BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001E01

Length=259
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU37118.1|  hypothetical protein MIMGU_mgv1a022157mg                128   1e-35   Erythranthe guttata [common monkey flower]
ref|XP_006343565.1|  PREDICTED: cytochrome c oxidase subunit 6b-2...    125   5e-35   Solanum tuberosum [potatoes]
ref|XP_010103131.1|  Cytochrome c oxidase subunit 6b-1                  125   2e-34   
ref|XP_010047036.1|  PREDICTED: cytochrome c oxidase subunit 6b-2       124   2e-34   Eucalyptus grandis [rose gum]
ref|XP_011079340.1|  PREDICTED: cytochrome c oxidase subunit 6b-2       124   2e-34   Sesamum indicum [beniseed]
ref|XP_002454158.1|  hypothetical protein SORBIDRAFT_04g025700          123   3e-34   Sorghum bicolor [broomcorn]
ref|XP_004242645.1|  PREDICTED: cytochrome c oxidase subunit 6b-2       123   3e-34   Solanum lycopersicum
emb|CDP02891.1|  unnamed protein product                                122   6e-34   Coffea canephora [robusta coffee]
ref|XP_004953063.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...    122   8e-34   Setaria italica
ref|XP_010545443.1|  PREDICTED: cytochrome c oxidase subunit 6b-2       121   2e-33   Tarenaya hassleriana [spider flower]
ref|XP_007154837.1|  hypothetical protein PHAVU_003G151900g             121   2e-33   Phaseolus vulgaris [French bean]
gb|EPS74026.1|  hypothetical protein M569_00726                         129   3e-33   Genlisea aurea
ref|XP_003542317.1|  PREDICTED: cytochrome c oxidase subunit 6b-2...    120   3e-33   Glycine max [soybeans]
ref|XP_011069843.1|  PREDICTED: cytochrome c oxidase subunit 6b-2...    120   4e-33   Sesamum indicum [beniseed]
gb|AFK38546.1|  unknown                                                 120   4e-33   Lotus japonicus
ref|XP_009390533.1|  PREDICTED: cytochrome c oxidase subunit 6b-2...    120   4e-33   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN17535.1|  Cytochrome c oxidase subunit 6b-1                       120   4e-33   Glycine soja [wild soybean]
ref|XP_009349099.1|  PREDICTED: cytochrome c oxidase subunit 6b-2       120   5e-33   Pyrus x bretschneideri [bai li]
ref|XP_004309856.1|  PREDICTED: cytochrome c oxidase subunit 6b-2       120   6e-33   Fragaria vesca subsp. vesca
ref|XP_007226359.1|  hypothetical protein PRUPE_ppa022392mg             120   9e-33   
ref|XP_008452371.1|  PREDICTED: cytochrome c oxidase subunit 6b-2       119   1e-32   Cucumis melo [Oriental melon]
emb|CDY19008.1|  BnaC01g20600D                                          120   1e-32   Brassica napus [oilseed rape]
gb|ACU17340.1|  unknown                                                 119   1e-32   Glycine max [soybeans]
dbj|BAJ88586.1|  predicted protein                                      119   2e-32   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003580071.1|  PREDICTED: cytochrome c oxidase subunit 6b-2       119   2e-32   Brachypodium distachyon [annual false brome]
ref|XP_003549519.1|  PREDICTED: cytochrome c oxidase subunit 6b-3       119   2e-32   Glycine max [soybeans]
ref|XP_008360325.1|  PREDICTED: cytochrome c oxidase subunit 6b-2       118   2e-32   Malus domestica [apple tree]
ref|XP_008678787.1|  PREDICTED: cytochrome c oxidase subunit 6b-3       118   2e-32   
emb|CDX92861.1|  BnaC07g41190D                                          121   3e-32   
ref|XP_010483320.1|  PREDICTED: cytochrome c oxidase subunit 6b-2...    118   3e-32   Camelina sativa [gold-of-pleasure]
ref|XP_004144709.1|  PREDICTED: cytochrome c oxidase subunit 6b-2...    118   4e-32   Cucumis sativus [cucumbers]
ref|XP_008223569.1|  PREDICTED: cytochrome c oxidase subunit 6b-2...    118   4e-32   Prunus mume [ume]
ref|XP_009600161.1|  PREDICTED: cytochrome c oxidase subunit 6b-3       117   5e-32   Nicotiana tomentosiformis
ref|NP_001053212.1|  Os04g0498200                                       117   5e-32   
ref|XP_010268397.1|  PREDICTED: cytochrome c oxidase subunit 6b-2       117   5e-32   Nelumbo nucifera [Indian lotus]
ref|XP_010687691.1|  PREDICTED: cytochrome c oxidase subunit 6b-2       117   6e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010539459.1|  PREDICTED: cytochrome c oxidase subunit 6b-2...    117   6e-32   Tarenaya hassleriana [spider flower]
gb|KFK27323.1|  hypothetical protein AALP_AA8G367900                    117   6e-32   Arabis alpina [alpine rockcress]
ref|XP_004507784.1|  PREDICTED: cytochrome c oxidase subunit 6b-3...    117   7e-32   Cicer arietinum [garbanzo]
ref|XP_004976105.1|  PREDICTED: cytochrome c oxidase subunit 6b-3...    117   8e-32   Setaria italica
gb|EYU34304.1|  hypothetical protein MIMGU_mgv1a025239mg                117   9e-32   Erythranthe guttata [common monkey flower]
ref|XP_004162692.1|  PREDICTED: cytochrome c oxidase subunit 6b-2...    117   1e-31   
ref|NP_568867.1|  cytochrome c oxidase subunit 6b-2                     117   1e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010539460.1|  PREDICTED: cytochrome c oxidase subunit 6b-2...    117   1e-31   Tarenaya hassleriana [spider flower]
ref|XP_004144708.1|  PREDICTED: cytochrome c oxidase subunit 6b-2...    117   2e-31   
ref|XP_007013954.1|  Cytochrome c oxidase subunit 6b                    116   2e-31   Theobroma cacao [chocolate]
ref|XP_010278031.1|  PREDICTED: cytochrome c oxidase subunit 6b-2...    116   2e-31   Nelumbo nucifera [Indian lotus]
ref|XP_006453502.1|  hypothetical protein CICLE_v10010074mg             116   2e-31   Citrus clementina [clementine]
ref|XP_006284746.1|  hypothetical protein CARUB_v10006010mg             117   2e-31   
ref|XP_010914058.1|  PREDICTED: cytochrome c oxidase subunit 6b-3       115   3e-31   Elaeis guineensis
ref|XP_002271982.1|  PREDICTED: cytochrome c oxidase subunit 6b-2       115   3e-31   Vitis vinifera
ref|XP_002864529.1|  hypothetical protein ARALYDRAFT_918963             115   3e-31   Arabidopsis lyrata subsp. lyrata
ref|XP_002325099.1|  hypothetical protein POPTR_0018s10890g             115   3e-31   Populus trichocarpa [western balsam poplar]
ref|XP_002528213.1|  cytochrome C oxidase polypeptide vib, putative     115   4e-31   Ricinus communis
gb|AAM64280.1|  cytochrome c oxidase subunit 6b                         115   4e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008223568.1|  PREDICTED: cytochrome c oxidase subunit 6b-2...    115   5e-31   Prunus mume [ume]
ref|XP_010929208.1|  PREDICTED: cytochrome c oxidase subunit 6b-3...    115   5e-31   Elaeis guineensis
ref|XP_006412997.1|  hypothetical protein EUTSA_v10026527mg             117   6e-31   
ref|XP_009144153.1|  PREDICTED: cytochrome c oxidase subunit 6b-2       115   6e-31   Brassica rapa
ref|XP_010278029.1|  PREDICTED: cytochrome c oxidase subunit 6b-2...    117   6e-31   Nelumbo nucifera [Indian lotus]
gb|KJB21358.1|  hypothetical protein B456_004G104700                    115   6e-31   Gossypium raimondii
gb|KHG12789.1|  Cytochrome c oxidase subunit 6b-2 -like protein         115   6e-31   Gossypium arboreum [tree cotton]
ref|XP_010278032.1|  PREDICTED: cytochrome c oxidase subunit 6b-2...    114   1e-30   Nelumbo nucifera [Indian lotus]
gb|KHG12868.1|  Cytochrome c oxidase subunit 6b-1 -like protein         117   1e-30   Gossypium arboreum [tree cotton]
gb|KJB59908.1|  hypothetical protein B456_009G280300                    117   1e-30   Gossypium raimondii
ref|NP_194535.2|  cytochrome c oxidase, subunit 6b                      114   1e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008794399.1|  PREDICTED: cytochrome c oxidase subunit 6b-3...    114   2e-30   Phoenix dactylifera
ref|XP_009137757.1|  PREDICTED: cytochrome c oxidase subunit 6b-3...    114   2e-30   Brassica rapa
ref|XP_002867470.1|  hypothetical protein ARALYDRAFT_913717             114   2e-30   
emb|CDY46649.1|  BnaA07g10470D                                          117   2e-30   Brassica napus [oilseed rape]
emb|CDY00453.1|  BnaC07g13730D                                          116   2e-30   
ref|XP_009103236.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...    116   3e-30   Brassica rapa
gb|EYU36481.1|  hypothetical protein MIMGU_mgv1a015237mg                115   3e-30   Erythranthe guttata [common monkey flower]
ref|NP_001140389.1|  uncharacterized protein LOC100272443               115   3e-30   Zea mays [maize]
gb|ACG47964.1|  cytochrome c oxidase subunit                            115   4e-30   Zea mays [maize]
ref|NP_001050275.1|  Os03g0390400                                       115   4e-30   
ref|XP_008658230.1|  PREDICTED: uncharacterized protein LOC100272...    115   4e-30   Zea mays [maize]
ref|XP_006650155.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...    115   4e-30   Oryza brachyantha
ref|XP_007141211.1|  hypothetical protein PHAVU_008G176600g             115   4e-30   Phaseolus vulgaris [French bean]
gb|ACG48101.1|  cytochrome c oxidase subunit                            115   5e-30   Zea mays [maize]
ref|XP_006305630.1|  hypothetical protein CARUB_v10010326mg             115   5e-30   Capsella rubella
emb|CDY04815.1|  BnaC05g17740D                                          115   5e-30   
gb|EPS59241.1|  hypothetical protein M569_15568                         114   6e-30   Genlisea aurea
ref|XP_004299671.1|  PREDICTED: cytochrome c oxidase subunit 6b-1       115   7e-30   Fragaria vesca subsp. vesca
ref|XP_006305631.1|  hypothetical protein CARUB_v10010326mg             115   7e-30   
ref|XP_008658229.1|  PREDICTED: uncharacterized protein LOC100272...    115   9e-30   Zea mays [maize]
ref|XP_003615162.1|  Subunit 6b of cytochrome c oxidase                 115   9e-30   Medicago truncatula
gb|EEC75393.1|  hypothetical protein OsI_11877                          115   9e-30   Oryza sativa Indica Group [Indian rice]
gb|KHG00496.1|  Cytochrome c oxidase subunit 6b-1 -like protein         114   1e-29   Gossypium arboreum [tree cotton]
gb|KJB58993.1|  hypothetical protein B456_009G234400                    114   1e-29   Gossypium raimondii
ref|XP_009413575.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...    114   1e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010477504.1|  PREDICTED: cytochrome c oxidase subunit 6b-1       115   1e-29   Camelina sativa [gold-of-pleasure]
gb|KEH32587.1|  cytochrome C oxidase, subunit VIb family protein        112   1e-29   Medicago truncatula
ref|XP_008781379.1|  PREDICTED: cytochrome c oxidase subunit 6b-2...    111   1e-29   Phoenix dactylifera
ref|XP_010459999.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...    115   1e-29   Camelina sativa [gold-of-pleasure]
gb|EMT25976.1|  Cytochrome c oxidase subunit 6B                         114   1e-29   
dbj|BAJ94958.1|  predicted protein                                      114   1e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010521174.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...    114   1e-29   Tarenaya hassleriana [spider flower]
ref|XP_006433933.1|  hypothetical protein CICLE_v10002573mg             114   1e-29   Citrus clementina [clementine]
ref|XP_008386123.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...    114   1e-29   Malus domestica [apple tree]
gb|ACF79897.1|  unknown                                                 114   1e-29   Zea mays [maize]
ref|XP_003562686.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...    113   2e-29   Brachypodium distachyon [annual false brome]
ref|XP_004984149.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...    114   2e-29   Setaria italica
ref|XP_010272991.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...    114   2e-29   Nelumbo nucifera [Indian lotus]
ref|XP_010675986.1|  PREDICTED: cytochrome c oxidase subunit 6b-1       114   2e-29   Beta vulgaris subsp. vulgaris [field beet]
gb|AAM92706.1|  putative cytochrome c oxidase subunit                   113   2e-29   Triticum aestivum [Canadian hard winter wheat]
gb|KFK44340.1|  hypothetical protein AALP_AA1G245300                    114   2e-29   Arabis alpina [alpine rockcress]
gb|AAM63485.1|  cytochrome c oxidase subunit, putative                  114   2e-29   Arabidopsis thaliana [mouse-ear cress]
ref|NP_173661.1|  cytochrome C oxidase 6B                               114   2e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004252528.1|  PREDICTED: cytochrome c oxidase subunit 6b-1       113   3e-29   Solanum lycopersicum
ref|XP_006658829.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...    112   3e-29   Oryza brachyantha
ref|XP_010498713.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...    114   4e-29   Camelina sativa [gold-of-pleasure]
ref|XP_003544809.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...    113   4e-29   Glycine max [soybeans]
gb|KHN26096.1|  Cytochrome c oxidase subunit 6b-1                       113   4e-29   Glycine soja [wild soybean]
gb|KHN35491.1|  Cytochrome c oxidase subunit 6b-1                       113   4e-29   Glycine soja [wild soybean]
ref|XP_004490381.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...    113   4e-29   Cicer arietinum [garbanzo]
ref|NP_001236320.1|  uncharacterized protein LOC100306272               113   4e-29   
ref|XP_009777811.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...    113   4e-29   Nicotiana sylvestris
ref|XP_006472562.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...    113   4e-29   Citrus sinensis [apfelsine]
ref|XP_002890515.1|  hypothetical protein ARALYDRAFT_889753             113   4e-29   Arabidopsis lyrata subsp. lyrata
ref|XP_009145340.1|  PREDICTED: cytochrome c oxidase subunit 6b-1       112   4e-29   Brassica rapa
ref|XP_009632005.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...    113   4e-29   Nicotiana tomentosiformis
ref|XP_007225925.1|  hypothetical protein PRUPE_ppa012107mg             113   4e-29   Prunus persica
ref|XP_006360302.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...    113   5e-29   
ref|XP_007018715.1|  Cytochrome C oxidase polypeptide vib, putative     113   5e-29   
ref|XP_011009575.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...    113   5e-29   Populus euphratica
gb|AFK42242.1|  unknown                                                 112   5e-29   Lotus japonicus
ref|XP_010025934.1|  PREDICTED: cytochrome c oxidase subunit 6b-1       113   5e-29   Eucalyptus grandis [rose gum]
ref|XP_009623905.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...    113   6e-29   Nicotiana tomentosiformis
ref|XP_011074207.1|  PREDICTED: cytochrome c oxidase subunit 6b-1       113   6e-29   Sesamum indicum [beniseed]
ref|XP_009373072.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...    112   7e-29   Pyrus x bretschneideri [bai li]
ref|NP_001131473.1|  hypothetical protein                               112   7e-29   Zea mays [maize]
ref|XP_009799940.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...    112   7e-29   Nicotiana sylvestris
emb|CDY41480.1|  BnaA08g20820D                                          110   7e-29   Brassica napus [oilseed rape]
ref|XP_002307362.1|  cytochrome c oxidase 6b family protein             112   8e-29   Populus trichocarpa [western balsam poplar]
gb|ABK96664.1|  unknown                                                 112   8e-29   Populus trichocarpa x Populus deltoides
ref|XP_009373077.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...    111   8e-29   Pyrus x bretschneideri [bai li]
gb|KHG23610.1|  Cytochrome c oxidase subunit 6b-1 -like protein         109   8e-29   Gossypium arboreum [tree cotton]
ref|XP_009110136.1|  PREDICTED: cytochrome c oxidase subunit 6b-3...    110   9e-29   Brassica rapa
ref|XP_004958350.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...    112   9e-29   Setaria italica
gb|ABK92629.1|  unknown                                                 112   1e-28   Populus trichocarpa [western balsam poplar]
gb|KDP41415.1|  hypothetical protein JCGZ_15822                         112   1e-28   Jatropha curcas
emb|CDX91679.1|  BnaC08g05980D                                          110   1e-28   
ref|XP_003557780.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...    112   1e-28   Brachypodium distachyon [annual false brome]
gb|KJB21359.1|  hypothetical protein B456_004G104700                    109   1e-28   Gossypium raimondii
ref|XP_006363287.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...    112   1e-28   Solanum tuberosum [potatoes]
ref|XP_010267072.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...    111   2e-28   Nelumbo nucifera [Indian lotus]
ref|XP_008356355.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...    110   2e-28   Malus domestica [apple tree]
ref|XP_002463195.1|  hypothetical protein SORBIDRAFT_02g039590          112   2e-28   
ref|XP_010535301.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome c...    111   2e-28   Tarenaya hassleriana [spider flower]
ref|XP_008219336.1|  PREDICTED: cytochrome c oxidase subunit 6b-1       111   2e-28   Prunus mume [ume]
gb|KDP38756.1|  hypothetical protein JCGZ_04109                         108   2e-28   Jatropha curcas
ref|XP_004152624.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...    111   3e-28   Cucumis sativus [cucumbers]
dbj|BAJ88460.1|  predicted protein                                      108   3e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEC82467.1|  hypothetical protein OsI_26908                          111   4e-28   Oryza sativa Indica Group [Indian rice]
dbj|BAC10187.1|  putative cytochrome c oxidase subunit 6b-1             110   4e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008782171.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...    111   5e-28   Phoenix dactylifera
ref|XP_010916711.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...    109   5e-28   
gb|ABK95863.1|  unknown                                                 110   6e-28   Populus trichocarpa [western balsam poplar]
gb|AFK39313.1|  unknown                                                 107   6e-28   Medicago truncatula
ref|XP_010916710.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...    109   7e-28   Elaeis guineensis
ref|XP_008444857.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...    110   7e-28   Cucumis melo [Oriental melon]
ref|XP_010534085.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...    109   7e-28   Tarenaya hassleriana [spider flower]
ref|XP_011016796.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...    109   9e-28   Populus euphratica
ref|XP_010534086.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...    108   1e-27   Tarenaya hassleriana [spider flower]
ref|XP_004237938.1|  PREDICTED: cytochrome c oxidase subunit 6b-1       109   1e-27   Solanum lycopersicum
ref|XP_002513958.1|  cytochrome C oxidase polypeptide vib, putative     109   2e-27   Ricinus communis
gb|EEC77562.1|  hypothetical protein OsI_16493                          105   2e-27   Oryza sativa Indica Group [Indian rice]
ref|XP_009409166.1|  PREDICTED: cytochrome c oxidase subunit 6b-1       108   2e-27   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABK23476.1|  unknown                                                 108   2e-27   Picea sitchensis
emb|CDP01101.1|  unnamed protein product                                109   2e-27   Coffea canephora [robusta coffee]
ref|XP_002282064.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...    108   3e-27   Vitis vinifera
ref|XP_006453501.1|  hypothetical protein CICLE_v10010074mg             105   3e-27   
ref|XP_002282033.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...    108   3e-27   Vitis vinifera
gb|EAZ40696.1|  hypothetical protein OsJ_25165                          110   3e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010658140.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...    108   4e-27   Vitis vinifera
gb|KJB76600.1|  hypothetical protein B456_012G096600                    105   5e-27   Gossypium raimondii
emb|CAB36775.1|  putative protein                                       107   6e-27   Arabidopsis thaliana [mouse-ear cress]
gb|ABK23944.1|  unknown                                                 105   6e-27   Picea sitchensis
ref|XP_002281992.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...    107   7e-27   Vitis vinifera
emb|CBI25309.3|  unnamed protein product                                108   1e-26   Vitis vinifera
ref|XP_008804786.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...    106   1e-26   Phoenix dactylifera
ref|XP_010274628.1|  PREDICTED: cytochrome c oxidase subunit 6b-3...    103   1e-26   
ref|XP_010926331.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...    107   1e-26   Elaeis guineensis
ref|XP_010929209.1|  PREDICTED: cytochrome c oxidase subunit 6b-3...    103   2e-26   Elaeis guineensis
ref|XP_006416198.1|  hypothetical protein EUTSA_v10008804mg             106   2e-26   
gb|KJB58992.1|  hypothetical protein B456_009G234400                    106   3e-26   Gossypium raimondii
emb|CAE01625.3|  OSJNBa0029H02.2                                        102   7e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004984148.1|  PREDICTED: cytochrome c oxidase subunit 6b-1...    104   1e-25   
ref|XP_008658228.1|  PREDICTED: uncharacterized protein LOC100272...    104   1e-25   
ref|XP_001784031.1|  predicted protein                                  100   3e-25   
ref|XP_008658227.1|  PREDICTED: uncharacterized protein LOC100272...    104   3e-25   Zea mays [maize]
gb|KHN25113.1|  Cytochrome c oxidase subunit 6b-3                       100   3e-25   Glycine soja [wild soybean]
gb|KHN34761.1|  Cytochrome c oxidase subunit 6b-2                       100   5e-25   Glycine soja [wild soybean]
gb|ABK26488.1|  unknown                                                 101   9e-25   Picea sitchensis
gb|KDO81040.1|  hypothetical protein CISIN_1g029538mg                   102   1e-24   Citrus sinensis [apfelsine]
gb|ACW82405.1|  cytochrome c oxidase subunit 6b                         101   2e-24   Larix kaempferi [karamatsu]
ref|XP_006845475.1|  hypothetical protein AMTR_s00019p00135210        99.0    2e-24   
ref|XP_006386412.1|  hypothetical protein POPTR_0002s10020g             100   5e-24   Populus trichocarpa [western balsam poplar]
ref|XP_006828021.1|  hypothetical protein AMTR_s00008p00250560        99.0    5e-24   
gb|KJB76603.1|  hypothetical protein B456_012G096600                  97.1    6e-24   Gossypium raimondii
ref|XP_008643509.1|  PREDICTED: uncharacterized protein LOC100192...  98.6    1e-23   Zea mays [maize]
ref|XP_004148521.1|  PREDICTED: putative cytochrome c oxidase sub...  97.8    2e-23   
gb|KDP45959.1|  hypothetical protein JCGZ_11862                       95.5    1e-22   Jatropha curcas
ref|XP_008465918.1|  PREDICTED: putative cytochrome c oxidase sub...  95.1    2e-22   Cucumis melo [Oriental melon]
ref|XP_001763315.1|  predicted protein                                92.0    4e-22   
ref|XP_002989279.1|  hypothetical protein SELMODRAFT_129448           92.0    6e-22   
ref|XP_003559516.1|  PREDICTED: cytochrome c oxidase subunit 6b-3...  93.2    7e-22   Brachypodium distachyon [annual false brome]
ref|XP_005646865.1|  cytochrome c oxidase subunit H                   91.7    8e-22   Coccomyxa subellipsoidea C-169
ref|XP_002965431.1|  hypothetical protein SELMODRAFT_84137            91.3    9e-22   
gb|AAP80832.1|  cytochrome c oxidase subunit 6b-1                     90.9    2e-21   Griffithsia japonica
ref|XP_002528789.1|  cytochrome C oxidase polypeptide vib, putative   90.1    1e-20   
emb|CAN71453.1|  hypothetical protein VITISV_018238                   94.4    1e-20   Vitis vinifera
gb|KCW71840.1|  hypothetical protein EUGRSUZ_E00322                   88.6    1e-20   Eucalyptus grandis [rose gum]
gb|ABQ41966.1|  cytochrome c oxidase subunit                          87.4    7e-20   Sonneratia caseolaris
gb|ABQ41965.1|  cytochrome c oxidase subunit                          87.4    8e-20   Sonneratia alba
gb|ABQ41968.1|  cytochrome c oxidase subunit                          87.4    9e-20   Sonneratia apetala
gb|ABQ41967.1|  cytochrome c oxidase subunit                          87.4    9e-20   Sonneratia ovata
ref|XP_005707710.1|  cytochrome c oxidase subunit VIb                 86.3    1e-19   Galdieria sulphuraria
gb|KHN24386.1|  Cytochrome c oxidase subunit 6b-3                     85.1    2e-19   Glycine soja [wild soybean]
ref|NP_001048358.1|  Os02g0791400                                     85.5    3e-19   
ref|XP_011395893.1|  Cytochrome c oxidase subunit 6B                  86.3    3e-19   Auxenochlorella protothecoides
gb|EEC74151.1|  hypothetical protein OsI_09238                        85.1    3e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_005715645.1|  Cytochrome c oxidase subunit 6b-1                84.7    4e-19   Chondrus crispus [carageen]
ref|XP_003064158.1|  predicted protein                                84.7    9e-19   Micromonas pusilla CCMP1545
ref|XP_007342910.1|  cytochrome c oxidase, subunit VIb                83.6    2e-18   
ref|XP_002109684.1|  hypothetical protein TRIADDRAFT_21297            83.2    2e-18   Trichoplax adhaerens
ref|XP_007512788.1|  predicted protein                                83.2    4e-18   Bathycoccus prasinos
ref|XP_002978684.1|  hypothetical protein SELMODRAFT_59940            81.6    6e-18   
ref|XP_003083867.1|  putative cytochrome c oxidase subunit 6b-1 (...  82.0    7e-18   Ostreococcus tauri
ref|XP_011389179.1|  putative cytochrome c oxidase subunit VIb        81.6    7e-18   Ustilago maydis 521
gb|KIM84395.1|  hypothetical protein PILCRDRAFT_6626                  81.6    8e-18   Piloderma croceum F 1598
ref|XP_002965634.1|  hypothetical protein SELMODRAFT_39649            80.9    8e-18   
ref|XP_007393250.1|  hypothetical protein PHACADRAFT_251841           81.3    1e-17   Phanerochaete carnosa HHB-10118-sp
ref|XP_004927405.1|  PREDICTED: serine/arginine repetitive matrix...  81.3    1e-17   Bombyx mori [silk moth]
gb|EMD33294.1|  hypothetical protein CERSUDRAFT_117921                81.3    1e-17   Gelatoporia subvermispora B
emb|CCM04696.1|  predicted protein                                    82.0    1e-17   Fibroporia radiculosa
ref|XP_001421861.1|  predicted protein                                80.5    1e-17   Ostreococcus lucimarinus CCE9901
ref|XP_008039169.1|  cytochrome c oxidase subunit VIb                 80.9    1e-17   Trametes versicolor FP-101664 SS1
gb|KHN24387.1|  Cytochrome c oxidase subunit 6b-3                     80.5    2e-17   Glycine soja [wild soybean]
gb|KIK44418.1|  hypothetical protein CY34DRAFT_802731                 80.9    2e-17   Suillus luteus UH-Slu-Lm8-n1
ref|XP_001744850.1|  hypothetical protein                             80.5    2e-17   Monosiga brevicollis MX1
ref|XP_005732012.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  80.5    2e-17   Pundamilia nyererei
ref|XP_003450733.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  80.5    2e-17   Oreochromis niloticus
ref|XP_010883232.1|  PREDICTED: cytochrome c oxidase subunit 6B1      80.5    2e-17   Esox lucius
emb|CCF52863.1|  probable COX12-cytochrome-c oxidase, subunit VIB     80.1    2e-17   Ustilago hordei
ref|XP_007387899.1|  cytochrome c oxidase subunit VIb                 80.1    3e-17   Punctularia strigosozonata HHB-11173 SS5
emb|CEG63622.1|  Putative Cytochrome c oxidase subunit 6b             80.1    3e-17   Rhizopus microsporus
gb|KIP10969.1|  hypothetical protein PHLGIDRAFT_114891                79.7    3e-17   Phlebiopsis gigantea 11061_1 CR5-6
gb|KIK63200.1|  hypothetical protein GYMLUDRAFT_41528                 79.7    4e-17   Gymnopus luxurians FD-317 M1
gb|KFH65271.1|  cytochrome c oxidase subunit VIb                      79.3    5e-17   Mortierella verticillata NRRL 6337
ref|XP_005644079.1|  cytochrome c oxidase subunit H                   80.5    5e-17   Coccomyxa subellipsoidea C-169
ref|XP_006802982.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  79.3    6e-17   Neolamprologus brichardi [lyretail cichlid]
gb|EPS93615.1|  cytochrome c oxidase subunit VIb                      79.3    6e-17   Fomitopsis pinicola FP-58527 SS1
emb|CDI53501.1|  probable COX12-cytochrome-c oxidase, subunit VIB     79.3    6e-17   Melanopsichium pennsylvanicum 4
gb|EST05549.1|  cytochrome c oxidase, subunit VIb/COX12               79.3    6e-17   Kalmanozyma brasiliensis GHG001
gb|EHJ78864.1|  hypothetical protein KGM_10332                        79.0    7e-17   
dbj|BAM18074.1|  cytochrome c oxidase,-subunit VIb                    79.0    7e-17   Papilio xuthus [Chinese swallowtail]
gb|KDN53415.1|  putative COX12-cytochrome-c oxidase, subunit VIB      79.0    7e-17   Tilletiaria anomala UBC 951
gb|EFX84358.1|  hypothetical protein DAPPUDRAFT_230594                79.0    7e-17   Daphnia pulex
ref|XP_004986287.1|  PREDICTED: uncharacterized protein LOC101775406  82.0    8e-17   
emb|CDH58799.1|  cytochrome c oxidase subunit vib                     79.0    8e-17   Lichtheimia corymbifera JMRC:FSU:9682
ref|NP_001165174.1|  cytochrome c oxidase subunit VIb polypeptide...  79.0    8e-17   Xenopus laevis [clawed frog]
ref|XP_007262758.1|  cytochrome c oxidase, subunit VIb                79.0    9e-17   Fomitiporia mediterranea MF3/22
gb|KIK25075.1|  hypothetical protein PISMIDRAFT_677628                79.0    9e-17   Pisolithus microcarpus 441
ref|NP_001165173.1|  cytochrome c oxidase subunit VIb polypeptide...  78.6    1e-16   Xenopus laevis [clawed frog]
ref|XP_007299744.1|  cytochrome c oxidase subunit VIb                 78.6    1e-16   Stereum hirsutum FP-91666 SS1
gb|KIO14980.1|  hypothetical protein M404DRAFT_991719                 78.6    1e-16   Pisolithus tinctorius Marx 270
emb|CBQ73024.1|  probable COX12-cytochrome-c oxidase, subunit VIB     78.6    1e-16   Sporisorium reilianum SRZ2
ref|XP_007371404.1|  cytochrome c oxidase subunit VIb                 78.6    1e-16   Dichomitus squalens LYAD-421 SS1
gb|KDQ53110.1|  hypothetical protein JAAARDRAFT_39484                 78.6    1e-16   Jaapia argillacea MUCL 33604
gb|KIY68835.1|  cytochrome c oxidase subunit VIb                      78.6    1e-16   Cylindrobasidium torrendii FP15055 ss-10
gb|KFH71317.1|  cytochrome c oxidase subunit VIb                      78.2    1e-16   Mortierella verticillata NRRL 6337
dbj|GAC71816.1|  cytochrome c oxidase, subunit VIb/COX12              79.7    1e-16   Moesziomyces antarcticus T-34
gb|AAP88308.1|  cytochrome c oxidase polypeptide VIb                  78.2    1e-16   Drosophila simulans
ref|XP_003032240.1|  hypothetical protein SCHCODRAFT_85217            78.2    1e-16   Schizophyllum commune H4-8
ref|XP_006960765.1|  cytochrome c oxidase, subunit VIb                78.2    2e-16   Wallemia mellicola CBS 633.66
ref|NP_001005102.1|  cytochrome c oxidase subunit 6B1                 78.2    2e-16   Xenopus tropicalis [western clawed frog]
gb|AGO12712.1|  AaceriADR240Cp                                        77.8    2e-16   Saccharomycetaceae sp. 'Ashbya aceri'
ref|NP_984336.1|  ADR240Cp                                            77.8    2e-16   
ref|XP_007877792.1|  hypothetical protein PFL1_02090                  77.8    2e-16   
ref|WP_017455654.1|  hypothetical protein                             77.4    3e-16   
ref|XP_002427088.1|  cytochrome c oxidase subunit VIb isoform 1, ...  77.4    3e-16   
emb|CDK28523.1|  unnamed protein product                              77.0    3e-16   
gb|KIM62787.1|  hypothetical protein SCLCIDRAFT_24841                 77.4    4e-16   
ref|XP_006674976.1|  hypothetical protein BATDEDRAFT_8182             77.4    4e-16   
gb|KIJ51207.1|  hypothetical protein M422DRAFT_244393                 77.0    4e-16   
gb|KII84452.1|  hypothetical protein PLICRDRAFT_46358                 77.0    5e-16   
ref|XP_008320814.1|  PREDICTED: cytochrome c oxidase subunit 6B1      77.0    5e-16   
ref|XP_008303262.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  77.0    5e-16   
ref|NP_001165815.1|  cytochrome c oxidase subunit 6B1                 76.6    5e-16   
emb|CDS07306.1|  Putative Cytochrome c oxidase subunit 6b             76.6    6e-16   
ref|XP_007765493.1|  cytochrome c oxidase subunit VIb                 76.6    7e-16   
ref|XP_002493850.1|  Subunit VIb of cytochrome c oxidase              76.3    8e-16   
ref|XP_004994976.1|  cytochrome c oxidase polypeptide VIb             76.6    8e-16   
emb|CAF97940.1|  unnamed protein product                              76.3    8e-16   
ref|XP_571555.1|  hypothetical protein CNF01340                       76.3    9e-16   
ref|XP_003686491.1|  hypothetical protein TPHA_0G02210                76.3    9e-16   
ref|XP_002064719.1|  GK15083                                          75.9    1e-15   
ref|XP_006814663.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  75.9    1e-15   
gb|EPX70840.1|  cytochrome c oxidase subunit VIb                      76.3    1e-15   
ref|XP_009013960.1|  hypothetical protein HELRODRAFT_75683            75.9    1e-15   
ref|XP_006459144.1|  COX6B subunit VIb of cytochrome c oxidase        76.3    1e-15   
gb|EMS18372.1|  cytochrome c oxidase subunit VIb                      75.9    1e-15   
gb|EPB85052.1|  cytochrome c oxidase subunit 6b                       75.9    1e-15   
gb|EKG18120.1|  Cytochrome c oxidase subunit VIb                      75.9    1e-15   
emb|CCA67044.1|  probable COX12-cytochrome-c oxidase, subunit VIB     75.9    1e-15   
ref|XP_005798838.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  75.9    1e-15   
emb|CEP15129.1|  hypothetical protein                                 75.9    1e-15   
ref|XP_007331472.1|  COX6B subunit VIb of cytochrome c oxidase        75.9    1e-15   
gb|KIJ14205.1|  hypothetical protein PAXINDRAFT_79676                 75.5    1e-15   
gb|ACO09529.1|  Cytochrome c oxidase subunit VIb isoform 1            75.9    1e-15   
emb|CDH49691.1|  cytochrome c oxidase subunit vib                     75.9    1e-15   
ref|XP_003966298.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  75.9    1e-15   
ref|XP_785769.2|  PREDICTED: cytochrome c oxidase subunit 6B1-like    75.5    1e-15   
emb|CDO91794.1|  unnamed protein product                              75.5    2e-15   
gb|EUC57569.1|  COX6B subunit VIb of cytochrome C oxidase             75.5    2e-15   
ref|XP_001963575.1|  GF20466                                          75.1    2e-15   
ref|XP_007550136.1|  PREDICTED: cytochrome c oxidase subunit 6B1      75.5    2e-15   
ref|XP_006804274.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  75.5    2e-15   
ref|XP_008584078.1|  PREDICTED: cytochrome c oxidase subunit 6B1      75.1    2e-15   
gb|ACI67996.1|  Cytochrome c oxidase subunit VIb isoform 1            75.1    2e-15   
ref|XP_004078004.1|  PREDICTED: cytochrome c oxidase subunit 6B1      75.1    2e-15   
gb|KDE07254.1|  cytochrome c oxidase subunit 6B                       75.1    2e-15   
ref|XP_004089249.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  75.5    2e-15   
gb|KIL67478.1|  hypothetical protein M378DRAFT_159292                 75.1    2e-15   
ref|NP_588322.2|  cytochrome c oxidase subunit VIb (predicted)        75.1    2e-15   
gb|AAP36312.1|  Homo sapiens cytochrome c oxidase subunit VIb         75.1    3e-15   
ref|NP_001125213.1|  cytochrome c oxidase subunit 6B1                 75.1    3e-15   
ref|NP_001854.1|  cytochrome c oxidase subunit 6B1                    75.1    3e-15   
ref|XP_003915408.1|  PREDICTED: cytochrome c oxidase subunit 6B1      75.1    3e-15   
gb|ENN73614.1|  hypothetical protein YQE_09861                        74.7    3e-15   
gb|EPY52005.1|  cytochrome c oxidase subunit VIb                      74.7    3e-15   
ref|XP_008190597.1|  PREDICTED: cytochrome c oxidase subunit 6B2 ...  75.5    3e-15   
gb|ACQ58800.1|  Cytochrome c oxidase subunit VIb isoform 1            74.7    3e-15   
gb|ACQ57987.1|  Cytochrome c oxidase subunit VIb isoform 1            74.7    3e-15   
ref|XP_002722267.1|  PREDICTED: cytochrome c oxidase subunit 6B1      74.7    3e-15   
dbj|BAO40090.1|  cytochrome c oxidase subunit 6B                      74.7    3e-15   
ref|XP_001862365.1|  cytochrome c oxidase,-subunit VIb                74.7    3e-15   
gb|KIR86331.1|  cytochrome c oxidase subunit 6b                       74.7    4e-15   
ref|XP_010895184.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  74.7    4e-15   
gb|KGB75864.1|  cytochrome c oxidase subunit 6b                       74.3    4e-15   
gb|ADY18356.1|  cytochrome c oxidase subunit VIb                      74.3    4e-15   
ref|XP_010948401.1|  PREDICTED: cytochrome c oxidase subunit 6B1      75.5    4e-15   
gb|AAR09978.1|  similar to Drosophila melanogaster CG14235            74.7    4e-15   
ref|XP_004179208.1|  hypothetical protein TBLA_0B08740                74.3    4e-15   
ref|NP_728295.1|  cytochrome c oxidase subunit VIb, isoform B         74.3    4e-15   
ref|XP_974620.1|  PREDICTED: cytochrome c oxidase subunit 6B2 iso...  74.3    4e-15   
ref|XP_008429715.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  74.3    5e-15   
ref|XP_009545239.1|  hypothetical protein HETIRDRAFT_148489           74.3    5e-15   
ref|XP_004659984.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  74.3    5e-15   
emb|CDQ75523.1|  unnamed protein product                              74.7    5e-15   
ref|XP_010367581.1|  PREDICTED: cytochrome c oxidase subunit 6B1      74.3    5e-15   
gb|ACI66506.1|  Cytochrome c oxidase subunit VIb isoform 1            74.3    5e-15   
ref|NP_079904.1|  cytochrome c oxidase subunit 6B1                    74.3    5e-15   
ref|XP_010895183.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  74.7    6e-15   
ref|XP_010749954.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  73.9    6e-15   
ref|XP_003505603.1|  PREDICTED: cytochrome c oxidase subunit 6B1      73.9    6e-15   
ref|XP_003280092.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  73.9    6e-15   
gb|EDM07730.1|  rCG53767                                              73.9    6e-15   
gb|ESW99527.1|  cytochrome c oxidase subunit VIb                      74.3    6e-15   
ref|XP_007532683.1|  PREDICTED: cytochrome c oxidase subunit 6B1      73.9    7e-15   
ref|XP_455857.1|  hypothetical protein                                73.9    7e-15   
ref|XP_008545034.1|  PREDICTED: cytochrome c oxidase subunit 6B1      73.9    7e-15   
ref|NP_001165874.1|  cytochrome c oxidase subunit VIb polypeptide 1   73.9    7e-15   
gb|ACO08418.1|  Cytochrome c oxidase subunit VIb isoform 1            73.9    7e-15   
ref|XP_008293980.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  73.9    7e-15   
ref|XP_007587440.1|  putative cytochrome c oxidase polypeptide vi...  73.9    7e-15   
ref|XP_007101122.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  73.9    8e-15   
ref|XP_002024406.1|  GL14818                                          73.6    8e-15   
ref|XP_006171699.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  73.9    8e-15   
ref|XP_003673351.1|  hypothetical protein NCAS_0A04060                73.6    8e-15   
ref|XP_005081861.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  73.6    9e-15   
ref|XP_006184471.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  73.6    9e-15   
ref|XP_003452739.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  73.6    9e-15   
emb|CDR42382.1|  CYFA0S09e02410g1_1                                   73.6    9e-15   
ref|XP_008714934.1|  hypothetical protein HMPREF1541_02357            73.9    9e-15   
ref|XP_002173711.1|  cytochrome c oxidase subunit VIb                 73.6    9e-15   
gb|KDR14446.1|  Cytochrome c oxidase subunit 6B                       73.6    9e-15   
ref|XP_003195015.1|  hypothetical protein CGB_F4700C                  73.6    1e-14   
gb|KIV83305.1|  hypothetical protein PV11_05340                       73.6    1e-14   
ref|XP_003707648.1|  PREDICTED: cytochrome c oxidase subunit 6B2-...  73.6    1e-14   
gb|ADI40593.1|  cytochrome c oxidase subunit VIb polypeptide 1        73.2    1e-14   
ref|XP_006982116.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  73.6    1e-14   
gb|KDQ24589.1|  subunit VIb of cytochrome c oxidase, COX6B            73.6    1e-14   
ref|XP_001644818.1|  hypothetical protein Kpol_1041p18                73.2    1e-14   
ref|XP_006867418.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  73.2    1e-14   
emb|CCO28530.1|  cytochrome c oxidase subunit VIb                     73.2    1e-14   
ref|XP_007953041.1|  PREDICTED: cytochrome c oxidase subunit 6B1      73.2    1e-14   
ref|XP_004439802.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  73.2    1e-14   
gb|AAQ14281.1|AF255947_1  cytochrome c oxidase subunit VIb precursor  73.2    1e-14   
ref|XP_003969110.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  73.2    1e-14   
gb|EIF47242.1|  cytochrome c oxidase subunit vib                      73.6    1e-14   
ref|XP_005400035.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  73.2    1e-14   
ref|XP_004600792.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  73.2    1e-14   
ref|XP_001838761.2|  hypothetical protein CC1G_13336                  73.2    1e-14   
ref|XP_008434508.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  73.2    1e-14   
ref|XP_003938732.1|  PREDICTED: cytochrome c oxidase subunit 6B1      73.2    1e-14   
gb|ADI40596.1|  cytochrome c oxidase subunit VIb polypeptide 1        72.8    1e-14   
ref|XP_010748655.1|  PREDICTED: cytochrome c oxidase subunit 6B1      73.2    1e-14   
gb|KFM74266.1|  Cytochrome c oxidase subunit 6B1                      73.2    1e-14   
gb|KFZ12815.1|  hypothetical protein V502_06919                       73.2    1e-14   
ref|XP_006899733.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  73.2    1e-14   
gb|KFX86820.1|  hypothetical protein V490_08809                       73.2    1e-14   
ref|XP_005745244.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  73.2    2e-14   
ref|XP_008312477.1|  PREDICTED: cytochrome c oxidase subunit 6B1      73.2    2e-14   
gb|EHH29933.1|  Cytochrome c oxidase subunit VIb isoform 1            73.6    2e-14   
ref|XP_006765065.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  72.8    2e-14   
ref|XP_004902244.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  72.8    2e-14   
ref|XP_006758439.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  72.8    2e-14   
ref|XP_003647286.1|  hypothetical protein Ecym_6069                   72.8    2e-14   
ref|XP_444921.1|  hypothetical protein                                72.8    2e-14   
ref|XP_001642972.1|  hypothetical protein Kpol_1046p4                 72.8    2e-14   
ref|XP_009229971.1|  cytochrome c oxidase subunit 6B                  72.8    2e-14   
ref|XP_006217116.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  72.8    2e-14   
ref|XP_008138046.1|  PREDICTED: cytochrome c oxidase subunit 6B1      72.8    2e-14   
ref|NP_001035371.1|  cytochrome c oxidase subunit 6B1                 72.8    2e-14   
gb|ELK29283.1|  Cytochrome c oxidase subunit 6B1                      73.6    2e-14   
ref|XP_006098728.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  72.8    2e-14   
ref|XP_001492435.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  72.8    2e-14   
ref|XP_011123340.1|  hypothetical protein AOL_s00081g221              72.8    2e-14   
gb|KIX04039.1|  hypothetical protein Z518_07592                       73.2    2e-14   
emb|CEP61015.1|  LALA0S02e04830g1_1                                   72.8    2e-14   
ref|XP_006765062.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  72.8    2e-14   
ref|XP_855469.1|  PREDICTED: cytochrome c oxidase subunit 6B1-lik...  72.8    2e-14   
ref|XP_003225071.1|  PREDICTED: cytochrome c oxidase subunit 6B1 ...  72.8    2e-14   
ref|NP_788848.1|  cytochrome c oxidase subunit 6B1                    72.8    2e-14   
ref|XP_004765148.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  72.8    2e-14   
ref|XP_005664554.1|  PREDICTED: cytochrome c oxidase subunit 6B1 ...  72.8    2e-14   
ref|XP_004690622.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  72.8    2e-14   
ref|XP_004015238.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  72.8    2e-14   
ref|XP_007471061.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  72.8    2e-14   
ref|XP_005692355.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  72.4    2e-14   
emb|CDO74366.1|  hypothetical protein BN946_scf184355.g14             73.2    2e-14   
gb|KJA23014.1|  hypothetical protein HYPSUDRAFT_201810                72.4    2e-14   
ref|XP_002920921.1|  PREDICTED: cytochrome c oxidase subunit 6B1      72.4    2e-14   
pdb|1OCC|H  Chain H, Structure Of Bovine Heart Cytochrome C Oxida...  72.4    2e-14   
gb|ADI40594.1|  cytochrome c oxidase subunit VIb polypeptide 1        72.4    2e-14   
prf||1614425A  chymodenin                                             72.4    2e-14
ref|XP_001653503.1|  AAEL008887-PA                                    72.4    2e-14   
emb|CDF88452.1|  BN860_10616g1_1                                      72.4    3e-14   
ref|XP_008710335.1|  PREDICTED: cytochrome c oxidase subunit 6B1      72.4    3e-14   
gb|ELR05726.1|  cytochrome c oxidase subunit VIb                      72.4    3e-14   
ref|XP_003796178.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  72.4    3e-14   
ref|NP_956800.1|  cytochrome c oxidase subunit VIb polypeptide 2      72.4    3e-14   
emb|CCK68260.1|  hypothetical protein KNAG_0A05980                    72.8    3e-14   
ref|XP_002165950.1|  PREDICTED: cytochrome c oxidase subunit 6B-like  72.4    3e-14   
ref|XP_010786746.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  72.4    3e-14   
gb|KIV97889.1|  hypothetical protein PV10_01589                       73.6    3e-14   
ref|XP_004529675.1|  PREDICTED: cytochrome c oxidase subunit 6B2-...  72.4    3e-14   
ref|XP_003717823.1|  cytochrome c oxidase subunit 6B                  72.4    3e-14   
ref|XP_002392571.1|  hypothetical protein MPER_07829                  72.4    3e-14   
ref|XP_011273234.1|  Cytochrome c oxidase subunit VIb isoform 1       72.0    3e-14   
ref|XP_011263394.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  72.4    3e-14   
ref|XP_002762067.1|  PREDICTED: cytochrome c oxidase subunit 6B1      72.4    3e-14   
ref|XP_007842213.1|  subunit vib of cytochrome c oxidase              72.4    3e-14   
ref|XP_001995561.1|  GH17817                                          72.0    3e-14   
gb|KEF57864.1|  cytochrome c oxidase subunit 6b                       72.4    3e-14   
ref|XP_003997948.1|  PREDICTED: cytochrome c oxidase subunit 6B1      72.0    4e-14   
emb|CCD34814.1|  similar to cytochrome c oxidase polypeptide vib      72.0    4e-14   
gb|KIW14054.1|  hypothetical protein PV08_06835                       72.4    4e-14   
gb|KIO21157.1|  hypothetical protein M407DRAFT_29215                  72.0    4e-14   
ref|XP_004396534.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  72.0    4e-14   
ref|XP_007296937.1|  cytochrome c oxidase polypeptide VIb             72.0    4e-14   
ref|NP_013139.1|  cytochrome c oxidase subunit VIb                    72.0    4e-14   
gb|EJT41301.1|  COX12-like protein                                    72.0    4e-14   
ref|XP_002075313.1|  GK15866                                          71.6    4e-14   
ref|XP_004715853.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  72.0    4e-14   
gb|KIZ05207.1|  cytochrome c oxidase subunit VIb                      73.2    4e-14   
ref|XP_007564424.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  72.0    4e-14   
gb|ADO29173.1|  cytochrome c oxidase subunit 6b1                      72.0    4e-14   
gb|EGU76168.1|  hypothetical protein FOXB_13340                       72.0    4e-14   
ref|XP_011104449.1|  cox12p                                           71.6    4e-14   
gb|ACJ73990.1|  COX6B protein (predicted)                             71.6    4e-14   
gb|KIJ57534.1|  hypothetical protein HYDPIDRAFT_184280                72.0    4e-14   
gb|EGI64447.1|  Cytochrome c oxidase subunit 6B2                      71.6    5e-14   
gb|ACO72858.1|  GH28726p                                              72.8    5e-14   
ref|XP_002494748.1|  ZYRO0A08734p                                     71.6    5e-14   
ref|XP_005804763.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  71.6    5e-14   
ref|XP_003657724.1|  hypothetical protein THITE_2123681               71.6    5e-14   
gb|EXX69637.1|  cytochrome c oxidase subunit VIb                      71.6    5e-14   
gb|ERS94985.1|  hypothetical protein HMPREF1624_08697                 71.6    5e-14   
ref|XP_006009126.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  71.6    5e-14   
ref|XP_004388166.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  71.6    5e-14   
gb|AIU99749.1|  mitochondrial cytochrome c oxidase subunit VIb        71.6    5e-14   
gb|EJU04694.1|  cytochrome c oxidase subunit VIb                      71.6    5e-14   
ref|XP_003670238.1|  hypothetical protein NDAI_0E01790                71.6    5e-14   
ref|XP_008826256.1|  PREDICTED: cytochrome c oxidase subunit 6B1      71.6    5e-14   
gb|EFX06706.1|  cytochrome c oxidase polypeptide vib                  71.6    5e-14   
emb|CCX05188.1|  Similar to Cytochrome c oxidase subunit 6B; acc....  71.6    5e-14   
ref|XP_006637266.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  71.6    5e-14   
gb|KIK10313.1|  hypothetical protein K443DRAFT_81574                  71.2    6e-14   
gb|KIW58518.1|  hypothetical protein PV05_03029                       71.6    6e-14   
ref|XP_010630129.1|  PREDICTED: cytochrome c oxidase subunit 6B1      71.6    6e-14   
gb|ACO10158.1|  Cytochrome c oxidase subunit VIb isoform 1            71.6    6e-14   
ref|NP_728294.1|  cytochrome c oxidase subunit VIb, isoform A         71.6    6e-14   
gb|KIJ57638.1|  hypothetical protein HYDPIDRAFT_184275                71.6    6e-14   
ref|XP_010015235.1|  PREDICTED: cytochrome c oxidase subunit 6B1      71.6    6e-14   
ref|XP_005908261.1|  PREDICTED: cytochrome c oxidase subunit 6B1-...  71.6    6e-14   
ref|XP_011107037.1|  hypothetical protein H072_1045                   71.6    6e-14   



>gb|EYU37118.1| hypothetical protein MIMGU_mgv1a022157mg, partial [Erythranthe 
guttata]
Length=113

 Score =   128 bits (321),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +3

Query  39   FVRCSSSMAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYR  218
            F    S MAEIELKTAPADFRFPTTNQT HCFT Y+EFHRCVAAKG E GDC KFA+ YR
Sbjct  30   FRSIISPMAEIELKTAPADFRFPTTNQTRHCFTRYIEFHRCVAAKGDESGDCGKFAQYYR  89

Query  219  ALCPGEWVEKWNE  257
            +LCPGEWVEKWNE
Sbjct  90   SLCPGEWVEKWNE  102



>ref|XP_006343565.1| PREDICTED: cytochrome c oxidase subunit 6b-2-like [Solanum tuberosum]
Length=77

 Score =   125 bits (314),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = +3

Query  60   MAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEW  239
            MAEIELKTAPADFRFPTTNQT HCFT YVEFHRCVAAKG E  DCE+FA+ YRALCPGEW
Sbjct  1    MAEIELKTAPADFRFPTTNQTRHCFTRYVEFHRCVAAKGDEAADCERFAKYYRALCPGEW  60

Query  240  VEKWNE  257
            V+KWNE
Sbjct  61   VDKWNE  66



>ref|XP_010103131.1| Cytochrome c oxidase subunit 6b-1 [Morus notabilis]
 gb|EXB94896.1| Cytochrome c oxidase subunit 6b-1 [Morus notabilis]
Length=129

 Score =   125 bits (315),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = +3

Query  60   MAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEW  239
            MAEI LKTAPADFRFPTTNQT HCFT Y+EFHRC+AAKG E G+CEKFAR YR+LCPGEW
Sbjct  1    MAEIALKTAPADFRFPTTNQTRHCFTRYIEFHRCLAAKGEESGECEKFARYYRSLCPGEW  60

Query  240  VEKWNE  257
            VEKWNE
Sbjct  61   VEKWNE  66



>ref|XP_010047036.1| PREDICTED: cytochrome c oxidase subunit 6b-2 [Eucalyptus grandis]
 gb|KCW78786.1| hypothetical protein EUGRSUZ_C00220 [Eucalyptus grandis]
Length=77

 Score =   124 bits (310),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = +3

Query  60   MAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEW  239
            MA+I+LKTAPADFRFPTTNQT HCFT Y+EFHRC+AAKG E GDCEKFA+ YR+LCPGEW
Sbjct  1    MADIDLKTAPADFRFPTTNQTRHCFTRYIEFHRCIAAKGEESGDCEKFAKYYRSLCPGEW  60

Query  240  VEKWNE  257
            V+KWNE
Sbjct  61   VDKWNE  66



>ref|XP_011079340.1| PREDICTED: cytochrome c oxidase subunit 6b-2 [Sesamum indicum]
Length=77

 Score =   124 bits (310),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 55/66 (83%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = +3

Query  60   MAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEW  239
            MAEIELKTAPADFRFPTTNQT HCFT Y+EFHRCVAAKG E GDC KFA+ YR+LCPGEW
Sbjct  1    MAEIELKTAPADFRFPTTNQTRHCFTRYIEFHRCVAAKGEESGDCNKFAKYYRSLCPGEW  60

Query  240  VEKWNE  257
            ++KWNE
Sbjct  61   IDKWNE  66



>ref|XP_002454158.1| hypothetical protein SORBIDRAFT_04g025700 [Sorghum bicolor]
 gb|EES07134.1| hypothetical protein SORBIDRAFT_04g025700 [Sorghum bicolor]
Length=77

 Score =   123 bits (309),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 55/66 (83%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = +3

Query  60   MAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEW  239
            MAEIE+KTAPADFRFPTTNQT HCFT YVE+HRCV AKG + GDCEKFA+ YR+LCPGEW
Sbjct  1    MAEIEIKTAPADFRFPTTNQTRHCFTRYVEYHRCVNAKGDDAGDCEKFAKYYRSLCPGEW  60

Query  240  VEKWNE  257
            VEKWNE
Sbjct  61   VEKWNE  66



>ref|XP_004242645.1| PREDICTED: cytochrome c oxidase subunit 6b-2 [Solanum lycopersicum]
Length=77

 Score =   123 bits (309),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +3

Query  60   MAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEW  239
            MAEIELKTAPADFRFPTTNQT HCFT YVEFHRCVAAKG E  DC +FA+ YRALCPGEW
Sbjct  1    MAEIELKTAPADFRFPTTNQTRHCFTRYVEFHRCVAAKGDEAADCARFAKYYRALCPGEW  60

Query  240  VEKWNE  257
            V+KWNE
Sbjct  61   VDKWNE  66



>emb|CDP02891.1| unnamed protein product [Coffea canephora]
Length=77

 Score =   122 bits (307),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = +3

Query  60   MAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEW  239
            MAEIELKTAPADFRFPTTNQT HCFT Y+EFHRC+AAKG + G+CEKFA+ YR+LCPGEW
Sbjct  1    MAEIELKTAPADFRFPTTNQTRHCFTRYIEFHRCLAAKGDDSGECEKFAKYYRSLCPGEW  60

Query  240  VEKWNE  257
            VE+WNE
Sbjct  61   VERWNE  66



>ref|XP_004953063.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Setaria italica]
Length=77

 Score =   122 bits (306),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = +3

Query  60   MAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEW  239
            MAEIE+KTAPADFRFPTTNQT HCFT YVE+HRCV AKG + GDC+KFA+ YR+LCPGEW
Sbjct  1    MAEIEIKTAPADFRFPTTNQTRHCFTRYVEYHRCVNAKGDDAGDCDKFAKYYRSLCPGEW  60

Query  240  VEKWNE  257
            VEKWNE
Sbjct  61   VEKWNE  66



>ref|XP_010545443.1| PREDICTED: cytochrome c oxidase subunit 6b-2 [Tarenaya hassleriana]
Length=78

 Score =   121 bits (304),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 55/64 (86%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EIELKTAPADFRFPTTNQT HCFT Y+EFHRC+AAKG E  DCEKFA+ YRALCPGEWVE
Sbjct  4    EIELKTAPADFRFPTTNQTRHCFTRYIEFHRCIAAKGEESNDCEKFAKFYRALCPGEWVE  63

Query  246  KWNE  257
            KWNE
Sbjct  64   KWNE  67



>ref|XP_007154837.1| hypothetical protein PHAVU_003G151900g [Phaseolus vulgaris]
 gb|ESW26831.1| hypothetical protein PHAVU_003G151900g [Phaseolus vulgaris]
Length=77

 Score =   121 bits (303),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = +3

Query  60   MAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEW  239
            MAEIELKTAPADFRFPTTNQT HCFT Y+EFHRC+AAKG   G+C+KFA+ YR+LCPGEW
Sbjct  1    MAEIELKTAPADFRFPTTNQTRHCFTRYIEFHRCLAAKGDNSGECQKFAKYYRSLCPGEW  60

Query  240  VEKWNE  257
            V+KWNE
Sbjct  61   VDKWNE  66



>gb|EPS74026.1| hypothetical protein M569_00726 [Genlisea aurea]
Length=533

 Score =   129 bits (324),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            +IELKTAPADFRFPTTNQT HCFT Y+EFHRCVAAKG + G+C KFA  YRALCPGEW+E
Sbjct  459  QIELKTAPADFRFPTTNQTRHCFTRYIEFHRCVAAKGEDSGECAKFANYYRALCPGEWIE  518

Query  246  KWNE  257
            KWNE
Sbjct  519  KWNE  522



>ref|XP_003542317.1| PREDICTED: cytochrome c oxidase subunit 6b-2-like [Glycine max]
Length=77

 Score =   120 bits (302),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = +3

Query  60   MAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEW  239
            MAEIELKTAPADFRFPTTNQT HCFT Y+EFHRC+AAKG   G+CE+FA+ YR+LCPGEW
Sbjct  1    MAEIELKTAPADFRFPTTNQTRHCFTRYIEFHRCLAAKGENSGECERFAKYYRSLCPGEW  60

Query  240  VEKWNE  257
            VE+WNE
Sbjct  61   VERWNE  66



>ref|XP_011069843.1| PREDICTED: cytochrome c oxidase subunit 6b-2-like [Sesamum indicum]
Length=77

 Score =   120 bits (302),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  60   MAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEW  239
            MAEIELKTAPADFRFPTTNQT HCFT Y+EFHRC AAKG    DC+KFAR YR+LCPGEW
Sbjct  1    MAEIELKTAPADFRFPTTNQTRHCFTRYIEFHRCTAAKGEGSSDCDKFARYYRSLCPGEW  60

Query  240  VEKWNE  257
            +EKWNE
Sbjct  61   IEKWNE  66



>gb|AFK38546.1| unknown [Lotus japonicus]
Length=77

 Score =   120 bits (301),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +3

Query  60   MAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEW  239
            MAEIELKTAP DFRFPTTNQT HCFT Y+EFHRC+A KG E G+CE+FA+ YR+LCPGEW
Sbjct  1    MAEIELKTAPVDFRFPTTNQTRHCFTRYIEFHRCLAVKGEESGECERFAKYYRSLCPGEW  60

Query  240  VEKWNE  257
            VEKWNE
Sbjct  61   VEKWNE  66



>ref|XP_009390533.1| PREDICTED: cytochrome c oxidase subunit 6b-2-like [Musa acuminata 
subsp. malaccensis]
Length=77

 Score =   120 bits (301),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +3

Query  60   MAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEW  239
            MAEIELKTAPADFRFPTTNQT HCFT Y+E+H+CVAAKG E  DC KFA+ YR+LCPGEW
Sbjct  1    MAEIELKTAPADFRFPTTNQTRHCFTRYIEYHKCVAAKGEETPDCHKFAKYYRSLCPGEW  60

Query  240  VEKWNE  257
            VEKWNE
Sbjct  61   VEKWNE  66



>gb|KHN17535.1| Cytochrome c oxidase subunit 6b-1 [Glycine soja]
Length=77

 Score =   120 bits (301),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = +3

Query  60   MAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEW  239
            MAEIELKTAPADFRFPTTNQT HCFT Y+EFHRC+AAKG   G+CE+FA+ YR+LCPGEW
Sbjct  1    MAEIELKTAPADFRFPTTNQTRHCFTRYIEFHRCLAAKGENSGECERFAKYYRSLCPGEW  60

Query  240  VEKWNE  257
            VE+WNE
Sbjct  61   VERWNE  66



>ref|XP_009349099.1| PREDICTED: cytochrome c oxidase subunit 6b-2 [Pyrus x bretschneideri]
Length=77

 Score =   120 bits (301),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = +3

Query  60   MAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEW  239
            MAEIELKTAPADFRFPTTNQT HCFT Y+EFHRCV+AKG E  +CEKFA+ YR+LCPGEW
Sbjct  1    MAEIELKTAPADFRFPTTNQTRHCFTRYIEFHRCVSAKGEESNECEKFAKYYRSLCPGEW  60

Query  240  VEKWNE  257
            +EKW+E
Sbjct  61   IEKWDE  66



>ref|XP_004309856.1| PREDICTED: cytochrome c oxidase subunit 6b-2 [Fragaria vesca 
subsp. vesca]
Length=77

 Score =   120 bits (300),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = +3

Query  60   MAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEW  239
            MAE+ELKTAPADFRFPTTNQT HCFT Y+EFHRC+AAKG E  +CE+F++ YR+LCPGEW
Sbjct  1    MAEVELKTAPADFRFPTTNQTRHCFTRYIEFHRCLAAKGEESAECERFSKYYRSLCPGEW  60

Query  240  VEKWNE  257
            VEKWNE
Sbjct  61   VEKWNE  66



>ref|XP_007226359.1| hypothetical protein PRUPE_ppa022392mg, partial [Prunus persica]
 gb|EMJ27558.1| hypothetical protein PRUPE_ppa022392mg, partial [Prunus persica]
Length=119

 Score =   120 bits (302),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = +3

Query  51   SSSMAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCP  230
            SS MAEIELKTAP DFRFPTTNQT HCFT Y+EFHRCVAAKG E  +CE+FA+ YR+LCP
Sbjct  40   SSVMAEIELKTAPVDFRFPTTNQTRHCFTRYIEFHRCVAAKGEESNECERFAKYYRSLCP  99

Query  231  GEWVEKWNE  257
            GEW+E+W E
Sbjct  100  GEWIERWAE  108



>ref|XP_008452371.1| PREDICTED: cytochrome c oxidase subunit 6b-2 [Cucumis melo]
Length=77

 Score =   119 bits (299),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +3

Query  60   MAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEW  239
            M EIELKTAPADFRFPTTNQT HCFT Y+EFHRC+ AKG E G+CE+FA+ YRALCPGEW
Sbjct  1    MDEIELKTAPADFRFPTTNQTRHCFTRYIEFHRCLTAKGEESGECERFAKYYRALCPGEW  60

Query  240  VEKWNE  257
            V+KWNE
Sbjct  61   VDKWNE  66



>emb|CDY19008.1| BnaC01g20600D [Brassica napus]
Length=98

 Score =   120 bits (300),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +3

Query  18   CAHRKGNFVRCSSSMAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCE  197
            C     +F  C   + +IELKTAPADFRFPTTNQT HCFT Y+EFHRC  AKG +  DCE
Sbjct  8    CISESYSFFLCVFLLNQIELKTAPADFRFPTTNQTRHCFTRYIEFHRCTTAKGEDSNDCE  67

Query  198  KFARXYRALCPGEWVEKWNE  257
            +FA+ YRALCPGEWV+KWNE
Sbjct  68   RFAKYYRALCPGEWVDKWNE  87



>gb|ACU17340.1| unknown [Glycine max]
Length=77

 Score =   119 bits (298),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +3

Query  60   MAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEW  239
            MAEIELKTAPADFRFPTTNQT HCFT Y+EFHRC+ AKG   G+CE+FA+ YR+LCPGEW
Sbjct  1    MAEIELKTAPADFRFPTTNQTRHCFTRYIEFHRCLVAKGENSGECERFAKYYRSLCPGEW  60

Query  240  VEKWNE  257
            VE+WNE
Sbjct  61   VERWNE  66



>dbj|BAJ88586.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=77

 Score =   119 bits (297),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +3

Query  60   MAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEW  239
            MAEIE+KTAPADFRFPTTNQT HCFT YVEFHRCV+AKG E  +C+KFA+ YR+LCP EW
Sbjct  1    MAEIEIKTAPADFRFPTTNQTRHCFTRYVEFHRCVSAKGDEAAECDKFAKYYRSLCPAEW  60

Query  240  VEKWNE  257
            V+KWNE
Sbjct  61   VDKWNE  66



>ref|XP_003580071.1| PREDICTED: cytochrome c oxidase subunit 6b-2 [Brachypodium distachyon]
Length=77

 Score =   119 bits (297),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  60   MAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEW  239
            MAEIE+KTAPADFRFPTTNQT HCFT YVE+HRCV AKG E  DCEKFA+ YR+LCP EW
Sbjct  1    MAEIEIKTAPADFRFPTTNQTRHCFTRYVEYHRCVNAKGEETADCEKFAKYYRSLCPAEW  60

Query  240  VEKWNE  257
            V+KWNE
Sbjct  61   VDKWNE  66



>ref|XP_003549519.1| PREDICTED: cytochrome c oxidase subunit 6b-3 [Glycine max]
Length=77

 Score =   119 bits (297),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +3

Query  60   MAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEW  239
            M EIELKTAPADFRFPTTNQT HCFT Y+EFHRC+AAKG   G+CE+FA+ YR+LCPGEW
Sbjct  1    MTEIELKTAPADFRFPTTNQTRHCFTRYIEFHRCLAAKGENSGECERFAKYYRSLCPGEW  60

Query  240  VEKWNE  257
            VE+WNE
Sbjct  61   VERWNE  66



>ref|XP_008360325.1| PREDICTED: cytochrome c oxidase subunit 6b-2 [Malus domestica]
Length=77

 Score =   118 bits (296),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +3

Query  60   MAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEW  239
            MAEIELKTAPADFRFPTTNQT HCF+ Y+EFHRCV+AKG E  +CEKFA+ YR+LCPGEW
Sbjct  1    MAEIELKTAPADFRFPTTNQTRHCFSRYIEFHRCVSAKGEESNECEKFAKYYRSLCPGEW  60

Query  240  VEKWNE  257
            +EKW E
Sbjct  61   IEKWEE  66



>ref|XP_008678787.1| PREDICTED: cytochrome c oxidase subunit 6b-3 [Zea mays]
 gb|ACG28095.1| cytochrome c oxidase polypeptide VIb [Zea mays]
 gb|ACG30732.1| cytochrome c oxidase polypeptide VIb [Zea mays]
 gb|ACG30819.1| cytochrome c oxidase polypeptide VIb [Zea mays]
 gb|ACG30838.1| cytochrome c oxidase polypeptide VIb [Zea mays]
 gb|ACG32533.1| cytochrome c oxidase polypeptide VIb [Zea mays]
 gb|ACG45178.1| cytochrome c oxidase polypeptide VIb [Zea mays]
 gb|AFW62925.1| cytochrome c oxidase polypeptide VIb isoform 1 [Zea mays]
 gb|AFW62926.1| cytochrome c oxidase polypeptide VIb isoform 2 [Zea mays]
Length=77

 Score =   118 bits (296),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +3

Query  60   MAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEW  239
            MAEIE+KTAPADFRFPTTNQT HCFT YVE+HRC+ AKG + G CEKFA+ YR+LCPGEW
Sbjct  1    MAEIEIKTAPADFRFPTTNQTRHCFTRYVEYHRCLNAKGDDAGVCEKFAKYYRSLCPGEW  60

Query  240  VEKWNE  257
            VEKWNE
Sbjct  61   VEKWNE  66



>emb|CDX92861.1| BnaC07g41190D [Brassica napus]
Length=175

 Score =   121 bits (303),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = +3

Query  33   GNFVRCSSSMAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARX  212
             +F+  S+   EIELKTAPADFRFPTTNQT HCFT Y+EFHRC  AKG +  DCE+FA+ 
Sbjct  90   SSFLFRSAMEDEIELKTAPADFRFPTTNQTRHCFTRYIEFHRCTTAKGEDSNDCERFAKY  149

Query  213  YRALCPGEWVEKWNE  257
            YRALCPGEWV+KWNE
Sbjct  150  YRALCPGEWVDKWNE  164



>ref|XP_010483320.1| PREDICTED: cytochrome c oxidase subunit 6b-2-like [Camelina sativa]
 ref|XP_010483321.1| PREDICTED: cytochrome c oxidase subunit 6b-2-like [Camelina sativa]
 ref|XP_010483322.1| PREDICTED: cytochrome c oxidase subunit 6b-2-like [Camelina sativa]
 ref|XP_010483323.1| PREDICTED: cytochrome c oxidase subunit 6b-2-like [Camelina sativa]
 ref|XP_010483324.1| PREDICTED: cytochrome c oxidase subunit 6b-2-like [Camelina sativa]
 ref|XP_010483325.1| PREDICTED: cytochrome c oxidase subunit 6b-2-like [Camelina sativa]
 ref|XP_010483326.1| PREDICTED: cytochrome c oxidase subunit 6b-2-like [Camelina sativa]
 ref|XP_010483327.1| PREDICTED: cytochrome c oxidase subunit 6b-2-like [Camelina sativa]
 ref|XP_010483328.1| PREDICTED: cytochrome c oxidase subunit 6b-2-like [Camelina sativa]
Length=83

 Score =   118 bits (296),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = +3

Query  51   SSSMAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCP  230
             S+   IELKTAPADFRFPTTNQT HCFT Y+EFHRC  AKG E  DCE+FA+ YRALCP
Sbjct  4    QSTSTMIELKTAPADFRFPTTNQTRHCFTRYIEFHRCTTAKGEESNDCERFAKYYRALCP  63

Query  231  GEWVEKWNE  257
            GEWVEKWNE
Sbjct  64   GEWVEKWNE  72



>ref|XP_004144709.1| PREDICTED: cytochrome c oxidase subunit 6b-2-like isoform 2 [Cucumis 
sativus]
 ref|XP_004144710.1| PREDICTED: cytochrome c oxidase subunit 6b-2-like isoform 3 [Cucumis 
sativus]
 ref|XP_004162693.1| PREDICTED: cytochrome c oxidase subunit 6b-2-like isoform 2 [Cucumis 
sativus]
 ref|XP_004162694.1| PREDICTED: cytochrome c oxidase subunit 6b-2-like isoform 3 [Cucumis 
sativus]
 gb|KGN61078.1| hypothetical protein Csa_2G037250 [Cucumis sativus]
Length=77

 Score =   118 bits (295),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  60   MAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEW  239
            M EIELKTAPADFRFPTTNQT HCFT Y+EFHRC+  KG E G+CE+FA+ YRALCPGEW
Sbjct  1    MDEIELKTAPADFRFPTTNQTRHCFTRYIEFHRCLTVKGEESGECERFAKYYRALCPGEW  60

Query  240  VEKWNE  257
            V+KWNE
Sbjct  61   VDKWNE  66



>ref|XP_008223569.1| PREDICTED: cytochrome c oxidase subunit 6b-2 isoform X2 [Prunus 
mume]
Length=77

 Score =   118 bits (295),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +3

Query  60   MAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEW  239
            MAEIELKTAP DFRFPTTNQT HCFT Y+EFHRCVAAKG E  +CE+FA+ YR+LCPGEW
Sbjct  1    MAEIELKTAPVDFRFPTTNQTRHCFTRYIEFHRCVAAKGEESNECERFAKYYRSLCPGEW  60

Query  240  VEKWNE  257
            +E+W+E
Sbjct  61   IERWDE  66



>ref|XP_009600161.1| PREDICTED: cytochrome c oxidase subunit 6b-3 [Nicotiana tomentosiformis]
 ref|XP_009790994.1| PREDICTED: cytochrome c oxidase subunit 6b-3 [Nicotiana sylvestris]
Length=78

 Score =   117 bits (294),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EIELKTAPADFRFPTTNQT HCFT YVEFHRCVAAKG E  +C KFA+ YRALCPGEWVE
Sbjct  4    EIELKTAPADFRFPTTNQTRHCFTRYVEFHRCVAAKGDEAAECGKFAKYYRALCPGEWVE  63

Query  246  KWNE  257
            +WNE
Sbjct  64   RWNE  67



>ref|NP_001053212.1| Os04g0498200 [Oryza sativa Japonica Group]
 ref|XP_006652475.1| PREDICTED: cytochrome c oxidase subunit 6b-2-like [Oryza brachyantha]
 dbj|BAB12275.1| cytochrome c oxidase subunit 6b [Oryza sativa Japonica Group]
 dbj|BAB12339.1| cytochrome c oxidase subunit 6b [Oryza sativa Japonica Group]
 emb|CAD41243.2| OSJNBa0067K08.22 [Oryza sativa Japonica Group]
 emb|CAC09495.2| H0711G06.1 [Oryza sativa Indica Group]
 dbj|BAF15126.1| Os04g0498200 [Oryza sativa Japonica Group]
 emb|CAH67519.1| OSIGBa0092E01.14 [Oryza sativa Indica Group]
 dbj|BAG99190.1| unnamed protein product [Oryza sativa Japonica Group]
Length=77

 Score =   117 bits (294),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  60   MAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEW  239
            MAEIE+KTAPADFRFPTTNQT HCFT Y+E+HRCV AKG    DCEKFA+ YR+LCP EW
Sbjct  1    MAEIEIKTAPADFRFPTTNQTRHCFTRYIEYHRCVNAKGEATADCEKFAKYYRSLCPAEW  60

Query  240  VEKWNE  257
            VEKWNE
Sbjct  61   VEKWNE  66



>ref|XP_010268397.1| PREDICTED: cytochrome c oxidase subunit 6b-2 [Nelumbo nucifera]
Length=78

 Score =   117 bits (294),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EIELKTAPADFRFPTTNQT HCFT Y+EFHRC+ AKG E G+CE+FAR YR+LCPGEW+E
Sbjct  4    EIELKTAPADFRFPTTNQTRHCFTRYIEFHRCLQAKGEESGECERFARYYRSLCPGEWIE  63

Query  246  KWNE  257
            +WNE
Sbjct  64   RWNE  67



>ref|XP_010687691.1| PREDICTED: cytochrome c oxidase subunit 6b-2 [Beta vulgaris subsp. 
vulgaris]
Length=77

 Score =   117 bits (294),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  60   MAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEW  239
            MAEIELKTAPADFRFPTTNQT HCFT Y+EFHRC+AAKG E   C KFA+ YRALCPGEW
Sbjct  1    MAEIELKTAPADFRFPTTNQTRHCFTRYIEFHRCLAAKGEESDACGKFAQYYRALCPGEW  60

Query  240  VEKWNE  257
            VE+WNE
Sbjct  61   VERWNE  66



>ref|XP_010539459.1| PREDICTED: cytochrome c oxidase subunit 6b-2-like isoform X1 
[Tarenaya hassleriana]
Length=78

 Score =   117 bits (294),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EIELKTAPADFRFPTTNQT HCFT Y+EFHRC+AAKG E  DC KFA+ YRALCPGEWVE
Sbjct  4    EIELKTAPADFRFPTTNQTRHCFTRYIEFHRCIAAKGEESNDCGKFAKFYRALCPGEWVE  63

Query  246  KWNE  257
            +WNE
Sbjct  64   RWNE  67



>gb|KFK27323.1| hypothetical protein AALP_AA8G367900 [Arabis alpina]
Length=78

 Score =   117 bits (293),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EIELKTAPADFRFPTTNQT HCFT Y+EFHRC  AKG E  DCE+FA+ YRALCPGEWVE
Sbjct  4    EIELKTAPADFRFPTTNQTRHCFTRYIEFHRCTIAKGEESNDCERFAKYYRALCPGEWVE  63

Query  246  KWNE  257
            KWNE
Sbjct  64   KWNE  67



>ref|XP_004507784.1| PREDICTED: cytochrome c oxidase subunit 6b-3-like [Cicer arietinum]
Length=77

 Score =   117 bits (293),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  60   MAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEW  239
            MAEIELKTAP DFRFPTTNQT HCFT Y+EFHRC AAKG    +CEKFA+ YR+LCPGEW
Sbjct  1    MAEIELKTAPVDFRFPTTNQTRHCFTRYIEFHRCTAAKGENSSECEKFAKYYRSLCPGEW  60

Query  240  VEKWNE  257
            V+KWNE
Sbjct  61   VDKWNE  66



>ref|XP_004976105.1| PREDICTED: cytochrome c oxidase subunit 6b-3-like [Setaria italica]
Length=77

 Score =   117 bits (293),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  60   MAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEW  239
            MAEIELKTAP DFRFPTTNQT HCFT Y+E+HRCV AKG    +CEKFA+ YR+LCPGEW
Sbjct  1    MAEIELKTAPTDFRFPTTNQTRHCFTRYIEYHRCVNAKGDGTAECEKFAKYYRSLCPGEW  60

Query  240  VEKWNE  257
            VEKWNE
Sbjct  61   VEKWNE  66



>gb|EYU34304.1| hypothetical protein MIMGU_mgv1a025239mg, partial [Erythranthe 
guttata]
Length=74

 Score =   117 bits (292),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  69   IELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVEK  248
            +ELKTAPADFRFPTTNQT HCFT Y+EFHRCV AKG + GDC+KFA+ YR+LCPGEWVEK
Sbjct  1    VELKTAPADFRFPTTNQTRHCFTRYIEFHRCVTAKGEDSGDCDKFAKYYRSLCPGEWVEK  60

Query  249  WNE  257
            WNE
Sbjct  61   WNE  63



>ref|XP_004162692.1| PREDICTED: cytochrome c oxidase subunit 6b-2-like isoform 1 [Cucumis 
sativus]
Length=102

 Score =   117 bits (294),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 62/74 (84%), Gaps = 2/74 (3%)
 Frame = +3

Query  36   NFVRCSSSMAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXY  215
            +F  C SS  +IELKTAPADFRFPTTNQT HCFT Y+EFHRC+  KG E G+CE+FA+ Y
Sbjct  20   SFSSCLSS--QIELKTAPADFRFPTTNQTRHCFTRYIEFHRCLTVKGEESGECERFAKYY  77

Query  216  RALCPGEWVEKWNE  257
            RALCPGEWV+KWNE
Sbjct  78   RALCPGEWVDKWNE  91



>ref|NP_568867.1| cytochrome c oxidase subunit 6b-2 [Arabidopsis thaliana]
 sp|Q945L0.1|CX6B2_ARATH RecName: Full=Cytochrome c oxidase subunit 6b-2; Short=AtCOX6b-2 
[Arabidopsis thaliana]
 gb|AAL06549.1|AF412096_1 AT4g28060/T13J8_170 [Arabidopsis thaliana]
 gb|AAM47369.1| AT4g28060/T13J8_170 [Arabidopsis thaliana]
 dbj|BAC42309.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF00303.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED96955.1| cytochrome c oxidase subunit 6b-2 [Arabidopsis thaliana]
Length=78

 Score =   117 bits (292),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EIELKTAPADFRFPTTNQT HCFT Y+EFHRC  AKG E  DCE+FA+ YRALCPGEWV+
Sbjct  4    EIELKTAPADFRFPTTNQTRHCFTRYIEFHRCTTAKGEESNDCERFAKYYRALCPGEWVD  63

Query  246  KWNE  257
            KWNE
Sbjct  64   KWNE  67



>ref|XP_010539460.1| PREDICTED: cytochrome c oxidase subunit 6b-2-like isoform X2 
[Tarenaya hassleriana]
Length=77

 Score =   117 bits (292),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  60   MAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEW  239
            M  IELKTAPADFRFPTTNQT HCFT Y+EFHRC+AAKG E  DC KFA+ YRALCPGEW
Sbjct  1    MDYIELKTAPADFRFPTTNQTRHCFTRYIEFHRCIAAKGEESNDCGKFAKFYRALCPGEW  60

Query  240  VEKWNE  257
            VE+WNE
Sbjct  61   VERWNE  66



>ref|XP_004144708.1| PREDICTED: cytochrome c oxidase subunit 6b-2-like isoform 1 [Cucumis 
sativus]
Length=102

 Score =   117 bits (292),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 61/74 (82%), Gaps = 2/74 (3%)
 Frame = +3

Query  36   NFVRCSSSMAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXY  215
            +F  C S   +IELKTAPADFRFPTTNQT HCFT Y+EFHRC+  KG E G+CE+FA+ Y
Sbjct  20   SFSSCLS--PQIELKTAPADFRFPTTNQTRHCFTRYIEFHRCLTVKGEESGECERFAKYY  77

Query  216  RALCPGEWVEKWNE  257
            RALCPGEWV+KWNE
Sbjct  78   RALCPGEWVDKWNE  91



>ref|XP_007013954.1| Cytochrome c oxidase subunit 6b [Theobroma cacao]
 gb|EOY31573.1| Cytochrome c oxidase subunit 6b [Theobroma cacao]
Length=80

 Score =   116 bits (290),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = +3

Query  63   AEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWV  242
            ++IELKTAPADFRFPTTNQT HCFT Y+EFHRC+AAKG E  +CE+FA+ YR+LCPGEWV
Sbjct  5    SQIELKTAPADFRFPTTNQTRHCFTRYIEFHRCLAAKGEESNECERFAKYYRSLCPGEWV  64

Query  243  EKWNE  257
            E+WNE
Sbjct  65   ERWNE  69



>ref|XP_010278031.1| PREDICTED: cytochrome c oxidase subunit 6b-2 isoform X2 [Nelumbo 
nucifera]
Length=78

 Score =   116 bits (290),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EIELKTAPADFRFPT NQT HCFT Y+EFHRC+ AKG E G+C+KFAR YR+LCPGEW+E
Sbjct  4    EIELKTAPADFRFPTANQTRHCFTRYIEFHRCLQAKGEESGECDKFARYYRSLCPGEWIE  63

Query  246  KWNE  257
            +WNE
Sbjct  64   RWNE  67



>ref|XP_006453502.1| hypothetical protein CICLE_v10010074mg [Citrus clementina]
 ref|XP_006474088.1| PREDICTED: cytochrome c oxidase subunit 6b-2-like [Citrus sinensis]
 gb|ESR66742.1| hypothetical protein CICLE_v10010074mg [Citrus clementina]
 gb|KDO62351.1| hypothetical protein CISIN_1g034905mg [Citrus sinensis]
Length=79

 Score =   116 bits (290),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EIELKTAPADFRFPTTNQT HCFT Y+EFHRC+AAKG E  +CE+FA+ YR+LCPG+W+E
Sbjct  5    EIELKTAPADFRFPTTNQTRHCFTRYIEFHRCLAAKGEESNECERFAKYYRSLCPGDWIE  64

Query  246  KWNE  257
            KWNE
Sbjct  65   KWNE  68



>ref|XP_006284746.1| hypothetical protein CARUB_v10006010mg [Capsella rubella]
 gb|EOA17644.1| hypothetical protein CARUB_v10006010mg [Capsella rubella]
Length=133

 Score =   117 bits (294),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = +3

Query  33   GNFVRCSSSMAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARX  212
             +FV  S+   EIELKTAPADFRFPTTNQT HCFT Y+EFHRC  AKG +  +CE+FA+ 
Sbjct  48   SSFVFRSAMEDEIELKTAPADFRFPTTNQTRHCFTRYIEFHRCTTAKGEDSNECERFAKY  107

Query  213  YRALCPGEWVEKWNE  257
            YRALCPGEWV+KWNE
Sbjct  108  YRALCPGEWVDKWNE  122



>ref|XP_010914058.1| PREDICTED: cytochrome c oxidase subunit 6b-3 [Elaeis guineensis]
Length=77

 Score =   115 bits (289),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +3

Query  60   MAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEW  239
            MAEIELKTAPADFRFPTTNQT HCFT ++E+H+C+ AKG +  +C+KFAR YR+LCPGEW
Sbjct  1    MAEIELKTAPADFRFPTTNQTRHCFTRFIEYHKCLNAKGEDAAECQKFARYYRSLCPGEW  60

Query  240  VEKWNE  257
            +EKWNE
Sbjct  61   IEKWNE  66



>ref|XP_002271982.1| PREDICTED: cytochrome c oxidase subunit 6b-2 [Vitis vinifera]
 emb|CBI36604.3| unnamed protein product [Vitis vinifera]
Length=77

 Score =   115 bits (289),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  60   MAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEW  239
            M E+ L+TAPADFRFP+TNQT HCFT Y+EFHRC+AAKG E GDCEKFA+ YR+LCP EW
Sbjct  1    MEEVHLQTAPADFRFPSTNQTRHCFTRYIEFHRCLAAKGEESGDCEKFAKYYRSLCPVEW  60

Query  240  VEKWNE  257
            +EKWNE
Sbjct  61   IEKWNE  66



>ref|XP_002864529.1| hypothetical protein ARALYDRAFT_918963 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40788.1| hypothetical protein ARALYDRAFT_918963 [Arabidopsis lyrata subsp. 
lyrata]
Length=78

 Score =   115 bits (289),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EIELKTAPADFRFPTTNQT HCFT Y+EFHRC  AKG    DCE+FA+ YRALCPGEWVE
Sbjct  4    EIELKTAPADFRFPTTNQTRHCFTRYIEFHRCTTAKGEASNDCERFAKYYRALCPGEWVE  63

Query  246  KWNE  257
            KWNE
Sbjct  64   KWNE  67



>ref|XP_002325099.1| hypothetical protein POPTR_0018s10890g [Populus trichocarpa]
 ref|XP_011018099.1| PREDICTED: cytochrome c oxidase subunit 6b-2 [Populus euphratica]
 ref|XP_011015150.1| PREDICTED: cytochrome c oxidase subunit 6b-2 [Populus euphratica]
 gb|ABK93801.1| unknown [Populus trichocarpa]
 gb|EEF03664.1| hypothetical protein POPTR_0018s10890g [Populus trichocarpa]
Length=78

 Score =   115 bits (289),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EIELKTAPAD+RFPTTNQT HCFT Y+EFHRCVAAKG E  DCE+FA+ YR+LCP EWVE
Sbjct  4    EIELKTAPADYRFPTTNQTRHCFTRYIEFHRCVAAKGDEGNDCERFAKYYRSLCPSEWVE  63

Query  246  KWNE  257
            +WNE
Sbjct  64   RWNE  67



>ref|XP_002528213.1| cytochrome C oxidase polypeptide vib, putative [Ricinus communis]
 gb|EEF34170.1| cytochrome C oxidase polypeptide vib, putative [Ricinus communis]
Length=78

 Score =   115 bits (288),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EIELKTAPADFRFPTTNQT HCFT Y+EFHRC+AAKG E  +C++FA+ YRALCPGEWVE
Sbjct  4    EIELKTAPADFRFPTTNQTRHCFTRYIEFHRCLAAKGEEPKECDRFAKYYRALCPGEWVE  63

Query  246  KWNE  257
            +WNE
Sbjct  64   RWNE  67



>gb|AAM64280.1| cytochrome c oxidase subunit 6b [Arabidopsis thaliana]
Length=78

 Score =   115 bits (288),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EIELKTAPADFRFPTTNQT HCFT Y++FHRC  AKG E  DCE+FA+ YRALCPGEWV+
Sbjct  4    EIELKTAPADFRFPTTNQTRHCFTRYIKFHRCTTAKGEESNDCERFAKYYRALCPGEWVD  63

Query  246  KWNE  257
            KWNE
Sbjct  64   KWNE  67



>ref|XP_008223568.1| PREDICTED: cytochrome c oxidase subunit 6b-2 isoform X1 [Prunus 
mume]
Length=78

 Score =   115 bits (288),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +3

Query  60   MAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEW  239
            +++IELKTAP DFRFPTTNQT HCFT Y+EFHRCVAAKG E  +CE+FA+ YR+LCPGEW
Sbjct  2    LSQIELKTAPVDFRFPTTNQTRHCFTRYIEFHRCVAAKGEESNECERFAKYYRSLCPGEW  61

Query  240  VEKWNE  257
            +E+W+E
Sbjct  62   IERWDE  67



>ref|XP_010929208.1| PREDICTED: cytochrome c oxidase subunit 6b-3 isoform X1 [Elaeis 
guineensis]
Length=77

 Score =   115 bits (287),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  60   MAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEW  239
            MAEIELKTAPADFRFPTTNQT HCFT Y+E+H+C+ AKG +  +C+KFAR YR+LCP EW
Sbjct  1    MAEIELKTAPADFRFPTTNQTRHCFTRYIEYHKCLNAKGEDASECQKFARYYRSLCPMEW  60

Query  240  VEKWNE  257
            VEKWNE
Sbjct  61   VEKWNE  66



>ref|XP_006412997.1| hypothetical protein EUTSA_v10026527mg [Eutrema salsugineum]
 gb|ESQ54450.1| hypothetical protein EUTSA_v10026527mg [Eutrema salsugineum]
Length=138

 Score =   117 bits (292),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EIELKTAPADFRFPTTNQT HCFT Y+EFHRC  AKG +  +CE+FA+ YRALCPGEWV+
Sbjct  64   EIELKTAPADFRFPTTNQTRHCFTRYIEFHRCTTAKGEDSNECERFAKYYRALCPGEWVD  123

Query  246  KWNE  257
            KWNE
Sbjct  124  KWNE  127



>ref|XP_009144153.1| PREDICTED: cytochrome c oxidase subunit 6b-2 [Brassica rapa]
 emb|CDX89207.1| BnaA01g16860D [Brassica napus]
Length=78

 Score =   115 bits (287),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EIELKTAPADFRFPTTNQT HCFT Y+EFHRC  AKG    DCE+FA+ YRALCPGEWV+
Sbjct  4    EIELKTAPADFRFPTTNQTRHCFTRYIEFHRCTTAKGENSSDCERFAKYYRALCPGEWVD  63

Query  246  KWNE  257
            KWNE
Sbjct  64   KWNE  67



>ref|XP_010278029.1| PREDICTED: cytochrome c oxidase subunit 6b-2 isoform X1 [Nelumbo 
nucifera]
Length=137

 Score =   117 bits (292),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = +3

Query  51   SSSMAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCP  230
            S S  +IELKTAPADFRFPT NQT HCFT Y+EFHRC+ AKG E G+C+KFAR YR+LCP
Sbjct  58   SFSSLKIELKTAPADFRFPTANQTRHCFTRYIEFHRCLQAKGEESGECDKFARYYRSLCP  117

Query  231  GEWVEKWNE  257
            GEW+E+WNE
Sbjct  118  GEWIERWNE  126



>gb|KJB21358.1| hypothetical protein B456_004G104700 [Gossypium raimondii]
Length=79

 Score =   115 bits (287),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +3

Query  69   IELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVEK  248
            IELKTAPADFRFPTTNQT HCFT Y+EFHRC+AAKG E   CEKFA+ YR+LCPGEW++K
Sbjct  6    IELKTAPADFRFPTTNQTRHCFTRYIEFHRCLAAKGEESNQCEKFAKYYRSLCPGEWIDK  65

Query  249  WNE  257
            WNE
Sbjct  66   WNE  68



>gb|KHG12789.1| Cytochrome c oxidase subunit 6b-2 -like protein [Gossypium arboreum]
 gb|KJB21360.1| hypothetical protein B456_004G104700 [Gossypium raimondii]
Length=78

 Score =   115 bits (287),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +3

Query  69   IELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVEK  248
            IELKTAPADFRFPTTNQT HCFT Y+EFHRC+AAKG E   CEKFA+ YR+LCPGEW++K
Sbjct  5    IELKTAPADFRFPTTNQTRHCFTRYIEFHRCLAAKGEESNQCEKFAKYYRSLCPGEWIDK  64

Query  249  WNE  257
            WNE
Sbjct  65   WNE  67



>ref|XP_010278032.1| PREDICTED: cytochrome c oxidase subunit 6b-2 isoform X3 [Nelumbo 
nucifera]
Length=78

 Score =   114 bits (285),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +3

Query  69   IELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVEK  248
            IELKTAPADFRFPT NQT HCFT Y+EFHRC+ AKG E G+C+KFAR YR+LCPGEW+E+
Sbjct  5    IELKTAPADFRFPTANQTRHCFTRYIEFHRCLQAKGEESGECDKFARYYRSLCPGEWIER  64

Query  249  WNE  257
            WNE
Sbjct  65   WNE  67



>gb|KHG12868.1| Cytochrome c oxidase subunit 6b-1 -like protein [Gossypium arboreum]
Length=184

 Score =   117 bits (293),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+L+TAPADFRFPTTNQT HCFT Y+E+HRCVAAKG +  +C+KFA+ YRALCPGEW++
Sbjct  110  EIKLETAPADFRFPTTNQTRHCFTRYIEYHRCVAAKGEDASECDKFAKYYRALCPGEWID  169

Query  246  KWNE  257
            +WNE
Sbjct  170  RWNE  173



>gb|KJB59908.1| hypothetical protein B456_009G280300 [Gossypium raimondii]
Length=184

 Score =   117 bits (293),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+L+TAPADFRFPTTNQT HCFT Y+E+HRCVAAKG +  +C+KFA+ YRALCPGEW++
Sbjct  110  EIKLETAPADFRFPTTNQTRHCFTRYIEYHRCVAAKGEDASECDKFAKYYRALCPGEWID  169

Query  246  KWNE  257
            +WNE
Sbjct  170  RWNE  173



>ref|NP_194535.2| cytochrome c oxidase, subunit 6b [Arabidopsis thaliana]
 sp|Q9SUD3.2|CX6B3_ARATH RecName: Full=Cytochrome c oxidase subunit 6b-3; Short=AtCOX6b-3 
[Arabidopsis thaliana]
 gb|AEE85432.1| cytochrome c oxidase, subunit 6b [Arabidopsis thaliana]
Length=78

 Score =   114 bits (285),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EIELKTAPADFRFPTTNQT HCFT Y+EFHRC  AKG +  +CE+FA+ YRALCPGEWV+
Sbjct  4    EIELKTAPADFRFPTTNQTRHCFTRYIEFHRCTTAKGEDANECERFAKYYRALCPGEWVD  63

Query  246  KWNE  257
            KWNE
Sbjct  64   KWNE  67



>ref|XP_008794399.1| PREDICTED: cytochrome c oxidase subunit 6b-3-like [Phoenix dactylifera]
Length=77

 Score =   114 bits (284),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  60   MAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEW  239
            MAEIELKTAPADFRFPTTNQT HCFT Y+E+H+C+ AKG +  +C+KFAR YR+LCP EW
Sbjct  1    MAEIELKTAPADFRFPTTNQTRHCFTRYIEYHKCLNAKGEDAAECQKFARYYRSLCPVEW  60

Query  240  VEKWNE  257
            VE+WNE
Sbjct  61   VERWNE  66



>ref|XP_009137757.1| PREDICTED: cytochrome c oxidase subunit 6b-3-like [Brassica rapa]
 emb|CDY29877.1| BnaA03g48980D [Brassica napus]
Length=78

 Score =   114 bits (284),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+LKTAPADFRFPTTNQT HCFT Y+EFHRC  AKG +  DCE+FA+ YRALCPGEWV+
Sbjct  4    EIDLKTAPADFRFPTTNQTRHCFTRYIEFHRCTTAKGEDSVDCERFAKYYRALCPGEWVD  63

Query  246  KWNE  257
            KWNE
Sbjct  64   KWNE  67



>ref|XP_002867470.1| hypothetical protein ARALYDRAFT_913717 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_010433266.1| PREDICTED: cytochrome c oxidase subunit 6b-3 [Camelina sativa]
 ref|XP_010438509.1| PREDICTED: cytochrome c oxidase subunit 6b-3 [Camelina sativa]
 ref|XP_010448036.1| PREDICTED: cytochrome c oxidase subunit 6b-3 [Camelina sativa]
 gb|EFH43729.1| hypothetical protein ARALYDRAFT_913717 [Arabidopsis lyrata subsp. 
lyrata]
Length=78

 Score =   114 bits (284),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EIELKTAPADFRFPTTNQT HCFT Y+EFHRC  AKG +  +CE+FA+ YRALCPGEWV+
Sbjct  4    EIELKTAPADFRFPTTNQTRHCFTRYIEFHRCTTAKGEDSNECERFAKYYRALCPGEWVD  63

Query  246  KWNE  257
            KWNE
Sbjct  64   KWNE  67



>emb|CDY46649.1| BnaA07g10470D [Brassica napus]
Length=185

 Score =   117 bits (292),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+L+TAPADFRFPTTNQT HCFT Y+E+HRCVAAKG +  +C+KF++ YR+LCPGEWV+
Sbjct  111  EIKLETAPADFRFPTTNQTRHCFTRYIEYHRCVAAKGDDAPECDKFSKFYRSLCPGEWVD  170

Query  246  KWNE  257
            KWNE
Sbjct  171  KWNE  174



>emb|CDY00453.1| BnaC07g13730D [Brassica napus]
Length=185

 Score =   116 bits (291),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+L+TAPADFRFPTTNQT HCFT Y+E+HRCVAAKG +  +C+KF++ YR+LCPGEWV+
Sbjct  111  EIKLETAPADFRFPTTNQTRHCFTRYIEYHRCVAAKGDDAPECDKFSKFYRSLCPGEWVD  170

Query  246  KWNE  257
            KWNE
Sbjct  171  KWNE  174



>ref|XP_009103236.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Brassica rapa]
Length=175

 Score =   116 bits (290),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+L+TAPADFRFPTTNQT HCFT Y+E+HRCVAAKG +  +C+KF++ YR+LCPGEWV+
Sbjct  101  EIKLETAPADFRFPTTNQTRHCFTRYIEYHRCVAAKGDDAPECDKFSKFYRSLCPGEWVD  160

Query  246  KWNE  257
            KWNE
Sbjct  161  KWNE  164



>gb|EYU36481.1| hypothetical protein MIMGU_mgv1a015237mg [Erythranthe guttata]
Length=164

 Score =   115 bits (289),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = +3

Query  63   AEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWV  242
             EI+++TAPADFRFPTTNQT HCFT Y+E+HRCVAAKG E  +C+KFA+ YR+LCPGEWV
Sbjct  89   PEIKIETAPADFRFPTTNQTRHCFTRYIEYHRCVAAKGDEAPECDKFAKYYRSLCPGEWV  148

Query  243  EKWNE  257
            +KWNE
Sbjct  149  DKWNE  153



>ref|NP_001140389.1| uncharacterized protein LOC100272443 [Zea mays]
 gb|ACF83724.1| unknown [Zea mays]
Length=166

 Score =   115 bits (289),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+++TAPADFRFPTTNQT HCFT YVE+HRCVAAKG +  +C+KFA+ YR+LCPGEWVE
Sbjct  92   EIKIETAPADFRFPTTNQTRHCFTRYVEYHRCVAAKGEDAPECDKFAKYYRSLCPGEWVE  151

Query  246  KWNE  257
            +WNE
Sbjct  152  RWNE  155



>gb|ACG47964.1| cytochrome c oxidase subunit [Zea mays]
Length=166

 Score =   115 bits (288),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+++TAPADFRFPTTNQT HCFT YVE+HRCVAAKG +  +C+KFA+ YR+LCPGEWVE
Sbjct  92   EIKIETAPADFRFPTTNQTRHCFTRYVEYHRCVAAKGEDAPECDKFAKYYRSLCPGEWVE  151

Query  246  KWNE  257
            +WNE
Sbjct  152  RWNE  155



>ref|NP_001050275.1| Os03g0390400 [Oryza sativa Japonica Group]
 dbj|BAA76393.1| cytochrome c oxidase subunit 6b-1 [Oryza sativa Japonica Group]
 dbj|BAB12338.1| cytochrome c oxidase subunit 6b [Oryza sativa Japonica Group]
 gb|AAR06368.1| cytochrome c oxidase subunit 6b-1 [Oryza sativa Japonica Group]
 gb|ABF96356.1| Cytochrome c oxidase subunit, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12189.1| Os03g0390400 [Oryza sativa Japonica Group]
 gb|EAZ27178.1| hypothetical protein OsJ_11115 [Oryza sativa Japonica Group]
 dbj|BAG99900.1| unnamed protein product [Oryza sativa Japonica Group]
Length=169

 Score =   115 bits (288),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+++TAPADFRFPTTNQT HCFT YVE+HRCVAAKG +  +C+KFA+ YR+LCPGEWVE
Sbjct  95   EIKIETAPADFRFPTTNQTRHCFTRYVEYHRCVAAKGEDAPECDKFAKYYRSLCPGEWVE  154

Query  246  KWNE  257
            +WNE
Sbjct  155  RWNE  158



>ref|XP_008658230.1| PREDICTED: uncharacterized protein LOC100272443 isoform X4 [Zea 
mays]
Length=162

 Score =   115 bits (288),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+++TAPADFRFPTTNQT HCFT YVE+HRCVAAKG +  +C+KFA+ YR+LCPGEWVE
Sbjct  88   EIKIETAPADFRFPTTNQTRHCFTRYVEYHRCVAAKGEDAPECDKFAKYYRSLCPGEWVE  147

Query  246  KWNE  257
            +WNE
Sbjct  148  RWNE  151



>ref|XP_006650155.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Oryza brachyantha]
Length=166

 Score =   115 bits (288),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+++TAPADFRFPTTNQT HCFT YVE+HRCVAAKG +  +C+KFA+ YR+LCPGEWVE
Sbjct  92   EIKIETAPADFRFPTTNQTRHCFTRYVEYHRCVAAKGEDAPECDKFAKYYRSLCPGEWVE  151

Query  246  KWNE  257
            +WNE
Sbjct  152  RWNE  155



>ref|XP_007141211.1| hypothetical protein PHAVU_008G176600g [Phaseolus vulgaris]
 gb|ESW13205.1| hypothetical protein PHAVU_008G176600g [Phaseolus vulgaris]
Length=177

 Score =   115 bits (289),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+L+TAPADFRFPTTNQT HCFT Y+E+HRCVAAKG +  +C+KFA+ YR+LCPGEW++
Sbjct  103  EIKLETAPADFRFPTTNQTRHCFTRYIEYHRCVAAKGEDASECDKFAKYYRSLCPGEWID  162

Query  246  KWNE  257
            +WNE
Sbjct  163  RWNE  166



>gb|ACG48101.1| cytochrome c oxidase subunit [Zea mays]
Length=162

 Score =   115 bits (287),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+++TAPADFRFPTTNQT HCFT YVE+HRCVAAKG +  +C+KFA+ YR+LCPGEWVE
Sbjct  88   EIKIETAPADFRFPTTNQTRHCFTRYVEYHRCVAAKGEDAPECDKFAKYYRSLCPGEWVE  147

Query  246  KWNE  257
            +WNE
Sbjct  148  RWNE  151



>ref|XP_006305630.1| hypothetical protein CARUB_v10010326mg [Capsella rubella]
 gb|EOA38528.1| hypothetical protein CARUB_v10010326mg [Capsella rubella]
Length=187

 Score =   115 bits (289),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 65/87 (75%), Gaps = 5/87 (6%)
 Frame = +3

Query  12   TGCAHRKGNFVRCSSSMAE-----IELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKG  176
            T  A  + N    S ++AE     I+L+TAPADFRFPTTNQT HCFT Y+E+HRCVAAKG
Sbjct  90   TPAATEENNDENSSEAVAEETPDEIKLETAPADFRFPTTNQTRHCFTRYIEYHRCVAAKG  149

Query  177  GEVGDCEKFARXYRALCPGEWVEKWNE  257
             E  +C+KFA+ YR+LCP EWV++WNE
Sbjct  150  DEAPECDKFAKFYRSLCPSEWVDRWNE  176



>emb|CDY04815.1| BnaC05g17740D [Brassica napus]
Length=163

 Score =   115 bits (287),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+L+TAPADFRFPTTNQT HCFT Y+E+HRCVAAKG E  +C+KF++ YR+LCPGEWV+
Sbjct  89   EIKLETAPADFRFPTTNQTRHCFTRYIEYHRCVAAKGDEAPECDKFSKFYRSLCPGEWVD  148

Query  246  KWNE  257
            +WNE
Sbjct  149  RWNE  152



>gb|EPS59241.1| hypothetical protein M569_15568, partial [Genlisea aurea]
Length=139

 Score =   114 bits (285),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  69   IELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVEK  248
            I+++TAPADFRFPTTNQT HCFT Y+E+HRCVAAKG E  +C+KFA+ YR+LCPGEWVEK
Sbjct  66   IKIETAPADFRFPTTNQTRHCFTRYIEYHRCVAAKGDEAPECQKFAKYYRSLCPGEWVEK  125

Query  249  WNE  257
            WNE
Sbjct  126  WNE  128



>ref|XP_004299671.1| PREDICTED: cytochrome c oxidase subunit 6b-1 [Fragaria vesca 
subsp. vesca]
Length=180

 Score =   115 bits (288),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+++TAPADFRFPTTNQT HCFT YVE+HRC+AAKG E  +C+KF + YR+LCPGEWVE
Sbjct  106  EIKIETAPADFRFPTTNQTRHCFTRYVEYHRCIAAKGEEAPECDKFKKYYRSLCPGEWVE  165

Query  246  KWNE  257
            +WNE
Sbjct  166  RWNE  169



>ref|XP_006305631.1| hypothetical protein CARUB_v10010326mg [Capsella rubella]
 gb|EOA38529.1| hypothetical protein CARUB_v10010326mg [Capsella rubella]
Length=202

 Score =   115 bits (289),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 65/87 (75%), Gaps = 5/87 (6%)
 Frame = +3

Query  12   TGCAHRKGNFVRCSSSMAE-----IELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKG  176
            T  A  + N    S ++AE     I+L+TAPADFRFPTTNQT HCFT Y+E+HRCVAAKG
Sbjct  105  TPAATEENNDENSSEAVAEETPDEIKLETAPADFRFPTTNQTRHCFTRYIEYHRCVAAKG  164

Query  177  GEVGDCEKFARXYRALCPGEWVEKWNE  257
             E  +C+KFA+ YR+LCP EWV++WNE
Sbjct  165  DEAPECDKFAKFYRSLCPSEWVDRWNE  191



>ref|XP_008658229.1| PREDICTED: uncharacterized protein LOC100272443 isoform X3 [Zea 
mays]
Length=187

 Score =   115 bits (287),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+++TAPADFRFPTTNQT HCFT YVE+HRCVAAKG +  +C+KFA+ YR+LCPGEWVE
Sbjct  113  EIKIETAPADFRFPTTNQTRHCFTRYVEYHRCVAAKGEDAPECDKFAKYYRSLCPGEWVE  172

Query  246  KWNE  257
            +WNE
Sbjct  173  RWNE  176



>ref|XP_003615162.1| Subunit 6b of cytochrome c oxidase [Medicago truncatula]
 gb|AES98120.1| cytochrome C oxidase, subunit VIb family protein [Medicago truncatula]
 gb|AFK34896.1| unknown [Medicago truncatula]
Length=183

 Score =   115 bits (287),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+L+TAP DFRFPTTNQT HCFT Y+E+HRCVAAKG +  +C+KFA+ YRALCPGEWV+
Sbjct  109  EIKLETAPVDFRFPTTNQTRHCFTRYIEYHRCVAAKGDDAPECDKFAKYYRALCPGEWVD  168

Query  246  KWNE  257
            +WNE
Sbjct  169  RWNE  172



>gb|EEC75393.1| hypothetical protein OsI_11877 [Oryza sativa Indica Group]
Length=185

 Score =   115 bits (287),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+++TAPADFRFPTTNQT HCFT YVE+HRCVAAKG +  +C+KFA+ YR+LCPGEWVE
Sbjct  111  EIKIETAPADFRFPTTNQTRHCFTRYVEYHRCVAAKGEDAPECDKFAKYYRSLCPGEWVE  170

Query  246  KWNE  257
            +WNE
Sbjct  171  RWNE  174



>gb|KHG00496.1| Cytochrome c oxidase subunit 6b-1 -like protein [Gossypium arboreum]
Length=177

 Score =   114 bits (286),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = +3

Query  51   SSSMAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCP  230
            S    EI+L+TAPADFRFPTTNQT HCFT Y+E+HRCVAAKG    +C+KFA+ YRALCP
Sbjct  98   SEETPEIKLETAPADFRFPTTNQTRHCFTRYIEYHRCVAAKGEGAPECDKFAKYYRALCP  157

Query  231  GEWVEKWNE  257
            GEW+++WNE
Sbjct  158  GEWIDRWNE  166



>gb|KJB58993.1| hypothetical protein B456_009G234400 [Gossypium raimondii]
Length=178

 Score =   114 bits (286),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = +3

Query  51   SSSMAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCP  230
            S    EI+L+TAPADFRFPTTNQT HCFT Y+E+HRCVAAKG    +C+KFA+ YRALCP
Sbjct  99   SEETPEIKLETAPADFRFPTTNQTRHCFTRYIEYHRCVAAKGEGAPECDKFAKYYRALCP  158

Query  231  GEWVEKWNE  257
            GEW+++WNE
Sbjct  159  GEWIDRWNE  167



>ref|XP_009413575.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Musa acuminata 
subsp. malaccensis]
Length=175

 Score =   114 bits (286),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+++TAPADFRFPTTNQT HCFT Y+E+HRC+AAKG +  +C KFA+ YR+LCPGEWVE
Sbjct  101  EIKIETAPADFRFPTTNQTRHCFTRYIEYHRCIAAKGEDASECNKFAKYYRSLCPGEWVE  160

Query  246  KWNE  257
            +WNE
Sbjct  161  RWNE  164



>ref|XP_010477504.1| PREDICTED: cytochrome c oxidase subunit 6b-1 [Camelina sativa]
Length=191

 Score =   115 bits (287),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+L+TAPADFRFPTTNQT HCFT Y+E+HRCVAAKG E  +C+KFA+ YR+LCP EWV+
Sbjct  117  EIKLETAPADFRFPTTNQTRHCFTRYIEYHRCVAAKGDEAPECDKFAKFYRSLCPSEWVD  176

Query  246  KWNE  257
            +WNE
Sbjct  177  RWNE  180



>gb|KEH32587.1| cytochrome C oxidase, subunit VIb family protein [Medicago truncatula]
Length=82

 Score =   112 bits (279),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +3

Query  69   IELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVEK  248
            IELKTAP DFRFPTTNQT HCFT Y+EFHRC+  KG   G+CEKFA+ YR+LCPGEWV+K
Sbjct  9    IELKTAPVDFRFPTTNQTRHCFTRYIEFHRCMTVKGENSGECEKFAKYYRSLCPGEWVDK  68

Query  249  WNE  257
            WNE
Sbjct  69   WNE  71



>ref|XP_008781379.1| PREDICTED: cytochrome c oxidase subunit 6b-2-like [Phoenix dactylifera]
Length=77

 Score =   111 bits (278),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  60   MAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEW  239
            MAEIELKTAPADF FP+ NQT+HCFT Y+E+H+C+ AKG +  DC+KFAR YR+LCP EW
Sbjct  1    MAEIELKTAPADFCFPSANQTSHCFTRYIEYHKCLKAKGEDAADCQKFARYYRSLCPLEW  60

Query  240  VEKWNE  257
            +EKWNE
Sbjct  61   IEKWNE  66



>ref|XP_010459999.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Camelina sativa]
Length=191

 Score =   115 bits (287),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 63/87 (72%), Gaps = 5/87 (6%)
 Frame = +3

Query  12   TGCAHRKGNFVRCSSSMAE-----IELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKG  176
            T  A    N    S  +AE     I+L+TAPADFRFPTTNQT HCFT Y+E+HRCVAAKG
Sbjct  94   TPAAAEDNNDENTSEEVAEETPDEIKLETAPADFRFPTTNQTRHCFTRYIEYHRCVAAKG  153

Query  177  GEVGDCEKFARXYRALCPGEWVEKWNE  257
             +  +C+KFA+ YR+LCP EWV++WNE
Sbjct  154  DDAPECDKFAKFYRSLCPSEWVDRWNE  180



>gb|EMT25976.1| Cytochrome c oxidase subunit 6B [Aegilops tauschii]
Length=162

 Score =   114 bits (284),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI ++TAPADFRFPTTNQT HCFT YVE+HRCVAAKG +  +CEKFA+ YR+LCP EWVE
Sbjct  88   EIVIETAPADFRFPTTNQTRHCFTRYVEYHRCVAAKGDDAPECEKFAKYYRSLCPSEWVE  147

Query  246  KWNE  257
            +WNE
Sbjct  148  RWNE  151



>dbj|BAJ94958.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=167

 Score =   114 bits (285),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI ++TAPADFRFPTTNQT HCFT YVE+HRCVAAKG +  +CEKFA+ YR+LCP EWVE
Sbjct  93   EIVIETAPADFRFPTTNQTRHCFTRYVEYHRCVAAKGDDAPECEKFAKYYRSLCPSEWVE  152

Query  246  KWNE  257
            +WNE
Sbjct  153  RWNE  156



>ref|XP_010521174.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Tarenaya hassleriana]
Length=182

 Score =   114 bits (286),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+L+TAPADFRFPTTNQT HCFT Y+E+HRCVAAKG +  +C+KFA+ YR+LCP EWVE
Sbjct  108  EIKLETAPADFRFPTTNQTRHCFTRYIEYHRCVAAKGEDAQECDKFAKYYRSLCPSEWVE  167

Query  246  KWNE  257
            +WNE
Sbjct  168  RWNE  171



>ref|XP_006433933.1| hypothetical protein CICLE_v10002573mg [Citrus clementina]
 gb|ESR47173.1| hypothetical protein CICLE_v10002573mg [Citrus clementina]
Length=192

 Score =   114 bits (286),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +3

Query  45   RCSSSMAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRAL  224
              S    EI+L+TAPADFRFPTTNQT HCFT Y+E+HRCVAAKG    +C+KFA+ YRAL
Sbjct  111  EASEETPEIKLETAPADFRFPTTNQTRHCFTRYIEYHRCVAAKGEGAPECDKFAKYYRAL  170

Query  225  CPGEWVEKWNE  257
            CP +W+EKWNE
Sbjct  171  CPSDWIEKWNE  181



>ref|XP_008386123.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Malus domestica]
Length=179

 Score =   114 bits (285),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+++TAPADFRFPTTNQT HCFT Y+E+HRC+AAKG +  +C+KFA+ YR+LCPGEWVE
Sbjct  105  EIKIETAPADFRFPTTNQTRHCFTRYIEYHRCIAAKGEDAPECDKFAKFYRSLCPGEWVE  164

Query  246  KWNE  257
            +WNE
Sbjct  165  RWNE  168



>gb|ACF79897.1| unknown [Zea mays]
 gb|ACG26229.1| cytochrome c oxidase subunit [Zea mays]
 gb|ACG36966.1| cytochrome c oxidase subunit [Zea mays]
 tpg|DAA45623.1| TPA: cytochrome c oxidase subunit [Zea mays]
Length=172

 Score =   114 bits (285),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+++TAPADFRFPTTNQT HCFT YVE+HRCVAAKG +  +C+KFA+ YR+LCPGEWV+
Sbjct  98   EIKIETAPADFRFPTTNQTRHCFTRYVEYHRCVAAKGEDAPECDKFAKYYRSLCPGEWVD  157

Query  246  KWNE  257
            +WNE
Sbjct  158  RWNE  161



>ref|XP_003562686.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Brachypodium 
distachyon]
Length=153

 Score =   113 bits (283),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            E++++TAPADFRFPTTNQT HCFT YVE+HRCVAAKG +  +CEKFA+ YR+LCP EWVE
Sbjct  79   EVKIETAPADFRFPTTNQTRHCFTRYVEYHRCVAAKGEDAPECEKFAKYYRSLCPSEWVE  138

Query  246  KWNE  257
            +WNE
Sbjct  139  RWNE  142



>ref|XP_004984149.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like isoform X2 
[Setaria italica]
Length=167

 Score =   114 bits (284),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+++TAPADFRFPTTNQT HCFT YVE+HRCVAAKG +  +C+KFA+ YR+LCPGEWV+
Sbjct  93   EIKIETAPADFRFPTTNQTRHCFTRYVEYHRCVAAKGEDAPECDKFAKYYRSLCPGEWVD  152

Query  246  KWNE  257
            +WNE
Sbjct  153  RWNE  156



>ref|XP_010272991.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Nelumbo nucifera]
Length=188

 Score =   114 bits (285),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+L+TAPADFRFPTTNQT HCFT Y+E+HRC+AAKG    +C+KFA+ YR+LCPGEW+E
Sbjct  114  EIKLETAPADFRFPTTNQTRHCFTRYIEYHRCIAAKGEGAPECDKFAKYYRSLCPGEWIE  173

Query  246  KWNE  257
            +WNE
Sbjct  174  RWNE  177



>ref|XP_010675986.1| PREDICTED: cytochrome c oxidase subunit 6b-1 [Beta vulgaris subsp. 
vulgaris]
Length=180

 Score =   114 bits (284),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+L+TAPADFRFPTTNQT HCFT Y+E+HRC AAKG +  +C+KFA+ YR+LCPGEWV+
Sbjct  106  EIKLETAPADFRFPTTNQTRHCFTRYIEYHRCTAAKGEDAPECDKFAKFYRSLCPGEWVD  165

Query  246  KWNE  257
            +WNE
Sbjct  166  RWNE  169



>gb|AAM92706.1| putative cytochrome c oxidase subunit [Triticum aestivum]
Length=157

 Score =   113 bits (283),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI ++TAPADFRFPTTNQT HCFT YVE+HRCVAAKG +  +CEKFA+ YR+LCP EWVE
Sbjct  83   EIVIETAPADFRFPTTNQTRHCFTRYVEYHRCVAAKGDDAPECEKFAKYYRSLCPSEWVE  142

Query  246  KWNE  257
            +WNE
Sbjct  143  RWNE  146



>gb|KFK44340.1| hypothetical protein AALP_AA1G245300 [Arabis alpina]
Length=186

 Score =   114 bits (285),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+L+TAPADFRFPTTNQT HCFT Y+E+HRCVAAKG E  +C+KFA+ YR+LCP EWV+
Sbjct  112  EIKLETAPADFRFPTTNQTRHCFTRYIEYHRCVAAKGDEAPECDKFAKFYRSLCPSEWVD  171

Query  246  KWNE  257
            +WNE
Sbjct  172  RWNE  175



>gb|AAM63485.1| cytochrome c oxidase subunit, putative [Arabidopsis thaliana]
Length=191

 Score =   114 bits (285),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+L+TAPADFRFPTTNQT HCFT YVE+HRCVAAKG +  +C+KFA+ YR+LCP EWV+
Sbjct  116  EIKLETAPADFRFPTTNQTRHCFTRYVEYHRCVAAKGDDAPECDKFAKFYRSLCPSEWVD  175

Query  246  KWNE  257
            +WNE
Sbjct  176  RWNE  179



>ref|NP_173661.1| cytochrome C oxidase 6B [Arabidopsis thaliana]
 sp|Q9S7L9.1|CX6B1_ARATH RecName: Full=Cytochrome c oxidase subunit 6b-1; Short=AtCOX6b-1 
[Arabidopsis thaliana]
 gb|AAF18532.1|AC006551_18 Subunit 6b of cytochrome c oxidase [Arabidopsis thaliana]
 dbj|BAA87883.1| subunit 6b of cytochrome c oxidase [Arabidopsis thaliana]
 gb|AAL36353.1| putative cytochrome c oxidase subunit [Arabidopsis thaliana]
 gb|AAM20330.1| putative cytochrome c oxidase subunit [Arabidopsis thaliana]
 gb|AEE30243.1| cytochrome C oxidase 6B [Arabidopsis thaliana]
Length=191

 Score =   114 bits (285),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+L+TAPADFRFPTTNQT HCFT YVE+HRCVAAKG +  +C+KFA+ YR+LCP EWV+
Sbjct  116  EIKLETAPADFRFPTTNQTRHCFTRYVEYHRCVAAKGDDAPECDKFAKFYRSLCPSEWVD  175

Query  246  KWNE  257
            +WNE
Sbjct  176  RWNE  179



>ref|XP_004252528.1| PREDICTED: cytochrome c oxidase subunit 6b-1 [Solanum lycopersicum]
Length=178

 Score =   113 bits (283),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+L+TAPADFRFPTTNQT HCFT YVE+HRC+AAKG    +C+KFA+ YR+LCPGEW++
Sbjct  104  EIKLETAPADFRFPTTNQTRHCFTRYVEYHRCIAAKGEGAPECDKFAKYYRSLCPGEWID  163

Query  246  KWNE  257
            +WNE
Sbjct  164  RWNE  167



>ref|XP_006658829.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Oryza brachyantha]
Length=159

 Score =   112 bits (281),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+++TAPADFRFPTTNQT HCFT Y+E+HRCVAAKG +  +CEKFA+ YR+LCP EW+E
Sbjct  85   EIKIETAPADFRFPTTNQTRHCFTRYIEYHRCVAAKGEDAPECEKFAKYYRSLCPSEWIE  144

Query  246  KWNE  257
            +WNE
Sbjct  145  RWNE  148



>ref|XP_010498713.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Camelina sativa]
Length=191

 Score =   114 bits (284),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+L+TAPADFRFPTTNQT HCFT Y+E+HRCVAAKG +  +C+KFA+ YR+LCP EWV+
Sbjct  117  EIKLETAPADFRFPTTNQTRHCFTRYIEYHRCVAAKGDDAPECDKFAKFYRSLCPSEWVD  176

Query  246  KWNE  257
            +WNE
Sbjct  177  RWNE  180



>ref|XP_003544809.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Glycine max]
Length=175

 Score =   113 bits (282),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 60/85 (71%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    HNCTGCAHRKGNFVRCSSSMAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGE  182
               +G           +    EI+L+TAPADFRFPTTNQT HCFT YVE+HRCVAAKG  
Sbjct  80   EQSSGNVEENSGNEDAAEETPEIKLETAPADFRFPTTNQTRHCFTRYVEYHRCVAAKGEG  139

Query  183  VGDCEKFARXYRALCPGEWVEKWNE  257
              +C+KFA+ YR+LCPGEW+++WNE
Sbjct  140  APECDKFAKYYRSLCPGEWIDRWNE  164



>gb|KHN26096.1| Cytochrome c oxidase subunit 6b-1 [Glycine soja]
Length=174

 Score =   113 bits (282),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 60/85 (71%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    HNCTGCAHRKGNFVRCSSSMAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGE  182
               +G           +    EI+L+TAPADFRFPTTNQT HCFT Y+E+HRCVAAKG  
Sbjct  79   EQSSGNVEENSGNEDVAEETPEIKLETAPADFRFPTTNQTRHCFTRYIEYHRCVAAKGEG  138

Query  183  VGDCEKFARXYRALCPGEWVEKWNE  257
              +C+KFA+ YR+LCPGEWV++WNE
Sbjct  139  APECDKFAKYYRSLCPGEWVDRWNE  163



>gb|KHN35491.1| Cytochrome c oxidase subunit 6b-1 [Glycine soja]
Length=175

 Score =   113 bits (282),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 60/85 (71%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    HNCTGCAHRKGNFVRCSSSMAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGE  182
               +G           +    EI+L+TAPADFRFPTTNQT HCFT YVE+HRCVAAKG  
Sbjct  80   EQSSGNVEENSGNEDAAEETPEIKLETAPADFRFPTTNQTRHCFTRYVEYHRCVAAKGEG  139

Query  183  VGDCEKFARXYRALCPGEWVEKWNE  257
              +C+KFA+ YR+LCPGEW+++WNE
Sbjct  140  APECDKFAKYYRSLCPGEWIDRWNE  164



>ref|XP_004490381.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Cicer arietinum]
Length=176

 Score =   113 bits (282),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+L+TAP DFRFPTTNQT HCFT Y+E+HRCVAAKG +  +C+KFA+ YR+LCPGEW++
Sbjct  102  EIKLETAPVDFRFPTTNQTRHCFTRYIEYHRCVAAKGEDAPECDKFAKYYRSLCPGEWID  161

Query  246  KWNE  257
            +WNE
Sbjct  162  RWNE  165



>ref|NP_001236320.1| uncharacterized protein LOC100306272 [Glycine max]
 gb|ACU14377.1| unknown [Glycine max]
Length=174

 Score =   113 bits (282),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 60/85 (71%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    HNCTGCAHRKGNFVRCSSSMAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGE  182
               +G           +    EI+L+TAPADFRFPTTNQT HCFT Y+E+HRCVAAKG  
Sbjct  79   EQSSGNVEENSGNEDVAEETPEIKLETAPADFRFPTTNQTRHCFTRYIEYHRCVAAKGEG  138

Query  183  VGDCEKFARXYRALCPGEWVEKWNE  257
              +C+KFA+ YR+LCPGEWV++WNE
Sbjct  139  APECDKFAKYYRSLCPGEWVDRWNE  163



>ref|XP_009777811.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Nicotiana 
sylvestris]
Length=192

 Score =   113 bits (283),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +3

Query  45   RCSSSMAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRAL  224
            + +    EI+L+TAPADFRFPTTNQT HCFT YVE+HRC+AAKG    +C+KFA+ YR+L
Sbjct  111  QSADETPEIKLETAPADFRFPTTNQTRHCFTRYVEYHRCIAAKGEGAPECDKFAKYYRSL  170

Query  225  CPGEWVEKWNE  257
            CPGEW+++WNE
Sbjct  171  CPGEWIDRWNE  181



>ref|XP_006472562.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Citrus sinensis]
 gb|KDO81039.1| hypothetical protein CISIN_1g029538mg [Citrus sinensis]
Length=192

 Score =   113 bits (283),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +3

Query  45   RCSSSMAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRAL  224
              S    +I+L+TAPADFRFPTTNQT HCFT Y+E+HRCVAAKG    +C+KFA+ YRAL
Sbjct  111  EASEETPDIKLETAPADFRFPTTNQTRHCFTRYIEYHRCVAAKGEGAPECDKFAKYYRAL  170

Query  225  CPGEWVEKWNE  257
            CP +W+EKWNE
Sbjct  171  CPSDWIEKWNE  181



>ref|XP_002890515.1| hypothetical protein ARALYDRAFT_889753 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66774.1| hypothetical protein ARALYDRAFT_889753 [Arabidopsis lyrata subsp. 
lyrata]
Length=192

 Score =   113 bits (283),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+L+TAPADFRFPTTNQT HCFT Y+E+HRCVAAKG +  +C+KFA+ YR+LCP EWV+
Sbjct  117  EIKLETAPADFRFPTTNQTRHCFTRYIEYHRCVAAKGDDAPECDKFAKFYRSLCPSEWVD  176

Query  246  KWNE  257
            +WNE
Sbjct  177  RWNE  180



>ref|XP_009145340.1| PREDICTED: cytochrome c oxidase subunit 6b-1 [Brassica rapa]
 emb|CDY71646.1| BnaAnng38290D [Brassica napus]
Length=162

 Score =   112 bits (281),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+L+TAPADFRFPTTNQT HCFT Y+E+HRCV+AKG +  +C+KF++ YR+LCPGEWV+
Sbjct  88   EIKLETAPADFRFPTTNQTRHCFTRYIEYHRCVSAKGDDAPECDKFSKFYRSLCPGEWVD  147

Query  246  KWNE  257
            +WNE
Sbjct  148  RWNE  151



>ref|XP_009632005.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Nicotiana 
tomentosiformis]
Length=192

 Score =   113 bits (283),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+L+TAPADFRFPTTNQT HCFT YVE+HRC+AAKG    +C+KFA+ YR+LCPGEW++
Sbjct  118  EIKLETAPADFRFPTTNQTRHCFTRYVEYHRCIAAKGEGAPECDKFAKYYRSLCPGEWID  177

Query  246  KWNE  257
            +WNE
Sbjct  178  RWNE  181



>ref|XP_007225925.1| hypothetical protein PRUPE_ppa012107mg [Prunus persica]
 gb|EMJ27124.1| hypothetical protein PRUPE_ppa012107mg [Prunus persica]
Length=183

 Score =   113 bits (282),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  69   IELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVEK  248
            I+++TAPADFRFPTTNQT HCFT YVE+HRCVAAKG +  +C+KFA+ YR+LCPGEW+E+
Sbjct  110  IKIETAPADFRFPTTNQTRHCFTRYVEYHRCVAAKGEDAPECDKFAKFYRSLCPGEWIER  169

Query  249  WNE  257
            WNE
Sbjct  170  WNE  172



>ref|XP_006360302.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Solanum tuberosum]
Length=196

 Score =   113 bits (283),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+L+TAPADFRFPTTNQT HCFT Y+E+HRC+AAKG    +C+KFA+ YR+LCPGEW++
Sbjct  122  EIKLETAPADFRFPTTNQTRHCFTRYIEYHRCIAAKGEGAPECDKFAKYYRSLCPGEWID  181

Query  246  KWNE  257
            +WNE
Sbjct  182  RWNE  185



>ref|XP_007018715.1| Cytochrome C oxidase polypeptide vib, putative [Theobroma cacao]
 gb|EOY15940.1| Cytochrome C oxidase polypeptide vib, putative [Theobroma cacao]
Length=187

 Score =   113 bits (282),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+L+TAPADFRFPTTNQT HCFT Y+E+HRCVAAKG    +C+KFA+ YR+LCPGEW++
Sbjct  113  EIKLETAPADFRFPTTNQTRHCFTRYIEYHRCVAAKGEGAPECDKFAKYYRSLCPGEWID  172

Query  246  KWNE  257
            +WNE
Sbjct  173  RWNE  176



>ref|XP_011009575.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Populus euphratica]
Length=189

 Score =   113 bits (282),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+++TAPAD+RFPTTNQT HCFT Y+E+HRCVAAKG +  +C+KFA+ YR+LCP EWVE
Sbjct  115  EIKIETAPADYRFPTTNQTRHCFTRYIEYHRCVAAKGEDASECDKFAKYYRSLCPSEWVE  174

Query  246  KWNE  257
            +WNE
Sbjct  175  RWNE  178



>gb|AFK42242.1| unknown [Lotus japonicus]
Length=177

 Score =   112 bits (281),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +3

Query  45   RCSSSMAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRAL  224
              +    EI+L+TAP DFRFPTTNQT HCFT Y+E+HRCVAAKG    +C+KFA+ YRAL
Sbjct  96   EAAEETPEIKLETAPVDFRFPTTNQTRHCFTRYIEYHRCVAAKGDGAPECDKFAKYYRAL  155

Query  225  CPGEWVEKWNE  257
            CPGEWV++WNE
Sbjct  156  CPGEWVDRWNE  166



>ref|XP_010025934.1| PREDICTED: cytochrome c oxidase subunit 6b-1 [Eucalyptus grandis]
 gb|KCW83080.1| hypothetical protein EUGRSUZ_B00038 [Eucalyptus grandis]
Length=195

 Score =   113 bits (283),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+++TAPADFRFPTTNQT HCFT YVE+HRC+AAKG +  +C+KF++ YR+LCPGEW++
Sbjct  121  EIKIETAPADFRFPTTNQTRHCFTRYVEYHRCIAAKGEDAQECQKFSKYYRSLCPGEWID  180

Query  246  KWNE  257
            +WNE
Sbjct  181  RWNE  184



>ref|XP_009623905.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Nicotiana 
tomentosiformis]
Length=185

 Score =   113 bits (282),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+L+TAPADFRFPTTNQT HCFT YVE+HRCVAAKG    +C+KFA+ YR+LCPGEW++
Sbjct  111  EIKLETAPADFRFPTTNQTRHCFTRYVEYHRCVAAKGEGAPECDKFAKYYRSLCPGEWID  170

Query  246  KWNE  257
            +WNE
Sbjct  171  RWNE  174



>ref|XP_011074207.1| PREDICTED: cytochrome c oxidase subunit 6b-1 [Sesamum indicum]
Length=191

 Score =   113 bits (282),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+L+TAPADFRFPTTNQT HCFT Y+E+HRC+AAKG    +C+KFA+ YR+LCPGEW++
Sbjct  117  EIKLETAPADFRFPTTNQTRHCFTRYIEYHRCIAAKGEGAPECDKFAKYYRSLCPGEWID  176

Query  246  KWNE  257
            +WNE
Sbjct  177  RWNE  180



>ref|XP_009373072.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like isoform X1 
[Pyrus x bretschneideri]
Length=174

 Score =   112 bits (281),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+++TAPADFRFPTTNQT HCFT Y+E+HRC+AAKG    +C+KFA+ YR+LCPGEWVE
Sbjct  100  EIKIETAPADFRFPTTNQTRHCFTRYIEYHRCIAAKGEGAPECDKFAKFYRSLCPGEWVE  159

Query  246  KWNE  257
            +WNE
Sbjct  160  RWNE  163



>ref|NP_001131473.1| hypothetical protein [Zea mays]
 gb|ACG26280.1| cytochrome c oxidase subunit [Zea mays]
Length=172

 Score =   112 bits (280),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+++T PADFRFPTTNQT HCFT YVE+HRCVAAKG +  +C+KFA+ YR+LCPGEWV+
Sbjct  98   EIKIETVPADFRFPTTNQTRHCFTRYVEYHRCVAAKGEDAPECDKFAKYYRSLCPGEWVD  157

Query  246  KWNE  257
            +WNE
Sbjct  158  RWNE  161



>ref|XP_009799940.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Nicotiana 
sylvestris]
Length=182

 Score =   112 bits (281),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+L+TAPADFRFPTTNQT HCFT YVE+HRCVAAKG    +C+KFA+ YR+LCPGEW++
Sbjct  108  EIKLETAPADFRFPTTNQTRHCFTRYVEYHRCVAAKGEGAPECDKFAKYYRSLCPGEWID  167

Query  246  KWNE  257
            +WNE
Sbjct  168  RWNE  171



>emb|CDY41480.1| BnaA08g20820D [Brassica napus]
Length=118

 Score =   110 bits (276),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI L+TAPADFRFPTTNQT HCFT Y+E+HRCVAAKG +  +C+KFA+ YR+LCP EWV+
Sbjct  44   EITLETAPADFRFPTTNQTRHCFTRYIEYHRCVAAKGDDAPECDKFAKFYRSLCPSEWVD  103

Query  246  KWNE  257
            +WNE
Sbjct  104  RWNE  107



>ref|XP_002307362.1| cytochrome c oxidase 6b family protein [Populus trichocarpa]
 gb|EEE94358.1| cytochrome c oxidase 6b family protein [Populus trichocarpa]
Length=189

 Score =   112 bits (281),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+++TAPAD+RFPTTNQT HCFT Y+E+HRCVAAKG +  +C+KFA+ YR+LCP EWVE
Sbjct  115  EIKIETAPADYRFPTTNQTRHCFTRYIEYHRCVAAKGEDASECDKFAKYYRSLCPSEWVE  174

Query  246  KWNE  257
            +WNE
Sbjct  175  RWNE  178



>gb|ABK96664.1| unknown [Populus trichocarpa x Populus deltoides]
Length=189

 Score =   112 bits (281),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+++TAPAD+RFPTTNQT HCFT Y+E+HRCVAAKG +  +C+KFA+ YR+LCP EWVE
Sbjct  115  EIKIETAPADYRFPTTNQTRHCFTRYIEYHRCVAAKGEDASECDKFAKYYRSLCPSEWVE  174

Query  246  KWNE  257
            +WNE
Sbjct  175  RWNE  178



>ref|XP_009373077.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like isoform X2 
[Pyrus x bretschneideri]
Length=151

 Score =   111 bits (278),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+++TAPADFRFPTTNQT HCFT Y+E+HRC+AAKG    +C+KFA+ YR+LCPGEWVE
Sbjct  77   EIKIETAPADFRFPTTNQTRHCFTRYIEYHRCIAAKGEGAPECDKFAKFYRSLCPGEWVE  136

Query  246  KWNE  257
            +WNE
Sbjct  137  RWNE  140



>gb|KHG23610.1| Cytochrome c oxidase subunit 6b-1 -like protein [Gossypium arboreum]
Length=88

 Score =   109 bits (273),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 57/64 (89%), Gaps = 1/64 (2%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            +I LKTAPADFRFPTTNQT HCFT Y+EFHRC+AAK GE  +CE+FA+ YR+LCPGEWVE
Sbjct  15   QIALKTAPADFRFPTTNQTRHCFTRYIEFHRCLAAK-GESNECERFAKYYRSLCPGEWVE  73

Query  246  KWNE  257
            +WNE
Sbjct  74   RWNE  77



>ref|XP_009110136.1| PREDICTED: cytochrome c oxidase subunit 6b-3-like [Brassica rapa]
Length=118

 Score =   110 bits (276),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI L+TAPADFRFPTTNQT HCFT Y+E+HRCVAAKG +  +C+KFA+ YR+LCP EWV+
Sbjct  44   EITLETAPADFRFPTTNQTRHCFTRYIEYHRCVAAKGDDAPECDKFAKFYRSLCPSEWVD  103

Query  246  KWNE  257
            +WNE
Sbjct  104  RWNE  107



>ref|XP_004958350.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Setaria italica]
Length=178

 Score =   112 bits (280),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+++TAPADFRFPTTNQT HCFT Y+E+HRCVAAKG    +CEKFA+ YR+LCP EW+E
Sbjct  104  EIKIETAPADFRFPTTNQTRHCFTRYIEYHRCVAAKGEGAPECEKFAKYYRSLCPSEWIE  163

Query  246  KWNE  257
            +WNE
Sbjct  164  RWNE  167



>gb|ABK92629.1| unknown [Populus trichocarpa]
Length=189

 Score =   112 bits (281),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+++TAPAD+RFPTTNQT HCFT Y+E+HRCVAAKG +  +C+KFA+ YR+LCP EWVE
Sbjct  115  EIKIETAPADYRFPTTNQTRHCFTRYIEYHRCVAAKGEDASECDKFAKYYRSLCPSEWVE  174

Query  246  KWNE  257
            +WNE
Sbjct  175  RWNE  178



>gb|KDP41415.1| hypothetical protein JCGZ_15822 [Jatropha curcas]
Length=188

 Score =   112 bits (280),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+L+TAPADFRFPTTNQT HCF  Y+E+HRCVAAKG    +C+KFA+ YR+LCPGEW+E
Sbjct  114  EIKLETAPADFRFPTTNQTRHCFARYIEYHRCVAAKGEGAPECDKFAKYYRSLCPGEWIE  173

Query  246  KWNE  257
            +WNE
Sbjct  174  RWNE  177



>emb|CDX91679.1| BnaC08g05980D [Brassica napus]
Length=114

 Score =   110 bits (275),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI L+TAPADFRFPTTNQT HCFT Y+E+HRCVAAKG +  +C+KFA+ YR+LCP EWV+
Sbjct  40   EITLETAPADFRFPTTNQTRHCFTRYIEYHRCVAAKGDDAPECDKFAKFYRSLCPSEWVD  99

Query  246  KWNE  257
            +WNE
Sbjct  100  RWNE  103



>ref|XP_003557780.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Brachypodium 
distachyon]
Length=172

 Score =   112 bits (279),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  69   IELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVEK  248
            I+++TAPADFRFPTTNQ+ HCFT YVE+HRCVAAKG +  +C+KFA+ YR+LCPGEWV++
Sbjct  99   IKIETAPADFRFPTTNQSRHCFTRYVEYHRCVAAKGEDASECDKFAKYYRSLCPGEWVDR  158

Query  249  WNE  257
            WNE
Sbjct  159  WNE  161



>gb|KJB21359.1| hypothetical protein B456_004G104700 [Gossypium raimondii]
Length=82

 Score =   109 bits (272),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 56/67 (84%), Gaps = 4/67 (6%)
 Frame = +3

Query  69   IELKTAPADFRFPTTNQTTHCFTHYVEFH----RCVAAKGGEVGDCEKFARXYRALCPGE  236
            IELKTAPADFRFPTTNQT HCFT Y+EFH    RC+AAKG E   CEKFA+ YR+LCPGE
Sbjct  5    IELKTAPADFRFPTTNQTRHCFTRYIEFHRSNCRCLAAKGEESNQCEKFAKYYRSLCPGE  64

Query  237  WVEKWNE  257
            W++KWNE
Sbjct  65   WIDKWNE  71



>ref|XP_006363287.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Solanum tuberosum]
Length=185

 Score =   112 bits (279),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+L+TAPADFRFPTTNQT HCFT YVE+HRC AAKG    +C+KFA+ YR+LCPGEWV+
Sbjct  111  EIKLETAPADFRFPTTNQTRHCFTRYVEYHRCTAAKGEGAPECDKFAKYYRSLCPGEWVD  170

Query  246  KWNE  257
            +WNE
Sbjct  171  RWNE  174



>ref|XP_010267072.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Nelumbo nucifera]
Length=155

 Score =   111 bits (277),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+L+TAPADFRFPTTNQT HCFT Y+E+HRC AAKG    +C+KFA+ YR+LCPGEW++
Sbjct  81   EIKLETAPADFRFPTTNQTRHCFTRYIEYHRCTAAKGEGAPECDKFAKYYRSLCPGEWID  140

Query  246  KWNE  257
            +WNE
Sbjct  141  RWNE  144



>ref|XP_008356355.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Malus domestica]
Length=152

 Score =   110 bits (276),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+++TAPADFRFPTTNQT HCFT Y+E+HRC+AAKG    +C+KFA+ YR+LCPGEWVE
Sbjct  78   EIKIETAPADFRFPTTNQTRHCFTRYIEYHRCIAAKGEGAPECDKFAKFYRSLCPGEWVE  137

Query  246  KWNE  257
            +WNE
Sbjct  138  RWNE  141



>ref|XP_002463195.1| hypothetical protein SORBIDRAFT_02g039590 [Sorghum bicolor]
 gb|EER99716.1| hypothetical protein SORBIDRAFT_02g039590 [Sorghum bicolor]
Length=216

 Score =   112 bits (280),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+++TAPADFRFPTTNQT HCFT Y+E+HRCVAAKG    +CEKFA+ YR+LCP EW+E
Sbjct  142  EIKIETAPADFRFPTTNQTRHCFTRYIEYHRCVAAKGEGAPECEKFAKYYRSLCPSEWIE  201

Query  246  KWNE  257
            +WNE
Sbjct  202  RWNE  205



>ref|XP_010535301.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome c oxidase subunit 
6b-1 [Tarenaya hassleriana]
Length=178

 Score =   111 bits (277),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +3

Query  69   IELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVEK  248
            I+L+TAPADFRFPTTNQT HCFT Y+E+HRCVAAKG    +C+KFA+ YR+LCP EWVE+
Sbjct  105  IKLETAPADFRFPTTNQTRHCFTRYIEYHRCVAAKGEGAEECDKFAKYYRSLCPSEWVER  164

Query  249  WNE  257
            WNE
Sbjct  165  WNE  167



>ref|XP_008219336.1| PREDICTED: cytochrome c oxidase subunit 6b-1 [Prunus mume]
Length=183

 Score =   111 bits (277),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +3

Query  69   IELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVEK  248
            I+++TAPADFRFPTTNQT HCFT YVE+HRCVAAKG    +C+KFA+ YR+LCPGEW+E+
Sbjct  110  IKIETAPADFRFPTTNQTRHCFTRYVEYHRCVAAKGEGAPECDKFAKFYRSLCPGEWIER  169

Query  249  WNE  257
            WNE
Sbjct  170  WNE  172



>gb|KDP38756.1| hypothetical protein JCGZ_04109 [Jatropha curcas]
Length=84

 Score =   108 bits (270),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWV  242
            EIELKTAPADFRFPTTNQT HCFT Y+EFHRC+AAKG E  +CE+FA+ YRALCPGEWV
Sbjct  4    EIELKTAPADFRFPTTNQTRHCFTRYIEFHRCLAAKGEESNECERFAKYYRALCPGEWV  62



>ref|XP_004152624.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Cucumis sativus]
 ref|XP_004162224.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Cucumis sativus]
 gb|KGN62709.1| hypothetical protein Csa_2G369100 [Cucumis sativus]
Length=195

 Score =   111 bits (278),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+L+TAP DFRFPTTNQT HCFT Y+EFHRC  AKG    +CEKFA+ YR+LCP EWVE
Sbjct  121  EIKLETAPVDFRFPTTNQTRHCFTRYIEFHRCTQAKGEGAPECEKFAKYYRSLCPSEWVE  180

Query  246  KWNE  257
            KWNE
Sbjct  181  KWNE  184



>dbj|BAJ88460.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=85

 Score =   108 bits (270),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +3

Query  39   FVRCSSSMAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYR  218
             V  S  +  IE+KT+PADFRFPTTNQT HCFT YVEFH CV AKG E  +C+KFA+ YR
Sbjct  2    IVEKSKIVCLIEIKTSPADFRFPTTNQTRHCFTRYVEFHGCVGAKGDEAVECDKFAKYYR  61

Query  219  ALCPGEWVEKWNE  257
            +LCP EWV+KWNE
Sbjct  62   SLCPAEWVDKWNE  74



>gb|EEC82467.1| hypothetical protein OsI_26908 [Oryza sativa Indica Group]
Length=190

 Score =   111 bits (277),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+++TAPADFRFPTTNQT HCFT Y+E+HRCVAAKG    +CEKFA+ YR+LCP EW+E
Sbjct  116  EIKIETAPADFRFPTTNQTRHCFTRYIEYHRCVAAKGEGAPECEKFAKYYRSLCPSEWIE  175

Query  246  KWNE  257
            +WNE
Sbjct  176  RWNE  179



>dbj|BAC10187.1| putative cytochrome c oxidase subunit 6b-1 [Oryza sativa Japonica 
Group]
Length=174

 Score =   110 bits (275),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+++TAPADFRFPTTNQT HCFT Y+E+HRCVAAKG    +CEKFA+ YR+LCP EW+E
Sbjct  100  EIKIETAPADFRFPTTNQTRHCFTRYIEYHRCVAAKGEGAPECEKFAKYYRSLCPSEWIE  159

Query  246  KWNE  257
            +WNE
Sbjct  160  RWNE  163



>ref|XP_008782171.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Phoenix dactylifera]
Length=221

 Score =   111 bits (278),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +3

Query  69   IELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVEK  248
            I+L+TAPADFRFPTTNQT HCFT Y+E+H+C+AAKG    DC+KFA+ YR+LCP EW+E+
Sbjct  148  IKLETAPADFRFPTTNQTRHCFTRYIEYHKCIAAKGEGAPDCDKFAKYYRSLCPSEWIER  207

Query  249  WNE  257
            WNE
Sbjct  208  WNE  210



>ref|XP_010916711.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like isoform X2 
[Elaeis guineensis]
Length=159

 Score =   109 bits (273),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +3

Query  69   IELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVEK  248
            I+L+TAPADFRFPTTNQT HCFT Y+E+H+CVAAKG    +CEKFA+ YR+LCP EW+E+
Sbjct  86   IKLETAPADFRFPTTNQTRHCFTRYIEYHKCVAAKGEGAPECEKFAKYYRSLCPSEWIER  145

Query  249  WNE  257
            WNE
Sbjct  146  WNE  148



>gb|ABK95863.1| unknown [Populus trichocarpa]
Length=183

 Score =   110 bits (275),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +3

Query  69   IELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVEK  248
            I+L+TAPAD+RFPTTNQT HCFT Y+E+HRCVAAKG    +C+KFA+ YR+LCP EWVE+
Sbjct  110  IKLETAPADYRFPTTNQTRHCFTRYIEYHRCVAAKGEGASECDKFAKYYRSLCPSEWVER  169

Query  249  WNE  257
            WNE
Sbjct  170  WNE  172



>gb|AFK39313.1| unknown [Medicago truncatula]
Length=87

 Score =   107 bits (267),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +3

Query  60   MAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEW  239
            MAEIELKTAP DFRFPTTNQT HCFT Y+EFHRC+  KG   G+CEKFA+ YR+LCPGEW
Sbjct  1    MAEIELKTAPVDFRFPTTNQTRHCFTRYIEFHRCMTVKGENSGECEKFAKYYRSLCPGEW  60

Query  240  VE  245
            ++
Sbjct  61   MQ  62



>ref|XP_010916710.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like isoform X1 
[Elaeis guineensis]
Length=164

 Score =   109 bits (273),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +3

Query  69   IELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVEK  248
            I+L+TAPADFRFPTTNQT HCFT Y+E+H+CVAAKG    +CEKFA+ YR+LCP EW+E+
Sbjct  91   IKLETAPADFRFPTTNQTRHCFTRYIEYHKCVAAKGEGAPECEKFAKYYRSLCPSEWIER  150

Query  249  WNE  257
            WNE
Sbjct  151  WNE  153



>ref|XP_008444857.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Cucumis melo]
Length=190

 Score =   110 bits (275),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +3

Query  45   RCSSSMAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRAL  224
              +    EI+L+TAP DFRFPTTNQT HCFT Y+E+HRC  AKG    +CEKFA+ YR+L
Sbjct  109  ESTDEQPEIKLETAPVDFRFPTTNQTRHCFTRYIEYHRCTQAKGEGAPECEKFAKYYRSL  168

Query  225  CPGEWVEKWNE  257
            CP EWVEKWNE
Sbjct  169  CPSEWVEKWNE  179



>ref|XP_010534085.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like isoform X1 
[Tarenaya hassleriana]
Length=167

 Score =   109 bits (273),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +3

Query  69   IELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVEK  248
            I+L+TAPADFRFPTTNQT HCFT Y+E+HRCV AKG +  +C+KFA+ YR+LCP EW+E+
Sbjct  94   IKLETAPADFRFPTTNQTRHCFTRYIEYHRCVEAKGEDAQECDKFAKYYRSLCPSEWIER  153

Query  249  WNE  257
            WNE
Sbjct  154  WNE  156



>ref|XP_011016796.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Populus euphratica]
Length=183

 Score =   109 bits (273),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +3

Query  69   IELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVEK  248
            I+L+TAPAD+RFPTTNQT HCFT Y+E+HRCVAAKG    +C+KFA+ YR+LCP EWVE+
Sbjct  110  IKLETAPADYRFPTTNQTRHCFTRYIEYHRCVAAKGEGASECDKFAKYYRSLCPSEWVER  169

Query  249  WNE  257
            WNE
Sbjct  170  WNE  172



>ref|XP_010534086.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like isoform X2 
[Tarenaya hassleriana]
Length=154

 Score =   108 bits (271),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +3

Query  69   IELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVEK  248
            I+L+TAPADFRFPTTNQT HCFT Y+E+HRCV AKG +  +C+KFA+ YR+LCP EW+E+
Sbjct  81   IKLETAPADFRFPTTNQTRHCFTRYIEYHRCVEAKGEDAQECDKFAKYYRSLCPSEWIER  140

Query  249  WNE  257
            WNE
Sbjct  141  WNE  143



>ref|XP_004237938.1| PREDICTED: cytochrome c oxidase subunit 6b-1 [Solanum lycopersicum]
Length=185

 Score =   109 bits (273),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +3

Query  69   IELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVEK  248
            I+L+TAPADFRFPTTNQ+ HCFT YVE+HRC AAKG    +C+KFA+ YR+LCPGEWV++
Sbjct  112  IKLETAPADFRFPTTNQSRHCFTRYVEYHRCTAAKGEGAPECDKFAKYYRSLCPGEWVDR  171

Query  249  WNE  257
            WNE
Sbjct  172  WNE  174



>ref|XP_002513958.1| cytochrome C oxidase polypeptide vib, putative [Ricinus communis]
 gb|EEF48541.1| cytochrome C oxidase polypeptide vib, putative [Ricinus communis]
Length=191

 Score =   109 bits (272),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +3

Query  69   IELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVEK  248
            I+L+TAPADFRFPTTNQT HCFT YVE+HRC AAKG    +C+KFA+ YR+LCPGEW+++
Sbjct  118  IKLETAPADFRFPTTNQTRHCFTRYVEYHRCTAAKGEGAPECDKFAKFYRSLCPGEWIDR  177

Query  249  WNE  257
            WNE
Sbjct  178  WNE  180



>gb|EEC77562.1| hypothetical protein OsI_16493 [Oryza sativa Indica Group]
Length=73

 Score =   105 bits (263),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  60   MAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEW  239
            MAEIE+KTAPADFRFPTTNQT HCFT Y+E+HRCV AKG    DCEKFA+ YR+LCP EW
Sbjct  1    MAEIEIKTAPADFRFPTTNQTRHCFTRYIEYHRCVNAKGEATADCEKFAKYYRSLCPAEW  60

Query  240  VE  245
             +
Sbjct  61   FD  62



>ref|XP_009409166.1| PREDICTED: cytochrome c oxidase subunit 6b-1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009409167.1| PREDICTED: cytochrome c oxidase subunit 6b-1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009409168.1| PREDICTED: cytochrome c oxidase subunit 6b-1 [Musa acuminata 
subsp. malaccensis]
Length=168

 Score =   108 bits (270),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +3

Query  69   IELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVEK  248
            I+++TAPADFRFPTTNQT HCFT Y+E+HRC+AAKG    +C+KFA+ YR+LCP EW+E+
Sbjct  95   IKIETAPADFRFPTTNQTRHCFTRYIEYHRCIAAKGEGAPECDKFAKYYRSLCPSEWIER  154

Query  249  WNE  257
            WNE
Sbjct  155  WNE  157



>gb|ABK23476.1| unknown [Picea sitchensis]
Length=165

 Score =   108 bits (270),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +3

Query  72   ELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVEKW  251
            ++KTAPADFRFPTTNQT HCFT Y+E+H+C+AAKG    +CEKFAR YR+LCPGEW++ W
Sbjct  93   DIKTAPADFRFPTTNQTRHCFTRYIEYHKCIAAKGEGASECEKFARHYRSLCPGEWIDSW  152

Query  252  NE  257
            NE
Sbjct  153  NE  154



>emb|CDP01101.1| unnamed protein product [Coffea canephora]
Length=194

 Score =   109 bits (272),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +3

Query  75   LKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVEKWN  254
            L+TAPADFRFPTTNQT HCFT Y+E+HRC+AAKG    +C+KFA+ YR+LCPGEW+++WN
Sbjct  123  LETAPADFRFPTTNQTRHCFTRYIEYHRCIAAKGEGASECQKFAKYYRSLCPGEWIDRWN  182

Query  255  E  257
            E
Sbjct  183  E  183



>ref|XP_002282064.1| PREDICTED: cytochrome c oxidase subunit 6b-1 isoform X4 [Vitis 
vinifera]
Length=175

 Score =   108 bits (270),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +3

Query  63   AEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWV  242
            +EI+L+TAPADFRFP+TNQT HCFT Y+E+HRC AAKG    +C+KFA+ YR+LCP EWV
Sbjct  100  SEIKLETAPADFRFPSTNQTRHCFTRYIEYHRCTAAKGEGATECDKFAKFYRSLCPAEWV  159

Query  243  EKWNE  257
            E+WNE
Sbjct  160  ERWNE  164



>ref|XP_006453501.1| hypothetical protein CICLE_v10010074mg [Citrus clementina]
 gb|ESR66741.1| hypothetical protein CICLE_v10010074mg [Citrus clementina]
 gb|KDO62352.1| hypothetical protein CISIN_1g034905mg [Citrus sinensis]
Length=72

 Score =   105 bits (262),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWV  242
            EIELKTAPADFRFPTTNQT HCFT Y+EFHRC+AAKG E  +CE+FA+ YR+LCPG+WV
Sbjct  5    EIELKTAPADFRFPTTNQTRHCFTRYIEFHRCLAAKGEESNECERFAKYYRSLCPGDWV  63



>ref|XP_002282033.1| PREDICTED: cytochrome c oxidase subunit 6b-1 isoform X1 [Vitis 
vinifera]
 emb|CBI25308.3| unnamed protein product [Vitis vinifera]
Length=191

 Score =   108 bits (271),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +3

Query  63   AEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWV  242
            +EI+L+TAPADFRFP+TNQT HCFT Y+E+HRC AAKG    +C+KFA+ YR+LCP EWV
Sbjct  116  SEIKLETAPADFRFPSTNQTRHCFTRYIEYHRCTAAKGEGATECDKFAKFYRSLCPAEWV  175

Query  243  EKWNE  257
            E+WNE
Sbjct  176  ERWNE  180



>gb|EAZ40696.1| hypothetical protein OsJ_25165 [Oryza sativa Japonica Group]
Length=255

 Score =   110 bits (274),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+++TAPADFRFPTTNQT HCFT Y+E+HRCVAAKG    +CEKFA+ YR+LCP EW+E
Sbjct  181  EIKIETAPADFRFPTTNQTRHCFTRYIEYHRCVAAKGEGAPECEKFAKYYRSLCPSEWIE  240

Query  246  KWNE  257
            +WNE
Sbjct  241  RWNE  244



>ref|XP_010658140.1| PREDICTED: cytochrome c oxidase subunit 6b-1 isoform X3 [Vitis 
vinifera]
Length=191

 Score =   108 bits (270),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +3

Query  63   AEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWV  242
            +EI+L+TAPADFRFP+TNQT HCFT Y+E+HRC AAKG    +C+KFA+ YR+LCP EWV
Sbjct  116  SEIKLETAPADFRFPSTNQTRHCFTRYIEYHRCTAAKGEGATECDKFAKFYRSLCPAEWV  175

Query  243  EKWNE  257
            E+WNE
Sbjct  176  ERWNE  180



>gb|KJB76600.1| hypothetical protein B456_012G096600 [Gossypium raimondii]
 gb|KJB76601.1| hypothetical protein B456_012G096600 [Gossypium raimondii]
 gb|KJB76602.1| hypothetical protein B456_012G096600 [Gossypium raimondii]
Length=77

 Score =   105 bits (261),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 56/64 (88%), Gaps = 1/64 (2%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EIELKTAPADFRFPTTNQT HCFT Y+EFH C+AAK GE  +CE+FA+ Y +LCPGEWVE
Sbjct  4    EIELKTAPADFRFPTTNQTRHCFTRYIEFHGCLAAK-GESNECERFAKYYLSLCPGEWVE  62

Query  246  KWNE  257
            +W+E
Sbjct  63   RWSE  66



>emb|CAB36775.1| putative protein [Arabidopsis thaliana]
 emb|CAB79608.1| putative protein [Arabidopsis thaliana]
Length=164

 Score =   107 bits (267),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 60/86 (70%), Gaps = 7/86 (8%)
 Frame = +3

Query  18   CAHRKGNFVRCSSSMAEIELKTAPADFRFPTTNQTTHCFTHYVEFHR------CVAAKGG  179
            CA R G  +        IELKTAPADFRFPTTNQT HCFT Y+EFHR      C  AKG 
Sbjct  69   CAMRHGTPL-ARFLKPRIELKTAPADFRFPTTNQTRHCFTRYIEFHRYSCVIECTTAKGE  127

Query  180  EVGDCEKFARXYRALCPGEWVEKWNE  257
            +  +CE+FA+ YRALCPGEWV+KWNE
Sbjct  128  DANECERFAKYYRALCPGEWVDKWNE  153



>gb|ABK23944.1| unknown [Picea sitchensis]
 gb|ABR16543.1| unknown [Picea sitchensis]
Length=85

 Score =   105 bits (261),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +3

Query  75   LKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVEKWN  254
            LKTAPADFRFPTTNQT HCFT Y+E+H+C+AAKG    +C+KFA+ YR+LCPGEW+++WN
Sbjct  14   LKTAPADFRFPTTNQTRHCFTRYIEYHKCLAAKGEGATECDKFAKYYRSLCPGEWIDRWN  73

Query  255  E  257
            E
Sbjct  74   E  74



>ref|XP_002281992.1| PREDICTED: cytochrome c oxidase subunit 6b-1 isoform X2 [Vitis 
vinifera]
Length=191

 Score =   107 bits (268),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +3

Query  63   AEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWV  242
            +EI+L+TAPADFRFP+TNQT HCFT Y+E+HRC A KG    +C+KFA+ YR+LCP EWV
Sbjct  116  SEIKLETAPADFRFPSTNQTRHCFTRYIEYHRCTAVKGEGASECDKFAKFYRSLCPAEWV  175

Query  243  EKWNE  257
            E+WNE
Sbjct  176  ERWNE  180



>emb|CBI25309.3| unnamed protein product [Vitis vinifera]
Length=224

 Score =   108 bits (269),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +3

Query  63   AEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWV  242
            +EI+L+TAPADFRFP+TNQT HCFT Y+E+HRC A KG    +C+KFA+ YR+LCP EWV
Sbjct  149  SEIKLETAPADFRFPSTNQTRHCFTRYIEYHRCTAVKGEGASECDKFAKFYRSLCPAEWV  208

Query  243  EKWNE  257
            E+WNE
Sbjct  209  ERWNE  213



>ref|XP_008804786.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Phoenix dactylifera]
Length=164

 Score =   106 bits (265),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +3

Query  69   IELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVEK  248
            I+L+TAPADFRFPTTNQT HCFT Y+E+H+C A KG    +CEKFA+ YR+LCP EW+E+
Sbjct  91   IKLETAPADFRFPTTNQTRHCFTRYIEYHKCTAVKGEGAPECEKFAKYYRSLCPSEWIER  150

Query  249  WNE  257
            WNE
Sbjct  151  WNE  153



>ref|XP_010274628.1| PREDICTED: cytochrome c oxidase subunit 6b-3-like, partial [Nelumbo 
nucifera]
Length=80

 Score =   103 bits (258),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            ++ LKTAPAD RFP+TNQT HCF  YVE+HRC+  KG E  +CEKFAR YR+LCP EW++
Sbjct  6    QVALKTAPADIRFPSTNQTRHCFARYVEYHRCIREKGDEAPECEKFARYYRSLCPSEWID  65

Query  246  KWNE  257
            KWNE
Sbjct  66   KWNE  69



>ref|XP_010926331.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Elaeis guineensis]
 ref|XP_010926332.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Elaeis guineensis]
Length=226

 Score =   107 bits (268),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +3

Query  69   IELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVEK  248
            I+L+TAPADFRFPTTNQT HCFT Y E+H+C+AAKG    DC+KFA+ YR+LCP EW+E+
Sbjct  153  IKLETAPADFRFPTTNQTRHCFTRYCEYHKCIAAKGEGAPDCDKFAKYYRSLCPSEWIER  212

Query  249  WNE  257
            WNE
Sbjct  213  WNE  215



>ref|XP_010929209.1| PREDICTED: cytochrome c oxidase subunit 6b-3 isoform X2 [Elaeis 
guineensis]
Length=75

 Score =   103 bits (257),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  60   MAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEW  239
            MAEIELKTAPADFRFPTTNQT HCFT Y+E+H+C+ AKG +  +C+KFAR YR+LCP EW
Sbjct  1    MAEIELKTAPADFRFPTTNQTRHCFTRYIEYHKCLNAKGEDASECQKFARYYRSLCPMEW  60



>ref|XP_006416198.1| hypothetical protein EUTSA_v10008804mg [Eutrema salsugineum]
 gb|ESQ34551.1| hypothetical protein EUTSA_v10008804mg [Eutrema salsugineum]
Length=202

 Score =   106 bits (265),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWV  242
            EI+L+TAPADFRFPTTNQT HCFT Y+E+HRCVAAKG E  +C+KFA+ YR+LCP EWV
Sbjct  117  EIKLETAPADFRFPTTNQTRHCFTRYIEYHRCVAAKGDEAPECDKFAKFYRSLCPSEWV  175



>gb|KJB58992.1| hypothetical protein B456_009G234400 [Gossypium raimondii]
Length=191

 Score =   106 bits (264),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +3

Query  51   SSSMAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCP  230
            S    EI+L+TAPADFRFPTTNQT HCFT Y+E+HRCVAAKG    +C+KFA+ YRALCP
Sbjct  99   SEETPEIKLETAPADFRFPTTNQTRHCFTRYIEYHRCVAAKGEGAPECDKFAKYYRALCP  158

Query  231  GEWVE  245
            GEW++
Sbjct  159  GEWID  163



>emb|CAE01625.3| OSJNBa0029H02.2 [Oryza sativa Japonica Group]
 gb|EAZ14258.1| hypothetical protein OsJ_04184 [Oryza sativa Japonica Group]
Length=76

 Score =   102 bits (253),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +3

Query  57   SMAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGE  236
            S+ +IE+KTAPADFRFPTTNQT HCFT Y+E+HRCV AKG    DCEKFA+ YR+LCP E
Sbjct  15   SIHQIEIKTAPADFRFPTTNQTRHCFTRYIEYHRCVNAKGEATADCEKFAKYYRSLCPAE  74

Query  237  W  239
            W
Sbjct  75   W  75



>ref|XP_004984148.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like isoform X1 
[Setaria italica]
Length=178

 Score =   104 bits (259),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWV  242
            EI+++TAPADFRFPTTNQT HCFT YVE+HRCVAAKG +  +C+KFA+ YR+LCPGEWV
Sbjct  93   EIKIETAPADFRFPTTNQTRHCFTRYVEYHRCVAAKGEDAPECDKFAKYYRSLCPGEWV  151



>ref|XP_008658228.1| PREDICTED: uncharacterized protein LOC100272443 isoform X2 [Zea 
mays]
Length=194

 Score =   104 bits (260),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEW  239
            EI+++TAPADFRFPTTNQT HCFT YVE+HRCVAAKG +  +C+KFA+ YR+LCPGEW
Sbjct  92   EIKIETAPADFRFPTTNQTRHCFTRYVEYHRCVAAKGEDAPECDKFAKYYRSLCPGEW  149



>ref|XP_001784031.1| predicted protein [Physcomitrella patens]
 gb|EDQ51137.1| predicted protein, partial [Physcomitrella patens]
Length=73

 Score =   100 bits (249),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  72   ELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVEKW  251
            ++KTAP DFRFPTTNQ  HCFT Y EFH+C A KG +  +C+K+AR YR+LCPGEW++KW
Sbjct  1    DIKTAPMDFRFPTTNQAKHCFTRYNEFHKCAAEKGEDAKECQKYARYYRSLCPGEWIDKW  60

Query  252  NE  257
            NE
Sbjct  61   NE  62



>ref|XP_008658227.1| PREDICTED: uncharacterized protein LOC100272443 isoform X1 [Zea 
mays]
Length=215

 Score =   104 bits (259),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEW  239
            EI+++TAPADFRFPTTNQT HCFT YVE+HRCVAAKG +  +C+KFA+ YR+LCPGEW
Sbjct  113  EIKIETAPADFRFPTTNQTRHCFTRYVEYHRCVAAKGEDAPECDKFAKYYRSLCPGEW  170



>gb|KHN25113.1| Cytochrome c oxidase subunit 6b-3, partial [Glycine soja]
Length=61

 Score =   100 bits (248),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +3

Query  69   IELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWV  242
            IELKTAPADF FPTTN T HCFT Y EFHRC+A KGG  G+CE+FA+ YR+LCPGEWV
Sbjct  1    IELKTAPADFHFPTTNHTRHCFTRYTEFHRCLATKGGNSGECERFAKYYRSLCPGEWV  58



>gb|KHN34761.1| Cytochrome c oxidase subunit 6b-2 [Glycine soja]
Length=77

 Score =   100 bits (248),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 54/64 (84%), Gaps = 1/64 (2%)
 Frame = +3

Query  69   IELKTAPADFRFPTTNQTTHCFTHYV-EFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            IELKTAPADFRFPTTNQT HCFT  + +  RC+AAKG   G+CE+FA+ YR+LCPGEWVE
Sbjct  3    IELKTAPADFRFPTTNQTRHCFTGGIPDIGRCLAAKGENSGECERFAKYYRSLCPGEWVE  62

Query  246  KWNE  257
            +WNE
Sbjct  63   RWNE  66



>gb|ABK26488.1| unknown [Picea sitchensis]
Length=153

 Score =   101 bits (251),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +3

Query  72   ELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWV  242
            ++KTAPADFRFPTTNQT HCFT Y+E+H+C+AAKG    +CEKFAR YR+LCPGEWV
Sbjct  93   DIKTAPADFRFPTTNQTRHCFTRYIEYHKCIAAKGEGASECEKFARHYRSLCPGEWV  149



>gb|KDO81040.1| hypothetical protein CISIN_1g029538mg [Citrus sinensis]
Length=192

 Score =   102 bits (253),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +3

Query  45   RCSSSMAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRAL  224
              S    +I+L+TAPADFRFPTTNQT HCFT Y+E+HRCVAAKG    +C+KFA+ YRAL
Sbjct  111  EASEETPDIKLETAPADFRFPTTNQTRHCFTRYIEYHRCVAAKGEGAPECDKFAKYYRAL  170

Query  225  CPGEWV  242
            CP +WV
Sbjct  171  CPSDWV  176



>gb|ACW82405.1| cytochrome c oxidase subunit 6b [Larix kaempferi]
Length=180

 Score =   101 bits (251),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 55/73 (75%), Gaps = 11/73 (15%)
 Frame = +3

Query  72   ELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKF-----------ARXYR  218
            ++KTAPADFRFPTTNQT HCFT Y+E+H+C+AAKG    +CEKF           AR YR
Sbjct  97   DIKTAPADFRFPTTNQTRHCFTRYIEYHKCIAAKGEGASECEKFARHYRSLCPGVARHYR  156

Query  219  ALCPGEWVEKWNE  257
            +LCPGEW+++WNE
Sbjct  157  SLCPGEWIDRWNE  169



>ref|XP_006845475.1| hypothetical protein AMTR_s00019p00135210 [Amborella trichopoda]
 gb|ERN07150.1| hypothetical protein AMTR_s00019p00135210 [Amborella trichopoda]
Length=88

 Score = 99.0 bits (245),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +3

Query  42   VRCSSSMAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRA  221
            V   S +   ++KTAPADFRFPTTNQT HCFT YVE+H+C+ AKG + G+C KFA+ YR+
Sbjct  6    VDIGSIITVGDIKTAPADFRFPTTNQTRHCFTRYVEYHKCMTAKGADSGECNKFAKYYRS  65

Query  222  LCPGEW  239
            LCPGEW
Sbjct  66   LCPGEW  71



>ref|XP_006386412.1| hypothetical protein POPTR_0002s10020g [Populus trichocarpa]
 gb|ERP64209.1| hypothetical protein POPTR_0002s10020g [Populus trichocarpa]
Length=194

 Score =   100 bits (249),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +3

Query  69   IELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWV  242
            I+L+TAPAD+RFPTTNQT HCFT Y+E+HRCVAAKG    +C+KFA+ YR+LCP EWV
Sbjct  110  IKLETAPADYRFPTTNQTRHCFTRYIEYHRCVAAKGEGASECDKFAKYYRSLCPSEWV  167



>ref|XP_006828021.1| hypothetical protein AMTR_s00008p00250560 [Amborella trichopoda]
 gb|ERM95437.1| hypothetical protein AMTR_s00008p00250560 [Amborella trichopoda]
Length=132

 Score = 99.0 bits (245),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +3

Query  69   IELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEW  239
            I+++TAPADFRFPTTNQT HCFT Y+E+HRC+AAKG    +C+KFA+ YR+LCPGEW
Sbjct  71   IKIETAPADFRFPTTNQTRHCFTRYIEYHRCIAAKGEGANECDKFAKYYRSLCPGEW  127



>gb|KJB76603.1| hypothetical protein B456_012G096600 [Gossypium raimondii]
Length=71

 Score = 97.1 bits (240),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 51/59 (86%), Gaps = 1/59 (2%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWV  242
            EIELKTAPADFRFPTTNQT HCFT Y+EFH C+AAK GE  +CE+FA+ Y +LCPGEWV
Sbjct  4    EIELKTAPADFRFPTTNQTRHCFTRYIEFHGCLAAK-GESNECERFAKYYLSLCPGEWV  61



>ref|XP_008643509.1| PREDICTED: uncharacterized protein LOC100192808 isoform X1 [Zea 
mays]
 tpg|DAA45624.1| TPA: hypothetical protein ZEAMMB73_022577 [Zea mays]
Length=153

 Score = 98.6 bits (244),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPG  233
            EI+++TAPADFRFPTTNQT HCFT YVE+HRCVAAKG +  +C+KFA+ YR+LCPG
Sbjct  98   EIKIETAPADFRFPTTNQTRHCFTRYVEYHRCVAAKGEDAPECDKFAKYYRSLCPG  153



>ref|XP_004148521.1| PREDICTED: putative cytochrome c oxidase subunit 6b-like [Cucumis 
sativus]
 ref|XP_004163766.1| PREDICTED: putative cytochrome c oxidase subunit 6b-like [Cucumis 
sativus]
 gb|KGN60435.1| hypothetical protein Csa_3G910720 [Cucumis sativus]
Length=149

 Score = 97.8 bits (242),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 56/77 (73%), Gaps = 0/77 (0%)
 Frame = +3

Query  27   RKGNFVRCSSSMAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFA  206
            R+G+  R +  + +  + TAP+D RFP TNQT HC+  Y+E+HRCV  KG    +C+KFA
Sbjct  62   RRGSEDRDNKVVMDEGVGTAPSDIRFPFTNQTRHCYARYLEYHRCVQKKGEHAPECKKFA  121

Query  207  RXYRALCPGEWVEKWNE  257
            + YR+LCPGEWVEKWNE
Sbjct  122  KYYRSLCPGEWVEKWNE  138



>gb|KDP45959.1| hypothetical protein JCGZ_11862 [Jatropha curcas]
Length=138

 Score = 95.5 bits (236),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +3

Query  69   IELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVEK  248
            +E  TAPAD RFPTTNQT HC+T Y+E+H+C+  KG +  +CEKFA+ YR+ CP EW+E+
Sbjct  65   VEAGTAPADVRFPTTNQTRHCYTRYLEYHKCIKEKGKDATECEKFAKYYRSFCPDEWIER  124

Query  249  WNE  257
            WN+
Sbjct  125  WND  127



>ref|XP_008465918.1| PREDICTED: putative cytochrome c oxidase subunit 6b-like [Cucumis 
melo]
Length=147

 Score = 95.1 bits (235),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +3

Query  75   LKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVEKWN  254
            ++TAP+D RFP TNQT HC+  Y+E+HRCV  KG    +C+KFA  YR+LCPGEWVEKWN
Sbjct  76   VETAPSDLRFPFTNQTRHCYARYLEYHRCVQKKGEHAPECKKFANYYRSLCPGEWVEKWN  135

Query  255  E  257
            E
Sbjct  136  E  136



>ref|XP_001763315.1| predicted protein [Physcomitrella patens]
 gb|EDQ71845.1| predicted protein, partial [Physcomitrella patens]
Length=71

 Score = 92.0 bits (227),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +3

Query  72   ELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVEKW  251
            +LKTAP D+RFP TNQ  HC+  Y EFH+C A KG    DC K+AR YR+LCPG W+EKW
Sbjct  1    DLKTAPMDWRFPATNQAKHCYYSYNEFHKCAAEKGEHDKDCRKYARYYRSLCPGHWIEKW  60

Query  252  NE  257
            NE
Sbjct  61   NE  62



>ref|XP_002989279.1| hypothetical protein SELMODRAFT_129448, partial [Selaginella 
moellendorffii]
 gb|EFJ09717.1| hypothetical protein SELMODRAFT_129448, partial [Selaginella 
moellendorffii]
Length=78

 Score = 92.0 bits (227),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +3

Query  69   IELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVEK  248
            +  KTAP D RFP+TNQT HC+T Y+E+H+C   +G +  +C+K+AR YR+LCP EW+E+
Sbjct  5    LNTKTAPFDIRFPSTNQTKHCYTRYIEYHKCRKERGPDAPECDKYARYYRSLCPSEWIER  64

Query  249  WNE  257
            WNE
Sbjct  65   WNE  67



>ref|XP_003559516.1| PREDICTED: cytochrome c oxidase subunit 6b-3-like [Brachypodium 
distachyon]
Length=127

 Score = 93.2 bits (230),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +3

Query  69   IELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVEK  248
            +EL+TAP DFRFPT NQT HC+  Y+E+HRC+ AK G+  +C+KF R YR+LCP +WV +
Sbjct  54   VELRTAPCDFRFPTQNQTRHCYVRYLEYHRCMKAKEGDKSECDKFQRYYRSLCPTDWVVE  113

Query  249  WN  254
            WN
Sbjct  114  WN  115



>ref|XP_005646865.1| cytochrome c oxidase subunit H, partial [Coccomyxa subellipsoidea 
C-169]
 gb|EIE22321.1| cytochrome c oxidase subunit H, partial [Coccomyxa subellipsoidea 
C-169]
Length=74

 Score = 91.7 bits (226),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +3

Query  69   IELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVEK  248
            IELKTA  D RFP+TNQ  HC+T Y E+HRCVA KG E  +C  F R YR++CPGEW+E+
Sbjct  1    IELKTASHDPRFPSTNQARHCYTRYNEYHRCVAQKGEEDPECSVFQRAYRSICPGEWLER  60

Query  249  WNE  257
            WNE
Sbjct  61   WNE  63



>ref|XP_002965431.1| hypothetical protein SELMODRAFT_84137, partial [Selaginella moellendorffii]
 ref|XP_002994166.1| hypothetical protein SELMODRAFT_138288, partial [Selaginella 
moellendorffii]
 gb|EFJ04756.1| hypothetical protein SELMODRAFT_138288, partial [Selaginella 
moellendorffii]
 gb|EFJ32851.1| hypothetical protein SELMODRAFT_84137, partial [Selaginella moellendorffii]
Length=72

 Score = 91.3 bits (225),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +3

Query  75   LKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVEKWN  254
            +KTAP D RFP+TNQT HC+T Y+EFH+C   +G    +C+K+AR YR+LCP EW+E+WN
Sbjct  1    IKTAPFDIRFPSTNQTKHCYTRYIEFHKCQKERGEGAPECQKYARYYRSLCPSEWIERWN  60

Query  255  E  257
            E
Sbjct  61   E  61



>gb|AAP80832.1| cytochrome c oxidase subunit 6b-1 [Griffithsia japonica]
Length=85

 Score = 90.9 bits (224),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 52/70 (74%), Gaps = 2/70 (3%)
 Frame = +3

Query  51   SSSMAE--IELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRAL  224
            SS+M+E  IELKTAP D RFPT NQT HC+  Y+EFH C  AKG +  +C+KF R Y +L
Sbjct  4    SSTMSEVTIELKTAPRDRRFPTQNQTKHCWARYLEFHACAKAKGQDDPECDKFKRWYISL  63

Query  225  CPGEWVEKWN  254
            CP EWVEKW+
Sbjct  64   CPIEWVEKWD  73



>ref|XP_002528789.1| cytochrome C oxidase polypeptide vib, putative [Ricinus communis]
 gb|EEF33611.1| cytochrome C oxidase polypeptide vib, putative [Ricinus communis]
Length=133

 Score = 90.1 bits (222),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +3

Query  81   TAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVEKWNE  257
            TAPAD RFP+ NQT HC+T Y+E+H+C+  KG +  +C KFA+ YR+LCP EWVE+WNE
Sbjct  64   TAPADARFPSMNQTRHCYTRYLEYHKCIQEKGKDAPECGKFAKYYRSLCPVEWVERWNE  122



>emb|CAN71453.1| hypothetical protein VITISV_018238 [Vitis vinifera]
Length=468

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +3

Query  63   AEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEW  239
            +EI+L+TAPADFRFP+TNQT HCFT Y+E+HRC A KG    +C+KFA+ YR+LCP EW
Sbjct  257  SEIKLETAPADFRFPSTNQTRHCFTRYIEYHRCTAXKGEGATECDKFAKFYRSLCPAEW  315



>gb|KCW71840.1| hypothetical protein EUGRSUZ_E00322 [Eucalyptus grandis]
Length=75

 Score = 88.6 bits (218),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +3

Query  69   IELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVEK  248
            ++L+TAPAD RFP TNQT HC+  Y+E  RC+  KG    +CEKFAR YR++CP EW+E+
Sbjct  2    VDLETAPADMRFPFTNQTRHCYARYLEHIRCIQEKGENAPECEKFARYYRSICPSEWIER  61

Query  249  WNE  257
            W++
Sbjct  62   WDD  64



>gb|ABQ41966.1| cytochrome c oxidase subunit [Sonneratia caseolaris]
Length=114

 Score = 87.4 bits (215),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +3

Query  69   IELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALC  227
            I+L+TAPADFRFPT+NQT HCFT Y+E+HRCVAAKG    +C+KFA+ YR+LC
Sbjct  62   IKLETAPADFRFPTSNQTRHCFTRYIEYHRCVAAKGEGAPECDKFAKYYRSLC  114



>gb|ABQ41965.1| cytochrome c oxidase subunit [Sonneratia alba]
Length=114

 Score = 87.4 bits (215),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +3

Query  69   IELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALC  227
            I+L+TAPADFRFPT+NQT HCFT Y+E+HRCVAAKG    +C+KFA+ YR+LC
Sbjct  62   IKLETAPADFRFPTSNQTRHCFTRYIEYHRCVAAKGEGAPECDKFAKYYRSLC  114



>gb|ABQ41968.1| cytochrome c oxidase subunit [Sonneratia apetala]
Length=114

 Score = 87.4 bits (215),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +3

Query  69   IELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALC  227
            I+L+TAPADFRFPT+NQT HCFT Y+E+HRCVAAKG    +C+KFA+ YR+LC
Sbjct  62   IKLETAPADFRFPTSNQTRHCFTRYIEYHRCVAAKGEGAPECDKFAKYYRSLC  114



>gb|ABQ41967.1| cytochrome c oxidase subunit [Sonneratia ovata]
Length=114

 Score = 87.4 bits (215),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +3

Query  69   IELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALC  227
            I+L+TAPADFRFPT+NQT HCFT Y+E+HRCVAAKG    +C+KFA+ YR+LC
Sbjct  62   IKLETAPADFRFPTSNQTRHCFTRYIEYHRCVAAKGEGAPECDKFAKHYRSLC  114



>ref|XP_005707710.1| cytochrome c oxidase subunit VIb [Galdieria sulphuraria]
 gb|EME31190.1| cytochrome c oxidase subunit VIb [Galdieria sulphuraria]
Length=85

 Score = 86.3 bits (212),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            EI+L+TAP D RF TTNQ  HC++ Y+E+H CV  KG E  +C+KF R Y++LCP EW+E
Sbjct  11   EIKLETAPHDPRFQTTNQAKHCWSRYIEYHACVKQKGEEDSECQKFKRWYKSLCPNEWLE  70

Query  246  KWNE  257
             W+E
Sbjct  71   NWDE  74



>gb|KHN24386.1| Cytochrome c oxidase subunit 6b-3, partial [Glycine soja]
Length=63

 Score = 85.1 bits (209),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 47/63 (75%), Gaps = 4/63 (6%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVE----FHRCVAAKGGEVGDCEKFARXYRALCPG  233
            +IELKT PADFRFP TNQT HCFT  +     F  C+A KGG  G+CE+FA+ YR+LCPG
Sbjct  1    KIELKTTPADFRFPKTNQTRHCFTGGIPDIGYFVLCLATKGGNSGECERFAKYYRSLCPG  60

Query  234  EWV  242
            EWV
Sbjct  61   EWV  63



>ref|NP_001048358.1| Os02g0791400 [Oryza sativa Japonica Group]
 dbj|BAD19121.1| putative cytochrome c oxidase subunit 6b-1 [Oryza sativa Japonica 
Group]
 dbj|BAF10272.1| Os02g0791400 [Oryza sativa Japonica Group]
Length=86

 Score = 85.5 bits (210),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 53/72 (74%), Gaps = 3/72 (4%)
 Frame = +3

Query  51   SSSMAE---IELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRA  221
            +  MAE   I+++T P D+RFP+ NQT  CFT Y+E+++C+ AKG    +C K+A+ YR+
Sbjct  4    APPMAEKPTIKVETTPGDWRFPSANQTKRCFTCYIEYNKCIEAKGEGSDECTKYAKCYRS  63

Query  222  LCPGEWVEKWNE  257
            LCPGEW+E+W E
Sbjct  64   LCPGEWIERWKE  75



>ref|XP_011395893.1| Cytochrome c oxidase subunit 6B [Auxenochlorella protothecoides]
 gb|KFM23023.1| Cytochrome c oxidase subunit 6B [Auxenochlorella protothecoides]
Length=117

 Score = 86.3 bits (212),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            +I L T+P DFRFP TNQ+ HC+  Y E HRC   KG E  +C++ A+ YR++CP EW+E
Sbjct  47   QITLSTSPVDFRFPITNQSRHCYVAYCEAHRCFQQKGEEDSECQRLAKVYRSICPVEWLE  106

Query  246  KWNE  257
            +WNE
Sbjct  107  QWNE  110



>gb|EEC74151.1| hypothetical protein OsI_09238 [Oryza sativa Indica Group]
 gb|EEE57950.1| hypothetical protein OsJ_08678 [Oryza sativa Japonica Group]
Length=80

 Score = 85.1 bits (209),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 52/69 (75%), Gaps = 3/69 (4%)
 Frame = +3

Query  60   MAE---IELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCP  230
            MAE   I+++T P D+RFP+ NQT  CFT Y+E+++C+ AKG    +C K+A+ YR+LCP
Sbjct  1    MAEKPTIKVETTPGDWRFPSANQTKRCFTCYIEYNKCIEAKGEGSDECTKYAKCYRSLCP  60

Query  231  GEWVEKWNE  257
            GEW+E+W E
Sbjct  61   GEWIERWKE  69



>ref|XP_005715645.1| Cytochrome c oxidase subunit 6b-1 [Chondrus crispus]
 emb|CDF35826.1| Cytochrome c oxidase subunit 6b-1 [Chondrus crispus]
Length=79

 Score = 84.7 bits (208),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +3

Query  57   SMAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGE  236
            S   I+++TAP D RFPTTNQT HC+  Y+EFH C   KG +  +CEKF R Y +LCP E
Sbjct  2    SEVTIQVRTAPRDRRFPTTNQTKHCWARYLEFHACSKVKGDDDPECEKFKRWYLSLCPEE  61

Query  237  WVEKWN  254
            WVE W+
Sbjct  62   WVENWD  67



>ref|XP_003064158.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH51780.1| predicted protein [Micromonas pusilla CCMP1545]
Length=110

 Score = 84.7 bits (208),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = +3

Query  69   IELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVEK  248
            I+L TAP D RFP  NQ  HC+T Y EFH+C A +G +  +CE +A+ YR+LCP EWVEK
Sbjct  37   IKLATAPFDPRFPQQNQAKHCYTRYNEFHKCKAQQGEDAEECETYAKYYRSLCPTEWVEK  96

Query  249  WNE  257
            W+E
Sbjct  97   WDE  99



>ref|XP_007342910.1| cytochrome c oxidase, subunit VIb [Auricularia delicata TFB-10046 
SS5]
 gb|EJD49011.1| cytochrome c oxidase, subunit VIb [Auricularia delicata TFB-10046 
SS5]
Length=94

 Score = 83.6 bits (205),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +3

Query  75   LKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVEKWN  254
            L+TAP D RFP  NQT HC+  YV++H+CV AKG +   C++F R YR+LCP EWV +W+
Sbjct  21   LQTAPFDARFPNQNQTRHCWQSYVDYHKCVNAKGEDFAPCKQFKRVYRSLCPIEWVSRWD  80

Query  255  E  257
            E
Sbjct  81   E  81



>ref|XP_002109684.1| hypothetical protein TRIADDRAFT_21297 [Trichoplax adhaerens]
 gb|EDV27850.1| hypothetical protein TRIADDRAFT_21297 [Trichoplax adhaerens]
Length=81

 Score = 83.2 bits (204),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +3

Query  51   SSSMAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCP  230
            S    +I LKTAP D RFP TNQT +C+ +YV++ RC+ AKG +   C+ F R YR +CP
Sbjct  2    SEEKEKIVLKTAPFDNRFPNTNQTKNCWQNYVDYQRCIKAKGEDFEACQYFKRIYRIMCP  61

Query  231  GEWVEKWNE  257
              WVE+W+E
Sbjct  62   NHWVEQWDE  70



>ref|XP_007512788.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17388.1| predicted protein [Bathycoccus prasinos]
Length=124

 Score = 83.2 bits (204),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 45/64 (70%), Gaps = 2/64 (3%)
 Frame = +3

Query  66   EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVE  245
            +I +KT P D RFP  NQ  HC+T Y E+H+C A KG E  +C   AR YR++CPGEWVE
Sbjct  52   DIVVKTTPFDPRFPQQNQAKHCYTRYNEYHKCAAEKGEE--ECASMARLYRSICPGEWVE  109

Query  246  KWNE  257
            KWNE
Sbjct  110  KWNE  113



>ref|XP_002978684.1| hypothetical protein SELMODRAFT_59940, partial [Selaginella moellendorffii]
 gb|EFJ20131.1| hypothetical protein SELMODRAFT_59940, partial [Selaginella moellendorffii]
Length=72

 Score = 81.6 bits (200),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +3

Query  72   ELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVEKW  251
            ++KT P D RFP TNQT +CFT YVE+H+C+   G     CEK+ R Y++LCP EWVE W
Sbjct  1    DIKTCPPDSRFPVTNQTKNCFTKYVEYHKCIQENGEGDSRCEKYRRAYKSLCPIEWVEAW  60

Query  252  NE  257
            +E
Sbjct  61   DE  62



>ref|XP_003083867.1| putative cytochrome c oxidase subunit 6b-1 (ISS) [Ostreococcus 
tauri]
 emb|CAL57834.1| Cytochrome c oxidase, subunit VIb [Ostreococcus tauri]
Length=99

 Score = 82.0 bits (201),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +3

Query  75   LKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVEKWN  254
            LKT P D RFP TNQ  HC+T Y EFH+C A  G    +CE   + YRA+CP EWVEKWN
Sbjct  28   LKTTPFDARFPQTNQAKHCYTRYNEFHKCQAENGEGAEECEPLGKFYRAICPQEWVEKWN  87

Query  255  E  257
            E
Sbjct  88   E  88



>ref|XP_011389179.1| putative cytochrome c oxidase subunit VIb [Ustilago maydis 521]
 gb|KIS69300.1| putative cytochrome c oxidase subunit VIb [Ustilago maydis 521]
Length=85

 Score = 81.6 bits (200),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +3

Query  51   SSSMAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCP  230
            SS      L+TA  D RFP  NQT HC+ +YV++HRC+ AKG +   C++F R Y +LCP
Sbjct  4    SSEQKSYTLQTASFDARFPNQNQTKHCWQNYVDYHRCINAKGEDFVPCKQFFRAYNSLCP  63

Query  231  GEWVEKWNE  257
             EW+ KW+E
Sbjct  64   NEWIAKWDE  72



>gb|KIM84395.1| hypothetical protein PILCRDRAFT_6626 [Piloderma croceum F 1598]
Length=86

 Score = 81.6 bits (200),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +3

Query  75   LKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVEKWN  254
            L+TAP D RFP TNQT HC+ +Y ++ +C+ AKG +   C++F R Y +LCP  W+EKWN
Sbjct  13   LQTAPFDARFPNTNQTKHCYQNYTDYFKCIGAKGEDYVPCKQFKRAYNSLCPNSWIEKWN  72

Query  255  E  257
            +
Sbjct  73   D  73



>ref|XP_002965634.1| hypothetical protein SELMODRAFT_39649, partial [Selaginella moellendorffii]
 gb|EFJ33054.1| hypothetical protein SELMODRAFT_39649, partial [Selaginella moellendorffii]
Length=57

 Score = 80.9 bits (198),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +3

Query  69   IELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEW  239
            +  KTAP D RFP+TNQT HC+T Y+E+H+C   +G +  +C+K+AR YR+LCP EW
Sbjct  1    LNTKTAPFDIRFPSTNQTKHCYTRYIEYHKCRKERGPDAPECDKYARYYRSLCPSEW  57



>ref|XP_007393250.1| hypothetical protein PHACADRAFT_251841 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM57909.1| hypothetical protein PHACADRAFT_251841 [Phanerochaete carnosa 
HHB-10118-sp]
Length=84

 Score = 81.3 bits (199),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +3

Query  75   LKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVEKWN  254
            L+TA  D RFP TNQT HCF +Y ++ +C+AAKG E   C++F R Y +LCP EW+ KW+
Sbjct  11   LQTAGFDARFPNTNQTRHCFQNYTDYFKCIAAKGEEFAPCKQFKRAYNSLCPNEWIAKWD  70

Query  255  E  257
            E
Sbjct  71   E  71



>ref|XP_004927405.1| PREDICTED: serine/arginine repetitive matrix protein 5-like isoform 
X3 [Bombyx mori]
 ref|XP_004927406.1| PREDICTED: serine/arginine repetitive matrix protein 5-like isoform 
X4 [Bombyx mori]
Length=82

 Score = 81.3 bits (199),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +3

Query  72   ELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVEKW  251
            +LKTAP D RFP  NQT HC+  YV+FHRC   +G +   C  F R YR+LCP EWV+KW
Sbjct  10   DLKTAPFDPRFPNQNQTRHCYQSYVDFHRCQKVRGEKYEPCYYFKRVYRSLCPNEWVDKW  69

Query  252  N  254
            +
Sbjct  70   D  70



>gb|EMD33294.1| hypothetical protein CERSUDRAFT_117921 [Ceriporiopsis subvermispora 
B]
Length=85

 Score = 81.3 bits (199),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +3

Query  51   SSSMAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCP  230
            S   ++  L+TA  D RFP TNQT HCF +Y ++ +C+AAKG +   C++F R Y +LCP
Sbjct  4    SDLQSKYVLQTAGFDARFPNTNQTRHCFQNYTDYFKCIAAKGEDYAPCKQFKRAYNSLCP  63

Query  231  GEWVEKWNE  257
             EW+ KW+E
Sbjct  64   NEWISKWDE  72



>emb|CCM04696.1| predicted protein [Fibroporia radiculosa]
Length=120

 Score = 82.0 bits (201),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 53/84 (63%), Gaps = 4/84 (5%)
 Frame = +3

Query  18   CAHRKGNFVRCSSSMAEIE----LKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEV  185
             A    N +  SS+M+++     L+TA  D RFP TNQT HCF +Y ++ +C+AAKG + 
Sbjct  24   LALLPSNQLTYSSAMSDLSSKYVLQTAGFDARFPNTNQTWHCFQNYTDYFKCIAAKGEDF  83

Query  186  GDCEKFARXYRALCPGEWVEKWNE  257
              C++F R Y +LCP EW  KW+E
Sbjct  84   APCKQFKRAYNSLCPNEWTTKWDE  107



>ref|XP_001421861.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABP00155.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=73

 Score = 80.5 bits (197),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +3

Query  72   ELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVEKW  251
            +LKT P D RFP TNQ  HC+T Y EFH+C A  G    +CE  A+ YR++CP EW EKW
Sbjct  1    QLKTTPFDPRFPQTNQAKHCYTRYNEFHKCQAENGEGAEECEPLAKFYRSICPTEWTEKW  60

Query  252  NE  257
            NE
Sbjct  61   NE  62



>ref|XP_008039169.1| cytochrome c oxidase subunit VIb [Trametes versicolor FP-101664 
SS1]
 gb|EIW57802.1| cytochrome c oxidase subunit VIb [Trametes versicolor FP-101664 
SS1]
Length=85

 Score = 80.9 bits (198),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +3

Query  75   LKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVEKWN  254
            L+TA  D RFP TNQT HCF +Y ++ +C+AAKG +   C++F R Y +LCP EW+ KW+
Sbjct  12   LQTAGFDARFPNTNQTRHCFQNYTDYFKCIAAKGEDYAPCKQFKRAYNSLCPNEWINKWD  71

Query  255  E  257
            E
Sbjct  72   E  72



>gb|KHN24387.1| Cytochrome c oxidase subunit 6b-3, partial [Glycine soja]
Length=65

 Score = 80.5 bits (197),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 45/62 (73%), Gaps = 4/62 (6%)
 Frame = +3

Query  69   IELKTAPADFRFPTTNQTTHCFTHYVE----FHRCVAAKGGEVGDCEKFARXYRALCPGE  236
            IELKT PADFRFPTTNQT HCFT  +        C+AAKG   G+ E+F++ YR+LCPGE
Sbjct  1    IELKTTPADFRFPTTNQTRHCFTGGIPDIGYLVLCMAAKGENSGESERFSKYYRSLCPGE  60

Query  237  WV  242
            WV
Sbjct  61   WV  62



>gb|KIK44418.1| hypothetical protein CY34DRAFT_802731 [Suillus luteus UH-Slu-Lm8-n1]
Length=88

 Score = 80.9 bits (198),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +3

Query  75   LKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVEKWN  254
            L+TA  D RFP TNQT HCF +Y ++ +CVAAKG +   C++F R Y +LCP EW+ KW+
Sbjct  15   LQTAGFDARFPNTNQTRHCFQNYTDYFKCVAAKGEDFAPCKQFKRAYNSLCPNEWIAKWD  74

Query  255  E  257
            E
Sbjct  75   E  75



>ref|XP_001744850.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ90083.1| predicted protein [Monosiga brevicollis MX1]
Length=88

 Score = 80.5 bits (197),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = +3

Query  54   SSMAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPG  233
            SS+    +KTAP D RFP  NQT  C+ +YV+FH+C+A KG     C +F + Y +LCP 
Sbjct  2    SSIDASAIKTAPFDARFPNQNQTKSCWQNYVDFHKCIALKGESYKPCGQFFKTYMSLCPL  61

Query  234  EWVEKWNE  257
            EWVEKW+E
Sbjct  62   EWVEKWDE  69



>ref|XP_005732012.1| PREDICTED: cytochrome c oxidase subunit 6B1-like [Pundamilia 
nyererei]
Length=86

 Score = 80.5 bits (197),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 46/63 (73%), Gaps = 3/63 (5%)
 Frame = +3

Query  78   KTAPADFRFPTTNQTTHCFTHYVEFHRC---VAAKGGEVGDCEKFARXYRALCPGEWVEK  248
            KTAP D RFP TNQT +CF +Y++FHRC   ++AKG EV  CE + + Y++LCP  WV K
Sbjct  13   KTAPFDARFPNTNQTRNCFQNYLDFHRCNKALSAKGQEVSPCEWYQKVYKSLCPMSWVSK  72

Query  249  WNE  257
            W+E
Sbjct  73   WDE  75



>ref|XP_003450733.1| PREDICTED: cytochrome c oxidase subunit 6B1-like [Oreochromis 
niloticus]
 ref|XP_004550798.1| PREDICTED: cytochrome c oxidase subunit 6B1-like isoform X1 [Maylandia 
zebra]
 ref|XP_004550799.1| PREDICTED: cytochrome c oxidase subunit 6B1-like isoform X2 [Maylandia 
zebra]
 ref|XP_005925345.1| PREDICTED: cytochrome c oxidase subunit 6B1-like [Haplochromis 
burtoni]
Length=86

 Score = 80.5 bits (197),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 46/63 (73%), Gaps = 3/63 (5%)
 Frame = +3

Query  78   KTAPADFRFPTTNQTTHCFTHYVEFHRC---VAAKGGEVGDCEKFARXYRALCPGEWVEK  248
            KTAP D RFP TNQT +CF +Y++FHRC   ++AKG EV  CE + + Y++LCP  WV K
Sbjct  13   KTAPFDARFPNTNQTRNCFQNYLDFHRCNKALSAKGQEVSPCEWYQKVYKSLCPMSWVSK  72

Query  249  WNE  257
            W+E
Sbjct  73   WDE  75



>ref|XP_010883232.1| PREDICTED: cytochrome c oxidase subunit 6B1 [Esox lucius]
 gb|ACO13829.1| Cytochrome c oxidase subunit VIb isoform 1 [Esox lucius]
Length=85

 Score = 80.5 bits (197),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 51/74 (69%), Gaps = 8/74 (11%)
 Frame = +3

Query  60   MAEIELK-----TAPADFRFPTTNQTTHCFTHYVEFHRC---VAAKGGEVGDCEKFARXY  215
            MAEI+ K     TAP D RFP TNQT +CF +Y++FHRC   ++AKG +V  C+ + R Y
Sbjct  1    MAEIDAKIKNYRTAPFDARFPNTNQTRNCFQNYLDFHRCSKALSAKGQDVSPCDWYQRVY  60

Query  216  RALCPGEWVEKWNE  257
            ++LCP  WV KW++
Sbjct  61   KSLCPLSWVSKWDD  74



>emb|CCF52863.1| probable COX12-cytochrome-c oxidase, subunit VIB [Ustilago hordei]
Length=85

 Score = 80.1 bits (196),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +3

Query  51   SSSMAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCP  230
            SS      L+TA  D RFP  NQT HC+ +Y+++ RCV AKG E   C++F R Y +LCP
Sbjct  4    SSEQKSFTLQTASFDARFPNQNQTKHCWQNYIDYFRCVNAKGEEFVPCKQFFRAYNSLCP  63

Query  231  GEWVEKWNE  257
             EW+ KW+E
Sbjct  64   NEWIAKWDE  72



>ref|XP_007387899.1| cytochrome c oxidase subunit VIb [Punctularia strigosozonata 
HHB-11173 SS5]
 gb|EIN04976.1| cytochrome c oxidase subunit VIb [Punctularia strigosozonata 
HHB-11173 SS5]
Length=84

 Score = 80.1 bits (196),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +3

Query  75   LKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVEKWN  254
            L+TA  D RFP TNQT HCF +Y ++ +C+AAKG +   C++F R Y +LCP EW+ KW+
Sbjct  11   LQTAGFDARFPNTNQTRHCFQNYTDYFKCIAAKGEDFAPCKQFKRAYNSLCPNEWITKWD  70

Query  255  E  257
            E
Sbjct  71   E  71



>emb|CEG63622.1| Putative Cytochrome c oxidase subunit 6b [Rhizopus microsporus]
 emb|CEI99189.1| Putative Cytochrome c oxidase subunit 6b [Rhizopus microsporus]
 emb|CEI88372.1| Putative Cytochrome c oxidase subunit 6b [Rhizopus microsporus]
Length=82

 Score = 80.1 bits (196),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 48/67 (72%), Gaps = 0/67 (0%)
 Frame = +3

Query  54   SSMAEIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPG  233
            S +A+ +L TAP D RFP TNQT +C+ +YV++ +CV A+G +   C++F + Y ALCP 
Sbjct  2    SELADKQLSTAPFDARFPNTNQTKNCWQNYVDYFKCVNARGEDFEPCKQFYKAYHALCPN  61

Query  234  EWVEKWN  254
            EW+ KW+
Sbjct  62   EWISKWD  68



>gb|KIP10969.1| hypothetical protein PHLGIDRAFT_114891 [Phlebiopsis gigantea 
11061_1 CR5-6]
Length=84

 Score = 79.7 bits (195),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +3

Query  75   LKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALCPGEWVEKWN  254
            L+TA  D RFP TNQT HCF +Y ++ +C+AAKG +   C++F R Y +LCP EW+ KW+
Sbjct  11   LQTAGFDARFPNTNQTRHCFQNYTDYFKCIAAKGEDFAPCKQFKRAYNSLCPNEWISKWD  70

Query  255  E  257
            +
Sbjct  71   D  71



>gb|KIK63200.1| hypothetical protein GYMLUDRAFT_41528 [Gymnopus luxurians FD-317 
M1]
Length=88

 Score = 79.7 bits (195),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 48/70 (69%), Gaps = 1/70 (1%)
 Frame = +3

Query  51   SSSMA-EIELKTAPADFRFPTTNQTTHCFTHYVEFHRCVAAKGGEVGDCEKFARXYRALC  227
            SS +A +  LKT P D RFP  NQT +CF +Y ++ +C+AAKG +   C++F R Y +LC
Sbjct  6    SSELASKFVLKTVPFDARFPNQNQTRNCFQNYTDYFKCIAAKGDDFPPCKQFFRAYHSLC  65

Query  228  PGEWVEKWNE  257
            P EW+ KW+E
Sbjct  66   PNEWISKWDE  75



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 571209109800