCSSD  92



>ref|XP_006449893.1| hypothetical protein CICLE_v10014811mg [Citrus clementina]
 ref|XP_006449894.1| hypothetical protein CICLE_v10014811mg [Citrus clementina]
 gb|ESR63133.1| hypothetical protein CICLE_v10014811mg [Citrus clementina]
 gb|ESR63134.1| hypothetical protein CICLE_v10014811mg [Citrus clementina]
Length=547

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 44/67 (66%), Gaps = 1/67 (1%)
 Frame = +3

Query  348  VLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRSAFSPQC  527
            +L+N++ ++  S G    FQ   EQF+TLDS+ A      +DSP A S+SSNRS FSPQ 
Sbjct  34   ILDNNICSDVSSQGTNMSFQTYKEQFYTLDSSTA-TTGFSHDSPSAVSISSNRSTFSPQG  92

Query  528  SQSYMSD  548
            SQSY SD
Sbjct  93   SQSYQSD  99



>ref|XP_006467309.1| PREDICTED: scarecrow-like protein 13-like [Citrus sinensis]
 ref|XP_006475190.1| PREDICTED: scarecrow-like protein 13-like [Citrus sinensis]
 gb|KDO78491.1| hypothetical protein CISIN_1g008984mg [Citrus sinensis]
 gb|KDO78492.1| hypothetical protein CISIN_1g008984mg [Citrus sinensis]
Length=547

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 44/67 (66%), Gaps = 1/67 (1%)
 Frame = +3

Query  348  VLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRSAFSPQC  527
            +L+N++ ++  S G    FQ   EQF+TLDS+ A      +DSP A S+SSNRS FSPQ 
Sbjct  34   ILDNNICSDVSSQGTNMSFQTYKEQFYTLDSSTA-TTGFSHDSPSAVSISSNRSTFSPQG  92

Query  528  SQSYMSD  548
            SQSY SD
Sbjct  93   SQSYQSD  99



>ref|XP_007211536.1| hypothetical protein PRUPE_ppa003910mg [Prunus persica]
 gb|EMJ12735.1| hypothetical protein PRUPE_ppa003910mg [Prunus persica]
Length=540

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +3

Query  342  FHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRSAFSP  521
            F +L N V +++GS G    FQ   E++FTL+S+PA    V  DSP A S  SNRS FS 
Sbjct  30   FQILENSVCSDTGSQGNNVSFQTYKEEYFTLESSPATTGFVACDSPSAGSGLSNRSPFSS  89

Query  522  QCSQSYMSD  548
            Q SQS +SD
Sbjct  90   QGSQSCLSD  98



>ref|XP_008227448.1| PREDICTED: scarecrow-like protein 13 [Prunus mume]
Length=540

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +3

Query  342  FHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRSAFSP  521
            F +L N V +++GS G    FQ   E++FTL+S+PA    V  DSP A S  SNRS FS 
Sbjct  30   FQILENSVCSDTGSQGNNVSFQTYKEEYFTLESSPATTGFVACDSPSAVSGLSNRSPFSS  89

Query  522  QCSQSYMSD  548
            Q SQS +SD
Sbjct  90   QGSQSCLSD  98



>ref|XP_004134801.1| PREDICTED: scarecrow-like protein 13-like [Cucumis sativus]
 ref|XP_004170199.1| PREDICTED: scarecrow-like protein 13-like [Cucumis sativus]
 gb|KGN49047.1| hypothetical protein Csa_6G511620 [Cucumis sativus]
Length=541

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = +3

Query  330  YYAAFHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRS  509
            Y + FHVL N VS ++ S G    F +  +QFFTL+S PA  D    +SP   SV S+RS
Sbjct  20   YLSGFHVLGNHVSPDASSQGNSVNFSSYKDQFFTLESFPATADLSGSNSPSTGSVLSSRS  79

Query  510  AFSPQCSQSYMSD  548
             FSPQ SQS  SD
Sbjct  80   PFSPQGSQSCSSD  92



>ref|XP_010094683.1| hypothetical protein L484_004260 [Morus notabilis]
 gb|EXB56655.1| hypothetical protein L484_004260 [Morus notabilis]
Length=597

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 47/75 (63%), Gaps = 2/75 (3%)
 Frame = +3

Query  330  YYAAFHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYD--SPPAASVSSN  503
            Y   F +L N++  ++GS G+   F+  NEQ+FTLDS+PA  D +  D  SP A SV S+
Sbjct  76   YSPHFQILENNMFPDTGSQGKSLSFETCNEQYFTLDSSPATADFLTCDSHSPSAVSVLSH  135

Query  504  RSAFSPQCSQSYMSD  548
            RS FSPQ S S  SD
Sbjct  136  RSPFSPQGSHSCSSD  150



>ref|XP_003546192.1| PREDICTED: scarecrow-like protein 13-like [Glycine max]
 gb|KHN32954.1| Scarecrow-like protein 13 [Glycine soja]
Length=552

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 45/76 (59%), Gaps = 4/76 (5%)
 Frame = +3

Query  333  YAAFHVLN----NDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSS  500
            Y  + +L     +++ + S S G    F+   +Q+FTL+S+P   D +  DSP  ASVSS
Sbjct  26   YTHYQILQSNSCHEIHDNSSSQGTTISFETSKDQYFTLESSPVINDLIGCDSPSYASVSS  85

Query  501  NRSAFSPQCSQSYMSD  548
            NRS FSPQ S SY SD
Sbjct  86   NRSPFSPQASHSYHSD  101



>ref|XP_011040189.1| PREDICTED: scarecrow-like protein 13 [Populus euphratica]
Length=545

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 47/73 (64%), Gaps = 2/73 (3%)
 Frame = +3

Query  333  YAAFHV-LNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRS  509
            Y   H+ + N++ ++ GS G    FQ    +FFTL+S+ A   S+ YDS PAASVSSNRS
Sbjct  26   YGLSHIQILNNMYSDGGSQGAAISFQTDQGEFFTLESSSATAGSINYDS-PAASVSSNRS  84

Query  510  AFSPQCSQSYMSD  548
             FSPQ S S +SD
Sbjct  85   PFSPQGSHSCISD  97



>ref|XP_002534218.1| Chitin-inducible gibberellin-responsive protein, putative [Ricinus 
communis]
 gb|EEF28164.1| Chitin-inducible gibberellin-responsive protein, putative [Ricinus 
communis]
Length=542

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 43/69 (62%), Gaps = 1/69 (1%)
 Frame = +3

Query  342  FHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRSAFSP  521
              +L N   ++ GS G    FQ   E++FTL+S+ A    V YDS PAASVSSNRS FSP
Sbjct  31   IQILENSAFSDVGSQGTSVSFQTYKEEYFTLESSSANAGFVGYDS-PAASVSSNRSPFSP  89

Query  522  QCSQSYMSD  548
            Q S S +SD
Sbjct  90   QGSNSCLSD  98



>ref|XP_010686653.1| PREDICTED: scarecrow-like protein 21 [Beta vulgaris subsp. vulgaris]
Length=548

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 42/70 (60%), Gaps = 1/70 (1%)
 Frame = +3

Query  342  FHVLNNDVSNESGSVGEQGF-FQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRSAFS  518
            +  LN ++  ++ + G Q   FQ  +E F TLDS+P       YDSP   S SSNRS  S
Sbjct  32   YQALNKNMYPDNTTKGNQIISFQTFDEGFVTLDSSPNIGLYTNYDSPSGVSTSSNRSQVS  91

Query  519  PQCSQSYMSD  548
            PQCSQSY+SD
Sbjct  92   PQCSQSYISD  101



>gb|KHN40815.1| Scarecrow-like protein 13 [Glycine soja]
Length=548

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 46/78 (59%), Gaps = 4/78 (5%)
 Frame = +3

Query  333  YAAFHVL-NNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRS  509
            Y  + +L +N   + S S G    F+   EQ+FTL+S+PA  D +  DSP  ASVSSNRS
Sbjct  26   YTHYQILQSNSCHDNSSSQGTTISFETSKEQYFTLESSPAINDLIGCDSPSYASVSSNRS  85

Query  510  AFSPQCS---QSYMSDNT  554
             FSPQ S   Q   SDNT
Sbjct  86   PFSPQASHSDQHQSSDNT  103



>ref|XP_003534887.1| PREDICTED: scarecrow-like protein 13-like [Glycine max]
Length=548

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 46/78 (59%), Gaps = 4/78 (5%)
 Frame = +3

Query  333  YAAFHVL-NNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRS  509
            Y  + +L +N   + S S G    F+   EQ+FTL+S+PA  D +  DSP  ASVSSNRS
Sbjct  26   YTHYQILQSNSCHDNSSSQGTTISFETSKEQYFTLESSPAINDLIGCDSPSYASVSSNRS  85

Query  510  AFSPQCS---QSYMSDNT  554
             FSPQ S   Q   SDNT
Sbjct  86   PFSPQASHSDQHQSSDNT  103



>ref|XP_002322514.1| hypothetical protein POPTR_0016s01110g [Populus trichocarpa]
 gb|EEF04275.1| hypothetical protein POPTR_0016s01110g [Populus trichocarpa]
Length=546

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 45/69 (65%), Gaps = 1/69 (1%)
 Frame = +3

Query  342  FHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRSAFSP  521
              +L++++ ++ GS G    FQ    +FFTL+S+ A    V YDS PAASVSSNRS FSP
Sbjct  31   IQILDSNMYSDGGSQGAAISFQTDQGEFFTLESSSATAGFVNYDS-PAASVSSNRSPFSP  89

Query  522  QCSQSYMSD  548
            Q S S +SD
Sbjct  90   QGSHSCISD  98



>ref|XP_004293381.1| PREDICTED: scarecrow-like protein 13 [Fragaria vesca subsp. vesca]
 ref|XP_011460052.1| PREDICTED: scarecrow-like protein 13 [Fragaria vesca subsp. vesca]
Length=547

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 36/61 (59%), Gaps = 0/61 (0%)
 Frame = +3

Query  342  FHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRSAFSP  521
            F +L N V  ++GS G+   FQ   E+FFTL+S P     +  DSP A S  SNRS FSP
Sbjct  31   FQILENSVCPDTGSQGKNVSFQTDKEEFFTLESTPVNDGFIACDSPSAISGLSNRSPFSP  90

Query  522  Q  524
            Q
Sbjct  91   Q  91



>ref|XP_004236663.1| PREDICTED: scarecrow-like protein 21 [Solanum lycopersicum]
Length=553

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 37/62 (60%), Gaps = 5/62 (8%)
 Frame = +3

Query  357  NDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRSAFSPQCSQS  536
            ND SN    V        +NE+FFT+D+ PA  D   YD  P+ SVSSNRS FS QCSQS
Sbjct  40   NDGSNSQAQVS----LTTENEKFFTVDTFPA-TDCAIYDGDPSVSVSSNRSPFSSQCSQS  94

Query  537  YM  542
             M
Sbjct  95   NM  96



>ref|XP_002308802.1| hypothetical protein POPTR_0006s01720g [Populus trichocarpa]
 gb|EEE92325.1| hypothetical protein POPTR_0006s01720g [Populus trichocarpa]
Length=546

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 43/69 (62%), Gaps = 1/69 (1%)
 Frame = +3

Query  342  FHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRSAFSP  521
              +L+  + +++GS G    F+    QFFTL+S+ A    V YDS PAAS+SSNRS FS 
Sbjct  31   IQILDKTLYSDAGSQGTSVSFETCLGQFFTLESSSATAGFVVYDS-PAASISSNRSPFSS  89

Query  522  QCSQSYMSD  548
            Q S S +SD
Sbjct  90   QGSHSCISD  98



>ref|XP_007147638.1| hypothetical protein PHAVU_006G141700g [Phaseolus vulgaris]
 gb|ESW19632.1| hypothetical protein PHAVU_006G141700g [Phaseolus vulgaris]
Length=553

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 44/77 (57%), Gaps = 5/77 (6%)
 Frame = +3

Query  333  YAAFHVLNNDVSNE---SGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVS--  497
            Y  + VL ++  +E   S S G    F+   EQ+FTL+S+P   D +  DSP  ASVS  
Sbjct  26   YTRYQVLQSNSCHEIHDSSSQGTTISFEPSKEQYFTLESSPQINDLIGCDSPSYASVSSN  85

Query  498  SNRSAFSPQCSQSYMSD  548
            SNRS FSP  S SY SD
Sbjct  86   SNRSPFSPHASHSYHSD  102



>ref|XP_011004506.1| PREDICTED: scarecrow-like protein 13 [Populus euphratica]
 ref|XP_011004507.1| PREDICTED: scarecrow-like protein 13 [Populus euphratica]
Length=546

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 44/69 (64%), Gaps = 1/69 (1%)
 Frame = +3

Query  342  FHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRSAFSP  521
              +L+ ++ +++GS G    F+    QFFTL+S+ A    V YDS PAAS+SSNRS FS 
Sbjct  31   IQILDKNMYSDAGSQGTSVSFETCLGQFFTLESSSATAGFVVYDS-PAASISSNRSPFSS  89

Query  522  QCSQSYMSD  548
            Q S S +SD
Sbjct  90   QGSLSCISD  98



>gb|KDP40388.1| hypothetical protein JCGZ_04207 [Jatropha curcas]
 gb|AIY30623.1| GRAS18 [Jatropha curcas]
Length=542

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 44/69 (64%), Gaps = 2/69 (3%)
 Frame = +3

Query  342  FHVLNNDVSNESGSVGEQGFFQAQNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRSAFSP  521
              VL+N+  ++ GS G    FQ+  E++FTL+S+ A      YDS PAASVSS +S FSP
Sbjct  31   IQVLDNNALSDGGSQGTSLSFQSYKEEYFTLESSSATTGFAVYDS-PAASVSS-KSPFSP  88

Query  522  QCSQSYMSD  548
            Q S S +SD
Sbjct  89   QGSHSCLSD  97



>ref|XP_008370992.1| PREDICTED: scarecrow-like protein 13 [Malus domestica]
Length=536

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 42/73 (58%), Gaps = 4/73 (5%)
 Frame = +3

Query  339  AFHVLNNDVSNESGSVGEQGFFQAQN---EQFFTLDSAPAGIDSVYYDSPPAASVSSNRS  509
             F +L N +  ++GS G    FQ      EQFFTL+S+P+  D +  DSP A S  SNRS
Sbjct  24   GFQILENSMYPDTGSQGNNLSFQTDKDDKEQFFTLESSPS-TDFLPCDSPSAISGLSNRS  82

Query  510  AFSPQCSQSYMSD  548
             FSPQ S S  SD
Sbjct  83   PFSPQGSHSCFSD  95



>ref|XP_008366083.1| PREDICTED: LOW QUALITY PROTEIN: scarecrow-like protein 13 [Malus 
domestica]
Length=542

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 42/73 (58%), Gaps = 4/73 (5%)
 Frame = +3

Query  339  AFHVLNNDVSNESGSVGEQGFFQA---QNEQFFTLDSAPAGIDSVYYDSPPAASVSSNRS  509
             + +L N V  ++GS G    FQ      EQFFTL+S+PA    V  DSP A S  SN+S
Sbjct  29   GYQILENSVFPDTGSQGNNVSFQTGKDDEEQFFTLESSPA-TAFVXCDSPSAVSGLSNKS  87

Query  510  AFSPQCSQSYMSD  548
             FSPQ S S +SD
Sbjct  88   PFSPQGSHSCLSD  100



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 631248065840