BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001E04

Length=381
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009798658.1|  PREDICTED: biogenesis of lysosome-related or...    141   4e-40   Nicotiana sylvestris
ref|XP_002282212.1|  PREDICTED: biogenesis of lysosome-related or...    137   2e-38   Vitis vinifera
ref|XP_009596773.1|  PREDICTED: biogenesis of lysosome-related or...    136   3e-38   Nicotiana tomentosiformis
ref|XP_006365651.1|  PREDICTED: biogenesis of lysosome-related or...    135   8e-38   Solanum tuberosum [potatoes]
emb|CDP02359.1|  unnamed protein product                                135   1e-37   Coffea canephora [robusta coffee]
ref|XP_006482459.1|  PREDICTED: biogenesis of lysosome-related or...    134   3e-37   Citrus sinensis [apfelsine]
gb|EYU39351.1|  hypothetical protein MIMGU_mgv1a016473mg                133   5e-37   Erythranthe guttata [common monkey flower]
ref|XP_010317138.1|  PREDICTED: biogenesis of lysosome-related or...    133   6e-37   
ref|XP_010317139.1|  PREDICTED: biogenesis of lysosome-related or...    133   7e-37   Solanum lycopersicum
ref|XP_004233396.1|  PREDICTED: biogenesis of lysosome-related or...    132   1e-36   Solanum lycopersicum
ref|XP_010257886.1|  PREDICTED: biogenesis of lysosome-related or...    132   1e-36   Nelumbo nucifera [Indian lotus]
gb|KDP32629.1|  hypothetical protein JCGZ_13179                         130   7e-36   Jatropha curcas
ref|XP_004514572.1|  PREDICTED: biogenesis of lysosome-related or...    129   3e-35   Cicer arietinum [garbanzo]
ref|XP_002530815.1|  conserved hypothetical protein                     130   8e-35   
ref|XP_007215159.1|  hypothetical protein PRUPE_ppa013493mg             127   1e-34   Prunus persica
gb|KJB48231.1|  hypothetical protein B456_008G059200                    127   1e-34   Gossypium raimondii
ref|XP_008230321.1|  PREDICTED: biogenesis of lysosome-related or...    127   2e-34   Prunus mume [ume]
ref|XP_003599511.1|  hypothetical protein MTR_3g034300                  127   2e-34   
ref|XP_011085574.1|  PREDICTED: biogenesis of lysosome-related or...    126   3e-34   Sesamum indicum [beniseed]
ref|XP_004137147.1|  PREDICTED: biogenesis of lysosome-related or...    126   4e-34   Cucumis sativus [cucumbers]
ref|XP_010099280.1|  hypothetical protein L484_018142                   125   1e-33   Morus notabilis
ref|XP_008455567.1|  PREDICTED: biogenesis of lysosome-related or...    124   2e-33   Cucumis melo [Oriental melon]
ref|NP_001238015.1|  uncharacterized protein LOC100305617               123   7e-33   Glycine max [soybeans]
ref|XP_004304182.1|  PREDICTED: biogenesis of lysosome-related or...    122   8e-33   Fragaria vesca subsp. vesca
ref|XP_011468565.1|  PREDICTED: biogenesis of lysosome-related or...    123   2e-32   Fragaria vesca subsp. vesca
ref|XP_007151420.1|  hypothetical protein PHAVU_004G044700g             121   3e-32   Phaseolus vulgaris [French bean]
ref|XP_006373527.1|  hypothetical protein POPTR_0017s14540g             121   3e-32   Populus trichocarpa [western balsam poplar]
ref|XP_003555020.1|  PREDICTED: biogenesis of lysosome-related or...    121   3e-32   Glycine max [soybeans]
ref|XP_006373528.1|  hypothetical protein POPTR_0017s14540g             121   3e-32   
gb|KDP24336.1|  hypothetical protein JCGZ_25632                         120   5e-32   Jatropha curcas
ref|XP_009373753.1|  PREDICTED: biogenesis of lysosome-related or...    120   1e-31   Pyrus x bretschneideri [bai li]
ref|XP_007010353.1|  SMAD/FHA domain-containing-like protein isof...    125   1e-31   
ref|XP_006844105.1|  hypothetical protein AMTR_s00006p00254430          119   1e-31   Amborella trichopoda
ref|XP_011021126.1|  PREDICTED: biogenesis of lysosome-related or...    119   2e-31   Populus euphratica
ref|XP_008379472.1|  PREDICTED: biogenesis of lysosome-related or...    117   8e-31   
ref|XP_010527843.1|  PREDICTED: biogenesis of lysosome-related or...    116   4e-30   Tarenaya hassleriana [spider flower]
ref|XP_008797591.1|  PREDICTED: biogenesis of lysosome-related or...    115   4e-30   Phoenix dactylifera
gb|EPS70193.1|  hypothetical protein M569_04570                         115   9e-30   Genlisea aurea
ref|XP_010942249.1|  PREDICTED: biogenesis of lysosome-related or...    114   2e-29   Elaeis guineensis
ref|XP_010062292.1|  PREDICTED: biogenesis of lysosome-related or...    114   2e-29   Eucalyptus grandis [rose gum]
ref|XP_009378292.1|  PREDICTED: biogenesis of lysosome-related or...    113   4e-29   Pyrus x bretschneideri [bai li]
ref|NP_001046154.1|  Os02g0190900                                       113   4e-29   
ref|XP_010694489.1|  PREDICTED: biogenesis of lysosome-related or...    112   7e-29   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006648402.1|  PREDICTED: biogenesis of lysosome-related or...    112   1e-28   Oryza brachyantha
dbj|BAK06586.1|  predicted protein                                      111   3e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004951615.1|  PREDICTED: biogenesis of lysosome-related or...    109   1e-27   Setaria italica
ref|XP_006281302.1|  hypothetical protein CARUB_v10027352mg             110   1e-27   
ref|XP_002453450.1|  hypothetical protein SORBIDRAFT_04g006140          109   1e-27   Sorghum bicolor [broomcorn]
ref|XP_003571077.1|  PREDICTED: biogenesis of lysosome-related or...    109   2e-27   Brachypodium distachyon [annual false brome]
ref|XP_009415449.1|  PREDICTED: biogenesis of lysosome-related or...    109   2e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010442422.1|  PREDICTED: biogenesis of lysosome-related or...    108   3e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010482231.1|  PREDICTED: biogenesis of lysosome-related or...    108   3e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010660551.1|  PREDICTED: biogenesis of lysosome-related or...    107   4e-27   Vitis vinifera
ref|XP_006395052.1|  hypothetical protein EUTSA_v10005135mg             106   1e-26   Eutrema salsugineum [saltwater cress]
ref|NP_001148358.1|  phytoene dehydrogenase-like                        106   2e-26   Zea mays [maize]
ref|XP_010440762.1|  PREDICTED: biogenesis of lysosome-related or...    106   3e-26   Camelina sativa [gold-of-pleasure]
ref|NP_568711.1|  biogenesis of lysosome-related organelles compl...    105   4e-26   Arabidopsis thaliana [mouse-ear cress]
gb|AAM64628.1|  unknown                                                 105   5e-26   Arabidopsis thaliana [mouse-ear cress]
emb|CDX86228.1|  BnaA06g29450D                                          104   7e-26   
emb|CDX85416.1|  BnaC07g27270D                                          104   9e-26   
gb|AFW70563.1|  phytoene dehydrogenase-like protein                     104   1e-25   
ref|XP_009151290.1|  PREDICTED: biogenesis of lysosome-related or...    104   2e-25   Brassica rapa
ref|XP_002862194.1|  hypothetical protein ARALYDRAFT_497552             103   2e-25   Arabidopsis lyrata subsp. lyrata
dbj|BAD93768.1|  hypothetical protein                                   103   3e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009111891.1|  PREDICTED: biogenesis of lysosome-related or...    102   5e-25   Brassica rapa
emb|CDY57026.1|  BnaA09g03400D                                          102   6e-25   Brassica napus [oilseed rape]
gb|KFK39013.1|  hypothetical protein AALP_AA3G189300                    102   7e-25   Arabis alpina [alpine rockcress]
ref|XP_002865741.1|  hypothetical protein ARALYDRAFT_495014             102   1e-24   
emb|CDY64756.1|  BnaCnng44780D                                          102   6e-24   Brassica napus [oilseed rape]
gb|EMT05782.1|  hypothetical protein F775_30501                       93.6    4e-21   
ref|XP_007010354.1|  SMAD/FHA domain-containing protein, putative...  94.0    1e-20   
ref|XP_001757268.1|  predicted protein                                90.1    2e-20   
ref|XP_010929453.1|  PREDICTED: biogenesis of lysosome-related or...  82.4    5e-17   
dbj|BAB10768.1|  phytoene dehydrogenase-like                          85.5    2e-16   Arabidopsis thaliana [mouse-ear cress]
gb|KCW48251.1|  hypothetical protein EUGRSUZ_K01979                   73.2    9e-14   Eucalyptus grandis [rose gum]
ref|XP_004352711.1|  biogenesis of lysosome related family protein    57.4    7e-08   Acanthamoeba castellanii str. Neff
ref|XP_002974644.1|  hypothetical protein SELMODRAFT_442593           56.2    1e-07   Selaginella moellendorffii
emb|CCX32098.1|  Similar to Probable biogenesis of lysosome-relat...  55.1    3e-07   Pyronema omphalodes CBS 100304
ref|XP_002963355.1|  hypothetical protein SELMODRAFT_405169           52.0    3e-06   
ref|XP_004365636.1|  hypothetical protein CAOG_00765                  53.1    4e-06   Capsaspora owczarzaki ATCC 30864
ref|XP_002836154.1|  hypothetical protein                             49.3    3e-05   Tuber melanosporum Mel28
ref|XP_003293642.1|  hypothetical protein DICPUDRAFT_158535           50.1    4e-05   Dictyostelium purpureum
ref|XP_004366248.1|  biogenesis of lysosome-related organelles co...  46.6    8e-04   Cavenderia fasciculata



>ref|XP_009798658.1| PREDICTED: biogenesis of lysosome-related organelles complex 
1 subunit 2 [Nicotiana sylvestris]
Length=114

 Score =   141 bits (355),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +1

Query  103  DRDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLRVFVE  282
            ++DHLAESLNDLFTNVS+M++GELQETNN+L L+E+MN RVAEEYKGFGDVASGLR+FVE
Sbjct  2    EQDHLAESLNDLFTNVSRMIRGELQETNNVLGLVEKMNTRVAEEYKGFGDVASGLRIFVE  61

Query  283  QLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            QLKSKSGSFDEYVQQID+IE QVTE EAV+SML
Sbjct  62   QLKSKSGSFDEYVQQIDTIEQQVTEFEAVISML  94



>ref|XP_002282212.1| PREDICTED: biogenesis of lysosome-related organelles complex 
1 subunit 2 isoform X1 [Vitis vinifera]
 emb|CAN71738.1| hypothetical protein VITISV_011558 [Vitis vinifera]
 emb|CBI16909.3| unnamed protein product [Vitis vinifera]
Length=121

 Score =   137 bits (344),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +1

Query  103  DRDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLRVFVE  282
            +RD LAESLNDLFT+VS MVKG+LQ TNNLLELLE+MN+RVAEEYKGFGDVASGLRVFVE
Sbjct  9    ERDALAESLNDLFTSVSTMVKGQLQGTNNLLELLEKMNLRVAEEYKGFGDVASGLRVFVE  68

Query  283  QLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            QLK+KSG+FDEYVQQID+IE QVTE EAV+SML
Sbjct  69   QLKAKSGNFDEYVQQIDAIEQQVTEFEAVISML  101



>ref|XP_009596773.1| PREDICTED: biogenesis of lysosome-related organelles complex 
1 subunit 2 [Nicotiana tomentosiformis]
Length=114

 Score =   136 bits (343),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +1

Query  103  DRDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLRVFVE  282
            ++D LAESLNDLFTNVS M++GELQETNN+L ++E+MN RVAEEYKGFGDVASGLR+FVE
Sbjct  2    EQDPLAESLNDLFTNVSMMIRGELQETNNVLGIVEKMNTRVAEEYKGFGDVASGLRIFVE  61

Query  283  QLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            QLKSKSGSFDEYVQQID+IE QVTE EAV+SML
Sbjct  62   QLKSKSGSFDEYVQQIDTIEQQVTEFEAVISML  94



>ref|XP_006365651.1| PREDICTED: biogenesis of lysosome-related organelles complex 
1 subunit 2-like [Solanum tuberosum]
Length=114

 Score =   135 bits (340),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = +1

Query  103  DRDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLRVFVE  282
            ++DHLAESLNDL TNVS M++GELQETNN+LEL+E+MN RVAEEYKGFGDVASGL +FVE
Sbjct  2    EQDHLAESLNDLLTNVSTMIRGELQETNNVLELVEKMNTRVAEEYKGFGDVASGLTIFVE  61

Query  283  QLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            QLK KSGSFDEYVQQID+IE QVTE EAV+SML
Sbjct  62   QLKCKSGSFDEYVQQIDTIEQQVTEFEAVISML  94



>emb|CDP02359.1| unnamed protein product [Coffea canephora]
Length=120

 Score =   135 bits (339),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 89/100 (89%), Gaps = 2/100 (2%)
 Frame = +1

Query  88   MASG--DDRDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVAS  261
            MASG  +  D LAESLNDLF NVS MVKGELQ TNNLLELLE+MN+RVAEEYKGFGDVAS
Sbjct  1    MASGAENKSDQLAESLNDLFINVSTMVKGELQGTNNLLELLEKMNLRVAEEYKGFGDVAS  60

Query  262  GLRVFVEQLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            GLRVF++QLKSKSGSFDEYVQQID IE QVTE EAV+SML
Sbjct  61   GLRVFMDQLKSKSGSFDEYVQQIDLIERQVTEFEAVISML  100



>ref|XP_006482459.1| PREDICTED: biogenesis of lysosome-related organelles complex 
1 subunit 2-like [Citrus sinensis]
 gb|KDO72330.1| hypothetical protein CISIN_1g033198mg [Citrus sinensis]
Length=125

 Score =   134 bits (337),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 78/92 (85%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = +1

Query  106  RDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLRVFVEQ  285
            RD LAESLNDLFT+VS MVK ELQ TNN LELLE+MN+RVAEEYKGFGDVA+GLRVFVEQ
Sbjct  13   RDELAESLNDLFTSVSAMVKSELQGTNNTLELLEKMNLRVAEEYKGFGDVAAGLRVFVEQ  72

Query  286  LKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            LK KSGSFDEYVQQIDSIE QVT+ EAV+SML
Sbjct  73   LKKKSGSFDEYVQQIDSIEQQVTQFEAVISML  104



>gb|EYU39351.1| hypothetical protein MIMGU_mgv1a016473mg [Erythranthe guttata]
Length=120

 Score =   133 bits (335),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 89/100 (89%), Gaps = 2/100 (2%)
 Frame = +1

Query  88   MASGD--DRDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVAS  261
            MASG   ++D LAESLNDLFTNVS M+KGELQ TNN+LELLE+MNIRVAEEYKGFGDVAS
Sbjct  1    MASGKGTEQDQLAESLNDLFTNVSAMIKGELQGTNNVLELLEKMNIRVAEEYKGFGDVAS  60

Query  262  GLRVFVEQLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            GLR+FVEQLKSKS +FDEYV Q+D+IE  VTE EAV+SML
Sbjct  61   GLRIFVEQLKSKSSTFDEYVLQLDTIEQHVTEFEAVISML  100



>ref|XP_010317138.1| PREDICTED: biogenesis of lysosome-related organelles complex 
1 subunit 2 isoform X2 [Solanum lycopersicum]
Length=117

 Score =   133 bits (335),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +1

Query  103  DRDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLRVFVE  282
            ++DHLAESL DLFTNVS M++GELQETNN+LEL+E+MN RVAEEYKGFGDVASGL +FVE
Sbjct  2    EQDHLAESLTDLFTNVSTMIRGELQETNNVLELVEKMNTRVAEEYKGFGDVASGLTIFVE  61

Query  283  QLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            QLK KSG FDEYVQQID+IE QVTE EAV+SML
Sbjct  62   QLKCKSGRFDEYVQQIDTIEQQVTEFEAVISML  94



>ref|XP_010317139.1| PREDICTED: biogenesis of lysosome-related organelles complex 
1 subunit 2 isoform X3 [Solanum lycopersicum]
Length=117

 Score =   133 bits (334),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +1

Query  103  DRDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLRVFVE  282
            ++DHLAESL DLFTNVS M++GELQETNN+LEL+E+MN RVAEEYKGFGDVASGL +FVE
Sbjct  2    EQDHLAESLTDLFTNVSTMIRGELQETNNVLELVEKMNTRVAEEYKGFGDVASGLTIFVE  61

Query  283  QLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            QLK KSG FDEYVQQID+IE QVTE EAV+SML
Sbjct  62   QLKCKSGRFDEYVQQIDTIEQQVTEFEAVISML  94



>ref|XP_004233396.1| PREDICTED: biogenesis of lysosome-related organelles complex 
1 subunit 2 isoform X1 [Solanum lycopersicum]
Length=120

 Score =   132 bits (333),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +1

Query  103  DRDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLRVFVE  282
            ++DHLAESL DLFTNVS M++GELQETNN+LEL+E+MN RVAEEYKGFGDVASGL +FVE
Sbjct  2    EQDHLAESLTDLFTNVSTMIRGELQETNNVLELVEKMNTRVAEEYKGFGDVASGLTIFVE  61

Query  283  QLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            QLK KSG FDEYVQQID+IE QVTE EAV+SML
Sbjct  62   QLKCKSGRFDEYVQQIDTIEQQVTEFEAVISML  94



>ref|XP_010257886.1| PREDICTED: biogenesis of lysosome-related organelles complex 
1 subunit 2 [Nelumbo nucifera]
Length=121

 Score =   132 bits (333),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 78/95 (82%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = +1

Query  97   GDDRDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLRVF  276
            G +RD L ESLNDLF NVS M+KGELQ TNNLLELLE+MN+RVAEEYKGFGDVASGLR+F
Sbjct  6    GLERDELTESLNDLFANVSTMIKGELQGTNNLLELLEKMNLRVAEEYKGFGDVASGLRIF  65

Query  277  VEQLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            VEQLK KS +FDEYVQQIDSIE QVTE EAV+SML
Sbjct  66   VEQLKGKSNNFDEYVQQIDSIEQQVTEFEAVISML  100



>gb|KDP32629.1| hypothetical protein JCGZ_13179 [Jatropha curcas]
Length=122

 Score =   130 bits (328),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 89/102 (87%), Gaps = 4/102 (4%)
 Frame = +1

Query  88   MASGDD----RDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDV  255
            MA+G +     D LA+S NDLFT+VS MVKGELQ TNNLLELLE+MN+RVAEEYKGFGDV
Sbjct  1    MAAGKEEVEVHDKLADSFNDLFTSVSTMVKGELQGTNNLLELLEKMNLRVAEEYKGFGDV  60

Query  256  ASGLRVFVEQLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            ASGLR+FVEQLKSKSG+FDEYVQQID IE QVTE EAV+SML
Sbjct  61   ASGLRIFVEQLKSKSGNFDEYVQQIDLIERQVTEFEAVISML  102



>ref|XP_004514572.1| PREDICTED: biogenesis of lysosome-related organelles complex 
1 subunit 2-like isoform X1 [Cicer arietinum]
 ref|XP_004514573.1| PREDICTED: biogenesis of lysosome-related organelles complex 
1 subunit 2-like isoform X2 [Cicer arietinum]
Length=128

 Score =   129 bits (324),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = +1

Query  91   ASGDDRDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLR  270
            A     D LAESLNDLFT+VS M+K ELQ TNN LELLE+MN+RVAEEYKGFGD+ASGLR
Sbjct  9    AQDQKHDELAESLNDLFTSVSTMIKSELQGTNNQLELLEKMNLRVAEEYKGFGDLASGLR  68

Query  271  VFVEQLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            VFVEQLK KSGSF+EYV+QID+IE QVTE EAVVSML
Sbjct  69   VFVEQLKCKSGSFNEYVEQIDAIEKQVTEFEAVVSML  105



>ref|XP_002530815.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31583.1| conserved hypothetical protein [Ricinus communis]
Length=210

 Score =   130 bits (327),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 75/92 (82%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = +1

Query  106  RDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLRVFVEQ  285
            +D LA+SLNDLF +VS MVKGE+Q TNNLL+LLE+MN+RVAEEYKGFGDVASGLRVFVEQ
Sbjct  12   QDELADSLNDLFASVSTMVKGEIQGTNNLLDLLEKMNLRVAEEYKGFGDVASGLRVFVEQ  71

Query  286  LKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            L+SKSGSFDEYVQQID+IE QVTE EAV+S+L
Sbjct  72   LQSKSGSFDEYVQQIDTIERQVTEFEAVISVL  103



>ref|XP_007215159.1| hypothetical protein PRUPE_ppa013493mg [Prunus persica]
 gb|EMJ16358.1| hypothetical protein PRUPE_ppa013493mg [Prunus persica]
Length=119

 Score =   127 bits (320),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +1

Query  88   MASGDDRDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGL  267
            MA  +++D LAESLNDLFT+VS MVK ELQ + N L+LLE+MN+RVAEEYKGFGDVASGL
Sbjct  1    MAGKEEQDKLAESLNDLFTSVSTMVKSELQGSTNHLDLLEKMNLRVAEEYKGFGDVASGL  60

Query  268  RVFVEQLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
             VFVEQLKSKSGSF+EY +QID IE QVTE EAV+S+L
Sbjct  61   SVFVEQLKSKSGSFEEYAKQIDVIEQQVTEFEAVISVL  98



>gb|KJB48231.1| hypothetical protein B456_008G059200 [Gossypium raimondii]
Length=120

 Score =   127 bits (319),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = +1

Query  106  RDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLRVFVEQ  285
            +D LAESLNDLFT++S MVK ELQ TNN+LELLE+MN+RVA+EYKGFGDVASGLRVFVEQ
Sbjct  9    QDDLAESLNDLFTSLSSMVKSELQGTNNVLELLEKMNLRVAQEYKGFGDVASGLRVFVEQ  68

Query  286  LKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            LK+KSG+FDEYVQQID+IE QVTE EAV+S+L
Sbjct  69   LKNKSGNFDEYVQQIDAIEQQVTEFEAVISVL  100



>ref|XP_008230321.1| PREDICTED: biogenesis of lysosome-related organelles complex 
1 subunit 2 [Prunus mume]
Length=119

 Score =   127 bits (318),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +1

Query  88   MASGDDRDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGL  267
            MA+ +D+D LAESLNDLFT+VS MVK ELQ + N L+LLE+MN+RVAEEYKGFGDVASGL
Sbjct  1    MAAKEDQDELAESLNDLFTSVSTMVKSELQGSTNHLDLLEKMNLRVAEEYKGFGDVASGL  60

Query  268  RVFVEQLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
             +FVEQLKSKSGSF+ Y +QID IE QVTE EAV+S+L
Sbjct  61   SIFVEQLKSKSGSFEVYAKQIDVIEQQVTEFEAVISVL  98



>ref|XP_003599511.1| hypothetical protein MTR_3g034300 [Medicago truncatula]
 gb|AES69762.1| biogenesis of lysosome-related organelles complex-1 protein [Medicago 
truncatula]
Length=127

 Score =   127 bits (318),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = +1

Query  91   ASGDDRDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLR  270
            A    RD LAESLNDLF++V+ M+K ELQ TNN LELLE+MN+RVAEEY GFGD+ASGLR
Sbjct  9    AQDQKRDELAESLNDLFSSVATMIKSELQGTNNHLELLEKMNLRVAEEYNGFGDLASGLR  68

Query  271  VFVEQLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            VFVEQLK KSGSF+EYV+QID+IE QVTE EAVVSML
Sbjct  69   VFVEQLKCKSGSFNEYVEQIDAIEKQVTEFEAVVSML  105



>ref|XP_011085574.1| PREDICTED: biogenesis of lysosome-related organelles complex 
1 subunit 2 [Sesamum indicum]
 ref|XP_011085575.1| PREDICTED: biogenesis of lysosome-related organelles complex 
1 subunit 2 [Sesamum indicum]
 ref|XP_011085576.1| PREDICTED: biogenesis of lysosome-related organelles complex 
1 subunit 2 [Sesamum indicum]
Length=120

 Score =   126 bits (317),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 87/100 (87%), Gaps = 2/100 (2%)
 Frame = +1

Query  88   MASGDD--RDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVAS  261
            MAS  +  +D LA SLNDLFT+VS M+KGELQ TNN+LELLE MN+RVAEEYKGFGDVAS
Sbjct  1    MASAKEAGQDELAASLNDLFTSVSTMIKGELQGTNNILELLENMNLRVAEEYKGFGDVAS  60

Query  262  GLRVFVEQLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            GLRVFVEQLK KS +FD+YVQQ+D+IE QVTE EAVVSML
Sbjct  61   GLRVFVEQLKLKSSTFDDYVQQLDAIEQQVTEFEAVVSML  100



>ref|XP_004137147.1| PREDICTED: biogenesis of lysosome-related organelles complex 
1 subunit 2-like [Cucumis sativus]
 ref|XP_004154730.1| PREDICTED: biogenesis of lysosome-related organelles complex 
1 subunit 2-like [Cucumis sativus]
 gb|KGN53763.1| hypothetical protein Csa_4G123360 [Cucumis sativus]
Length=121

 Score =   126 bits (316),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +1

Query  103  DRDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLRVFVE  282
            +RD LAESLN+ FT+VS+M+K +L  ++N LELLERMN+RVAEEYKGFGDVASG+RVFVE
Sbjct  10   NRDDLAESLNEFFTSVSEMIKSDLLGSSNQLELLERMNLRVAEEYKGFGDVASGMRVFVE  69

Query  283  QLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            QLKSKSG FDEY+ QI+ IE QVTE EAV+SML
Sbjct  70   QLKSKSGGFDEYINQIEKIEHQVTEFEAVISML  102



>ref|XP_010099280.1| hypothetical protein L484_018142 [Morus notabilis]
 gb|EXB77626.1| hypothetical protein L484_018142 [Morus notabilis]
Length=123

 Score =   125 bits (313),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = +1

Query  106  RDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLRVFVEQ  285
            RD LAESLNDLFT+V  MVK ELQ TNN LELLE+MN+RV EEYKG+GDVASGLRVFVEQ
Sbjct  11   RDELAESLNDLFTSVFAMVKSELQGTNNQLELLEKMNLRVGEEYKGYGDVASGLRVFVEQ  70

Query  286  LKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            LKSKSGSFDEY Q+I++I+ QVTE EAV+SML
Sbjct  71   LKSKSGSFDEYAQKIETIDQQVTEFEAVISML  102



>ref|XP_008455567.1| PREDICTED: biogenesis of lysosome-related organelles complex 
1 subunit 2 [Cucumis melo]
Length=121

 Score =   124 bits (311),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +1

Query  103  DRDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLRVFVE  282
            +RD LAESLN+ FT+VS+M+K +L  ++N LELLERMN RVAEEYKG+GDVASG+RVFVE
Sbjct  10   NRDELAESLNEFFTSVSEMIKSDLLGSSNQLELLERMNSRVAEEYKGYGDVASGMRVFVE  69

Query  283  QLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            QLKSKSG FDEY+ QI+ IE QVTE EAV+SML
Sbjct  70   QLKSKSGGFDEYIHQIEKIEHQVTEFEAVISML  102



>ref|NP_001238015.1| uncharacterized protein LOC100305617 [Glycine max]
 ref|XP_006593334.1| PREDICTED: uncharacterized protein LOC100305617 isoform X1 [Glycine 
max]
 ref|XP_006593335.1| PREDICTED: uncharacterized protein LOC100305617 isoform X2 [Glycine 
max]
 ref|XP_006593336.1| PREDICTED: uncharacterized protein LOC100305617 isoform X3 [Glycine 
max]
 gb|ACU13394.1| unknown [Glycine max]
 gb|KHN02649.1| Biogenesis of lysosome-related organelles complex 1 subunit 2 
[Glycine soja]
Length=130

 Score =   123 bits (308),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = +1

Query  106  RDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLRVFVEQ  285
            +D LAESL+ LF++VS M+K ELQ TNN LELLE+MN+RVAEEYKGFGD+ASGLRVFVEQ
Sbjct  14   QDELAESLDGLFSSVSTMIKSELQGTNNHLELLEKMNVRVAEEYKGFGDLASGLRVFVEQ  73

Query  286  LKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            LK KSGSF+EYV+QIDSIE QVTE EAVVSML
Sbjct  74   LKCKSGSFNEYVEQIDSIEKQVTEFEAVVSML  105



>ref|XP_004304182.1| PREDICTED: biogenesis of lysosome-related organelles complex 
1 subunit 2 [Fragaria vesca subsp. vesca]
Length=119

 Score =   122 bits (307),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +1

Query  88   MASGDDRDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGL  267
            MA  + +D LA+SLNDLF++VS M+K ELQ T N +ELLE+MN+RVAEEYKGFGDVASGL
Sbjct  1    MAEKEKQDELADSLNDLFSSVSTMIKTELQGTANHMELLEKMNLRVAEEYKGFGDVASGL  60

Query  268  RVFVEQLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
             VFVEQLKSKS  FDEYV+QID+I+ QVTE EAVVS+L
Sbjct  61   SVFVEQLKSKSSGFDEYVKQIDAIDQQVTEFEAVVSVL  98



>ref|XP_011468565.1| PREDICTED: biogenesis of lysosome-related organelles complex 
1 subunit 2-like [Fragaria vesca subsp. vesca]
Length=159

 Score =   123 bits (308),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +1

Query  109  DHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLRVFVEQL  288
            D LAESLNDLF++VS M+K ELQ T N +ELLE+MN+RVAEEYKGFGDVASGL VFVEQL
Sbjct  26   DELAESLNDLFSSVSTMIKSELQGTTNHMELLEKMNLRVAEEYKGFGDVASGLSVFVEQL  85

Query  289  KSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            KSKSG FDEYV+QID+I+ QVTE EAVVS+L
Sbjct  86   KSKSGGFDEYVKQIDAIDQQVTEFEAVVSVL  116



>ref|XP_007151420.1| hypothetical protein PHAVU_004G044700g [Phaseolus vulgaris]
 gb|ESW23414.1| hypothetical protein PHAVU_004G044700g [Phaseolus vulgaris]
Length=130

 Score =   121 bits (304),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = +1

Query  106  RDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLRVFVEQ  285
            +D LAESL+DLF ++S M+K ELQ TNN LELLE+MN+RV EEYKGFGD+ASGLRVFVEQ
Sbjct  14   QDQLAESLDDLFCSISTMIKSELQGTNNHLELLEKMNVRVGEEYKGFGDLASGLRVFVEQ  73

Query  286  LKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            LK KSG+F+EYV+QID+IE QVTE EAVVSML
Sbjct  74   LKCKSGNFNEYVEQIDNIEKQVTEFEAVVSML  105



>ref|XP_006373527.1| hypothetical protein POPTR_0017s14540g [Populus trichocarpa]
 gb|ERP51324.1| hypothetical protein POPTR_0017s14540g [Populus trichocarpa]
Length=130

 Score =   121 bits (304),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +1

Query  85   KMASGDDRDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASG  264
            K A    +D+LA+SLNDLFT+VS MVK ELQ T+N LELLE+MN+RV+EEYKGFGDVASG
Sbjct  7    KEAGMQQQDNLADSLNDLFTSVSNMVKSELQGTSNQLELLEKMNVRVSEEYKGFGDVASG  66

Query  265  LRVFVEQLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            LRV+VEQLK KSG+F+EYV QI+ IE QVTE EAV+S+L
Sbjct  67   LRVYVEQLKGKSGNFEEYVHQIEEIEKQVTEFEAVISVL  105



>ref|XP_003555020.1| PREDICTED: biogenesis of lysosome-related organelles complex 
1 subunit 2-like [Glycine max]
 gb|KHN30751.1| Biogenesis of lysosome-related organelles complex 1 subunit 2 
[Glycine soja]
Length=130

 Score =   121 bits (304),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = +1

Query  106  RDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLRVFVEQ  285
            +D LAESL+ LF++VS M+K ELQ TNN LELLE+MN+RVAEEYKGFGD+ASGLRVFVEQ
Sbjct  14   QDELAESLDGLFSSVSTMIKSELQGTNNHLELLEKMNVRVAEEYKGFGDLASGLRVFVEQ  73

Query  286  LKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            LK KSGSF+EYV+QID+IE QVTE EAVVSML
Sbjct  74   LKCKSGSFNEYVEQIDNIEKQVTEFEAVVSML  105



>ref|XP_006373528.1| hypothetical protein POPTR_0017s14540g [Populus trichocarpa]
 gb|ERP51325.1| hypothetical protein POPTR_0017s14540g [Populus trichocarpa]
Length=130

 Score =   121 bits (304),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +1

Query  85   KMASGDDRDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASG  264
            K A    +D+LA+SLNDLFT+VS MVK ELQ T+N LELLE+MN+RV+EEYKGFGDVASG
Sbjct  7    KEAGMQQQDNLADSLNDLFTSVSNMVKSELQGTSNQLELLEKMNVRVSEEYKGFGDVASG  66

Query  265  LRVFVEQLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            LRV+VEQLK KSG+F+EYV QI+ IE QVTE EAV+S+L
Sbjct  67   LRVYVEQLKGKSGNFEEYVHQIEEIEKQVTEFEAVISVL  105



>gb|KDP24336.1| hypothetical protein JCGZ_25632 [Jatropha curcas]
Length=122

 Score =   120 bits (302),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 86/102 (84%), Gaps = 4/102 (4%)
 Frame = +1

Query  88   MASGDD----RDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDV  255
            MA+G +    ++ LA+S ND FT++S MVKGELQ TNNLLELL++MN RVAEEYKGF DV
Sbjct  1    MAAGKEEVEVQEELADSFNDFFTSISTMVKGELQGTNNLLELLDKMNGRVAEEYKGFVDV  60

Query  256  ASGLRVFVEQLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            ASGLR+FVEQLKSKS SFDEYVQQID IE QVTE EAV+SML
Sbjct  61   ASGLRIFVEQLKSKSSSFDEYVQQIDLIEQQVTEFEAVISML  102



>ref|XP_009373753.1| PREDICTED: biogenesis of lysosome-related organelles complex 
1 subunit 2-like [Pyrus x bretschneideri]
Length=122

 Score =   120 bits (300),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 83/97 (86%), Gaps = 0/97 (0%)
 Frame = +1

Query  91   ASGDDRDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLR  270
            A  + +D LAES+NDLF +VS +VK ELQ + N L+LLE+MN+RVAEEYKGFGDVA+GL 
Sbjct  5    AKEEQKDALAESINDLFGSVSAVVKSELQGSTNHLDLLEKMNMRVAEEYKGFGDVAAGLS  64

Query  271  VFVEQLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            VFVEQLK+KSGSFDEYV+QID IE QVTE EAVVS+L
Sbjct  65   VFVEQLKAKSGSFDEYVKQIDVIEQQVTEFEAVVSVL  101



>ref|XP_007010353.1| SMAD/FHA domain-containing-like protein isoform 1 [Theobroma 
cacao]
 gb|EOY19163.1| SMAD/FHA domain-containing-like protein isoform 1 [Theobroma 
cacao]
Length=319

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  109  DHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLRVFVEQL  288
            D LAESLNDL T+VS MVK ELQ TNN+LELLE+MN++VAEEYKGFGDVASGLRVFVEQL
Sbjct  209  DELAESLNDLSTSVSTMVKSELQGTNNILELLEKMNLKVAEEYKGFGDVASGLRVFVEQL  268

Query  289  KSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            K+KSG+FDEYVQQID+IE QVTE EAV+S+L
Sbjct  269  KNKSGNFDEYVQQIDTIEQQVTEFEAVISVL  299



>ref|XP_006844105.1| hypothetical protein AMTR_s00006p00254430 [Amborella trichopoda]
 gb|ERN05780.1| hypothetical protein AMTR_s00006p00254430 [Amborella trichopoda]
Length=119

 Score =   119 bits (299),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +1

Query  103  DRDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLRVFVE  282
            ++D LAES+N+LF NVS M+KGELQ TNNLLELLE+MN+RVAEEY  +GD+ASGLRVFVE
Sbjct  7    NKDELAESVNELFVNVSTMIKGELQGTNNLLELLEKMNLRVAEEYNSYGDIASGLRVFVE  66

Query  283  QLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            QLK+K+ +FDEYVQQID+I+ QVTE EA+VSML
Sbjct  67   QLKAKNDNFDEYVQQIDAIDRQVTEFEALVSML  99



>ref|XP_011021126.1| PREDICTED: biogenesis of lysosome-related organelles complex 
1 subunit 2 [Populus euphratica]
Length=130

 Score =   119 bits (298),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +1

Query  85   KMASGDDRDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASG  264
            K A    +D LA+SLNDLFT+VS MV+ ELQ T+N LELLE+MN+RV+EEYKGFGDVASG
Sbjct  7    KEAGMQQQDDLADSLNDLFTSVSNMVQSELQGTSNQLELLEKMNVRVSEEYKGFGDVASG  66

Query  265  LRVFVEQLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            LRV+VEQLK KSG+F+EYV QI+ IE QVTE EAV+S+L
Sbjct  67   LRVYVEQLKGKSGNFEEYVHQIEEIEKQVTEFEAVISVL  105



>ref|XP_008379472.1| PREDICTED: biogenesis of lysosome-related organelles complex 
1 subunit 2 [Malus domestica]
 ref|XP_008348102.1| PREDICTED: biogenesis of lysosome-related organelles complex 
1 subunit 2-like [Malus domestica]
Length=122

 Score =   117 bits (294),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +1

Query  91   ASGDDRDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLR  270
            A  + +  LAES+NDLF +VS MVK ELQ + N L+LLE+MN+RVAEEYKGFGDVA+GL 
Sbjct  5    AKEEQKGELAESINDLFGSVSAMVKSELQGSTNHLDLLEKMNLRVAEEYKGFGDVAAGLS  64

Query  271  VFVEQLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            VFVEQLK+KSGSF+EYV+QID IE QVTE EAV+S+L
Sbjct  65   VFVEQLKAKSGSFEEYVKQIDVIEQQVTEFEAVISVL  101



>ref|XP_010527843.1| PREDICTED: biogenesis of lysosome-related organelles complex 
1 subunit 2-like [Tarenaya hassleriana]
Length=128

 Score =   116 bits (290),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = +1

Query  97   GDDRDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLRVF  276
             +DRD LA+SLNDLFTNVS MVK ELQ TNNLL L+E+MN+RVA EY  FGDVA+GLRVF
Sbjct  2    AEDRDDLADSLNDLFTNVSCMVKSELQGTNNLLNLVEKMNLRVAAEYNDFGDVAAGLRVF  61

Query  277  VEQLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
             EQ+KSKSG  DEYV+QI++IE QVT+ EAV S+L
Sbjct  62   AEQMKSKSGGLDEYVRQIEAIEKQVTDFEAVTSIL  96



>ref|XP_008797591.1| PREDICTED: biogenesis of lysosome-related organelles complex 
1 subunit 2 [Phoenix dactylifera]
Length=119

 Score =   115 bits (289),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = +1

Query  97   GDDRDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLRVF  276
            G +RD LAESL DLF NVS M+KGEL+ TNN L LLE+MN RVAEEY GF DVASGLRVF
Sbjct  5    GAERDELAESLEDLFANVSSMIKGELEGTNNQLRLLEKMNQRVAEEYDGFSDVASGLRVF  64

Query  277  VEQLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            VEQL  K+  FDEYV+Q+D I+ QVTE EAVVSML
Sbjct  65   VEQLSEKNQGFDEYVKQVDVIDQQVTEFEAVVSML  99



>gb|EPS70193.1| hypothetical protein M569_04570 [Genlisea aurea]
Length=115

 Score =   115 bits (287),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +1

Query  106  RDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLRVFVEQ  285
            RD LAESL  +F  VS M+KGELQ +N  LELLE+MN+RVA++YKG+GDVA GLRVF++Q
Sbjct  3    RDELAESLEHIFACVSDMIKGELQGSNTALELLEKMNLRVADKYKGYGDVACGLRVFMDQ  62

Query  286  LKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            LKSKS SFD+Y++Q+D IE QVTELEA++SML
Sbjct  63   LKSKSSSFDQYIKQLDQIEQQVTELEAIISML  94



>ref|XP_010942249.1| PREDICTED: biogenesis of lysosome-related organelles complex 
1 subunit 2-like [Elaeis guineensis]
Length=121

 Score =   114 bits (285),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +1

Query  103  DRDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLRVFVE  282
            +RD LAESL +LF NVS M+KGEL+ TNN L LLE+MN RVAEEY GF DVASGLRVFVE
Sbjct  9    ERDELAESLENLFINVSTMIKGELEGTNNQLSLLEKMNQRVAEEYNGFSDVASGLRVFVE  68

Query  283  QLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            QL  K+  FDEYV+QID I+ QVTE EAVVSML
Sbjct  69   QLSEKNQGFDEYVKQIDVIDQQVTEFEAVVSML  101



>ref|XP_010062292.1| PREDICTED: biogenesis of lysosome-related organelles complex 
1 subunit 2 [Eucalyptus grandis]
 gb|KCW69403.1| hypothetical protein EUGRSUZ_F02878 [Eucalyptus grandis]
Length=115

 Score =   114 bits (284),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = +1

Query  109  DHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLRVFVEQL  288
            D LAESLNDLF N+S MVK ELQ  NN LEL+E+MN +VAEEY GFGDVASGLRVFVEQL
Sbjct  4    DALAESLNDLFLNLSTMVKSELQGANNQLELVEKMNQQVAEEYVGFGDVASGLRVFVEQL  63

Query  289  KSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            KSKSG FDEYV+QI++IE QVT  E+VVS L
Sbjct  64   KSKSGGFDEYVRQIEAIEEQVTHFESVVSAL  94



>ref|XP_009378292.1| PREDICTED: biogenesis of lysosome-related organelles complex 
1 subunit 2-like [Pyrus x bretschneideri]
Length=122

 Score =   113 bits (283),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = +1

Query  100  DDRDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLRVFV  279
            + +D LAES+NDLF +VS MV+ ELQ + N L+LLE+MN+RVAEEYKGFGDVA+GL VFV
Sbjct  8    EKKDELAESINDLFGSVSAMVESELQGSTNHLDLLEKMNLRVAEEYKGFGDVAAGLSVFV  67

Query  280  EQLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            EQLK+KS  F+EYV+QID IE QVTE EAV+S+L
Sbjct  68   EQLKAKSCGFEEYVKQIDVIEQQVTEFEAVISVL  101



>ref|NP_001046154.1| Os02g0190900 [Oryza sativa Japonica Group]
 dbj|BAD16481.1| phytoene dehydrogenase-like protein [Oryza sativa Japonica Group]
 dbj|BAD34009.1| phytoene dehydrogenase-like protein [Oryza sativa Japonica Group]
 dbj|BAF08068.1| Os02g0190900 [Oryza sativa Japonica Group]
 gb|EAY84820.1| hypothetical protein OsI_06187 [Oryza sativa Indica Group]
 gb|EAZ22046.1| hypothetical protein OsJ_05704 [Oryza sativa Japonica Group]
 dbj|BAG99130.1| unnamed protein product [Oryza sativa Japonica Group]
Length=121

 Score =   113 bits (282),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +1

Query  91   ASGDDRDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLR  270
            A+  +RD LA+SL +LFTNVS MV+GELQ TN+ L LLE+MN RVAEEY  +GDVASGLR
Sbjct  4    AASGERDELADSLAELFTNVSLMVRGELQGTNSQLSLLEKMNRRVAEEYNNYGDVASGLR  63

Query  271  VFVEQLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            VFVEQL  K+ SF EYV QID+I+ QVTE EAVVSML
Sbjct  64   VFVEQLNEKNQSFGEYVSQIDAIDQQVTEFEAVVSML  100



>ref|XP_010694489.1| PREDICTED: biogenesis of lysosome-related organelles complex 
1 subunit 2 [Beta vulgaris subsp. vulgaris]
Length=125

 Score =   112 bits (281),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = +1

Query  97   GDDRDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLRVF  276
             D  D LA++L+DLF  VS M+K ELQ +NNLLELLE+MN++VAEEY  +GDVASGLRVF
Sbjct  11   NDQPDELADALDDLFNGVSTMIKSELQGSNNLLELLEKMNLKVAEEYTSYGDVASGLRVF  70

Query  277  VEQLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            VEQLK KSGSF+ YVQQID+I+ QVTE EAV+SML
Sbjct  71   VEQLKHKSGSFEGYVQQIDAIDQQVTEFEAVISML  105



>ref|XP_006648402.1| PREDICTED: biogenesis of lysosome-related organelles complex 
1 subunit 2-like [Oryza brachyantha]
Length=127

 Score =   112 bits (280),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +1

Query  103  DRDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLRVFVE  282
            +RD LA+SL +LF NVS MV+GELQ  NN L LLE+MN RVAEEY  +GDVASGLRVFVE
Sbjct  14   ERDELADSLAELFANVSLMVRGELQGANNQLSLLEKMNQRVAEEYNNYGDVASGLRVFVE  73

Query  283  QLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            QL  K+ SFDEYV QID+I+ QVTE EAVVSML
Sbjct  74   QLNEKNQSFDEYVSQIDAIDQQVTEFEAVVSML  106



>dbj|BAK06586.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=126

 Score =   111 bits (277),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +1

Query  85   KMASGDDRDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASG  264
            K A+   RD LA+SL++LFTNVS MV+GELQ TNN L LLE+MN RV EEY  +GDVASG
Sbjct  7    KEAAAGQRDELADSLSELFTNVSLMVRGELQGTNNQLSLLEKMNQRVTEEYSNYGDVASG  66

Query  265  LRVFVEQLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            LRVFVEQL  K+  FDEY  QID+I+ QV+E EAVVSML
Sbjct  67   LRVFVEQLNEKNQRFDEYTTQIDAIDQQVSEFEAVVSML  105



>ref|XP_004951615.1| PREDICTED: biogenesis of lysosome-related organelles complex 
1 subunit 2-like [Setaria italica]
Length=132

 Score =   109 bits (273),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +1

Query  106  RDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLRVFVEQ  285
            RD LAESL +LFTNVS MV+GELQ TN+ L LLE+MN RVA+EY  +GDVA+GLRVFVEQ
Sbjct  19   RDELAESLAELFTNVSLMVRGELQGTNSQLALLEKMNDRVAQEYSNYGDVAAGLRVFVEQ  78

Query  286  LKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            L  K+  FDEYV  ID+I+ QVTE EAVVSML
Sbjct  79   LNEKNQGFDEYVSHIDAIDQQVTEFEAVVSML  110



>ref|XP_006281302.1| hypothetical protein CARUB_v10027352mg, partial [Capsella rubella]
 gb|EOA14200.1| hypothetical protein CARUB_v10027352mg, partial [Capsella rubella]
Length=135

 Score =   110 bits (274),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = +1

Query  88   MASGDDRDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGL  267
            ++  D RD LAESL +LFT+VS MVK ELQ TNN L+LLE+MN+RVA EY   GDVA+GL
Sbjct  10   LSMADSRDDLAESLQNLFTSVSTMVKSELQGTNNQLDLLEKMNLRVASEYDDLGDVAAGL  69

Query  268  RVFVEQLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            RVF EQ+KSKSG FDE+V QID+IE QV+E EAV+S+L
Sbjct  70   RVFAEQMKSKSGGFDEFVGQIDAIEKQVSEFEAVISVL  107



>ref|XP_002453450.1| hypothetical protein SORBIDRAFT_04g006140 [Sorghum bicolor]
 gb|EES06426.1| hypothetical protein SORBIDRAFT_04g006140 [Sorghum bicolor]
Length=127

 Score =   109 bits (272),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +1

Query  106  RDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLRVFVEQ  285
            RD L+ESL +LFTNVS MV+GELQ TNN + LLE+MN RVA+EY  +GD+A+GLRVFVEQ
Sbjct  15   RDELSESLAELFTNVSLMVRGELQGTNNQMALLEKMNDRVAQEYSNYGDIAAGLRVFVEQ  74

Query  286  LKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            L  KS  FD+YV QID+I+ QVTE EAVVSML
Sbjct  75   LNEKSRGFDDYVSQIDAIDQQVTEFEAVVSML  106



>ref|XP_003571077.1| PREDICTED: biogenesis of lysosome-related organelles complex 
1 subunit 2 [Brachypodium distachyon]
Length=125

 Score =   109 bits (272),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = +1

Query  85   KMASGDDRDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASG  264
            K+ +   RD LAESL +LFTNVS MV+GELQ TNN L LLE+MN RVAEEY   GDVASG
Sbjct  6    KVVAAGQRDELAESLAELFTNVSLMVRGELQGTNNQLALLEKMNHRVAEEYNNNGDVASG  65

Query  265  LRVFVEQLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            LRVFVEQL  K+  F EY  QID+I+ QVTE EAVVSML
Sbjct  66   LRVFVEQLNEKNQRFGEYTSQIDAIDKQVTEFEAVVSML  104



>ref|XP_009415449.1| PREDICTED: biogenesis of lysosome-related organelles complex 
1 subunit 2-like [Musa acuminata subsp. malaccensis]
Length=134

 Score =   109 bits (272),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +1

Query  106  RDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLRVFVEQ  285
            R  LAESL DLFT++S M+KGEL+ TNN L LLE+MN RVAEEY G+GDVA+GLRVFVEQ
Sbjct  23   RHELAESLADLFTSISAMIKGELEGTNNQLLLLEKMNQRVAEEYNGYGDVAAGLRVFVEQ  82

Query  286  LKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            L  K+  F+EYVQQI+ I+ Q+TE EAVVSML
Sbjct  83   LCEKNHGFEEYVQQIEKIDQQLTEFEAVVSML  114



>ref|XP_010442422.1| PREDICTED: biogenesis of lysosome-related organelles complex 
1 subunit 2-like [Camelina sativa]
Length=126

 Score =   108 bits (271),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +1

Query  97   GDDRDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLRVF  276
             + RD LAESL +LFT+VS MVK ELQ TNN L+LLE+MN+RVA EY   GDVASGLRVF
Sbjct  2    AESRDDLAESLQNLFTSVSTMVKSELQGTNNHLDLLEKMNLRVASEYDDLGDVASGLRVF  61

Query  277  VEQLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
             EQ+KSKSG FDE+V QID+IE QV+E EAV+S+L
Sbjct  62   AEQMKSKSGGFDEFVGQIDAIEKQVSEFEAVISVL  96



>ref|XP_010482231.1| PREDICTED: biogenesis of lysosome-related organelles complex 
1 subunit 2 [Camelina sativa]
Length=126

 Score =   108 bits (271),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +1

Query  97   GDDRDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLRVF  276
             + RD LAESL +LFT+VS MVK ELQ TNN L+LLE+MN+RVA EY   GDVASGLRVF
Sbjct  2    AESRDDLAESLQNLFTSVSTMVKSELQGTNNHLDLLEKMNLRVASEYDDLGDVASGLRVF  61

Query  277  VEQLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
             EQ+KSKSG FDE+V QID+IE QV+E EAV+S+L
Sbjct  62   AEQMKSKSGGFDEFVGQIDAIEKQVSEFEAVISVL  96



>ref|XP_010660551.1| PREDICTED: biogenesis of lysosome-related organelles complex 
1 subunit 2 isoform X2 [Vitis vinifera]
Length=100

 Score =   107 bits (267),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +1

Query  208  RMNIRVAEEYKGFGDVASGLRVFVEQLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            +MN+RVAEEYKGFGDVASGLRVFVEQLK+KSG+FDEYVQQID+IE QVTE EAV+SML
Sbjct  23   KMNLRVAEEYKGFGDVASGLRVFVEQLKAKSGNFDEYVQQIDAIEQQVTEFEAVISML  80



>ref|XP_006395052.1| hypothetical protein EUTSA_v10005135mg [Eutrema salsugineum]
 gb|ESQ32338.1| hypothetical protein EUTSA_v10005135mg [Eutrema salsugineum]
Length=122

 Score =   106 bits (265),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +1

Query  97   GDDRDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLRVF  276
             D RD LAESL +LFT+VS MVK ELQ TNN L+LLE+MN+RVA EY+  GDVA+GLRVF
Sbjct  2    ADARDDLAESLQNLFTSVSSMVKSELQGTNNQLDLLEKMNLRVASEYEDLGDVAAGLRVF  61

Query  277  VEQLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
             EQ+KSKSG  DE+V Q+D+IE QV+E EAVVS+L
Sbjct  62   AEQMKSKSGGLDEFVGQMDAIEKQVSEFEAVVSVL  96



>ref|NP_001148358.1| phytoene dehydrogenase-like [Zea mays]
 gb|ACG31058.1| phytoene dehydrogenase-like [Zea mays]
Length=131

 Score =   106 bits (265),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +1

Query  106  RDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLRVFVEQ  285
            RD L+ESL +LFTNVS MV+GELQ TNN L LLE+MN RV++EY  +GD+A+GLRVFVEQ
Sbjct  19   RDELSESLAELFTNVSLMVRGELQGTNNQLALLEKMNDRVSQEYSNYGDIAAGLRVFVEQ  78

Query  286  LKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            L  K+  FD+YV QID+I+ QVTE EAVVSML
Sbjct  79   LNEKNRGFDDYVSQIDAIDQQVTEFEAVVSML  110



>ref|XP_010440762.1| PREDICTED: biogenesis of lysosome-related organelles complex 
1 subunit 2-like [Camelina sativa]
Length=125

 Score =   106 bits (264),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +1

Query  97   GDDRDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLRVF  276
             + RD LAESL +LFT+VS MVK ELQ TNN L+LLE+MN+RVA E+   GDVA+GLRVF
Sbjct  2    AESRDDLAESLQNLFTSVSTMVKSELQGTNNHLDLLEKMNLRVASEFDDLGDVAAGLRVF  61

Query  277  VEQLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
             EQ+KSKSG FDE+V QID+IE QV+E EAV+S+L
Sbjct  62   AEQMKSKSGGFDEFVGQIDAIEKQVSEFEAVISVL  96



>ref|NP_568711.1| biogenesis of lysosome-related organelles complex 1 subunit 2 
[Arabidopsis thaliana]
 sp|F4K657.1|BL1S2_ARATH RecName: Full=Biogenesis of lysosome-related organelles complex 
1 subunit 2; Short=BLOC-1 subunit 2 [Arabidopsis thaliana]
 gb|AED95828.1| uncharacterized protein AT5G49550 [Arabidopsis thaliana]
Length=127

 Score =   105 bits (263),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = +1

Query  97   GDDRDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLRVF  276
             D RD LAESL +LFT+VS MVK ELQ TNN L+LLE+MN+RVA EY   GDVA+GLRVF
Sbjct  2    ADSRDDLAESLQNLFTSVSSMVKSELQGTNNHLDLLEKMNLRVASEYDDMGDVAAGLRVF  61

Query  277  VEQLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
             EQ+KSKSG  DE+V Q+D+IE QV+E EAV+S+L
Sbjct  62   AEQMKSKSGGLDEFVGQMDAIEKQVSEFEAVISVL  96



>gb|AAM64628.1| unknown [Arabidopsis thaliana]
Length=127

 Score =   105 bits (262),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = +1

Query  97   GDDRDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLRVF  276
             D RD LAESL +LFT+VS MVK ELQ TNN L+LLE+MN+R+A EY   GDVA+GLRVF
Sbjct  2    ADSRDDLAESLQNLFTSVSSMVKSELQGTNNHLDLLEKMNLRIASEYDDMGDVAAGLRVF  61

Query  277  VEQLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
             EQ+KSKSG  DE+V Q+D+IE QV+E EAV+S+L
Sbjct  62   AEQMKSKSGGLDEFVGQMDAIEKQVSEFEAVISVL  96



>emb|CDX86228.1| BnaA06g29450D [Brassica napus]
Length=110

 Score =   104 bits (260),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 77/97 (79%), Gaps = 3/97 (3%)
 Frame = +1

Query  91   ASGDDRDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLR  270
            A GDD   LAESL  LFTNVS MVK ELQ TNN ++LLE+MN+RVA EY   GDVA+GLR
Sbjct  4    AQGDD---LAESLQSLFTNVSSMVKSELQGTNNQMDLLEKMNVRVAAEYDDLGDVAAGLR  60

Query  271  VFVEQLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            VF EQ+K KSG FDE+V Q+D+IE QV+E EAVVS+L
Sbjct  61   VFAEQMKLKSGGFDEFVGQMDAIEKQVSEFEAVVSVL  97



>emb|CDX85416.1| BnaC07g27270D [Brassica napus]
Length=110

 Score =   104 bits (259),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 77/97 (79%), Gaps = 3/97 (3%)
 Frame = +1

Query  91   ASGDDRDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLR  270
            A GDD   LAESL  LFTNVS MVK ELQ TNN ++LLE+MN+RVA EY   GDVA+GLR
Sbjct  4    AHGDD---LAESLQSLFTNVSSMVKSELQGTNNQMDLLEKMNVRVAAEYDDLGDVAAGLR  60

Query  271  VFVEQLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            VF EQ+K KSG FDE+V Q+D+IE QV+E EAVVS+L
Sbjct  61   VFAEQMKLKSGGFDEFVGQMDAIEKQVSEFEAVVSVL  97



>gb|AFW70563.1| phytoene dehydrogenase-like protein [Zea mays]
Length=131

 Score =   104 bits (259),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +1

Query  106  RDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLRVFVEQ  285
            RD L+ESL +LFTNVS MV+GELQ TNN L LLE+MN RV++EY  +GD+A+GLRVFVEQ
Sbjct  19   RDELSESLAELFTNVSLMVRGELQGTNNQLALLEKMNDRVSQEYSNYGDIAAGLRVFVEQ  78

Query  286  LKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            L  K+  F++YV QID+I+ QVTE EAVVSML
Sbjct  79   LNEKNRGFEDYVSQIDAIDQQVTEFEAVVSML  110



>ref|XP_009151290.1| PREDICTED: biogenesis of lysosome-related organelles complex 
1 subunit 2 [Brassica rapa]
Length=141

 Score =   104 bits (260),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 77/97 (79%), Gaps = 3/97 (3%)
 Frame = +1

Query  91   ASGDDRDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLR  270
            A GDD   LAESL  LFTNVS MVK ELQ TNN ++LLE+MN+RVA EY   GDVA+GLR
Sbjct  35   AQGDD---LAESLQSLFTNVSSMVKSELQGTNNQMDLLEKMNVRVAAEYDDLGDVAAGLR  91

Query  271  VFVEQLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            VF EQ+K KSG FDE+V Q+D+IE QV+E EAVVS+L
Sbjct  92   VFAEQMKLKSGGFDEFVGQMDAIEKQVSEFEAVVSVL  128



>ref|XP_002862194.1| hypothetical protein ARALYDRAFT_497552 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH38452.1| hypothetical protein ARALYDRAFT_497552 [Arabidopsis lyrata subsp. 
lyrata]
Length=127

 Score =   103 bits (258),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = +1

Query  97   GDDRDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLRVF  276
             D RD LAESL +LFT+VS MVK ELQ TNN L+LLE+MN RVA EY   GDVA+GLRVF
Sbjct  2    ADSRDDLAESLQNLFTSVSSMVKSELQGTNNHLDLLEKMNQRVASEYDDMGDVAAGLRVF  61

Query  277  VEQLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
             EQ+KSKSG  DE+V Q+D+IE QV+E EAV+S+L
Sbjct  62   AEQMKSKSGGLDEFVGQMDAIEKQVSEFEAVISVL  96



>dbj|BAD93768.1| hypothetical protein [Arabidopsis thaliana]
Length=127

 Score =   103 bits (257),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = +1

Query  97   GDDRDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLRVF  276
             D RD LAESL +LFT+VS MVK ELQ TNN L+LLE+MN+RVA EY   GDVA+G RVF
Sbjct  2    ADSRDDLAESLQNLFTSVSSMVKSELQGTNNHLDLLEKMNLRVASEYDDMGDVAAGPRVF  61

Query  277  VEQLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
             EQ+KSKSG  DE+V Q+D+IE QV+E EAV+S+L
Sbjct  62   AEQMKSKSGGLDEFVGQMDAIEKQVSEFEAVISVL  96



>ref|XP_009111891.1| PREDICTED: biogenesis of lysosome-related organelles complex 
1 subunit 2-like [Brassica rapa]
Length=127

 Score =   102 bits (255),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 78/97 (80%), Gaps = 3/97 (3%)
 Frame = +1

Query  91   ASGDDRDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLR  270
            A GDD   LAESL +LFT+VS MVK ELQ TNN L+LLE+MN+RVA EY   GDVA+GLR
Sbjct  4    ARGDD---LAESLKNLFTSVSSMVKSELQGTNNQLDLLEKMNLRVAAEYDDLGDVAAGLR  60

Query  271  VFVEQLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            VF EQ+KSKSG  DE+V Q+D+IE QV+E EAV+S+L
Sbjct  61   VFAEQMKSKSGGLDEFVGQMDAIEKQVSEFEAVISVL  97



>emb|CDY57026.1| BnaA09g03400D [Brassica napus]
Length=127

 Score =   102 bits (255),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 78/97 (80%), Gaps = 3/97 (3%)
 Frame = +1

Query  91   ASGDDRDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLR  270
            A GDD   LAESL +LFT+VS MVK ELQ TNN L+LLE+MN+RVA EY   GDVA+GLR
Sbjct  4    ARGDD---LAESLKNLFTSVSSMVKSELQGTNNQLDLLEKMNLRVAAEYDDLGDVAAGLR  60

Query  271  VFVEQLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            VF EQ+KSKSG  DE+V Q+D+IE QV+E EAV+S+L
Sbjct  61   VFAEQMKSKSGGLDEFVGQMDAIEKQVSEFEAVISVL  97



>gb|KFK39013.1| hypothetical protein AALP_AA3G189300 [Arabis alpina]
Length=121

 Score =   102 bits (254),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +1

Query  109  DHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLRVFVEQL  288
            D LAESL  LFT+VS MVK ELQ TNN L+L+E+MN+RVA EY   GDVASGLRVF EQ+
Sbjct  3    DDLAESLQSLFTSVSSMVKSELQGTNNQLDLIEKMNLRVASEYDDLGDVASGLRVFAEQM  62

Query  289  KSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            KSKSG  DE+V Q+D+IE QV+E EAV+S+L
Sbjct  63   KSKSGGLDEFVGQMDAIEKQVSEFEAVISVL  93



>ref|XP_002865741.1| hypothetical protein ARALYDRAFT_495014 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42000.1| hypothetical protein ARALYDRAFT_495014 [Arabidopsis lyrata subsp. 
lyrata]
Length=127

 Score =   102 bits (253),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = +1

Query  97   GDDRDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLRVF  276
             + RD LAESL +LFT+VS MVK ELQ TNN L+LLE+MN RVA EY   GDVA+GLRVF
Sbjct  2    AESRDDLAESLQNLFTSVSSMVKSELQGTNNHLDLLEKMNQRVASEYDDMGDVAAGLRVF  61

Query  277  VEQLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
             EQ+KSKSG  DE+V Q+D+IE QV+E EAV+S+L
Sbjct  62   AEQMKSKSGGLDEFVGQMDAIEKQVSEFEAVISVL  96



>emb|CDY64756.1| BnaCnng44780D [Brassica napus]
Length=211

 Score =   102 bits (254),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 80/102 (78%), Gaps = 1/102 (1%)
 Frame = +1

Query  79   QTKMASGDDR-DHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDV  255
            +  ++  D R D LAESL +LFT+VS MVK ELQ TNN L+LLE+MN+RVA EY   GDV
Sbjct  81   EASLSMADTRGDDLAESLQNLFTSVSSMVKSELQGTNNQLDLLEKMNLRVAAEYDDLGDV  140

Query  256  ASGLRVFVEQLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            A+GLRVF EQ+KSKSG  DE+V Q+D+IE QV+E EAV+S+L
Sbjct  141  AAGLRVFAEQMKSKSGGLDEFVGQMDAIEKQVSEFEAVISVL  182



>gb|EMT05782.1| hypothetical protein F775_30501 [Aegilops tauschii]
Length=154

 Score = 93.6 bits (231),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 76/125 (61%), Gaps = 28/125 (22%)
 Frame = +1

Query  91   ASGDDRDHLAESLNDLFTNVSKMVKGelqe----------------------------tn  186
            A+   RD LA+SL++LFTNVS MV+GELQ                             TN
Sbjct  9    AAAGQRDELADSLSELFTNVSLMVRGELQVFSGSGLLTGASLTFAPIWFPMPRFEGLGTN  68

Query  187  nllelleRMNIRVAEEYKGFGDVASGLRVFVEQLKSKSGSFDEYVQQIDSIEGQVTELEA  366
            N L LLE+MN RV EEY   GDVASGLRVFVEQL  K+  FDEY  QID+I+ QV+E EA
Sbjct  69   NQLSLLEKMNQRVTEEYSNHGDVASGLRVFVEQLNEKNQRFDEYTTQIDAIDQQVSEFEA  128

Query  367  VVSML  381
            VVSML
Sbjct  129  VVSML  133



>ref|XP_007010354.1| SMAD/FHA domain-containing protein, putative isoform 2, partial 
[Theobroma cacao]
 gb|EOY19164.1| SMAD/FHA domain-containing protein, putative isoform 2, partial 
[Theobroma cacao]
Length=233

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +1

Query  208  RMNIRVAEEYKGFGDVASGLRVFVEQLKSKSGSFDEYVQQIDSIEGQVTE  357
            +MN++VAEEYKGFGDVASGLRVFVEQLK+KSG+FDEYVQQID+IE QVTE
Sbjct  184  KMNLKVAEEYKGFGDVASGLRVFVEQLKNKSGNFDEYVQQIDTIEQQVTE  233



>ref|XP_001757268.1| predicted protein [Physcomitrella patens]
 gb|EDQ77753.1| predicted protein, partial [Physcomitrella patens]
Length=105

 Score = 90.1 bits (222),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 68/91 (75%), Gaps = 0/91 (0%)
 Frame = +1

Query  109  DHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLRVFVEQL  288
            D LA++L  LF NV+ +V+GELQ  N+  ELLERMN+RVA E+    D A GLRVFVE+L
Sbjct  1    DPLAKALQTLFLNVTTLVQGELQAANSEYELLERMNLRVASEHDNQADFAEGLRVFVERL  60

Query  289  KSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            K K+  F EY+QQID I+ +VTELEAVVS L
Sbjct  61   KQKNEGFTEYMQQIDEIDQEVTELEAVVSTL  91



>ref|XP_010929453.1| PREDICTED: biogenesis of lysosome-related organelles complex 
1 subunit 2-like [Elaeis guineensis]
Length=141

 Score = 82.4 bits (202),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +1

Query  208  RMNIRVAEEYKGFGDVASGLRVFVEQLKSKSGSFDEYVQQIDSIEGQVTELEAVVSM  378
            +MN RVAEEY GFGDVASGLRVF+E+   KS  FD+Y++Q+D+++ Q+TE EAVVSM
Sbjct  68   KMNQRVAEEYNGFGDVASGLRVFMEKQSEKSRGFDQYIRQVDAMDQQITEFEAVVSM  124



>dbj|BAB10768.1| phytoene dehydrogenase-like [Arabidopsis thaliana]
Length=647

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 38/58 (66%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +1

Query  208  RMNIRVAEEYKGFGDVASGLRVFVEQLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            +MN+RVA EY   GDVA+GLRVF EQ+KSKSG  DE+V Q+D+IE QV+E EAV+S+L
Sbjct  559  KMNLRVASEYDDMGDVAAGLRVFAEQMKSKSGGLDEFVGQMDAIEKQVSEFEAVISVL  616



>gb|KCW48251.1| hypothetical protein EUGRSUZ_K01979 [Eucalyptus grandis]
Length=113

 Score = 73.2 bits (178),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 65/88 (74%), Gaps = 3/88 (3%)
 Frame = +1

Query  109  DHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEY--KGFGDVASGLRVFVE  282
            D LAESLNDLF N+S MVK ELQ  NN LEL+E+MN RVAEE   +  G  A  +RV VE
Sbjct  4    DALAESLNDLFLNLSTMVKSELQGVNNQLELVEKMNQRVAEECGVRRRGVEAGSVRV-VE  62

Query  283  QLKSKSGSFDEYVQQIDSIEGQVTELEA  366
            QLKSKSG F EYV+QI++IE QVT  E+
Sbjct  63   QLKSKSGGFYEYVRQIEAIEEQVTHFES  90



>ref|XP_004352711.1| biogenesis of lysosome related family protein [Acanthamoeba castellanii 
str. Neff]
 gb|ELR23183.1| biogenesis of lysosome related family protein [Acanthamoeba castellanii 
str. Neff]
Length=175

 Score = 57.4 bits (137),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = +1

Query  103  DRDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLRVFVE  282
            ++  L  +   +F N+S+ ++GEL  T++  +LLE+MN    E+YK   D A+ L +F+E
Sbjct  37   NQKELIRNTEAMFKNISEYIQGELLVTSSDYKLLEQMNHVTTEKYKAMTDQATDLVLFME  96

Query  283  QLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            +L+ K  SF  Y+QQID+IE  V ELE  V ++
Sbjct  97   ELQKKYVSFQPYLQQIDTIEKSVDELERTVMLM  129



>ref|XP_002974644.1| hypothetical protein SELMODRAFT_442593 [Selaginella moellendorffii]
 gb|EFJ24164.1| hypothetical protein SELMODRAFT_442593 [Selaginella moellendorffii]
Length=125

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = +1

Query  103  DRDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLRVFVE  282
            D   LA+++  L  N++ + +GELQ      EL+E++N++V  EY  + D ASGL VFVE
Sbjct  16   DSSSLAKAMGGLALNLASVARGELQGAGTHAELIEKLNLKVGTEYDDYADFASGLLVFVE  75

Query  283  QLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            +LK ++ S    ++ I  I+ +V  LEA+VS L
Sbjct  76   RLKQQNESLCSNLKVIQEIDDEVRHLEAIVSTL  108



>emb|CCX32098.1| Similar to Probable biogenesis of lysosome-related organelles 
complex 1 subunit 2; acc. no. Q54Y67 [Pyronema omphalodes CBS 
100304]
Length=116

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 56/98 (57%), Gaps = 1/98 (1%)
 Frame = +1

Query  88   MASGDDRDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGL  267
            MA+   RD    ++ND   ++  +++ + + T   L+LL R+N   AE YK   D A GL
Sbjct  1    MAASAQRDP-TNAVNDTLASLENLIRLDTESTVGDLDLLVRVNKHAAERYKAMTDAAEGL  59

Query  268  RVFVEQLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
                E LK+K     +YV+Q+D ++ +VT+LEA+V  L
Sbjct  60   ETDSEHLKAKYAEVQKYVKQVDELDERVTDLEAIVREL  97



>ref|XP_002963355.1| hypothetical protein SELMODRAFT_405169 [Selaginella moellendorffii]
 gb|EFJ35226.1| hypothetical protein SELMODRAFT_405169 [Selaginella moellendorffii]
Length=102

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +1

Query  136  LFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLRVFVEQLKSKSGSFDE  315
            L  N++ + +GELQ      EL+E++N++V  EY  + D ASGL VFVE+LK ++ S   
Sbjct  4    LALNLASVARGELQGAGTHAELIEKLNLKVGTEYDDYADFASGLLVFVERLKQQNESLCS  63

Query  316  YVQQIDSIEGQVTELEAVVSML  381
             ++ I  I+ +V  LEA+VS L
Sbjct  64   NLKVIQEIDDEVRHLEAIVSTL  85



>ref|XP_004365636.1| hypothetical protein CAOG_00765 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE89255.1| hypothetical protein CAOG_000765 [Capsaspora owczarzaki ATCC 
30864]
Length=233

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 54/101 (53%), Gaps = 0/101 (0%)
 Frame = +1

Query  79   QTKMASGDDRDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVA  258
            Q+    G D  ++ +   ++F+ VS+ VKGEL+ +    +LL+ MN R AE+Y G   +A
Sbjct  116  QSPAPGGQDMANVEQLTREMFSRVSEYVKGELRLSAEDYKLLQVMNERTAEKYAGMTSLA  175

Query  259  SGLRVFVEQLKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            + L   +  L  K  S   Y+ QID IE  V ELE   + L
Sbjct  176  TNLNKTMAHLNEKQASLQPYLSQIDQIETMVEELEQTANRL  216



>ref|XP_002836154.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ80345.1| unnamed protein product [Tuber melanosporum]
Length=112

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 50/88 (57%), Gaps = 0/88 (0%)
 Frame = +1

Query  118  AESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLRVFVEQLKSK  297
            A ++ND+   +  +++ + + T   L+LL R+N+   E YK   D A GL    E L  K
Sbjct  7    ANNVNDVLATLENVIRADTEATVGDLDLLNRVNLHATERYKAIADAAVGLETDSEYLGQK  66

Query  298  SGSFDEYVQQIDSIEGQVTELEAVVSML  381
                ++Y QQ+D+++ +V +LEA+V  L
Sbjct  67   YAEIEKYKQQVDNLDERVGDLEAIVKEL  94



>ref|XP_003293642.1| hypothetical protein DICPUDRAFT_158535 [Dictyostelium purpureum]
 gb|EGC29844.1| hypothetical protein DICPUDRAFT_158535 [Dictyostelium purpureum]
Length=195

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 51/92 (55%), Gaps = 0/92 (0%)
 Frame = +1

Query  106  RDHLAESLNDLFTNVSKMVKGelqetnnllelleRMNIRVAEEYKGFGDVASGLRVFVEQ  285
            ++ L +S  ++FT VS  +KGEL  T     LL +MN     +Y+   ++  GL V++  
Sbjct  43   QEDLQKSTKEMFTKVSDYIKGELSTTVADYNLLIQMNNITTSKYQDMTNITKGLSVYMGD  102

Query  286  LKSKSGSFDEYVQQIDSIEGQVTELEAVVSML  381
            LK K   F  Y ++I+ ++  VTELE  V +L
Sbjct  103  LKLKYEEFQPYFEKINELDKNVTELEKTVQLL  134



>ref|XP_004366248.1| biogenesis of lysosome-related organelles complex-1 [Dictyostelium 
fasciculatum]
 gb|EGG18344.1| biogenesis of lysosome-related organelles complex-1 [Dictyostelium 
fasciculatum]
Length=202

 Score = 46.6 bits (109),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 34/126 (27%), Positives = 65/126 (52%), Gaps = 3/126 (2%)
 Frame = +1

Query  4    SSRSAILHQTHLAKERKEKGKH*ILQTKMASGDDRDHLAESLNDLFTNVSKMVKGelqet  183
            ++ +A   Q     E ++K ++ I + ++    D   L  S  ++FT VSK + GEL  T
Sbjct  42   TAATASTEQPKEVNEFQQKAQNDIARPQLPVQQD---LQASTTEMFTKVSKYLSGELATT  98

Query  184  nnllelleRMNIRVAEEYKGFGDVASGLRVFVEQLKSKSGSFDEYVQQIDSIEGQVTELE  363
                 LL +MN   + +Y    ++  GL +++  LK +   F  Y+++I+ ++  VT+LE
Sbjct  99   LADYNLLVQMNNVTSAKYHDMTEITKGLTLYMNDLKIQYEQFQPYIEKINDLDKNVTDLE  158

Query  364  AVVSML  381
              V ++
Sbjct  159  KTVQVI  164



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 567734137750