BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001D22

Length=545
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAO57279.1|  alpha-expansin                                         289   3e-95   Ipomoea nil [qian niu]
ref|XP_009788740.1|  PREDICTED: expansin-A3-like                        275   7e-90   Nicotiana sylvestris
ref|XP_009587747.1|  PREDICTED: expansin-A3-like                        271   3e-88   Nicotiana tomentosiformis
ref|XP_006341021.1|  PREDICTED: expansin-A3                             271   4e-88   Solanum tuberosum [potatoes]
ref|NP_001234081.1|  expansin A4 precursor                              270   7e-88   Solanum lycopersicum
gb|AEQ55271.1|  expansin                                                268   3e-87   Breonia chinensis
emb|CDP06606.1|  unnamed protein product                                266   2e-86   Coffea canephora [robusta coffee]
gb|AEE69071.1|  expansin-4                                              266   3e-86   Petunia hybrid cultivar [hybrid petunia]
ref|XP_009607348.1|  PREDICTED: expansin-A3-like                        265   3e-85   Nicotiana tomentosiformis
ref|XP_010256907.1|  PREDICTED: expansin-A4                             263   3e-85   Nelumbo nucifera [Indian lotus]
ref|XP_011027216.1|  PREDICTED: expansin-A4                             263   4e-85   Populus euphratica
gb|AFK33369.1|  unknown                                                 259   9e-85   Lotus japonicus
ref|NP_001234881.1|  expansin9 precursor                                262   1e-84   Solanum lycopersicum
gb|AAF32410.1|AF230277_1  alpha-expansin 2                              262   1e-84   Triphysaria versicolor
gb|KJB36710.1|  hypothetical protein B456_006G172400                    262   1e-84   Gossypium raimondii
ref|XP_004249634.1|  PREDICTED: expansin-A3                             262   1e-84   
gb|KHG15821.1|  Expansin-A4 -like protein                               262   1e-84   Gossypium arboreum [tree cotton]
ref|XP_003537990.1|  PREDICTED: expansin-A4-like                        261   2e-84   
ref|XP_002315218.1|  alpha-expansin 9 precursor family protein          261   2e-84   
gb|EYU41729.1|  hypothetical protein MIMGU_mgv1a012073mg                261   3e-84   Erythranthe guttata [common monkey flower]
gb|AAR82850.1|  expansin-2                                              261   3e-84   Petunia x hybrida [garden petunia]
ref|XP_002533097.1|  Alpha-expansin 4 precursor, putative               261   3e-84   Ricinus communis
ref|XP_004249536.1|  PREDICTED: expansin-A6-like                        261   4e-84   Solanum lycopersicum
gb|KDP35637.1|  hypothetical protein JCGZ_09075                         261   4e-84   Jatropha curcas
ref|XP_009761115.1|  PREDICTED: expansin-A6-like                        260   5e-84   Nicotiana sylvestris
ref|XP_007027012.1|  Expansin A4, ALPHA 1.6,EXPA4                       261   5e-84   
ref|XP_009341751.1|  PREDICTED: expansin-A4-like                        260   5e-84   Pyrus x bretschneideri [bai li]
gb|KHN21950.1|  Expansin-A4                                             262   6e-84   Glycine soja [wild soybean]
ref|XP_009787901.1|  PREDICTED: expansin-A3-like                        261   6e-84   Nicotiana sylvestris
ref|XP_008464122.1|  PREDICTED: expansin-A4                             260   6e-84   Cucumis melo [Oriental melon]
ref|XP_008387765.1|  PREDICTED: expansin-A4-like                        260   6e-84   
gb|AHL25255.1|  expansin                                                260   7e-84   Boehmeria nivea [Chinese silk-plant]
emb|CAH18933.1|  expansin                                               260   8e-84   Pyrus communis
gb|AIE54285.1|  expansin                                                259   9e-84   Nicotiana tabacum [American tobacco]
ref|XP_009610453.1|  PREDICTED: expansin-A3-like                        259   9e-84   Nicotiana tomentosiformis
ref|XP_007205748.1|  hypothetical protein PRUPE_ppa010226mg             259   9e-84   Prunus persica
gb|KCW65541.1|  hypothetical protein EUGRSUZ_G02938                     259   1e-83   Eucalyptus grandis [rose gum]
gb|ABO32367.1|  expansin                                                259   1e-83   Litchi
ref|XP_011094866.1|  PREDICTED: expansin-A6                             259   1e-83   Sesamum indicum [beniseed]
ref|XP_003552173.1|  PREDICTED: expansin-A4                             259   1e-83   Glycine max [soybeans]
ref|XP_006349505.1|  PREDICTED: expansin-A3-like                        259   2e-83   Solanum tuberosum [potatoes]
dbj|BAC67193.1|  expansin                                               259   2e-83   Pyrus communis
ref|XP_008233635.1|  PREDICTED: expansin-A4-like                        258   3e-83   Prunus mume [ume]
ref|XP_006339024.1|  PREDICTED: expansin-A3-like                        258   3e-83   Solanum tuberosum [potatoes]
ref|XP_010067412.1|  PREDICTED: expansin-A4                             260   3e-83   Eucalyptus grandis [rose gum]
gb|AFB77223.1|  expansin 1                                              258   4e-83   Betula platyphylla [Asian white birch]
gb|ACK36943.1|  expansin                                                258   4e-83   Annona cherimola [cherimoya]
ref|NP_001242978.1|  expansin-A4-like precursor                         258   5e-83   Glycine max [soybeans]
gb|KHG12430.1|  Expansin-A4 -like protein                               258   5e-83   Gossypium arboreum [tree cotton]
ref|XP_004143121.1|  PREDICTED: expansin-A4-like                        258   6e-83   Cucumis sativus [cucumbers]
ref|NP_001236550.1|  expansin precursor                                 257   7e-83   
ref|XP_007218834.1|  hypothetical protein PRUPE_ppa010198mg             257   8e-83   Prunus persica
gb|KJB76740.1|  hypothetical protein B456_012G104400                    258   9e-83   Gossypium raimondii
ref|XP_009768238.1|  PREDICTED: expansin-A6-like                        257   1e-82   Nicotiana sylvestris
ref|XP_009772489.1|  PREDICTED: expansin-A3-like                        257   1e-82   Nicotiana sylvestris
ref|XP_007133996.1|  hypothetical protein PHAVU_010G010200g             257   1e-82   Phaseolus vulgaris [French bean]
dbj|BAH36862.1|  alpha expansin                                         256   2e-82   Rosa hybrid cultivar
gb|AAT11859.2|  expansin 1                                              256   2e-82   Mangifera indica
ref|XP_009597793.1|  PREDICTED: expansin-A6-like                        256   2e-82   Nicotiana tomentosiformis
gb|KJB16930.1|  hypothetical protein B456_002G257400                    256   2e-82   Gossypium raimondii
gb|AAM47000.1|AF512542_1  alpha-expansin precursor                      256   3e-82   Gossypium hirsutum [American cotton]
ref|XP_007016396.1|  Expansin A4, ALPHA 1.6,EXPA4                       256   3e-82   Theobroma cacao [chocolate]
ref|XP_003544219.1|  PREDICTED: expansin-A6-like                        256   3e-82   Glycine max [soybeans]
ref|XP_004302749.1|  PREDICTED: expansin-A6                             256   3e-82   Fragaria vesca subsp. vesca
gb|KFK36651.1|  alpha-expansin 4                                        256   4e-82   Arabis alpina [alpine rockcress]
ref|XP_009757427.1|  PREDICTED: expansin-A4-like                        256   4e-82   Nicotiana sylvestris
ref|XP_007140533.1|  hypothetical protein PHAVU_008G120700g             255   4e-82   Phaseolus vulgaris [French bean]
gb|KJB46592.1|  hypothetical protein B456_007G376300                    256   5e-82   Gossypium raimondii
ref|XP_003519349.1|  PREDICTED: expansin-A4-like                        255   5e-82   Glycine max [soybeans]
ref|XP_007009225.1|  Expansin A4, ALPHA 1.6,EXPA4                       255   5e-82   
gb|EYU18981.1|  hypothetical protein MIMGU_mgv1a012125mg                255   6e-82   Erythranthe guttata [common monkey flower]
ref|XP_007132063.1|  hypothetical protein PHAVU_011G063800g             255   6e-82   Phaseolus vulgaris [French bean]
ref|XP_010106493.1|  hypothetical protein L484_025251                   255   7e-82   Morus notabilis
ref|XP_009589397.1|  PREDICTED: expansin-A4-like                        255   7e-82   Nicotiana tomentosiformis
gb|KHG30766.1|  Expansin-A4 -like protein                               255   8e-82   Gossypium arboreum [tree cotton]
ref|XP_009343581.1|  PREDICTED: expansin-A4-like                        255   8e-82   Pyrus x bretschneideri [bai li]
gb|KJB73995.1|  hypothetical protein B456_011G266000                    255   8e-82   Gossypium raimondii
ref|XP_003538409.1|  PREDICTED: expansin-A6                             254   8e-82   Glycine max [soybeans]
ref|XP_003552064.1|  PREDICTED: expansin-A4                             254   8e-82   Glycine max [soybeans]
ref|XP_003543517.1|  PREDICTED: expansin-A4                             254   8e-82   Glycine max [soybeans]
ref|XP_010922313.1|  PREDICTED: LOW QUALITY PROTEIN: expansin-A4-...    254   9e-82   
ref|XP_008784594.1|  PREDICTED: expansin-A4-like                        254   9e-82   Phoenix dactylifera
ref|XP_004505858.1|  PREDICTED: expansin-A6-like                        254   1e-81   Cicer arietinum [garbanzo]
ref|NP_181300.1|  expansin-A3                                           254   1e-81   Arabidopsis thaliana [mouse-ear cress]
gb|ACN94264.1|  expansin                                                254   1e-81   Rehmannia glutinosa [Chinese foxglove]
ref|XP_004300427.1|  PREDICTED: expansin-A6                             254   1e-81   Fragaria vesca subsp. vesca
ref|XP_004142066.1|  PREDICTED: expansin-A4-like                        254   1e-81   
ref|XP_009364387.1|  PREDICTED: expansin-A4                             254   1e-81   Pyrus x bretschneideri [bai li]
ref|NP_001284471.1|  expansin-A4 precursor                              254   1e-81   Cucumis melo [Oriental melon]
gb|AEQ55274.1|  expansin                                                254   1e-81   Breonia chinensis
ref|XP_009613959.1|  PREDICTED: expansin-A6-like                        254   1e-81   Nicotiana tomentosiformis
ref|XP_008357089.1|  PREDICTED: expansin-A6                             254   2e-81   
ref|XP_003552923.2|  PREDICTED: expansin-A3-like                        254   2e-81   Glycine max [soybeans]
ref|XP_002283358.1|  PREDICTED: expansin-A4                             254   2e-81   Vitis vinifera
ref|NP_001288852.1|  expansin-A3 precursor                              254   2e-81   Brassica rapa
gb|ACA05164.1|  expansin 1                                              254   2e-81   Dimocarpus longan [longan]
emb|CDX74942.1|  BnaA05g06880D                                          254   2e-81   
ref|XP_003547326.1|  PREDICTED: expansin-A4-like                        253   2e-81   Glycine max [soybeans]
gb|KHN17924.1|  Expansin-A3                                             255   2e-81   Glycine soja [wild soybean]
ref|XP_002266625.1|  PREDICTED: expansin-A6                             253   2e-81   Vitis vinifera
ref|XP_006410954.1|  hypothetical protein EUTSA_v10017095mg             254   3e-81   Eutrema salsugineum [saltwater cress]
gb|KJB78839.1|  hypothetical protein B456_013G022200                    253   3e-81   Gossypium raimondii
gb|KJB55836.1|  hypothetical protein B456_009G098800                    253   3e-81   Gossypium raimondii
ref|XP_010528418.1|  PREDICTED: expansin-A3                             253   3e-81   Tarenaya hassleriana [spider flower]
gb|AEN70893.1|  expansin                                                253   3e-81   Gossypium schwendimanii
gb|ACJ48968.2|  expansin                                                253   4e-81   Breonia chinensis
ref|XP_010505357.1|  PREDICTED: expansin-A3-like                        253   4e-81   Camelina sativa [gold-of-pleasure]
gb|AEN70914.1|  expansin                                                253   4e-81   Gossypium trilobum
ref|XP_008457477.1|  PREDICTED: expansin-A4-like                        253   4e-81   Cucumis melo [Oriental melon]
gb|KHG29956.1|  Expansin-A4 -like protein                               253   4e-81   Gossypium arboreum [tree cotton]
ref|XP_010517036.1|  PREDICTED: expansin-A3                             253   4e-81   Camelina sativa [gold-of-pleasure]
ref|XP_010043542.1|  PREDICTED: expansin-A4-like                        253   4e-81   Eucalyptus grandis [rose gum]
emb|CDP09064.1|  unnamed protein product                                253   5e-81   Coffea canephora [robusta coffee]
gb|AAR82849.1|  expansin-1                                              253   5e-81   Petunia x hybrida [garden petunia]
ref|XP_010920576.1|  PREDICTED: expansin-A4-like                        253   5e-81   Elaeis guineensis
ref|XP_004492358.1|  PREDICTED: expansin-A6-like                        253   6e-81   Cicer arietinum [garbanzo]
gb|AEN70907.1|  expansin                                                253   6e-81   Gossypium armourianum
gb|ADY68815.1|  expansin                                                252   7e-81   Gossypium barbadense [Egyptian cotton]
emb|CAA59470.1|  orf                                                    252   7e-81   Pisum sativum [garden pea]
emb|CBI16120.3|  unnamed protein product                                253   8e-81   Vitis vinifera
ref|XP_010033123.1|  PREDICTED: expansin-A4                             252   8e-81   Eucalyptus grandis [rose gum]
ref|XP_006424843.1|  hypothetical protein CICLE_v10029094mg             252   8e-81   Citrus clementina [clementine]
ref|XP_006488339.1|  PREDICTED: expansin-A4-like                        252   8e-81   Citrus sinensis [apfelsine]
ref|XP_008802710.1|  PREDICTED: expansin-A4                             252   8e-81   Phoenix dactylifera
gb|ADC35365.1|  alpha-expansin 2                                        252   9e-81   Coffea arabica [arabica coffee]
ref|XP_009349313.1|  PREDICTED: expansin-A6-like                        252   9e-81   Pyrus x bretschneideri [bai li]
ref|XP_002283530.1|  PREDICTED: expansin-A4                             252   9e-81   Vitis vinifera
gb|AEQ55290.1|  expansin                                                252   9e-81   Breonia chinensis
ref|XP_010685747.1|  PREDICTED: expansin-A4                             252   9e-81   Beta vulgaris subsp. vulgaris [field beet]
gb|AEN70901.1|  expansin                                                252   9e-81   Gossypium barbadense var. brasiliense
ref|XP_008384848.1|  PREDICTED: expansin-A4                             252   1e-80   Malus domestica [apple tree]
ref|XP_009353647.1|  PREDICTED: expansin-A6-like                        252   1e-80   Pyrus x bretschneideri [bai li]
ref|XP_008799850.1|  PREDICTED: expansin-A6-like                        252   1e-80   Phoenix dactylifera
gb|AEN70891.1|  expansin                                                252   1e-80   Gossypium thurberi
gb|ADY68817.1|  expansin                                                252   1e-80   Gossypium raimondii
gb|ADY68814.1|  expansin                                                252   1e-80   Gossypium barbadense [Egyptian cotton]
gb|KDP44940.1|  hypothetical protein JCGZ_01440                         252   1e-80   Jatropha curcas
ref|XP_007141864.1|  hypothetical protein PHAVU_008G232200g             252   1e-80   Phaseolus vulgaris [French bean]
gb|KEH22886.1|  expansin-A1-like protein                                252   1e-80   Medicago truncatula
ref|XP_007163413.1|  hypothetical protein PHAVU_001G232600g             252   1e-80   Phaseolus vulgaris [French bean]
gb|AEQ55275.1|  expansin                                                251   1e-80   Breonia chinensis
gb|KHG20113.1|  Expansin-A4 -like protein                               251   1e-80   Gossypium arboreum [tree cotton]
ref|XP_004154408.1|  PREDICTED: expansin-A4-like                        251   1e-80   
gb|AAL31477.1|AF319472_1  alpha-expansin 6 precursor                    251   2e-80   Cucumis sativus [cucumbers]
ref|XP_002881524.1|  ATEXPA3                                            251   2e-80   Arabidopsis lyrata subsp. lyrata
gb|EYU26594.1|  hypothetical protein MIMGU_mgv1a012061mg                251   2e-80   Erythranthe guttata [common monkey flower]
ref|XP_008240857.1|  PREDICTED: expansin-A6-like                        251   2e-80   Prunus mume [ume]
gb|KHN30166.1|  Expansin-A4                                             252   2e-80   Glycine soja [wild soybean]
gb|KDP20458.1|  hypothetical protein JCGZ_05303                         251   3e-80   Jatropha curcas
ref|XP_002309061.1|  expansin family protein                            251   3e-80   Populus trichocarpa [western balsam poplar]
emb|CAN73252.1|  hypothetical protein VITISV_027049                     250   3e-80   Vitis vinifera
gb|ACO07292.1|  expansin 10                                             251   3e-80   Cucumis sativus [cucumbers]
gb|AAP48989.1|  expansin                                                251   3e-80   Sambucus nigra
gb|ADY68818.1|  expansin                                                251   4e-80   Gossypium hirsutum [American cotton]
gb|ABK93258.1|  unknown                                                 248   4e-80   Populus trichocarpa [western balsam poplar]
gb|AEN70900.1|  expansin                                                251   4e-80   Gossypium tomentosum
ref|XP_011035307.1|  PREDICTED: expansin-A6                             250   4e-80   Populus euphratica
gb|AFK34565.1|  unknown                                                 248   4e-80   Medicago truncatula
ref|XP_009409516.1|  PREDICTED: expansin-A6-like                        250   5e-80   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010414459.1|  PREDICTED: expansin-A6-like                        250   6e-80   Camelina sativa [gold-of-pleasure]
ref|XP_010264435.1|  PREDICTED: expansin-A4                             250   6e-80   Nelumbo nucifera [Indian lotus]
emb|CDX80810.1|  BnaC03g00640D                                          250   6e-80   
ref|XP_008343537.1|  PREDICTED: expansin-A4-like                        250   6e-80   Malus domestica [apple tree]
gb|KEH39447.1|  expansin A10                                            250   7e-80   Medicago truncatula
gb|AAL31480.1|AF319475_1  alpha-expansin 9 precursor                    249   7e-80   Cucumis sativus [cucumbers]
ref|XP_004486999.1|  PREDICTED: expansin-A6-like                        250   7e-80   Cicer arietinum [garbanzo]
ref|XP_009130690.1|  PREDICTED: expansin-A9-like                        250   7e-80   Brassica rapa
ref|XP_003597354.1|  Cell wall protein Exp5                             247   7e-80   
ref|XP_002298353.1|  alpha-expansin 1 family protein                    250   8e-80   Populus trichocarpa [western balsam poplar]
ref|XP_003616412.1|  Expansin                                           249   8e-80   Medicago truncatula
ref|XP_008461679.1|  PREDICTED: expansin-A4                             249   9e-80   Cucumis melo [Oriental melon]
ref|XP_002313434.1|  alpha-expansin 1 family protein                    249   1e-79   Populus trichocarpa [western balsam poplar]
ref|XP_004147685.1|  PREDICTED: expansin-A4-like                        249   1e-79   Cucumis sativus [cucumbers]
ref|XP_009357738.1|  PREDICTED: expansin-A4-like                        249   1e-79   Pyrus x bretschneideri [bai li]
ref|XP_010690765.1|  PREDICTED: expansin-A4                             249   1e-79   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010111142.1|  hypothetical protein L484_010756                   249   2e-79   Morus notabilis
emb|CDP00110.1|  unnamed protein product                                249   2e-79   Coffea canephora [robusta coffee]
gb|ACU17612.1|  unknown                                                 245   2e-79   Glycine max [soybeans]
gb|AEN70895.1|  expansin                                                249   2e-79   Gossypium mustelinum
ref|XP_008777004.1|  PREDICTED: expansin-A4-like                        249   2e-79   Phoenix dactylifera
ref|XP_008371813.1|  PREDICTED: expansin-A4-like                        249   2e-79   Malus domestica [apple tree]
ref|XP_006366490.1|  PREDICTED: expansin-A6                             248   2e-79   Solanum tuberosum [potatoes]
ref|XP_007150329.1|  hypothetical protein PHAVU_005G144500g             248   2e-79   Phaseolus vulgaris [French bean]
ref|NP_001234761.1|  expansin18 precursor                               248   3e-79   
gb|AFZ78606.1|  expansin protein                                        248   3e-79   Populus tomentosa [Chinese white poplar]
ref|XP_006480833.1|  PREDICTED: expansin-A4-like                        248   3e-79   Citrus sinensis [apfelsine]
ref|XP_009122794.1|  PREDICTED: expansin-A9                             248   3e-79   Brassica rapa
ref|NP_001288956.1|  expansin-A9-like precursor                         248   3e-79   Brassica rapa
ref|XP_004490888.1|  PREDICTED: expansin-A4-like                        248   3e-79   Cicer arietinum [garbanzo]
ref|XP_006294816.1|  hypothetical protein CARUB_v10023867mg             248   4e-79   Capsella rubella
gb|KJB08889.1|  hypothetical protein B456_001G111100                    248   4e-79   Gossypium raimondii
gb|AAR09168.1|  alpha-expansin 1                                        248   4e-79   Populus tremula x Populus tremuloides
gb|AFK40565.1|  unknown                                                 247   4e-79   Medicago truncatula
gb|AAM22625.1|AF428178_1  expansin 11 precursor                         248   4e-79   Rumex palustris
ref|XP_006429095.1|  hypothetical protein CICLE_v10012518mg             248   5e-79   Citrus clementina [clementine]
ref|XP_010558331.1|  PREDICTED: expansin-A9                             248   5e-79   Tarenaya hassleriana [spider flower]
ref|XP_011089478.1|  PREDICTED: expansin-A6                             248   5e-79   Sesamum indicum [beniseed]
ref|XP_002881024.1|  ATEXPA6                                            248   5e-79   Arabidopsis lyrata subsp. lyrata
emb|CDY10456.1|  BnaCnng03570D                                          248   5e-79   Brassica napus [oilseed rape]
ref|XP_006398690.1|  hypothetical protein EUTSA_v10014430mg             248   5e-79   Eutrema salsugineum [saltwater cress]
ref|XP_006435550.1|  hypothetical protein CICLE_v10032484mg             248   5e-79   Citrus clementina [clementine]
emb|CDY31742.1|  BnaA04g16780D                                          248   5e-79   Brassica napus [oilseed rape]
gb|KHG24991.1|  Expansin-A4 -like protein                               248   5e-79   Gossypium arboreum [tree cotton]
ref|NP_001288899.1|  expansin-A6 precursor                              248   5e-79   Brassica rapa
ref|XP_010510558.1|  PREDICTED: expansin-A6                             247   6e-79   Camelina sativa [gold-of-pleasure]
ref|XP_009380637.1|  PREDICTED: expansin-A4                             248   6e-79   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY04847.1|  BnaAnng00290D                                          248   6e-79   
ref|NP_001233958.1|  expansin precursor                                 248   6e-79   Solanum lycopersicum
gb|AFK44569.1|  unknown                                                 247   8e-79   Medicago truncatula
ref|XP_006409928.1|  hypothetical protein EUTSA_v10017116mg             247   9e-79   Eutrema salsugineum [saltwater cress]
gb|KEH30169.1|  expansin A10                                            247   9e-79   Medicago truncatula
dbj|BAC67194.1|  expansin                                               247   1e-78   Pyrus communis
ref|XP_010534508.1|  PREDICTED: expansin-A4                             247   1e-78   Tarenaya hassleriana [spider flower]
emb|CDY48101.1|  BnaC02g03580D                                          247   1e-78   Brassica napus [oilseed rape]
ref|XP_006288496.1|  hypothetical protein CARUB_v10001761mg             246   1e-78   Capsella rubella
ref|XP_007205740.1|  hypothetical protein PRUPE_ppa010180mg             247   1e-78   Prunus persica
ref|XP_006411198.1|  hypothetical protein EUTSA_v10017119mg             246   1e-78   Eutrema salsugineum [saltwater cress]
ref|XP_010521846.1|  PREDICTED: expansin-A6                             246   1e-78   Tarenaya hassleriana [spider flower]
ref|XP_011019858.1|  PREDICTED: expansin-A6                             246   1e-78   Populus euphratica
emb|CDX77222.1|  BnaC04g40170D                                          246   2e-78   
gb|EPS67093.1|  hypothetical protein M569_07682                         246   2e-78   Genlisea aurea
ref|XP_008223717.1|  PREDICTED: expansin-A4                             246   2e-78   Prunus mume [ume]
ref|XP_006350774.1|  PREDICTED: expansin-A6                             246   2e-78   Solanum tuberosum [potatoes]
ref|XP_010937609.1|  PREDICTED: expansin-A4                             246   2e-78   Elaeis guineensis
gb|KFK32246.1|  hypothetical protein AALP_AA6G217100                    246   2e-78   Arabis alpina [alpine rockcress]
emb|CDY47883.1|  BnaA07g14280D                                          246   3e-78   Brassica napus [oilseed rape]
gb|AAM22626.1|AF428179_1  expansin 12 precursor                         246   3e-78   Rumex palustris
ref|NP_180461.1|  expansin A6                                           246   3e-78   Arabidopsis thaliana [mouse-ear cress]
gb|AAM22624.1|AF428177_1  expansin 10 precursor                         246   3e-78   Rumex palustris
ref|XP_010423881.1|  PREDICTED: expansin-A9-like                        245   4e-78   Camelina sativa [gold-of-pleasure]
ref|XP_004145295.1|  PREDICTED: expansin-A4-like                        245   5e-78   
ref|XP_011077214.1|  PREDICTED: expansin-A6-like                        245   5e-78   Sesamum indicum [beniseed]
ref|XP_009409019.1|  PREDICTED: expansin-A4-like                        245   5e-78   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY07024.1|  BnaA04g22910D                                          245   5e-78   
gb|AEU08407.1|  expansin 2                                              245   6e-78   Prunus salicina [Japanese plum]
ref|XP_006294843.1|  hypothetical protein CARUB_v10023894mg             245   6e-78   Capsella rubella
ref|XP_009141827.1|  PREDICTED: expansin-A4-like                        245   6e-78   Brassica rapa
ref|XP_011031225.1|  PREDICTED: expansin-A4-like                        245   6e-78   Populus euphratica
ref|NP_181500.1|  expansin A4                                           245   7e-78   Arabidopsis thaliana [mouse-ear cress]
gb|AAV85475.1|  expansin                                                244   7e-78   Populus tomentosa [Chinese white poplar]
ref|XP_010532011.1|  PREDICTED: expansin-A4-like                        244   8e-78   Tarenaya hassleriana [spider flower]
ref|XP_002312101.1|  alpha-expansin 9 precursor family protein          244   8e-78   Populus trichocarpa [western balsam poplar]
gb|AAK48848.1|AF350939_1  expansin                                      244   9e-78   Prunus cerasus [pie cherry]
emb|CDY07642.1|  BnaA03g18690D                                          244   9e-78   Brassica napus [oilseed rape]
ref|XP_010557251.1|  PREDICTED: expansin-A6-like                        244   9e-78   Tarenaya hassleriana [spider flower]
ref|XP_011042710.1|  PREDICTED: expansin-A4-like                        244   1e-77   Populus euphratica
ref|NP_001150534.1|  alpha-expansin 6 precursor                         244   1e-77   
ref|XP_010452058.1|  PREDICTED: expansin-A9-like                        244   1e-77   Camelina sativa [gold-of-pleasure]
gb|ABK93541.1|  unknown                                                 244   1e-77   Populus trichocarpa [western balsam poplar]
ref|XP_010931278.1|  PREDICTED: LOW QUALITY PROTEIN: expansin-A7        244   1e-77   Elaeis guineensis
emb|CAA04385.1|  Expansin                                               244   1e-77   Brassica napus [oilseed rape]
ref|XP_009419260.1|  PREDICTED: expansin-A7-like                        244   1e-77   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009388613.1|  PREDICTED: expansin-A7                             244   2e-77   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN33378.1|  Expansin-A4                                             243   2e-77   Glycine soja [wild soybean]
ref|XP_009124371.1|  PREDICTED: LOW QUALITY PROTEIN: expansin-A6        244   2e-77   Brassica rapa
ref|XP_010505648.1|  PREDICTED: expansin-A4                             243   2e-77   Camelina sativa [gold-of-pleasure]
dbj|BAN09210.1|  alpha expansin                                         243   2e-77   Eustoma exaltatum subsp. russellianum [bluebells]
gb|ACT67493.1|  expansin A1                                             243   3e-77   Raphanus sativus
ref|XP_002881669.1|  ATEXPA4                                            243   3e-77   
ref|XP_002463623.1|  hypothetical protein SORBIDRAFT_01g003120          243   3e-77   Sorghum bicolor [broomcorn]
ref|XP_010554612.1|  PREDICTED: expansin-A4                             243   3e-77   Tarenaya hassleriana [spider flower]
emb|CDY69611.1|  BnaCnng64440D                                          243   3e-77   Brassica napus [oilseed rape]
dbj|BAE06067.1|  expansin                                               243   3e-77   Sagittaria pygmaea
ref|NP_001288961.1|  expansin-A4 precursor                              243   3e-77   Brassica rapa
gb|ACF87150.1|  unknown                                                 243   4e-77   Zea mays [maize]
gb|AAM62987.1|  expansin AtEx6                                          243   4e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010111457.1|  hypothetical protein L484_021280                   243   4e-77   Morus notabilis
gb|ABO30976.2|  alpha expansin protein 1                                243   4e-77   Calotropis procera
ref|XP_010490643.1|  PREDICTED: expansin-A9                             243   5e-77   Camelina sativa [gold-of-pleasure]
ref|XP_011077647.1|  PREDICTED: expansin-A6-like                        243   5e-77   
ref|XP_010517323.1|  PREDICTED: expansin-A4-like                        242   6e-77   Camelina sativa [gold-of-pleasure]
ref|XP_010508990.1|  PREDICTED: expansin-A4-like                        242   6e-77   Camelina sativa [gold-of-pleasure]
ref|XP_006294844.1|  hypothetical protein CARUB_v10023895mg             242   7e-77   Capsella rubella
ref|NP_001288942.1|  expansin-A16 precursor                             242   8e-77   Brassica rapa
emb|CDY24952.1|  BnaC03g22200D                                          242   9e-77   Brassica napus [oilseed rape]
ref|XP_006846223.1|  hypothetical protein AMTR_s00012p00230920          242   9e-77   Amborella trichopoda
ref|XP_008458865.1|  PREDICTED: expansin-A4                             241   1e-76   Cucumis melo [Oriental melon]
gb|ABK24904.1|  unknown                                                 241   2e-76   Picea sitchensis
ref|XP_002878036.1|  ATEXPA16                                           241   3e-76   Arabidopsis lyrata subsp. lyrata
ref|XP_002870966.1|  ATEXPA9                                            240   4e-76   
ref|XP_004981242.1|  PREDICTED: expansin-A7-like                        240   4e-76   
gb|KJB20063.1|  hypothetical protein B456_003G131000                    238   4e-76   
gb|AAM62937.1|  Alpha-expansin 4 precursor (At-EXP4) (AtEx4) (Ath...    240   5e-76   
ref|XP_010509297.1|  PREDICTED: expansin-A3-like                        236   6e-76   
gb|KFK34799.1|  hypothetical protein AALP_AA5G194700                    239   9e-76   
ref|XP_009398502.1|  PREDICTED: expansin-A7-like                        239   9e-76   
gb|ABN09939.1|  expansin A4                                             239   9e-76   
emb|CDY40233.1|  BnaA09g35150D                                          239   1e-75   
emb|CDY20467.1|  BnaC04g05770D                                          239   2e-75   
ref|XP_004171211.1|  PREDICTED: expansin-A16-like                       239   2e-75   
ref|NP_195846.1|  expansin A9                                           239   2e-75   
ref|XP_009143296.1|  PREDICTED: expansin-A4-like                        238   2e-75   
gb|KFK24708.1|  hypothetical protein AALP_AA8G014300                    238   2e-75   
gb|KJB46593.1|  hypothetical protein B456_007G376300                    239   3e-75   
ref|NP_001051731.1|  Os03g0822000                                       238   3e-75   
ref|XP_010504408.1|  PREDICTED: expansin-A16-like                       238   4e-75   
ref|XP_006650810.1|  PREDICTED: expansin-A7-like                        238   5e-75   
ref|XP_007205739.1|  hypothetical protein PRUPE_ppa010180mg             234   8e-75   
gb|ABN09942.1|  expansin A5                                             236   9e-75   
ref|XP_003563572.1|  PREDICTED: expansin-A7                             237   9e-75   
gb|AAL87021.1|  cell wall protein EXP2 precursor                        236   1e-74   
ref|XP_010516124.1|  PREDICTED: expansin-A16                            236   2e-74   
gb|AAS48878.1|  expansin EXPA9                                          236   3e-74   
ref|XP_009381075.1|  PREDICTED: expansin-A7-like                        235   3e-74   
emb|CDY41218.1|  BnaC08g26400D                                          235   5e-74   
ref|XP_010427324.1|  PREDICTED: expansin-A16-like                       235   5e-74   
gb|KFK36856.1|  hypothetical protein AALP_AA4G180600                    234   9e-74   
ref|XP_009139160.1|  PREDICTED: expansin-A16-like                       234   1e-73   
emb|CDX76090.1|  BnaA04g03540D                                          234   2e-73   
ref|XP_010677870.1|  PREDICTED: expansin-A4-like                        233   2e-73   
gb|ACO52763.1|  EXP6                                                    229   2e-73   
gb|ACO52788.1|  EXP6                                                    229   2e-73   
gb|ABN09940.1|  expansin A5                                             233   2e-73   
ref|NP_191109.1|  expansin A16                                          233   2e-73   
gb|KJB08890.1|  hypothetical protein B456_001G111100                    234   3e-73   
gb|AFW67136.1|  hypothetical protein ZEAMMB73_591538                    229   3e-73   
ref|XP_006403453.1|  hypothetical protein EUTSA_v10010989mg             233   3e-73   
gb|AAQ08016.1|  expansin                                                233   4e-73   
gb|ACO52755.1|  EXP6                                                    229   4e-73   
gb|ACO52786.1|  EXP6                                                    228   5e-73   
gb|ACO52796.1|  EXP6                                                    228   5e-73   
ref|XP_006291698.1|  hypothetical protein CARUB_v10017862mg             232   6e-73   
gb|ACG46282.1|  alpha-expansin 6 precursor                              232   7e-73   
gb|ACO52759.1|  EXP6                                                    228   1e-72   
emb|CDY02943.1|  BnaC04g25430D                                          231   2e-72   
gb|ABM66430.1|  expansin 3                                              231   2e-72   
gb|ACO52804.1|  EXP6                                                    227   2e-72   
gb|ABM54492.1|  expansin 2                                              231   2e-72   
gb|EPS64820.1|  hypothetical protein M569_09956                         230   4e-72   
gb|KFK34800.1|  hypothetical protein AALP_AA5G194900                    229   4e-72   
gb|AAN60246.1|  unknown                                                 228   4e-72   
ref|XP_004307494.1|  PREDICTED: expansin-A4-like                        229   1e-71   
gb|ACO52757.1|  EXP6                                                    225   1e-71   
gb|ACO52765.1|  EXP6                                                    224   2e-71   
ref|NP_001267685.1|  expansin-A16-like                                  226   7e-71   
gb|ACO52791.1|  EXP6                                                    223   7e-71   
gb|KHN07218.1|  Expansin-A4                                             226   1e-70   
gb|AAL01624.1|  expansin                                                223   1e-70   
gb|ACO52767.1|  EXP6                                                    222   2e-70   
gb|ACF84785.1|  unknown                                                 225   4e-70   
gb|ACO57092.1|  EXP6                                                    219   2e-69   
gb|AGU13763.1|  expansin                                                222   5e-69   
gb|ACO52780.1|  EXP6                                                    218   6e-69   
gb|ADC35366.1|  alpha-expansin 3                                        221   1e-68   
gb|ACO52764.1|  EXP6                                                    216   3e-68   
gb|AAL87024.1|  cell wall protein Exp5                                  216   7e-68   
gb|ACI02326.1|  expansion-related protein                               219   8e-68   
gb|EYU19913.1|  hypothetical protein MIMGU_mgv1a012177mg                219   9e-68   
ref|XP_002523388.1|  Alpha-expansin 1 precursor, putative               218   1e-67   
gb|AEQ55268.1|  expansin                                                218   1e-67   
ref|XP_010931357.1|  PREDICTED: expansin-A4-like                        218   2e-67   
emb|CDP04049.1|  unnamed protein product                                218   2e-67   
gb|KCW65774.1|  hypothetical protein EUGRSUZ_G03134                     217   3e-67   
gb|KFK42332.1|  hypothetical protein AALP_AA2G242600                    218   3e-67   
ref|XP_002963702.1|  hypothetical protein SELMODRAFT_230202             217   3e-67   
dbj|BAD00017.1|  expansin                                               216   6e-67   
gb|AEQ55270.1|  expansin                                                216   1e-66   
ref|XP_010921302.1|  PREDICTED: expansin-A10-like                       215   1e-66   
emb|CDY24897.1|  BnaC03g22750D                                          216   1e-66   
gb|KDP30638.1|  hypothetical protein JCGZ_16203                         215   2e-66   
ref|XP_004135171.1|  PREDICTED: expansin-A1-like                        215   2e-66   
ref|XP_004155305.1|  PREDICTED: LOW QUALITY PROTEIN: expansin-A1-...    215   2e-66   
ref|XP_002974792.1|  hypothetical protein SELMODRAFT_102164             215   2e-66   
tpg|DAA52222.1|  TPA: hypothetical protein ZEAMMB73_487280              212   3e-66   
ref|XP_007142047.1|  hypothetical protein PHAVU_008G248000g             214   4e-66   
ref|XP_007017076.1|  Expansin A8, ALPHA 1.11,EXPA8                      214   4e-66   
ref|XP_008446373.1|  PREDICTED: expansin-A1                             214   4e-66   
emb|CDY23890.1|  BnaC04g01470D                                          214   5e-66   
gb|AAM08930.1|  expansin 1                                              214   5e-66   
ref|XP_009142702.1|  PREDICTED: expansin-A8                             214   6e-66   
ref|XP_002323665.1|  expansin S1 precursor family protein               214   6e-66   
gb|ADN03964.1|  EXP1                                                    214   7e-66   
gb|ACK43222.1|  expansin 2                                              214   7e-66   
ref|XP_009399909.1|  PREDICTED: expansin-A2-like                        215   7e-66   
ref|XP_006411329.1|  hypothetical protein EUTSA_v10017120mg             214   7e-66   
gb|KDO49685.1|  hypothetical protein CISIN_1g025193mg                   214   8e-66   
gb|EPS68567.1|  hypothetical protein M569_06200                         214   9e-66   
ref|XP_009410516.1|  PREDICTED: expansin-A4-like                        213   1e-65   
ref|XP_003568245.1|  PREDICTED: expansin-A4                             213   1e-65   
ref|NP_001289251.1|  expansin-A4-like precursor                         213   1e-65   
ref|XP_008354429.1|  PREDICTED: expansin-A4-like                        213   1e-65   
gb|AEQ55269.1|  expansin                                                213   1e-65   
gb|AEQ55284.1|  expansin                                                213   1e-65   
ref|XP_010525408.1|  PREDICTED: expansin-A8                             213   1e-65   
gb|ACA05165.1|  expansin 2                                              213   1e-65   
ref|XP_009767600.1|  PREDICTED: expansin-A15-like                       213   1e-65   
gb|AHL25252.1|  expansin                                                213   2e-65   
ref|XP_010257816.1|  PREDICTED: expansin-A1                             213   2e-65   
ref|XP_009399910.1|  PREDICTED: expansin-A2-like                        213   2e-65   
ref|XP_007205762.1|  hypothetical protein PRUPE_ppa010314mg             213   2e-65   
ref|XP_010103644.1|  hypothetical protein L484_011237                   213   2e-65   
ref|XP_008242138.1|  PREDICTED: expansin-A8-like                        213   2e-65   
emb|CBI15823.3|  unnamed protein product                                212   2e-65   
ref|XP_010938009.1|  PREDICTED: expansin-A2-like                        213   2e-65   
gb|ACO52768.1|  EXP6                                                    208   2e-65   
gb|AAC33529.1|  expansin                                                213   3e-65   
ref|XP_010922733.1|  PREDICTED: expansin-A2-like                        212   3e-65   
gb|AAG13982.1|AF297521_1  expansin 1                                    212   3e-65   
ref|XP_009374380.1|  PREDICTED: expansin-A4-like                        212   3e-65   
gb|ABO32366.1|  expansin                                                212   3e-65   
ref|XP_009404081.1|  PREDICTED: expansin-A15                            212   3e-65   
ref|XP_009384771.1|  PREDICTED: expansin-A2                             212   3e-65   
ref|XP_009141922.1|  PREDICTED: expansin-A8-like                        212   3e-65   
ref|XP_003529476.1|  PREDICTED: expansin-A15-like                       212   3e-65   
gb|AFK24457.1|  expansin 4                                              212   3e-65   
ref|NP_001288831.1|  expansin precursor                                 212   5e-65   
ref|XP_006842458.1|  hypothetical protein AMTR_s00077p00063420          212   5e-65   
ref|XP_010917068.1|  PREDICTED: expansin-A10-like                       211   6e-65   
ref|XP_010108480.1|  hypothetical protein L484_010673                   211   6e-65   
ref|XP_010670609.1|  PREDICTED: expansin-A4                             211   6e-65   
ref|XP_002276565.3|  PREDICTED: expansin-A4                             211   6e-65   
gb|ACK87022.1|  expansin                                                211   6e-65   
ref|XP_010252076.1|  PREDICTED: expansin-A8-like                        211   7e-65   
gb|ACJ70084.1|  expansin                                                211   7e-65   
ref|XP_010031088.1|  PREDICTED: expansin-A8-like                        211   7e-65   
gb|EYU46016.1|  hypothetical protein MIMGU_mgv1a012336mg                211   8e-65   
gb|AFZ78605.1|  expansin protein                                        211   8e-65   
ref|XP_003613849.1|  Expansin                                           211   8e-65   
gb|KDP21654.1|  hypothetical protein JCGZ_03325                         211   8e-65   
ref|XP_002520863.1|  Alpha-expansin 8 precursor, putative               211   8e-65   
ref|XP_011011315.1|  PREDICTED: expansin-A8-like                        211   8e-65   
gb|AJR32958.1|  expansin                                                211   9e-65   
gb|ACK43886.1|  expansin                                                211   9e-65   
ref|XP_004307732.1|  PREDICTED: expansin-A10                            211   1e-64   
gb|ABB59694.1|  alpha-expansin 2                                        211   1e-64   
gb|ACK43884.1|  expansin                                                211   1e-64   
gb|AEQ55272.1|  expansin                                                211   1e-64   
emb|CDP13911.1|  unnamed protein product                                210   1e-64   
gb|AFK34543.1|  unknown                                                 211   1e-64   
gb|KDP22771.1|  hypothetical protein JCGZ_00358                         210   1e-64   
ref|XP_006435913.1|  hypothetical protein CICLE_v10032524mg             211   1e-64   
ref|XP_010921134.1|  PREDICTED: expansin-A2-like isoform X1             211   1e-64   
ref|XP_003607738.1|  Expansin                                           211   2e-64   
gb|ABY65114.1|  putative expansin                                       210   2e-64   
ref|XP_002325925.2|  alpha-expansin 8 precursor family protein          210   2e-64   
ref|NP_001275780.1|  expansin 2 precursor                               210   2e-64   
ref|XP_003523276.1|  PREDICTED: expansin-A8-like                        210   2e-64   
gb|ACM90161.1|  expansin 3                                              210   2e-64   
ref|XP_006296492.1|  hypothetical protein CARUB_v10025678mg             210   2e-64   
ref|XP_006445551.1|  hypothetical protein CICLE_v10017738mg             210   2e-64   
ref|XP_008391992.1|  PREDICTED: expansin-A6-like                        206   2e-64   
ref|XP_003544930.1|  PREDICTED: expansin-A8                             210   2e-64   
gb|AEQ55278.1|  expansin                                                210   2e-64   
gb|AHL25254.1|  expansin                                                210   2e-64   
ref|XP_011048141.1|  PREDICTED: expansin-A15-like                       210   2e-64   
gb|ABR17119.1|  unknown                                                 210   2e-64   
ref|XP_008782645.1|  PREDICTED: expansin-A2-like                        210   2e-64   
gb|EYU20096.1|  hypothetical protein MIMGU_mgv1a012489mg                210   2e-64   
ref|XP_008792215.1|  PREDICTED: expansin-A8-like                        210   2e-64   
ref|NP_849869.1|  expansin A1                                           211   3e-64   
ref|NP_001281040.1|  expansin-A4-like precursor                         210   3e-64   
emb|CDX98831.1|  BnaC09g50040D                                          210   3e-64   
ref|NP_001117573.1|  expansin A1                                        210   3e-64   
ref|XP_002297611.1|  expansin S1 precursor family protein               209   3e-64   
ref|XP_010517501.1|  PREDICTED: expansin-A8                             210   3e-64   
gb|AAL87025.1|  cell wall protein Exp1 precursor                        209   3e-64   
emb|CDX70161.1|  BnaA10g25100D                                          209   3e-64   
ref|NP_177112.1|  expansin A1                                           209   3e-64   
ref|XP_009122138.1|  PREDICTED: expansin-A2                             209   3e-64   
ref|XP_010508833.1|  PREDICTED: expansin-A8-like                        210   3e-64   
ref|XP_010258310.1|  PREDICTED: expansin-A1 isoform X1                  209   3e-64   
ref|XP_009399925.1|  PREDICTED: expansin-A15-like                       209   3e-64   
dbj|BAC66696.1|  expansin                                               209   3e-64   
ref|XP_009622932.1|  PREDICTED: expansin-A8-like                        209   3e-64   
ref|XP_011013147.1|  PREDICTED: expansin-A1                             209   3e-64   
ref|XP_007037392.1|  Expansin A1, ALPHA 1.2,EXPA1                       211   3e-64   
ref|XP_002280300.1|  PREDICTED: expansin-A8                             209   3e-64   
ref|XP_010505810.1|  PREDICTED: expansin-A8-like                        209   4e-64   
ref|NP_001185357.1|  expansin A1                                        209   4e-64   
ref|XP_002887242.1|  ATEXPA1                                            209   4e-64   
gb|AEC03978.1|  expansin                                                209   4e-64   
gb|ACA05166.1|  expansin 3                                              209   4e-64   
dbj|BAJ34927.1|  similar to expansin                                    209   4e-64   
ref|NP_181593.1|  expansin A8                                           209   5e-64   
ref|XP_002522457.1|  Alpha-expansin 1 precursor, putative               209   5e-64   
ref|XP_009390308.1|  PREDICTED: expansin-A10-like                       209   5e-64   
gb|ACO52766.1|  EXP6                                                    204   5e-64   
ref|XP_002881731.1|  ATEXPA8                                            209   5e-64   
gb|ACO52773.1|  EXP6                                                    204   6e-64   
gb|AEN70887.1|  alpha-expansin 1                                        209   6e-64   
ref|XP_010257730.1|  PREDICTED: expansin-A15-like                       209   7e-64   
gb|AAB38070.1|  expansin At-EXPA1                                       208   7e-64   
ref|XP_006654542.1|  PREDICTED: expansin-A4-like                        208   7e-64   
ref|XP_010043148.1|  PREDICTED: expansin-A4-like                        209   8e-64   
ref|XP_011019014.1|  PREDICTED: expansin-A8-like                        209   8e-64   
gb|KEH35550.1|  expansin A10                                            209   8e-64   
ref|XP_011089527.1|  PREDICTED: expansin-A4-like                        208   8e-64   
gb|AAD47901.1|AF085330_1  expansin                                      208   8e-64   
ref|XP_002456550.1|  hypothetical protein SORBIDRAFT_03g038290          208   1e-63   
ref|XP_002514740.1|  Alpha-expansin 15 precursor, putative              208   1e-63   
ref|XP_010511994.1|  PREDICTED: expansin-A1                             208   1e-63   
gb|AFZ78603.1|  expansin protein                                        208   1e-63   
ref|XP_004294733.1|  PREDICTED: expansin-A4-like                        208   1e-63   
gb|AEQ55281.1|  expansin                                                207   2e-63   
emb|CAC18802.1|  expansin                                               205   2e-63   
ref|NP_001267550.1|  expansin-A8-like precursor                         207   2e-63   
gb|KHG01029.1|  Expansin-A15 -like protein                              207   2e-63   
ref|NP_001240113.1|  expansin precursor                                 207   2e-63   
ref|XP_011076589.1|  PREDICTED: expansin-A4-like                        207   2e-63   
ref|XP_006302737.1|  hypothetical protein CARUB_v10020849mg             207   2e-63   



>dbj|BAO57279.1| alpha-expansin [Ipomoea nil]
Length=257

 Score =   289 bits (739),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 146/160 (91%), Gaps = 1/160 (1%)
 Frame = +3

Query  69   MAALRVFCIALF-CFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYT  245
            MAA+RV CIAL  C LTAV ARIPGVY+ G WQ AHATFYGGADASGTM GACGYGNLY+
Sbjct  1    MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  60

Query  246  QGYGVNNAALSTALFNTGLSCGACFEIKCNNDRSCLAGNPSIVVTATNFCPPNFALPNDN  425
            QGYGVNNAALSTALFN GLSCGACFEIKC+NDRSC  GNPSI VTATNFCPPNFALPNDN
Sbjct  61   QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRSCSPGNPSIFVTATNFCPPNFALPNDN  120

Query  426  GGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            GGWCNPPR HFDLAMPMFLKIAAYRAGIVPVNFRR+PCRK
Sbjct  121  GGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRK  160



>ref|XP_009788740.1| PREDICTED: expansin-A3-like [Nicotiana sylvestris]
Length=259

 Score =   275 bits (704),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 142/162 (88%), Gaps = 3/162 (2%)
 Frame = +3

Query  69   MAALRVFCIA--LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLY  242
            MA  ++ CIA  L CFLTAV A+IPGVYT GPWQGAHATFYGG+DASGTM GACGYGNLY
Sbjct  1    MAVTKILCIAATLLCFLTAVNAKIPGVYTGGPWQGAHATFYGGSDASGTMGGACGYGNLY  60

Query  243  TQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPN  419
            +QGYGVNNAALST LFN GLSCGACFEIKC +D + CL GNPSI VTATNFCPPNFALPN
Sbjct  61   SQGYGVNNAALSTVLFNNGLSCGACFEIKCVDDGKWCLPGNPSIFVTATNFCPPNFALPN  120

Query  420  DNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            D+GGWCNPPR HFDLAMPMFLKI  YRAGIVPV +RRVPCRK
Sbjct  121  DDGGWCNPPRPHFDLAMPMFLKIGQYRAGIVPVTYRRVPCRK  162



>ref|XP_009587747.1| PREDICTED: expansin-A3-like [Nicotiana tomentosiformis]
Length=259

 Score =   271 bits (693),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 130/162 (80%), Positives = 141/162 (87%), Gaps = 3/162 (2%)
 Frame = +3

Query  69   MAALRVFCIA--LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLY  242
            M   ++ CI   L CFLTAV A+IPGVYT GPWQGAHATFYGG+DASGTM GACGYGNLY
Sbjct  1    MVVTKILCITTTLLCFLTAVNAKIPGVYTGGPWQGAHATFYGGSDASGTMGGACGYGNLY  60

Query  243  TQGYGVNNAALSTALFNTGLSCGACFEIKC-NNDRSCLAGNPSIVVTATNFCPPNFALPN  419
            +QGYGVNNAALST LFN GLSCGACFEIKC ++D+ CL GNPSI VTATNFCPPNFALPN
Sbjct  61   SQGYGVNNAALSTVLFNNGLSCGACFEIKCVDDDKWCLPGNPSIFVTATNFCPPNFALPN  120

Query  420  DNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            D+GGWCNPPR HFDLAMPMFLKI  YRAGIVPV++RRV CRK
Sbjct  121  DDGGWCNPPRPHFDLAMPMFLKIGLYRAGIVPVSYRRVACRK  162



>ref|XP_006341021.1| PREDICTED: expansin-A3 [Solanum tuberosum]
Length=263

 Score =   271 bits (693),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 138/164 (84%), Gaps = 1/164 (1%)
 Frame = +3

Query  57   KFMEMAALRVFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGN  236
            K      L +    L CFLTAV ARIPGVYT GPWQ AHATFYGG+DASGTM GACGYGN
Sbjct  3    KMAATMMLYITTTILLCFLTAVNARIPGVYTGGPWQSAHATFYGGSDASGTMGGACGYGN  62

Query  237  LYTQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFAL  413
            LY+QGYGVNNAALST LFN GLSCGACFE+KC+ND + CL GNPSI VTATNFCPPNFAL
Sbjct  63   LYSQGYGVNNAALSTVLFNNGLSCGACFELKCDNDGKWCLPGNPSIFVTATNFCPPNFAL  122

Query  414  PNDNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            PND+GGWCNPPR HFDLAMPMFLKI  YRAGIVPV +RRVPCRK
Sbjct  123  PNDDGGWCNPPRPHFDLAMPMFLKIGLYRAGIVPVTYRRVPCRK  166



>ref|NP_001234081.1| expansin A4 precursor [Solanum lycopersicum]
 gb|AAD13632.1| expansin precursor [Solanum lycopersicum]
Length=263

 Score =   270 bits (691),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 141/164 (86%), Gaps = 4/164 (2%)
 Frame = +3

Query  66   EMAA---LRVFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGN  236
            +MAA   L +    L CFLTAV ARIPGVYT GPWQ AHATFYGG+DASGTM GACGYGN
Sbjct  3    KMAANMMLYITITVLLCFLTAVNARIPGVYTGGPWQTAHATFYGGSDASGTMGGACGYGN  62

Query  237  LYTQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFAL  413
            LY+QGYGVNNAALST LFN GLSCGACFE+KC+ND + CL GNPSI VTATNFCPPNFAL
Sbjct  63   LYSQGYGVNNAALSTVLFNNGLSCGACFELKCDNDGKWCLPGNPSIFVTATNFCPPNFAL  122

Query  414  PNDNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            PND+GGWCNPPR HFDLAMPMFLKI  YRAGIVPV +RRVPCRK
Sbjct  123  PNDDGGWCNPPRPHFDLAMPMFLKIGLYRAGIVPVTYRRVPCRK  166



>gb|AEQ55271.1| expansin [Breonia chinensis]
 gb|AEQ55286.1| expansin [Breonia chinensis]
Length=258

 Score =   268 bits (686),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 140/161 (87%), Gaps = 2/161 (1%)
 Frame = +3

Query  69   MAALRVFCIA-LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYT  245
            MA + + CIA L CFLT V ARIPGVY+ GPWQ AHATFYGG+DASGTM GACGYGNLY+
Sbjct  1    MAQVGLLCIATLLCFLTVVNARIPGVYSGGPWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  246  QGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPND  422
            QGYGVN  ALSTALFN GLSCGACFE+KC N  + CL GNPSI +TATNFCPPNFALPND
Sbjct  61   QGYGVNTGALSTALFNNGLSCGACFELKCANAPKWCLPGNPSIFITATNFCPPNFALPND  120

Query  423  NGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            NGGWCNPPR HFDLAMPMFLKIA YRAGIVPVN+RRVPCRK
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVNYRRVPCRK  161



>emb|CDP06606.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   266 bits (681),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 140/161 (87%), Gaps = 2/161 (1%)
 Frame = +3

Query  69   MAALRVFCIA-LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYT  245
            MA +   CIA L CFLT V AR+PG Y+ GPWQ AHATFYGG+DASGTM GACGYGNLY+
Sbjct  1    MAQMCPLCIAALLCFLTVVNARLPGAYSGGPWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  246  QGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPND  422
            QGYGVN AALSTALFN GLSCGACFE+KC +D + CL G+PSI +TATNFCPPNFALPND
Sbjct  61   QGYGVNTAALSTALFNDGLSCGACFELKCADDPKWCLPGSPSIFITATNFCPPNFALPND  120

Query  423  NGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            NGGWCNPPR HFDLAMPMFLKIA YRAGIVPVNFRRVPCRK
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAQYRAGIVPVNFRRVPCRK  161



>gb|AEE69071.1| expansin-4 [Petunia hybrid cultivar]
Length=248

 Score =   266 bits (679),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 126/148 (85%), Positives = 134/148 (91%), Gaps = 1/148 (1%)
 Frame = +3

Query  105  CFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVNNAALSTA  284
            CFLTAV A+IPGVY  GPWQ AHATFYGG+DASGTM GACGYGNLY+QGYGVNNAALST 
Sbjct  4    CFLTAVYAKIPGVYIGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTV  63

Query  285  LFNTGLSCGACFEIKCNNDRS-CLAGNPSIVVTATNFCPPNFALPNDNGGWCNPPRLHFD  461
            LFN+GLSCGACFE+KC ND   CL GNPSI VTATNFCPPN+ALPND+GGWCNPPR HFD
Sbjct  64   LFNSGLSCGACFELKCTNDEPWCLPGNPSIFVTATNFCPPNYALPNDDGGWCNPPRPHFD  123

Query  462  LAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            LAMPMFLKIA YRAGIVPVN+RRVPCRK
Sbjct  124  LAMPMFLKIAQYRAGIVPVNYRRVPCRK  151



>ref|XP_009607348.1| PREDICTED: expansin-A3-like [Nicotiana tomentosiformis]
Length=293

 Score =   265 bits (676),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 136/161 (84%), Gaps = 0/161 (0%)
 Frame = +3

Query  63   MEMAALRVFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLY  242
            M +    ++  ++ CFLTAV A+I G Y  GPW  AHATFYGG+DASGTM GACGYGNLY
Sbjct  1    MAVTNWTLYIASVLCFLTAVNAKISGNYAGGPWTTAHATFYGGSDASGTMGGACGYGNLY  60

Query  243  TQGYGVNNAALSTALFNTGLSCGACFEIKCNNDRSCLAGNPSIVVTATNFCPPNFALPND  422
            +QGYGVNNAALST LFN GLSCGACFE+KC + + C  GNPSI+VTATNFCPPNFALPND
Sbjct  61   SQGYGVNNAALSTVLFNNGLSCGACFELKCTDQKWCTPGNPSILVTATNFCPPNFALPND  120

Query  423  NGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            NGGWCNPPR HFDLAMPMFLKIA YRAGIVPVN+RRVPCRK
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVNYRRVPCRK  161



>ref|XP_010256907.1| PREDICTED: expansin-A4 [Nelumbo nucifera]
Length=260

 Score =   263 bits (673),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 135/155 (87%), Gaps = 1/155 (1%)
 Frame = +3

Query  84   VFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVN  263
            V  + L  FLT V ARIPGVYT GPWQ AHATFYGG+DASGTM GACGYGNLY+QGYGVN
Sbjct  9    VSAVLLISFLTLVDARIPGVYTGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVN  68

Query  264  NAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNGGWCN  440
             AALSTALFN GLSCGACFEIKC ND + C +G+PSI +TATNFCPPN+ALPNDNGGWCN
Sbjct  69   TAALSTALFNAGLSCGACFEIKCANDPQWCHSGSPSIFITATNFCPPNYALPNDNGGWCN  128

Query  441  PPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            PPR HFDLAMPMFLKIA YRAGIVPV +RRVPCRK
Sbjct  129  PPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRK  163



>ref|XP_011027216.1| PREDICTED: expansin-A4 [Populus euphratica]
Length=258

 Score =   263 bits (672),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 140/161 (87%), Gaps = 2/161 (1%)
 Frame = +3

Query  69   MAALRVFCIA-LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYT  245
            MA     C+A L  FLT V ARIPGVYT G WQ AHATFYGG+DASGTM GACGYGNLY+
Sbjct  1    MAIRATTCVASLVLFLTLVEARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  246  QGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPND  422
            QGYGVN AALSTALFN+GLSCGACFEIKC ND + C +G+PSI++TATNFCPPN+ALP+D
Sbjct  61   QGYGVNTAALSTALFNSGLSCGACFEIKCGNDPQWCHSGSPSILITATNFCPPNYALPSD  120

Query  423  NGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            NGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  161



>gb|AFK33369.1| unknown [Lotus japonicus]
Length=180

 Score =   259 bits (663),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 139/165 (84%), Gaps = 4/165 (2%)
 Frame = +3

Query  63   MEMAALRVFCI---ALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYG  233
            M +   RV C+   +L   +  V+ARIPGVYT G WQGAHATFYGG+DASGTM GACGYG
Sbjct  1    MAVFLARVLCLYMASLISLMWMVQARIPGVYTGGAWQGAHATFYGGSDASGTMGGACGYG  60

Query  234  NLYTQGYGVNNAALSTALFNTGLSCGACFEIKCNNDRS-CLAGNPSIVVTATNFCPPNFA  410
            NLY+QGYGVN AALSTALFN+GLSCGACFEIKC ND+  C +G+PSI +TATNFCPPN+A
Sbjct  61   NLYSQGYGVNTAALSTALFNSGLSCGACFEIKCANDKQWCHSGSPSIFITATNFCPPNYA  120

Query  411  LPNDNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            LPNDNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV +RRVPCR 
Sbjct  121  LPNDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRS  165



>ref|NP_001234881.1| expansin9 precursor [Solanum lycopersicum]
 emb|CAB46492.1| expansin9 [Solanum lycopersicum]
Length=257

 Score =   262 bits (670),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 135/160 (84%), Gaps = 1/160 (1%)
 Frame = +3

Query  69   MAALRVFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQ  248
            M  L+ F I +   L  V  RIPGVY+ G WQ AHATFYGG+DASGTM GACGYGNLY+Q
Sbjct  1    MEILKFFLIIILVILVGVEGRIPGVYSGGSWQNAHATFYGGSDASGTMGGACGYGNLYSQ  60

Query  249  GYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDN  425
            GYGVNNAALSTALFN GLSCGACFEIKC+N  + C  G+PSI++TATNFCPPN+ALPNDN
Sbjct  61   GYGVNNAALSTALFNNGLSCGACFEIKCDNQPQWCHPGSPSILITATNFCPPNYALPNDN  120

Query  426  GGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            GGWCNPPR HFDLAMPMFLKIA YRAGIVPV +RRVPCRK
Sbjct  121  GGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVVYRRVPCRK  160



>gb|AAF32410.1|AF230277_1 alpha-expansin 2 [Triphysaria versicolor]
Length=262

 Score =   262 bits (670),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 139/158 (88%), Gaps = 4/158 (3%)
 Frame = +3

Query  84   VFCIALF-CFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGV  260
            + CIA F CFLT+ +ARIPG+Y+ GPWQGAHATFYGG+DASGTM GACGYGNLY+QGYGV
Sbjct  8    LLCIATFICFLTSAQARIPGIYSGGPWQGAHATFYGGSDASGTMGGACGYGNLYSQGYGV  67

Query  261  NNAALSTALFNTGLSCGACFEIKCN---NDRSCLAGNPSIVVTATNFCPPNFALPNDNGG  431
            N AALSTALFN GLSCGACFEI+C+   + + C  G PSI+VTATNFCPPNFA P+DNGG
Sbjct  68   NTAALSTALFNNGLSCGACFEIRCDMAQDGKWCNPGTPSILVTATNFCPPNFAQPSDNGG  127

Query  432  WCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            WCNPPR HFDLAMPMFLKIA YRAGIVPVN+RR+PCRK
Sbjct  128  WCNPPRTHFDLAMPMFLKIAQYRAGIVPVNYRRIPCRK  165



>gb|KJB36710.1| hypothetical protein B456_006G172400 [Gossypium raimondii]
Length=264

 Score =   262 bits (670),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 137/159 (86%), Gaps = 2/159 (1%)
 Frame = +3

Query  75   ALRVFCIA-LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQG  251
            +L V C A L  FL  V ARIPGVYT G W+ AHATFYGG+DASGTM GACGYGNLY+QG
Sbjct  9    SLSVLCFASLLSFLAVVNARIPGVYTGGAWESAHATFYGGSDASGTMGGACGYGNLYSQG  68

Query  252  YGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNG  428
            YGVN AALSTALFN GLSCG CFEIKC ND R C +G+PSI++TATNFCPPN+ALPNDNG
Sbjct  69   YGVNTAALSTALFNNGLSCGGCFEIKCANDPRWCHSGSPSIIITATNFCPPNYALPNDNG  128

Query  429  GWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            GWCNPPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  129  GWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  167



>ref|XP_004249634.1| PREDICTED: expansin-A3 [Solanum lycopersicum]
Length=259

 Score =   262 bits (669),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 136/162 (84%), Gaps = 3/162 (2%)
 Frame = +3

Query  69   MAALRVFCIA-LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYT  245
            MA     CIA L CFLT V A+I GVYT GPW  AHATFYGGADASGTM GACGYGNLY+
Sbjct  1    MAVNWALCIATLLCFLTVVNAKIAGVYTGGPWTSAHATFYGGADASGTMGGACGYGNLYS  60

Query  246  QGYGVNNAALSTALFNTGLSCGACFEIKCNNDRS--CLAGNPSIVVTATNFCPPNFALPN  419
            QGYGVNNAALSTALFN GLSCGACFEIKC + +   C  GNPSI+VT TNFCPPN+ALPN
Sbjct  61   QGYGVNNAALSTALFNNGLSCGACFEIKCTDSKKEYCNPGNPSILVTGTNFCPPNYALPN  120

Query  420  DNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            DNGGWCNPPR HFDLAMPMFLKIA YRAGIV VN+RRVPCRK
Sbjct  121  DNGGWCNPPRPHFDLAMPMFLKIAVYRAGIVAVNYRRVPCRK  162



>gb|KHG15821.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=264

 Score =   262 bits (670),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 138/159 (87%), Gaps = 2/159 (1%)
 Frame = +3

Query  75   ALRVFCIA-LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQG  251
            +L V C A L  FL  V ARIPGV+T G W+ AHATFYGG+DASGTM GACGYGNLY+QG
Sbjct  9    SLSVLCFASLLSFLAVVNARIPGVFTGGAWESAHATFYGGSDASGTMGGACGYGNLYSQG  68

Query  252  YGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNG  428
            YGVN AALSTALFN GLSCGACFEIKC ND R C +G+PSI++TATNFCPPN+ALPNDNG
Sbjct  69   YGVNTAALSTALFNNGLSCGACFEIKCANDPRWCHSGSPSIIITATNFCPPNYALPNDNG  128

Query  429  GWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            GWCNPPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  129  GWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  167



>ref|XP_003537990.1| PREDICTED: expansin-A4-like [Glycine max]
Length=259

 Score =   261 bits (668),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 136/156 (87%), Gaps = 2/156 (1%)
 Frame = +3

Query  84   VFCIALFCFLT-AVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGV  260
            V CIA    LT AV ARIPG+Y+ G WQ AHATFYGG+DASGTM GACGYGNLY+QGYGV
Sbjct  7    VLCIAFIITLTWAVEARIPGIYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGV  66

Query  261  NNAALSTALFNTGLSCGACFEIKCNNDRS-CLAGNPSIVVTATNFCPPNFALPNDNGGWC  437
            N AALSTALFN+GLSCGACFEIKC NDR  C +G+PSI +TATNFCPPNFALPNDNGGWC
Sbjct  67   NTAALSTALFNSGLSCGACFEIKCANDRQWCHSGSPSIFITATNFCPPNFALPNDNGGWC  126

Query  438  NPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            NPPR HFDLAMPMFLKIA YRAGIVPV +RRVPCRK
Sbjct  127  NPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRK  162



>ref|XP_002315218.1| alpha-expansin 9 precursor family protein [Populus trichocarpa]
 gb|EEF01389.1| alpha-expansin 9 precursor family protein [Populus trichocarpa]
Length=258

 Score =   261 bits (667),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 139/161 (86%), Gaps = 2/161 (1%)
 Frame = +3

Query  69   MAALRVFCIA-LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYT  245
            MA     C+A L  FLT V ARIPGVYT G WQ AHATFYGG+DASGTM GACGYGNLY+
Sbjct  1    MAIRATICVASLVLFLTLVEARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  246  QGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPND  422
            QGYGVN AALSTALFN GLSCGACFEIKC ND + C +G+PSI++TATNFCPPN+ALP+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCGNDPQWCHSGSPSILITATNFCPPNYALPSD  120

Query  423  NGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            NGGWCNPPR HFDLAMP+FLKIA YRAGIVPV++RRVPCRK
Sbjct  121  NGGWCNPPRPHFDLAMPVFLKIAEYRAGIVPVSYRRVPCRK  161



>gb|EYU41729.1| hypothetical protein MIMGU_mgv1a012073mg [Erythranthe guttata]
Length=262

 Score =   261 bits (667),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 138/158 (87%), Gaps = 4/158 (3%)
 Frame = +3

Query  84   VFCIA-LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGV  260
            + C A + CFLT+ +ARIPGVY  GPW+ AHATFYGG+DASGTM GACGYGNLY+QGYGV
Sbjct  8    LLCFATVLCFLTSAQARIPGVYAGGPWETAHATFYGGSDASGTMGGACGYGNLYSQGYGV  67

Query  261  NNAALSTALFNTGLSCGACFEIKCN---NDRSCLAGNPSIVVTATNFCPPNFALPNDNGG  431
            N AALSTALFN GLSCGACFEIKC+   + + C  G+PSI+VTATNFCPPNFALPNDNGG
Sbjct  68   NTAALSTALFNNGLSCGACFEIKCDAAQDSKWCNPGSPSILVTATNFCPPNFALPNDNGG  127

Query  432  WCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            WCNPPR HFDLAMPMFLKIA YRAGIVPVNFRR+PCRK
Sbjct  128  WCNPPRTHFDLAMPMFLKIAQYRAGIVPVNFRRIPCRK  165



>gb|AAR82850.1| expansin-2 [Petunia x hybrida]
Length=262

 Score =   261 bits (667),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 136/163 (83%), Gaps = 3/163 (2%)
 Frame = +3

Query  66   EMAALRVFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYT  245
             M  +  + +AL   ++ V ARIPGVY+ G WQ AHATFYGG+DASGTM GACGYGNLY+
Sbjct  3    SMGVMATYILALLFLISLVEARIPGVYSGGSWQTAHATFYGGSDASGTMGGACGYGNLYS  62

Query  246  QGYGVNNAALSTALFNTGLSCGACFEIKCNND---RSCLAGNPSIVVTATNFCPPNFALP  416
            QGYGVN AALSTALFN GLSCGACFE+KC ND   + CL GNPSI++TATNFCPPN+A P
Sbjct  63   QGYGVNTAALSTALFNNGLSCGACFELKCTNDPHWKWCLPGNPSILITATNFCPPNYAKP  122

Query  417  NDNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            NDNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV +RRVPCRK
Sbjct  123  NDNGGWCNPPRSHFDLAMPMFLKIAEYRAGIVPVTYRRVPCRK  165



>ref|XP_002533097.1| Alpha-expansin 4 precursor, putative [Ricinus communis]
 gb|EEF29289.1| Alpha-expansin 4 precursor, putative [Ricinus communis]
Length=259

 Score =   261 bits (666),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 137/162 (85%), Gaps = 1/162 (1%)
 Frame = +3

Query  63   MEMAALRVFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLY  242
            M+M ++    I L   + A  ARIPGVYT G WQ AHATFYGG+DASGTM GACGYGNLY
Sbjct  1    MKMGSVISGVILLVMLMGASEARIPGVYTGGSWQSAHATFYGGSDASGTMGGACGYGNLY  60

Query  243  TQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPN  419
            +QGYGVN AALSTALFN GLSCGACFEIKC ND + C +G+PSI++TATNFCPPNFALPN
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGACFEIKCANDPKWCHSGSPSILITATNFCPPNFALPN  120

Query  420  DNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV +RRVPCRK
Sbjct  121  DNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRK  162



>ref|XP_004249536.1| PREDICTED: expansin-A6-like [Solanum lycopersicum]
Length=257

 Score =   261 bits (666),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 138/160 (86%), Gaps = 1/160 (1%)
 Frame = +3

Query  69   MAALRVFCIA-LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYT  245
            MA   +FCIA L  FLT V +++ GVYT+GPWQ AHATFYGG+DASGTM GACGYGNLY+
Sbjct  1    MAITWMFCIASLLSFLTIVESKVRGVYTAGPWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  246  QGYGVNNAALSTALFNTGLSCGACFEIKCNNDRSCLAGNPSIVVTATNFCPPNFALPNDN  425
             GYGVNNAALST LFN+GLSCGACFEIKC +++ C  GNPSI VT TNFCPPN+ALPNDN
Sbjct  61   TGYGVNNAALSTVLFNSGLSCGACFEIKCTDEKWCNPGNPSIFVTGTNFCPPNYALPNDN  120

Query  426  GGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            GGWCNPPR HFDL+MP+FL+IA YRAGIVPV +RRVPC+K
Sbjct  121  GGWCNPPRPHFDLSMPVFLQIAQYRAGIVPVTYRRVPCKK  160



>gb|KDP35637.1| hypothetical protein JCGZ_09075 [Jatropha curcas]
Length=258

 Score =   261 bits (666),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 137/161 (85%), Gaps = 2/161 (1%)
 Frame = +3

Query  69   MAALRVFCI-ALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYT  245
            MA L V CI +LF     V ARIPGVYT G W+ AHATFYGG+DASGTM GACGYGNLY+
Sbjct  1    MANLDVLCIISLFSLFWVVNARIPGVYTGGSWESAHATFYGGSDASGTMGGACGYGNLYS  60

Query  246  QGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPND  422
            QGYGVN AALSTALFN GLSCGACFEIKC +D + C  G+PSI +TATNFCPPNFALP+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCADDPKWCNPGSPSIFITATNFCPPNFALPSD  120

Query  423  NGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            NGGWCNPPR HFDLAMPMFLKIA YRAGIVPVNFRR+PCRK
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVNFRRIPCRK  161



>ref|XP_009761115.1| PREDICTED: expansin-A6-like [Nicotiana sylvestris]
Length=260

 Score =   260 bits (665),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 138/163 (85%), Gaps = 4/163 (2%)
 Frame = +3

Query  69   MAALRVFCI---ALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNL  239
            M  L  FCI    +  FL  V ARIPGVY+ G WQ AHATFYGG+DASGTM GACGYGNL
Sbjct  1    MEMLNFFCIFSLIISLFLLTVEARIPGVYSGGSWQTAHATFYGGSDASGTMGGACGYGNL  60

Query  240  YTQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALP  416
            Y+QGYGVNNAALSTALFN GLSCGACFEIKC+N  + C AG+PSI++TATNFCPPN+ALP
Sbjct  61   YSQGYGVNNAALSTALFNNGLSCGACFEIKCDNQPQWCHAGSPSILITATNFCPPNYALP  120

Query  417  NDNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            NDNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV +RRVPCRK
Sbjct  121  NDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVVYRRVPCRK  163



>ref|XP_007027012.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
 gb|EOY07514.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
Length=263

 Score =   261 bits (666),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 136/160 (85%), Gaps = 2/160 (1%)
 Frame = +3

Query  72   AALRVFCIA-LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQ  248
            ++L V C A L  F   V ARIPGVYT G W+ AHATFYGG+DASGTM GACGYGNLY+Q
Sbjct  7    SSLTVLCFASLLSFSVVVNARIPGVYTGGSWESAHATFYGGSDASGTMGGACGYGNLYSQ  66

Query  249  GYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDN  425
            GYGVN AALSTALFN GLSCGACFEIKC ND R C  G+PSI VTATNFCPPN+ALP+DN
Sbjct  67   GYGVNTAALSTALFNNGLSCGACFEIKCANDPRWCHPGSPSIFVTATNFCPPNYALPSDN  126

Query  426  GGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            GGWCNPPR HFDLAMPMFLKIA YRAGIVPV+FRRVPCRK
Sbjct  127  GGWCNPPRSHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRK  166



>ref|XP_009341751.1| PREDICTED: expansin-A4-like [Pyrus x bretschneideri]
Length=258

 Score =   260 bits (665),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 138/161 (86%), Gaps = 2/161 (1%)
 Frame = +3

Query  69   MAALRVFCIA-LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYT  245
            MA+LRV  IA +     A  ARIPGVYT GPW+GAHATFYGG DASGTM GACGYGNLY+
Sbjct  1    MASLRVLYIAFMLSLFMAANARIPGVYTGGPWEGAHATFYGGNDASGTMGGACGYGNLYS  60

Query  246  QGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPND  422
            QGYGVN AALSTALFN GLSCGACFE+KC +D R C  GNPSI+VTATNFCPPNFA P+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFELKCGDDPRWCHPGNPSILVTATNFCPPNFAQPSD  120

Query  423  NGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            +GGWCNPPR HFDLAMPMFLKIA Y+AGIVPV++RRVPCRK
Sbjct  121  DGGWCNPPRTHFDLAMPMFLKIAEYKAGIVPVSYRRVPCRK  161



>gb|KHN21950.1| Expansin-A4 [Glycine soja]
Length=299

 Score =   262 bits (669),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 136/156 (87%), Gaps = 2/156 (1%)
 Frame = +3

Query  84   VFCIALFCFLT-AVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGV  260
            V CIA    LT AV ARIPG+Y+ G WQ AHATFYGG+DASGTM GACGYGNLY+QGYGV
Sbjct  7    VLCIAFIITLTWAVEARIPGIYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGV  66

Query  261  NNAALSTALFNTGLSCGACFEIKCNNDRS-CLAGNPSIVVTATNFCPPNFALPNDNGGWC  437
            N AALSTALFN+GLSCGACFEIKC NDR  C +G+PSI +TATNFCPPNFALPNDNGGWC
Sbjct  67   NTAALSTALFNSGLSCGACFEIKCANDRQWCHSGSPSIFITATNFCPPNFALPNDNGGWC  126

Query  438  NPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            NPPR HFDLAMPMFLKIA YRAGIVPV +RRVPCRK
Sbjct  127  NPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRK  162



>ref|XP_009787901.1| PREDICTED: expansin-A3-like [Nicotiana sylvestris]
Length=293

 Score =   261 bits (668),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 134/155 (86%), Gaps = 1/155 (1%)
 Frame = +3

Query  84   VFCIA-LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGV  260
              CIA + CFLT+V A+I G Y  GPW  AHATFYGG+DASGTM GACGYGNLY+QGYGV
Sbjct  7    TLCIASVLCFLTSVNAKISGNYAGGPWTTAHATFYGGSDASGTMGGACGYGNLYSQGYGV  66

Query  261  NNAALSTALFNTGLSCGACFEIKCNNDRSCLAGNPSIVVTATNFCPPNFALPNDNGGWCN  440
            NNAALST LFN GLSCGACFE+KC + + C  GNPSI+VTATNFCPPN+ALPNDNGGWCN
Sbjct  67   NNAALSTVLFNNGLSCGACFELKCTDQKWCTPGNPSILVTATNFCPPNYALPNDNGGWCN  126

Query  441  PPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            PPR HFDLAMPMFLKIA YRAGIVPVN+RRVPCRK
Sbjct  127  PPRPHFDLAMPMFLKIAEYRAGIVPVNYRRVPCRK  161



>ref|XP_008464122.1| PREDICTED: expansin-A4 [Cucumis melo]
Length=258

 Score =   260 bits (665),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 137/161 (85%), Gaps = 2/161 (1%)
 Frame = +3

Query  69   MAALRVFCIALF-CFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYT  245
            MA     CIAL   F   + ARIPGVY+ GPWQ AHATFYGGADASGTM GACGYGNLY+
Sbjct  1    MATPISLCIALLLSFSLLIDARIPGVYSGGPWQSAHATFYGGADASGTMGGACGYGNLYS  60

Query  246  QGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPND  422
            QGYGVN AALSTALFN G SCGACFEIKC ND R C +G+PSI++TATNFCPPN+ALPND
Sbjct  61   QGYGVNTAALSTALFNKGQSCGACFEIKCANDPRWCHSGSPSILITATNFCPPNYALPND  120

Query  423  NGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            NGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  121  NGGWCNPPRSHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  161



>ref|XP_008387765.1| PREDICTED: expansin-A4-like [Malus domestica]
Length=258

 Score =   260 bits (665),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 137/161 (85%), Gaps = 2/161 (1%)
 Frame = +3

Query  69   MAALRVFCIA-LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYT  245
            MA LR+ CIA L     A  ARIPGVYT G W+GAHATFYGG+DASGTM GACGYGNLY+
Sbjct  1    MAFLRMLCIASLLSLFMAABARIPGVYTGGAWEGAHATFYGGSDASGTMGGACGYGNLYS  60

Query  246  QGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPND  422
            QGYGVN AALSTALFN GLSCGACFEIKC +D R C  GNPSI VTATNFCPPNFA P+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCGDDPRWCHPGNPSIFVTATNFCPPNFAQPSD  120

Query  423  NGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            +GGWCNPPR HFDLAMPMFLKIA Y+AGIVPV++RRVPCRK
Sbjct  121  DGGWCNPPRTHFDLAMPMFLKIAEYKAGIVPVSYRRVPCRK  161



>gb|AHL25255.1| expansin [Boehmeria nivea]
Length=260

 Score =   260 bits (664),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 139/159 (87%), Gaps = 2/159 (1%)
 Frame = +3

Query  72   AALRVFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQG  251
            AA ++ C+     L A  ARIPGVY+ G WQ AHATFYGG+DASGTM GACGYGNLY+QG
Sbjct  6    AAWKIACLVSLMTL-ATEARIPGVYSGGSWQTAHATFYGGSDASGTMGGACGYGNLYSQG  64

Query  252  YGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNG  428
            YGVN AALSTALFN+GLSCGACFE+KC ND +SC +G+PSI+VTATNFCPPN+ALPND+G
Sbjct  65   YGVNTAALSTALFNSGLSCGACFELKCANDPKSCHSGSPSIIVTATNFCPPNYALPNDHG  124

Query  429  GWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            GWCNPPR HFDLAMPMFLKIA YRAGIVPV+FRRVPCRK
Sbjct  125  GWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRK  163



>emb|CAH18933.1| expansin [Pyrus communis]
Length=258

 Score =   260 bits (664),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 137/161 (85%), Gaps = 2/161 (1%)
 Frame = +3

Query  69   MAALRVFCIA-LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYT  245
            MA+LRV  IA +        ARIPGVYT GPW+GAHATFYGG DASGTM GACGYGNLY+
Sbjct  1    MASLRVLYIAFMLSLFMEANARIPGVYTGGPWEGAHATFYGGNDASGTMGGACGYGNLYS  60

Query  246  QGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPND  422
            QGYGVN AALSTALFN GLSCGACFEIKC +D R C  GNPSI+VTATNFCPPNFA P+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCGDDPRWCHPGNPSILVTATNFCPPNFAQPSD  120

Query  423  NGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            +GGWCNPPR HFDLAMPMFLKIA Y+AGIVPV++RRVPCRK
Sbjct  121  DGGWCNPPRTHFDLAMPMFLKIAEYKAGIVPVSYRRVPCRK  161



>gb|AIE54285.1| expansin [Nicotiana tabacum]
Length=257

 Score =   259 bits (663),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 134/160 (84%), Gaps = 1/160 (1%)
 Frame = +3

Query  69   MAALRVFCIA-LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYT  245
            MA +   CIA L  FLT   A++PGVYTSGPW+ AHATFYGGADASGTM GACGYGNLY+
Sbjct  1    MAIIWTLCIASLLSFLTGANAKVPGVYTSGPWESAHATFYGGADASGTMGGACGYGNLYS  60

Query  246  QGYGVNNAALSTALFNTGLSCGACFEIKCNNDRSCLAGNPSIVVTATNFCPPNFALPNDN  425
             GYGVNNAALSTALFN GLSCGACFEI+C + + C  GNPSI VT TNFCPPN+ALPNDN
Sbjct  61   AGYGVNNAALSTALFNNGLSCGACFEIRCTDPKWCTPGNPSIFVTGTNFCPPNYALPNDN  120

Query  426  GGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            GGWCNPPR HFDLA PMFLK A YRAGIVPV +RRVPC+K
Sbjct  121  GGWCNPPRPHFDLAEPMFLKFAQYRAGIVPVTYRRVPCKK  160



>ref|XP_009610453.1| PREDICTED: expansin-A3-like [Nicotiana tomentosiformis]
Length=257

 Score =   259 bits (663),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 134/160 (84%), Gaps = 1/160 (1%)
 Frame = +3

Query  69   MAALRVFCIA-LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYT  245
            MA +   CIA L  FLT   A++PGVYTSGPW+ AHATFYGGADASGTM GACGYGNLY+
Sbjct  1    MAIIWTLCIASLLSFLTGANAKVPGVYTSGPWESAHATFYGGADASGTMGGACGYGNLYS  60

Query  246  QGYGVNNAALSTALFNTGLSCGACFEIKCNNDRSCLAGNPSIVVTATNFCPPNFALPNDN  425
             GYGVNNAALSTALFN GLSCGACFEI+C + + C  GNPSI VT TNFCPPN+ALPNDN
Sbjct  61   AGYGVNNAALSTALFNNGLSCGACFEIRCTDPKWCTPGNPSIFVTGTNFCPPNYALPNDN  120

Query  426  GGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            GGWCNPPR HFDLA PMFLK A YRAGIVPV +RRVPC+K
Sbjct  121  GGWCNPPRPHFDLAEPMFLKFAQYRAGIVPVTYRRVPCKK  160



>ref|XP_007205748.1| hypothetical protein PRUPE_ppa010226mg [Prunus persica]
 gb|EMJ06947.1| hypothetical protein PRUPE_ppa010226mg [Prunus persica]
Length=258

 Score =   259 bits (663),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 138/161 (86%), Gaps = 2/161 (1%)
 Frame = +3

Query  69   MAALRVFCIA-LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYT  245
            MA + + CIA L     A  ARIPGVYT GPW+GAHATFYGG+DASGTM GACGYGNLY+
Sbjct  1    MAFVHMLCIASLLSLFMAANARIPGVYTGGPWEGAHATFYGGSDASGTMGGACGYGNLYS  60

Query  246  QGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPND  422
            +GYGVN AALSTALFN GLSCGACFEIKC +D + C  GNPSI +TATNFCPPN+ALPND
Sbjct  61   EGYGVNTAALSTALFNNGLSCGACFEIKCGDDPKWCHPGNPSIFITATNFCPPNYALPND  120

Query  423  NGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            +GGWCNPPR HFDLAMPMFL+IA Y+AGIVPV+FRRVPCRK
Sbjct  121  DGGWCNPPRTHFDLAMPMFLQIAEYKAGIVPVSFRRVPCRK  161



>gb|KCW65541.1| hypothetical protein EUGRSUZ_G02938 [Eucalyptus grandis]
Length=259

 Score =   259 bits (663),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/162 (77%), Positives = 137/162 (85%), Gaps = 1/162 (1%)
 Frame = +3

Query  63   MEMAALRVFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLY  242
            M   +  V  ++L  F T   ARIPGVYT GPWQ AHATFYGG+DASGTM GACGYGNLY
Sbjct  1    MASVSRVVGLVSLILFSTLAEARIPGVYTGGPWQSAHATFYGGSDASGTMGGACGYGNLY  60

Query  243  TQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPN  419
            +QGYGVN AALSTALFN G SCGACFEIKC N+ + C +G+PSI+VTATNFCPPN+ALPN
Sbjct  61   SQGYGVNTAALSTALFNNGFSCGACFEIKCANEPQWCHSGSPSILVTATNFCPPNYALPN  120

Query  420  DNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  121  DNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  162



>gb|ABO32367.1| expansin [Litchi chinensis]
Length=256

 Score =   259 bits (663),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 136/160 (85%), Gaps = 2/160 (1%)
 Frame = +3

Query  69   MAALRVFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQ  248
            MA   V C     FLTA  A+IPGVYT GPW+ AHATFYGG+DASGTM GACGYGNLY+Q
Sbjct  1    MAVFNVLCFLSLLFLTA-NAKIPGVYTGGPWESAHATFYGGSDASGTMGGACGYGNLYSQ  59

Query  249  GYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDN  425
            GYGVN AALSTALFN GLSCGACFE+KC  D R CL GNPSI+VTATNFCPPNFA P+D+
Sbjct  60   GYGVNTAALSTALFNNGLSCGACFELKCVADPRWCLPGNPSILVTATNFCPPNFAQPSDD  119

Query  426  GGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            GGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  120  GGWCNPPRTHFDLAMPMFLKIAQYRAGIVPVSYRRVPCRK  159



>ref|XP_011094866.1| PREDICTED: expansin-A6 [Sesamum indicum]
Length=262

 Score =   259 bits (662),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 142/164 (87%), Gaps = 5/164 (3%)
 Frame = +3

Query  69   MAALRVF-CIA-LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLY  242
            +AA+++  CI+ + CFLT   ARIPGVY+ GPWQ AHATFYGG+DASGTM GACGYGNLY
Sbjct  2    LAAMKLLLCISSILCFLTCSDARIPGVYSGGPWQSAHATFYGGSDASGTMGGACGYGNLY  61

Query  243  TQGYGVNNAALSTALFNTGLSCGACFEIKCN---NDRSCLAGNPSIVVTATNFCPPNFAL  413
            +QGYGVN AALSTALFN GLSCGACFEIKC+   + + C  G+PSI+VTATNFCPPN+AL
Sbjct  62   SQGYGVNTAALSTALFNNGLSCGACFEIKCDAAQDPKWCNPGSPSILVTATNFCPPNYAL  121

Query  414  PNDNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            PNDNGGWCNPPR HFDLAMPMFLKIA Y AGIVPVNFRR+PCRK
Sbjct  122  PNDNGGWCNPPREHFDLAMPMFLKIAQYSAGIVPVNFRRIPCRK  165



>ref|XP_003552173.1| PREDICTED: expansin-A4 [Glycine max]
Length=258

 Score =   259 bits (662),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 136/161 (84%), Gaps = 2/161 (1%)
 Frame = +3

Query  69   MAALRVFCIA-LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYT  245
            MAA+    IA L     A  ARIPGVYT GPWQ AHATFYGG+DASGTM GACGYGNLY+
Sbjct  1    MAAIVFLHIASLASLFVATSARIPGVYTGGPWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  246  QGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPND  422
            QGYGVN AALSTALFN GLSCGACFEIKC+ D R C  G+PSI++TATNFCPPNFALPND
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCDQDPRWCNPGSPSILITATNFCPPNFALPND  120

Query  423  NGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            NGGWCNPPR HFDLAMPMFLKIA YRAGIVPV +RRVPCRK
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAQYRAGIVPVAYRRVPCRK  161



>ref|XP_006349505.1| PREDICTED: expansin-A3-like [Solanum tuberosum]
Length=259

 Score =   259 bits (662),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 136/162 (84%), Gaps = 3/162 (2%)
 Frame = +3

Query  69   MAALRVFCIA-LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYT  245
            MA     CIA L CFLT V A+I GVYT G W  AHATFYGGADASGTM GACGYGNLY+
Sbjct  1    MAVNWALCIASLLCFLTVVNAKIVGVYTGGSWTSAHATFYGGADASGTMGGACGYGNLYS  60

Query  246  QGYGVNNAALSTALFNTGLSCGACFEIKCNNDRS--CLAGNPSIVVTATNFCPPNFALPN  419
            QGYGVNNAALSTALFN+GLSCG+CFEIKC + +   C  GNPSI+VT TNFCPPN+ALPN
Sbjct  61   QGYGVNNAALSTALFNSGLSCGSCFEIKCTDSKKEYCNPGNPSILVTGTNFCPPNYALPN  120

Query  420  DNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            DNGGWCNPPR HFDLAMPMFLKIA YRAGIV VN+RRVPCRK
Sbjct  121  DNGGWCNPPRPHFDLAMPMFLKIAVYRAGIVAVNYRRVPCRK  162



>dbj|BAC67193.1| expansin [Pyrus communis]
Length=258

 Score =   259 bits (661),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 137/161 (85%), Gaps = 2/161 (1%)
 Frame = +3

Query  69   MAALRVFCIA-LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYT  245
            MA+LRV  IA +     A  ARIPGVYT G W+GAHATFYGG DASGTM GACGYGNLY+
Sbjct  1    MASLRVLYIAFMLSLFMAANARIPGVYTGGSWEGAHATFYGGNDASGTMGGACGYGNLYS  60

Query  246  QGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPND  422
            QGYGVN AALSTALFN GLSCGACFEIKC +D R C  GNPSI+VTATNFCPPNFA P+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCGDDPRWCHPGNPSILVTATNFCPPNFAQPSD  120

Query  423  NGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            +GGWCNPPR HFDLAMPMFLKIA Y+AGIVPV++RRVPCRK
Sbjct  121  DGGWCNPPRTHFDLAMPMFLKIAEYKAGIVPVSYRRVPCRK  161



>ref|XP_008233635.1| PREDICTED: expansin-A4-like [Prunus mume]
Length=259

 Score =   258 bits (660),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 137/162 (85%), Gaps = 3/162 (2%)
 Frame = +3

Query  69   MAALRVFCIALFCFL--TAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLY  242
            MA + + CI     L  T V ARIPGVY+ G WQGAHATFYGG+DASGTM GACGYGNLY
Sbjct  1    MATMTLLCIVSLIALASTIVEARIPGVYSGGAWQGAHATFYGGSDASGTMGGACGYGNLY  60

Query  243  TQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPN  419
            +QGYGVN AALSTALFN GLSCGACFEIKC N  + C +G+PSI VTATNFCPPN+ALPN
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGACFEIKCANQPQWCHSGSPSIFVTATNFCPPNYALPN  120

Query  420  DNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  121  DNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  162



>ref|XP_006339024.1| PREDICTED: expansin-A3-like [Solanum tuberosum]
Length=257

 Score =   258 bits (660),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 137/160 (86%), Gaps = 1/160 (1%)
 Frame = +3

Query  69   MAALRVFCIA-LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYT  245
            MA   + CIA L  FLT V +++ GVYT+GPWQ AHATFYGG+DASGTM GACGYGNLY+
Sbjct  1    MAITWMLCIASLLSFLTTVDSKVRGVYTAGPWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  246  QGYGVNNAALSTALFNTGLSCGACFEIKCNNDRSCLAGNPSIVVTATNFCPPNFALPNDN  425
             GYGVNNAALST LFN+GLSCGACFEIKC +++ C  GNPSI VT TNFCPPN+ALPNDN
Sbjct  61   TGYGVNNAALSTVLFNSGLSCGACFEIKCTDEKWCNPGNPSIFVTGTNFCPPNYALPNDN  120

Query  426  GGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            GGWCNPPR HFDL+MP+FL+IA YRAGIVPV +RRVPC+K
Sbjct  121  GGWCNPPRPHFDLSMPVFLQIAQYRAGIVPVTYRRVPCKK  160



>ref|XP_010067412.1| PREDICTED: expansin-A4 [Eucalyptus grandis]
Length=307

 Score =   260 bits (664),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 138/164 (84%), Gaps = 1/164 (1%)
 Frame = +3

Query  57   KFMEMAALRVFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGN  236
            K M   +  V  ++L  F T   ARIPGVYT GPWQ AHATFYGG+DASGTM GACGYGN
Sbjct  47   KPMASVSRVVGLVSLILFSTLAEARIPGVYTGGPWQSAHATFYGGSDASGTMGGACGYGN  106

Query  237  LYTQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFAL  413
            LY+QGYGVN AALSTALFN G SCGACFEIKC N+ + C +G+PSI+VTATNFCPPN+AL
Sbjct  107  LYSQGYGVNTAALSTALFNNGFSCGACFEIKCANEPQWCHSGSPSILVTATNFCPPNYAL  166

Query  414  PNDNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            PNDNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  167  PNDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  210



>gb|AFB77223.1| expansin 1 [Betula platyphylla]
Length=258

 Score =   258 bits (659),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 140/161 (87%), Gaps = 2/161 (1%)
 Frame = +3

Query  69   MAALRVFCI-ALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYT  245
            MAAL V CI +L   LT V A+IPGVY+ G WQ AHATFYGG DASGTM GACGYGNLY+
Sbjct  1    MAALCVACIVSLMALLTLVDAKIPGVYSGGAWQSAHATFYGGNDASGTMGGACGYGNLYS  60

Query  246  QGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPND  422
            QGYGVN AALSTALFN GLSCGACFEIKC N+ + C +G+PSI++TATNFCPPN+ALP+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCANEPQWCHSGSPSILITATNFCPPNYALPSD  120

Query  423  NGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            NGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  161



>gb|ACK36943.1| expansin [Annona cherimola]
Length=259

 Score =   258 bits (659),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 136/162 (84%), Gaps = 1/162 (1%)
 Frame = +3

Query  63   MEMAALRVFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLY  242
            M    +R F  +L   L+ V ARIPGVYT G WQ AHATFYGG+DASGTM GACGYGNLY
Sbjct  1    MATVGIRTFVASLILCLSLVEARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLY  60

Query  243  TQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPN  419
            +QGYGVN A LSTA FN GLSCGACFEIKC +D + C +G+PSI++TATNFCPPN+ALP+
Sbjct  61   SQGYGVNTAVLSTAFFNNGLSCGACFEIKCADDPKWCHSGSPSILITATNFCPPNYALPS  120

Query  420  DNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV+FRRVPCRK
Sbjct  121  DNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRK  162



>ref|NP_001242978.1| expansin-A4-like precursor [Glycine max]
 gb|AEV43316.1| expansin A5a [Glycine max]
Length=259

 Score =   258 bits (659),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 126/156 (81%), Positives = 136/156 (87%), Gaps = 2/156 (1%)
 Frame = +3

Query  84   VFCIALFCFLT-AVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGV  260
            V CI     LT  V+ARIPGVY++G WQ AHATFYGG+DASGTM GACGYGNLY+QGYGV
Sbjct  7    VLCIFFIISLTCMVQARIPGVYSAGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGV  66

Query  261  NNAALSTALFNTGLSCGACFEIKCNNDRS-CLAGNPSIVVTATNFCPPNFALPNDNGGWC  437
            N AALSTALFN+GLSCGACFEIKC NDR  C +G+PSI +TATNFCPPNFALPNDNGGWC
Sbjct  67   NTAALSTALFNSGLSCGACFEIKCANDRQWCHSGSPSIFITATNFCPPNFALPNDNGGWC  126

Query  438  NPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            NPPR HFDLAMPMFLKIA YRAGIVPV +RRVPCRK
Sbjct  127  NPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRK  162



>gb|KHG12430.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=264

 Score =   258 bits (659),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 136/160 (85%), Gaps = 2/160 (1%)
 Frame = +3

Query  72   AALRVFCIA-LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQ  248
            ++L + C A L C    V ARIPGVYT G W+ AHATFYGG+DASGTM GACGYGNLY+Q
Sbjct  8    SSLTLLCFASLMCLFGMVNARIPGVYTGGSWESAHATFYGGSDASGTMGGACGYGNLYSQ  67

Query  249  GYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDN  425
            GYGVN AALSTA+FN GLSCGACFEIKC +D R C  GNPSI +TATNFCPPN+ALP+DN
Sbjct  68   GYGVNTAALSTAIFNNGLSCGACFEIKCTDDPRWCHPGNPSIFITATNFCPPNYALPSDN  127

Query  426  GGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            GGWCNPPR HFDLAMPMFLKIA YRAGIVPV+FRRVPCRK
Sbjct  128  GGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRK  167



>ref|XP_004143121.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 ref|XP_004166197.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 gb|KGN47143.1| hypothetical protein Csa_6G190340 [Cucumis sativus]
Length=258

 Score =   258 bits (658),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 136/161 (84%), Gaps = 2/161 (1%)
 Frame = +3

Query  69   MAALRVFCI-ALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYT  245
            MA     CI  L  F   + ARIPGVY+ GPWQ AHATFYGG+DASGTM GACGYGNLY+
Sbjct  1    MATPFSLCIPLLLSFSLLIEARIPGVYSGGPWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  246  QGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPND  422
            QGYGVN AALSTALFN G SCGACFEIKC ND R C +G+PSI++TATNFCPPN+ALPND
Sbjct  61   QGYGVNTAALSTALFNKGQSCGACFEIKCANDPRWCHSGSPSILITATNFCPPNYALPND  120

Query  423  NGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            NGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  121  NGGWCNPPRSHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  161



>ref|NP_001236550.1| expansin precursor [Glycine max]
 gb|AAO15999.1|AF516880_1 expansin [Glycine max]
Length=258

 Score =   257 bits (657),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 134/161 (83%), Gaps = 2/161 (1%)
 Frame = +3

Query  69   MAALRVFCIA-LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYT  245
            MAA+    IA L     A  ARIPGVYT GPWQ AHATFYG +DASGTM G CGYGNLY+
Sbjct  1    MAAIVFIHIASLVSLFVATSARIPGVYTGGPWQSAHATFYGASDASGTMGGRCGYGNLYS  60

Query  246  QGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPND  422
            QGYGVN AALSTALFN GLSCGACFEIKC+ D R C  GNPSI++TATNFCPPNFALPND
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCDQDPRWCNPGNPSILITATNFCPPNFALPND  120

Query  423  NGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            NGGWCNPPR HFDLAMPMFLKIA YRAGIVPV +RRVPCRK
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAQYRAGIVPVAYRRVPCRK  161



>ref|XP_007218834.1| hypothetical protein PRUPE_ppa010198mg [Prunus persica]
 gb|EMJ20033.1| hypothetical protein PRUPE_ppa010198mg [Prunus persica]
Length=259

 Score =   257 bits (657),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 136/162 (84%), Gaps = 3/162 (2%)
 Frame = +3

Query  69   MAALRVFCIALFCFL--TAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLY  242
            MA + + CI     L  T V ARIPGVY+   WQGAHATFYGG+DASGTM GACGYGNLY
Sbjct  1    MATMALLCIVSLIALASTIVEARIPGVYSGEAWQGAHATFYGGSDASGTMGGACGYGNLY  60

Query  243  TQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPN  419
            +QGYGVN AALSTALFN GLSCGACFEIKC N  + C +G+PSI VTATNFCPPN+ALPN
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGACFEIKCANQPQWCHSGSPSIFVTATNFCPPNYALPN  120

Query  420  DNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  121  DNGGWCNPPRSHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  162



>gb|KJB76740.1| hypothetical protein B456_012G104400 [Gossypium raimondii]
Length=264

 Score =   258 bits (658),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 136/160 (85%), Gaps = 2/160 (1%)
 Frame = +3

Query  72   AALRVFCIA-LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQ  248
            ++L + C A L C    V ARIPGVYT G W+ AHATFYGG+DASGTM GACGYGNLY+Q
Sbjct  8    SSLTLLCFASLMCLFGMVNARIPGVYTGGSWESAHATFYGGSDASGTMGGACGYGNLYSQ  67

Query  249  GYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDN  425
            GYGVN AALSTALFN GLSCGACFEIKC +D R C  GNPSI +TATNFCPPN+ALP+DN
Sbjct  68   GYGVNTAALSTALFNNGLSCGACFEIKCTDDPRWCHPGNPSIFITATNFCPPNYALPSDN  127

Query  426  GGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            GGWCNPPR HFDLAMPMFLK+A YRAGIVPV+FRRVPCRK
Sbjct  128  GGWCNPPRPHFDLAMPMFLKMAEYRAGIVPVSFRRVPCRK  167



>ref|XP_009768238.1| PREDICTED: expansin-A6-like [Nicotiana sylvestris]
Length=257

 Score =   257 bits (656),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 134/160 (84%), Gaps = 1/160 (1%)
 Frame = +3

Query  69   MAALRVFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQ  248
            M  L V  I     + AV  RIPGVY+ G WQ AHATFYGG+DASGTM GACGYGNLY+Q
Sbjct  1    MGFLNVAFIFSLILVAAVEGRIPGVYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQ  60

Query  249  GYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDN  425
            GYGVNN ALSTALFN GLSCGACFEIKC+ D +SC +G+PSI +TATNFCPPNFALPNDN
Sbjct  61   GYGVNNGALSTALFNNGLSCGACFEIKCDKDPQSCHSGSPSIFITATNFCPPNFALPNDN  120

Query  426  GGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            GGWCNPPR HFDLAMPMFLKIA YRAGIVPV +RRVPCRK
Sbjct  121  GGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVVYRRVPCRK  160



>ref|XP_009772489.1| PREDICTED: expansin-A3-like [Nicotiana sylvestris]
Length=257

 Score =   257 bits (656),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 132/160 (83%), Gaps = 1/160 (1%)
 Frame = +3

Query  69   MAALRVFCIA-LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYT  245
            MA +   CIA L   LTA  A++PGVYT GPWQ AHATFYGG DASGTM GACGYGNLY+
Sbjct  1    MAIIWTLCIASLLSLLTAANAKVPGVYTGGPWQSAHATFYGGEDASGTMGGACGYGNLYS  60

Query  246  QGYGVNNAALSTALFNTGLSCGACFEIKCNNDRSCLAGNPSIVVTATNFCPPNFALPNDN  425
             GYGVNNAALSTALFN GLSCGACFEI+C + + C  GNPSI VT TNFCPPN+ALPNDN
Sbjct  61   AGYGVNNAALSTALFNNGLSCGACFEIRCTDPKWCTPGNPSIFVTGTNFCPPNYALPNDN  120

Query  426  GGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            GGWCNPPR HFDLA PMFLK A YRAGIVPV +RRVPC+K
Sbjct  121  GGWCNPPRPHFDLAEPMFLKFAQYRAGIVPVTYRRVPCKK  160



>ref|XP_007133996.1| hypothetical protein PHAVU_010G010200g [Phaseolus vulgaris]
 gb|ESW05990.1| hypothetical protein PHAVU_010G010200g [Phaseolus vulgaris]
Length=258

 Score =   257 bits (656),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 135/161 (84%), Gaps = 2/161 (1%)
 Frame = +3

Query  69   MAALRVFCIALFCFL-TAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYT  245
            MA +   CIA F  L  A  ARIPGVYT G WQGAHATFYGG+DASGTM GACGYGNLY+
Sbjct  1    MAEMLSLCIASFVTLFVATNARIPGVYTGGAWQGAHATFYGGSDASGTMGGACGYGNLYS  60

Query  246  QGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPND  422
            QGYGVN AALSTALFN GLSCGACFEIKC+ D R C  G PSI++TATNFCPPN ALP+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCDQDPRWCNPGRPSIIITATNFCPPNLALPSD  120

Query  423  NGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            NGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RRV CRK
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAQYRAGIVPVSYRRVACRK  161



>dbj|BAH36862.1| alpha expansin [Rosa hybrid cultivar]
Length=258

 Score =   256 bits (655),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 135/161 (84%), Gaps = 2/161 (1%)
 Frame = +3

Query  69   MAALRVFCIA-LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYT  245
            MA+L + CIA L   L    ARIPG YT GPWQ AHATFYGG+DASGTM GACGYGNLY+
Sbjct  1    MASLHLLCIASLASLLILANARIPGPYTGGPWQDAHATFYGGSDASGTMGGACGYGNLYS  60

Query  246  QGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPND  422
            QGYGVN AALSTALFN GLSCGACFEI+C +D R C  G PSI VTATNFCPPNFA P+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIRCGDDPRWCTPGKPSIFVTATNFCPPNFAQPSD  120

Query  423  NGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            NGGWCNPPR HFDLAMPMFLKIA Y+AGIVPV++RRVPCRK
Sbjct  121  NGGWCNPPRTHFDLAMPMFLKIAEYKAGIVPVSYRRVPCRK  161



>gb|AAT11859.2| expansin 1 [Mangifera indica]
Length=260

 Score =   256 bits (655),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 138/163 (85%), Gaps = 2/163 (1%)
 Frame = +3

Query  63   MEMAALRVFCI-ALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNL  239
            M M  L + CI +L C +  V ARIPGVYT G WQ AHATFYGG+DASGTM GACGYGNL
Sbjct  1    MAMVGLSMACILSLRCLMWMVEARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNL  60

Query  240  YTQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALP  416
            Y+QGYGVN AALSTALFN G SCGACFEIKC +D + C +G+PSI +TATNFCPPN+ALP
Sbjct  61   YSQGYGVNTAALSTALFNNGFSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALP  120

Query  417  NDNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            +DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RRVPCR+
Sbjct  121  SDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRE  163



>ref|XP_009597793.1| PREDICTED: expansin-A6-like [Nicotiana tomentosiformis]
Length=260

 Score =   256 bits (654),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 133/155 (86%), Gaps = 1/155 (1%)
 Frame = +3

Query  84   VFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVN  263
            + C+     + AV +RIPGVY+ G WQ AHATFYGG+DASGTM GACGYGNLY+QGYGVN
Sbjct  9    IACVFSLMLVVAVESRIPGVYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVN  68

Query  264  NAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNGGWCN  440
            N ALSTALFN GLSCGACFEIKC+ D + C +G+PSI +TATNFCPPNFALPNDNGGWCN
Sbjct  69   NGALSTALFNNGLSCGACFEIKCDKDPQWCHSGSPSIFITATNFCPPNFALPNDNGGWCN  128

Query  441  PPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            PPR HFDLAMPMFLKIA YRAGIVPV +RRVPCRK
Sbjct  129  PPRSHFDLAMPMFLKIAEYRAGIVPVVYRRVPCRK  163



>gb|KJB16930.1| hypothetical protein B456_002G257400 [Gossypium raimondii]
Length=264

 Score =   256 bits (654),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 131/151 (87%), Gaps = 1/151 (1%)
 Frame = +3

Query  96   ALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVNNAAL  275
            +LF     V ARIPGVYT G W+ AHATFYGG+DASGTM GACGYGNLY+QGYGVN AAL
Sbjct  17   SLFSIFVLVNARIPGVYTGGSWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAAL  76

Query  276  STALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNGGWCNPPRL  452
            STALFN GLSCGACFEIKC ND R C  G+PSI +TATNFCPPNFALP+DNGGWCNPPR 
Sbjct  77   STALFNNGLSCGACFEIKCANDPRWCHPGSPSIFITATNFCPPNFALPSDNGGWCNPPRP  136

Query  453  HFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            HFDLAMPMFLKIA YRAGIVPV+FRRVPCRK
Sbjct  137  HFDLAMPMFLKIAEYRAGIVPVSFRRVPCRK  167



>gb|AAM47000.1|AF512542_1 alpha-expansin precursor [Gossypium hirsutum]
Length=264

 Score =   256 bits (654),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 136/159 (86%), Gaps = 2/159 (1%)
 Frame = +3

Query  75   ALRVFCIA-LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQG  251
            +L V C A L  F   V ARIPGV+T G W+ AHATFYGG+DASGTM GACGYGNLY+QG
Sbjct  9    SLSVLCFASLLSFFGWVNARIPGVFTGGAWESAHATFYGGSDASGTMGGACGYGNLYSQG  68

Query  252  YGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNG  428
            YGVN AALS ALFN GLSCGACFEIKC ND R C +G+PSI++TATNFCPPN+ALPNDNG
Sbjct  69   YGVNTAALSPALFNNGLSCGACFEIKCANDPRWCHSGSPSIIITATNFCPPNYALPNDNG  128

Query  429  GWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            GWCNPPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  129  GWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  167



>ref|XP_007016396.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
 gb|EOY34015.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
Length=258

 Score =   256 bits (653),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 136/161 (84%), Gaps = 2/161 (1%)
 Frame = +3

Query  69   MAALRVFCIALF-CFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYT  245
            MA + V C+ LF   +    A+IPGVY+ G WQ AHATFYGG+DASGTM GACGYGNLY+
Sbjct  1    MAVVSVVCVLLFISSMWMAEAKIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYS  60

Query  246  QGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPND  422
            QGYGVN AALSTALFN GLSCGACFEIKC ND + C +G PSI +TATNFCPPN+ALPND
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCANDPKWCHSGGPSIFITATNFCPPNYALPND  120

Query  423  NGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            NGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  161



>ref|XP_003544219.1| PREDICTED: expansin-A6-like [Glycine max]
Length=260

 Score =   256 bits (653),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 132/152 (87%), Gaps = 1/152 (1%)
 Frame = +3

Query  93   IALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVNNAA  272
            + L   L +  AR+PGVY+ G W+ AHATFYGG+DASGTM GACGYGNLY+QGYGVN AA
Sbjct  12   VTLITLLASTEARVPGVYSGGAWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAA  71

Query  273  LSTALFNTGLSCGACFEIKCNNDRS-CLAGNPSIVVTATNFCPPNFALPNDNGGWCNPPR  449
            LSTALFN GLSCGACFEIKC ND S C AG+PSI VTATNFCPPN+ALPNDNGGWCNPPR
Sbjct  72   LSTALFNNGLSCGACFEIKCANDPSWCHAGSPSIFVTATNFCPPNYALPNDNGGWCNPPR  131

Query  450  LHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
             HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  132  PHFDLAMPMFLKIAQYRAGIVPVSYRRVPCRK  163



>ref|XP_004302749.1| PREDICTED: expansin-A6 [Fragaria vesca subsp. vesca]
Length=260

 Score =   256 bits (653),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 134/163 (82%), Gaps = 2/163 (1%)
 Frame = +3

Query  63   MEMAALRVFCIA-LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNL  239
            M    LR+ CIA L   L    ARIPG YT GPWQ AHATFYGG+DASGTM GACGYGNL
Sbjct  1    MASLHLRLLCIASLASLLMVANARIPGPYTGGPWQEAHATFYGGSDASGTMGGACGYGNL  60

Query  240  YTQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALP  416
            Y+QGYGVN AALSTALFN GLSCGACFEIKC +D R C AG PSI VTATNFCPPNFA P
Sbjct  61   YSQGYGVNTAALSTALFNNGLSCGACFEIKCGDDPRWCTAGKPSIFVTATNFCPPNFAQP  120

Query  417  NDNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            +DNGGWCNPPR HFDLAMPMFLKIA Y+AGIVPV++RRVPC K
Sbjct  121  SDNGGWCNPPRTHFDLAMPMFLKIAEYKAGIVPVSYRRVPCVK  163



>gb|KFK36651.1| alpha-expansin 4 [Arabis alpina]
Length=261

 Score =   256 bits (653),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 131/147 (89%), Gaps = 1/147 (1%)
 Frame = +3

Query  108  FLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVNNAALSTAL  287
             LTA  A+IPGVYT GPWQ AHATFYGGADASGTM GACGYGNLY+QGYGVN AALSTAL
Sbjct  18   LLTASNAKIPGVYTGGPWQNAHATFYGGADASGTMGGACGYGNLYSQGYGVNTAALSTAL  77

Query  288  FNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNGGWCNPPRLHFDL  464
            FN GLSCGACFE+KC +D R C+ GNPSI+VTATNFCPPNFA P+D+GGWCNPPR HFDL
Sbjct  78   FNNGLSCGACFEMKCTDDPRWCVPGNPSILVTATNFCPPNFAQPSDDGGWCNPPREHFDL  137

Query  465  AMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            AMPMFLKI  YRAGIVPV++RRVPCRK
Sbjct  138  AMPMFLKIGIYRAGIVPVSYRRVPCRK  164



>ref|XP_009757427.1| PREDICTED: expansin-A4-like [Nicotiana sylvestris]
Length=261

 Score =   256 bits (653),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 132/154 (86%), Gaps = 3/154 (2%)
 Frame = +3

Query  93   IALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVNNAA  272
            + L   ++ V ARIPGVY+ G WQ AHATFYGG+DASGTM GACGYGNLY+QGYGVN AA
Sbjct  11   VGLIFLVSLVEARIPGVYSGGSWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAA  70

Query  273  LSTALFNTGLSCGACFEIKCNND---RSCLAGNPSIVVTATNFCPPNFALPNDNGGWCNP  443
            LSTALFN GLSCGACFEIKC ND   + CL G+PSI++TATNFCPPN+A PNDNGGWCNP
Sbjct  71   LSTALFNNGLSCGACFEIKCTNDPNWKWCLPGSPSILITATNFCPPNYAKPNDNGGWCNP  130

Query  444  PRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            PR HFDLAMPMFLKIA YRAGIVPV +RR+PCRK
Sbjct  131  PRSHFDLAMPMFLKIAEYRAGIVPVTYRRIPCRK  164



>ref|XP_007140533.1| hypothetical protein PHAVU_008G120700g [Phaseolus vulgaris]
 gb|ESW12527.1| hypothetical protein PHAVU_008G120700g [Phaseolus vulgaris]
Length=258

 Score =   255 bits (652),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 134/161 (83%), Gaps = 2/161 (1%)
 Frame = +3

Query  69   MAALRVFCIA-LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYT  245
            MAA+    IA L     +  ARIPGVYT G WQ AHATFYGG+DASGTM GACGYGNLY+
Sbjct  1    MAAIVFLYIASLASLFVSTSARIPGVYTGGSWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  246  QGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPND  422
            QGYGVN AALSTALFN GLSCGACFEIKC+ D R C  GNPSI++TATNFCPPNFALPND
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCDQDPRWCNPGNPSILITATNFCPPNFALPND  120

Query  423  NGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            NGGWCNPPR HFDLAMPMFLKIA YRAGIVPV FRRV CRK
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAQYRAGIVPVAFRRVACRK  161



>gb|KJB46592.1| hypothetical protein B456_007G376300 [Gossypium raimondii]
Length=262

 Score =   256 bits (653),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 141/166 (85%), Gaps = 8/166 (5%)
 Frame = +3

Query  69   MAALRVFCIALFCF------LTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGY  230
            MAA + F +AL CF       T+V A+IPGVY++G W+ AHATFYGG+DASGTM GACGY
Sbjct  1    MAAPK-FSLALLCFTSLLPFFTSVNAKIPGVYSTGSWETAHATFYGGSDASGTMGGACGY  59

Query  231  GNLYTQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNF  407
            GNLY+QGYGVN AALSTALFN GLSCGACFEIKC +D R C  G+PSI VTATNFCPPNF
Sbjct  60   GNLYSQGYGVNTAALSTALFNNGLSCGACFEIKCASDPRWCHPGSPSIFVTATNFCPPNF  119

Query  408  ALPNDNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            ALP+DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV+FRRVPCRK
Sbjct  120  ALPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRK  165



>ref|XP_003519349.1| PREDICTED: expansin-A4-like [Glycine max]
Length=257

 Score =   255 bits (652),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 134/160 (84%), Gaps = 1/160 (1%)
 Frame = +3

Query  69   MAALRVFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQ  248
            M +L      +   LT+  ARIPG Y+ G W+ AHATFYGG+DASGTM GACGYGNLY+Q
Sbjct  1    MPSLIAIVTLIAVVLTSTEARIPGAYSGGAWETAHATFYGGSDASGTMGGACGYGNLYSQ  60

Query  249  GYGVNNAALSTALFNTGLSCGACFEIKCNNDRS-CLAGNPSIVVTATNFCPPNFALPNDN  425
            GYGVN AALSTALFN GLSCGACFEIKC ND S C AG+PSI VTATNFCPPN+ALPNDN
Sbjct  61   GYGVNTAALSTALFNNGLSCGACFEIKCANDPSWCHAGSPSIFVTATNFCPPNYALPNDN  120

Query  426  GGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            GGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  121  GGWCNPPRPHFDLAMPMFLKIAQYRAGIVPVSYRRVPCRK  160



>ref|XP_007009225.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
 gb|EOY18035.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
Length=259

 Score =   255 bits (652),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 137/162 (85%), Gaps = 1/162 (1%)
 Frame = +3

Query  63   MEMAALRVFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLY  242
            M + ++    +AL   L AV ARIPGVY+   WQ AHATFYGG+DASGTM GACGYGNLY
Sbjct  1    MAIGSVVACLVALNLILVAVEARIPGVYSGAEWQTAHATFYGGSDASGTMGGACGYGNLY  60

Query  243  TQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPN  419
            +QGYGVN AALSTALFN GLSCGACFEIKC N+ + C AG+PSI VTATNFCPPN+ALP+
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGACFEIKCANEPQWCHAGSPSIFVTATNFCPPNYALPS  120

Query  420  DNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  121  DNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  162



>gb|EYU18981.1| hypothetical protein MIMGU_mgv1a012125mg [Erythranthe guttata]
Length=260

 Score =   255 bits (652),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 137/163 (84%), Gaps = 4/163 (2%)
 Frame = +3

Query  69   MAALRVF-CIALFCFLTA--VRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNL  239
            MA L V  CIA    +    + ARIPGVY+ G WQGAHATFYGG+DASGTM GACGYGNL
Sbjct  1    MALLAVIACIATIVSVLPPPIEARIPGVYSGGGWQGAHATFYGGSDASGTMGGACGYGNL  60

Query  240  YTQGYGVNNAALSTALFNTGLSCGACFEIKCNNDRS-CLAGNPSIVVTATNFCPPNFALP  416
            Y+QGYGVN AALSTALFN G SCGACFEIKC N++  C AG+PSI+VTATNFCPPN+ALP
Sbjct  61   YSQGYGVNTAALSTALFNNGFSCGACFEIKCANEKQWCHAGSPSILVTATNFCPPNYALP  120

Query  417  NDNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            NDNGGWCNPPR HFDLAMPMFLKIA YRAGIVPVNFRRV CRK
Sbjct  121  NDNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVNFRRVACRK  163



>ref|XP_007132063.1| hypothetical protein PHAVU_011G063800g [Phaseolus vulgaris]
 gb|ESW04057.1| hypothetical protein PHAVU_011G063800g [Phaseolus vulgaris]
Length=259

 Score =   255 bits (651),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 137/162 (85%), Gaps = 3/162 (2%)
 Frame = +3

Query  69   MAALRVF-CIALFCFLT-AVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLY  242
            MA   +F CIA    LT  V ARIPG+Y+ G W+ AHATFYGG+DASGTM GACGYGNLY
Sbjct  1    MAVPNIFLCIAFVISLTWMVEARIPGIYSGGAWESAHATFYGGSDASGTMGGACGYGNLY  60

Query  243  TQGYGVNNAALSTALFNTGLSCGACFEIKCNNDRS-CLAGNPSIVVTATNFCPPNFALPN  419
            +QGYGVN AALSTALFN GLSCGACFEIKC NDR  C +G+PSI +TATNFCPPN+ALPN
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGACFEIKCANDRQWCHSGSPSIFITATNFCPPNYALPN  120

Query  420  DNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV FRRVPCRK
Sbjct  121  DNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAFRRVPCRK  162



>ref|XP_010106493.1| hypothetical protein L484_025251 [Morus notabilis]
 gb|EXC10669.1| hypothetical protein L484_025251 [Morus notabilis]
Length=258

 Score =   255 bits (651),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 136/161 (84%), Gaps = 2/161 (1%)
 Frame = +3

Query  69   MAALRVFCIA-LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYT  245
            MA L V  IA L   +    ARIPGVYT G W+ AHATFYGG+DASGTM GACGYGNLY+
Sbjct  1    MAGLTVTWIASLLSLMWMAEARIPGVYTGGSWETAHATFYGGSDASGTMGGACGYGNLYS  60

Query  246  QGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPND  422
            QGYGV+ AALSTALFN GLSCGACFEIKC ND + C +G+PSI++TATNFCPPN+ALPND
Sbjct  61   QGYGVSTAALSTALFNNGLSCGACFEIKCANDPKWCHSGSPSILITATNFCPPNYALPND  120

Query  423  NGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            NGGWCNPPR HFDLAMPMFLKIA YRAGIVPV +RRVPCRK
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRK  161



>ref|XP_009589397.1| PREDICTED: expansin-A4-like [Nicotiana tomentosiformis]
Length=261

 Score =   255 bits (651),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 136/164 (83%), Gaps = 5/164 (3%)
 Frame = +3

Query  69   MAALRVFC--IALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLY  242
            MA++ V    I L   ++ V ARIPGVY+ G WQ AHATFYGG+DASGTM GACGYGNLY
Sbjct  1    MASMGVITSIIGLIFLVSLVEARIPGVYSGGSWQTAHATFYGGSDASGTMGGACGYGNLY  60

Query  243  TQGYGVNNAALSTALFNTGLSCGACFEIKCNND---RSCLAGNPSIVVTATNFCPPNFAL  413
            +QGYGVN AALSTALFN GLSCGACFEIKC ND   + CL G+PSI++TATNFCPPN+A 
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGACFEIKCTNDPNWKWCLPGSPSILITATNFCPPNYAK  120

Query  414  PNDNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            PNDNGGWCNPPR HFDLAMPMFL IA YRAGIVPV +RR+PCRK
Sbjct  121  PNDNGGWCNPPRSHFDLAMPMFLNIAQYRAGIVPVTYRRIPCRK  164



>gb|KHG30766.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=262

 Score =   255 bits (651),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 138/159 (87%), Gaps = 2/159 (1%)
 Frame = +3

Query  75   ALRVFCI-ALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQG  251
            +L + C  +L  F T+V ARIPGV+++G W+ AHATFYGG+DASGTM GACGYGNLY+QG
Sbjct  7    SLTLLCFTSLLPFFTSVNARIPGVFSTGSWETAHATFYGGSDASGTMGGACGYGNLYSQG  66

Query  252  YGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNG  428
            YGVN AALSTALFN GLSCGACFEIKC +D R C  G+PSI VTATNFCPPNFALP+DNG
Sbjct  67   YGVNTAALSTALFNNGLSCGACFEIKCASDPRWCHPGSPSIFVTATNFCPPNFALPSDNG  126

Query  429  GWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            GWCNPPR HFDLAMPMFLKIA YRAGIVPV+FRRVPCRK
Sbjct  127  GWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRK  165



>ref|XP_009343581.1| PREDICTED: expansin-A4-like [Pyrus x bretschneideri]
Length=261

 Score =   255 bits (651),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 138/164 (84%), Gaps = 5/164 (3%)
 Frame = +3

Query  69   MAALR-VFCIALFCFLTA---VRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGN  236
            MAA+  + CIA    L +   V ARIPGVYT G WQGAHATFYGG+DASGTM GACGYGN
Sbjct  1    MAAMAPLLCIASLMALASTIVVEARIPGVYTGGAWQGAHATFYGGSDASGTMGGACGYGN  60

Query  237  LYTQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFAL  413
            LY+QGYGVN AALSTALFN GLSCGACFEIKC N  + C +G+PSI VTATNFCPPNFA 
Sbjct  61   LYSQGYGVNTAALSTALFNNGLSCGACFEIKCANQPQWCKSGSPSIFVTATNFCPPNFAQ  120

Query  414  PNDNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            P+DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  121  PSDNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  164



>gb|KJB73995.1| hypothetical protein B456_011G266000 [Gossypium raimondii]
Length=258

 Score =   255 bits (651),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 132/155 (85%), Gaps = 1/155 (1%)
 Frame = +3

Query  84   VFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVN  263
             + + L    TAV ARIPGVY+ G WQ AHATFYGG DASGTM GACG+GNLY+QGYGVN
Sbjct  7    TYLVYLIIISTAVEARIPGVYSGGAWQSAHATFYGGNDASGTMGGACGFGNLYSQGYGVN  66

Query  264  NAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNGGWCN  440
             AALSTALFN G SCGACFEIKC ND + C +G+PSI +TATNFCPPN+ALPNDNGGWCN
Sbjct  67   TAALSTALFNNGFSCGACFEIKCANDPQWCHSGSPSIFITATNFCPPNYALPNDNGGWCN  126

Query  441  PPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            PPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  127  PPRSHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  161



>ref|XP_003538409.1| PREDICTED: expansin-A6 [Glycine max]
Length=258

 Score =   254 bits (650),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 136/161 (84%), Gaps = 2/161 (1%)
 Frame = +3

Query  69   MAALRVFCI-ALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYT  245
            MA L +  I +L   +   +A+IPGVY+ GPWQ AHATFYGG+DASGTM GACGYGNLY+
Sbjct  1    MAMLNIIAIVSLLLLMIPSQAKIPGVYSGGPWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  246  QGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPND  422
            QGYGVN AALSTALFN G SCGACFEIKC +D + C  GNPSI VTATNFCPPN+ALP+D
Sbjct  61   QGYGVNTAALSTALFNNGFSCGACFEIKCTDDPKWCHPGNPSIFVTATNFCPPNYALPSD  120

Query  423  NGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            NGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAQYRAGIVPVSYRRVPCRK  161



>ref|XP_003552064.1| PREDICTED: expansin-A4 [Glycine max]
Length=258

 Score =   254 bits (650),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 135/161 (84%), Gaps = 2/161 (1%)
 Frame = +3

Query  69   MAALRVFCIA-LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYT  245
            MA +   CIA L     A  ARIPGV+  G WQGAHATFYGG DASGTM GACGYGNLY+
Sbjct  1    MAGMVPLCIASLVTLFVATSARIPGVFNGGAWQGAHATFYGGNDASGTMGGACGYGNLYS  60

Query  246  QGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPND  422
            QGYGVN AALSTALFN GLSCGACFEIKC+ D R C  G+PSIV+TATNFCPPNFALP+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCDQDPRWCNPGSPSIVITATNFCPPNFALPSD  120

Query  423  NGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            NGGWCNPPR HFDLAMPMFLKIA Y+AGIVPV++RRVPCRK
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAQYKAGIVPVSYRRVPCRK  161



>ref|XP_003543517.1| PREDICTED: expansin-A4 [Glycine max]
Length=257

 Score =   254 bits (650),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 135/160 (84%), Gaps = 4/160 (3%)
 Frame = +3

Query  78   LRVFCIALFCFLT---AVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQ  248
            + VF   L C ++    V ARIPGVY+ G WQ AHATFYGG+DASGTM GACGYGNLY+Q
Sbjct  1    MGVFSTVLLCLMSLMWMVDARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQ  60

Query  249  GYGVNNAALSTALFNTGLSCGACFEIKCNNDRS-CLAGNPSIVVTATNFCPPNFALPNDN  425
            GYGVN AALSTALFN+GLSCGACFEIKC ND+  C +G+PSI +TATNFCPPN+ALPNDN
Sbjct  61   GYGVNTAALSTALFNSGLSCGACFEIKCANDKQWCHSGSPSIFITATNFCPPNYALPNDN  120

Query  426  GGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            GGWCNPPR HFDLAMPMFLKIA YRAGIVPV FRRV CRK
Sbjct  121  GGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAFRRVACRK  160



>ref|XP_010922313.1| PREDICTED: LOW QUALITY PROTEIN: expansin-A4-like [Elaeis guineensis]
Length=258

 Score =   254 bits (650),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 138/161 (86%), Gaps = 2/161 (1%)
 Frame = +3

Query  69   MAALRVFCIA-LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYT  245
            MA LR+  +A L  FL    ARIPGVY+SGPWQ AHATFYGG+DASGTM GACGYGNLY+
Sbjct  1    MAILRLVALASLLAFLVPAAARIPGVYSSGPWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  246  QGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPND  422
            QGYGV  AALSTALFN G+SCGACFEIKC +D + C +G+PSI +TATNFCPPN+ALP+D
Sbjct  61   QGYGVETAALSTALFNDGMSCGACFEIKCADDPQWCHSGSPSIFITATNFCPPNYALPSD  120

Query  423  NGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            +GGWCNPP  HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  121  DGGWCNPPXPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  161



>ref|XP_008784594.1| PREDICTED: expansin-A4-like [Phoenix dactylifera]
Length=260

 Score =   254 bits (650),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 132/155 (85%), Gaps = 1/155 (1%)
 Frame = +3

Query  84   VFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVN  263
               ++L  FLT   ARIPGVY  GPWQ AHATFYGG+DASGTM GACGYGNLY+QGYGV 
Sbjct  9    TIAVSLLAFLTLADARIPGVYAGGPWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVE  68

Query  264  NAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNGGWCN  440
             AALSTALFN GLSCGACFEIKC  + R C  G+PSI++TATNFCPPN+ALP+DNGGWCN
Sbjct  69   TAALSTALFNDGLSCGACFEIKCGEEPRWCHPGSPSILITATNFCPPNYALPSDNGGWCN  128

Query  441  PPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            PPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  129  PPRPHFDLAMPMFLKIAQYRAGIVPVSYRRVPCRK  163



>ref|XP_004505858.1| PREDICTED: expansin-A6-like [Cicer arietinum]
Length=257

 Score =   254 bits (650),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 134/160 (84%), Gaps = 1/160 (1%)
 Frame = +3

Query  69   MAALRVFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQ  248
            M A  ++   +   +  V ARIPG+Y+ G WQ AHATFYGG+DASGTM GACGYGNLY+Q
Sbjct  1    MVAKILYIAFIISSMWIVEARIPGLYSGGQWQTAHATFYGGSDASGTMGGACGYGNLYSQ  60

Query  249  GYGVNNAALSTALFNTGLSCGACFEIKCNNDRS-CLAGNPSIVVTATNFCPPNFALPNDN  425
            GYGVN AALSTALFN GLSCGACFEIKC NDR  C +G+PSI +TATNFCPPNFALPNDN
Sbjct  61   GYGVNTAALSTALFNNGLSCGACFEIKCANDREWCHSGSPSIFITATNFCPPNFALPNDN  120

Query  426  GGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            GGWCNPPR HFDLAMPMFLKIA YRAGIVPV FRRVPCRK
Sbjct  121  GGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAFRRVPCRK  160



>ref|NP_181300.1| expansin-A3 [Arabidopsis thaliana]
 ref|XP_004253297.1| PREDICTED: expansin-A3 [Solanum lycopersicum]
 sp|O80932.1|EXPA3_ARATH RecName: Full=Expansin-A3; Short=AtEXPA3; AltName: Full=Alpha-expansin-3; 
Short=At-EXP3; Short=AtEx3; AltName: Full=Ath-ExpAlpha-1.9; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC23634.1| putative expansin [Arabidopsis thaliana]
 gb|AAL91271.1| At2g37640/F13M22.14 [Arabidopsis thaliana]
 gb|AAM67431.1| At2g37640/F13M22.14 [Arabidopsis thaliana]
 gb|AEC09429.1| expansin-A3 [Arabidopsis thaliana]
Length=262

 Score =   254 bits (650),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 135/165 (82%), Gaps = 4/165 (2%)
 Frame = +3

Query  63   MEMAALRV---FCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYG  233
            M   A RV     +     LTA  A+IPGVY+ GPWQ AHATFYGG+DASGTM GACGYG
Sbjct  1    MTATAFRVGLWLAVTASFLLTATNAKIPGVYSGGPWQNAHATFYGGSDASGTMGGACGYG  60

Query  234  NLYTQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFA  410
            NLY+QGYGVN AALSTALFN G SCGACFEIKC +D R C+ GNPSI+VTATNFCPPNFA
Sbjct  61   NLYSQGYGVNTAALSTALFNNGFSCGACFEIKCTDDPRWCVPGNPSILVTATNFCPPNFA  120

Query  411  LPNDNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
             P+D+GGWCNPPR HFDLAMPMFLKI  YRAGIVPV++RRVPCRK
Sbjct  121  QPSDDGGWCNPPREHFDLAMPMFLKIGLYRAGIVPVSYRRVPCRK  165



>gb|ACN94264.1| expansin [Rehmannia glutinosa]
 gb|ACN94265.1| expansin [Rehmannia glutinosa]
Length=260

 Score =   254 bits (650),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/163 (79%), Positives = 135/163 (83%), Gaps = 4/163 (2%)
 Frame = +3

Query  69   MAALRVF-CIALFCFLTA--VRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNL  239
            MA L V  CIA    +    + ARIPG Y  G WQGAHATFYGG+DASGTM GACGYGNL
Sbjct  1    MALLAVIACIASLISVLPPPIEARIPGNYGGGAWQGAHATFYGGSDASGTMGGACGYGNL  60

Query  240  YTQGYGVNNAALSTALFNTGLSCGACFEIKCNNDRS-CLAGNPSIVVTATNFCPPNFALP  416
            Y+QGYGVN AALSTALFN G SCGACFEIKC ND+  C AG+PSI VTATNFCPPN+ALP
Sbjct  61   YSQGYGVNTAALSTALFNNGFSCGACFEIKCANDKQWCHAGSPSIFVTATNFCPPNYALP  120

Query  417  NDNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            NDNGGWCNPPR HFDLAMPMFLKIA YRAGIVPVNFRRVPCRK
Sbjct  121  NDNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVNFRRVPCRK  163



>ref|XP_004300427.1| PREDICTED: expansin-A6 [Fragaria vesca subsp. vesca]
Length=259

 Score =   254 bits (650),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 134/162 (83%), Gaps = 1/162 (1%)
 Frame = +3

Query  63   MEMAALRVFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLY  242
            M MA+L      L    +   ARIPGVY+ G WQGAHATFYGG+DASGTM GACGYGNLY
Sbjct  1    MAMASLACIAALLISLTSITEARIPGVYSGGAWQGAHATFYGGSDASGTMGGACGYGNLY  60

Query  243  TQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPN  419
            +QGYGV+ AALSTALFN GLSCGACFEIKC ND   C +G+PSI +TATNFCPPNFA P+
Sbjct  61   SQGYGVSTAALSTALFNNGLSCGACFEIKCANDPNWCHSGSPSIFITATNFCPPNFAQPS  120

Query  420  DNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  121  DNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  162



>ref|XP_004142066.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 gb|KGN54256.1| hypothetical protein Csa_4G296100 [Cucumis sativus]
Length=259

 Score =   254 bits (650),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 128/142 (90%), Gaps = 1/142 (1%)
 Frame = +3

Query  123  RARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVNNAALSTALFNTGL  302
             ARIPGVY+ GPWQ AHATFYGG+DASGTM GACGYGNLY+QGYGVN AALSTALFN GL
Sbjct  21   HARIPGVYSGGPWQDAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  80

Query  303  SCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNGGWCNPPRLHFDLAMPMF  479
            SCGACFEIKC ND R C  G+PSI +TATNFCPPNFALPNDNGGWCNPPR HFDLAMPMF
Sbjct  81   SCGACFEIKCANDPRWCHPGSPSIFITATNFCPPNFALPNDNGGWCNPPRTHFDLAMPMF  140

Query  480  LKIAAYRAGIVPVNFRRVPCRK  545
            LKIA YRAGIVPV++RRVPCRK
Sbjct  141  LKIAEYRAGIVPVSYRRVPCRK  162



>ref|XP_009364387.1| PREDICTED: expansin-A4 [Pyrus x bretschneideri]
Length=260

 Score =   254 bits (649),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 132/155 (85%), Gaps = 3/155 (2%)
 Frame = +3

Query  90   CIA--LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVN  263
            CIA  L   +    ARIPGVYT G WQGAHATFYGG+DASGTM GACGYGNLY+QGYGVN
Sbjct  9    CIATLLISLMWVAEARIPGVYTGGAWQGAHATFYGGSDASGTMGGACGYGNLYSQGYGVN  68

Query  264  NAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNGGWCN  440
              ALSTALFN GLSCGACFEIKC+ND R C +G+PSI +TATNFCPPNFA P+DNGGWCN
Sbjct  69   TGALSTALFNNGLSCGACFEIKCSNDPRWCHSGSPSIFITATNFCPPNFAQPSDNGGWCN  128

Query  441  PPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            PPR HFDLAMPMFLKIA YRAGIVPV +RRVPCRK
Sbjct  129  PPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRK  163



>ref|NP_001284471.1| expansin-A4 precursor [Cucumis melo]
 gb|ABI94060.1| ripening-related expansin [Cucumis melo]
Length=259

 Score =   254 bits (649),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 128/142 (90%), Gaps = 1/142 (1%)
 Frame = +3

Query  123  RARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVNNAALSTALFNTGL  302
             ARIPGVY+ GPWQ AHATFYGG+DASGTM GACGYGNLY+QGYGVN AALSTALFN GL
Sbjct  21   HARIPGVYSGGPWQDAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  80

Query  303  SCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNGGWCNPPRLHFDLAMPMF  479
            SCGACFEIKC ND R C  G+PSI +TATNFCPPNFALPNDNGGWCNPPR HFDLAMPMF
Sbjct  81   SCGACFEIKCANDPRWCHPGSPSIFITATNFCPPNFALPNDNGGWCNPPRTHFDLAMPMF  140

Query  480  LKIAAYRAGIVPVNFRRVPCRK  545
            LKIA YRAGIVPV++RRVPCRK
Sbjct  141  LKIAEYRAGIVPVSYRRVPCRK  162



>gb|AEQ55274.1| expansin [Breonia chinensis]
 gb|AEQ55289.1| expansin [Breonia chinensis]
Length=256

 Score =   254 bits (649),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 135/160 (84%), Gaps = 2/160 (1%)
 Frame = +3

Query  69   MAALRVFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQ  248
            MA + + CIA    L A  ARIPGVYT G WQ AHATFYGG+DASGTM GACGYGNLY+Q
Sbjct  1    MAIVVLTCIASVLALVA-EARIPGVYTGGSWQSAHATFYGGSDASGTMGGACGYGNLYSQ  59

Query  249  GYGVNNAALSTALFNTGLSCGACFEIKCNNDRS-CLAGNPSIVVTATNFCPPNFALPNDN  425
            GYGVN  ALSTALFN+GLSCGACFE+KC ND   C  G+PSI +TATNFCPPN+ALPNDN
Sbjct  60   GYGVNTGALSTALFNSGLSCGACFELKCANDPGWCHPGSPSIFITATNFCPPNYALPNDN  119

Query  426  GGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            GGWCNPPR HFDLAMPMFLKIA YRAGIVPVN+RRVPCRK
Sbjct  120  GGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVNYRRVPCRK  159



>ref|XP_009613959.1| PREDICTED: expansin-A6-like [Nicotiana tomentosiformis]
Length=260

 Score =   254 bits (649),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 130/143 (91%), Gaps = 1/143 (1%)
 Frame = +3

Query  120  VRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVNNAALSTALFNTG  299
            V ARIPGVYT G WQ AHATFYGG+DASGTM GACGYGNLY+QGYGVNNAALSTALFN G
Sbjct  21   VEARIPGVYTGGSWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  80

Query  300  LSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNGGWCNPPRLHFDLAMPM  476
            LSCGACFEIKC+N  + C AG+PSI++TATNFCPPN+ALPNDNGGWCNPPR HFDLAMPM
Sbjct  81   LSCGACFEIKCDNQPQWCHAGSPSILITATNFCPPNYALPNDNGGWCNPPRPHFDLAMPM  140

Query  477  FLKIAAYRAGIVPVNFRRVPCRK  545
            FLKIA YRAGIVPV +RRVPCRK
Sbjct  141  FLKIAEYRAGIVPVVYRRVPCRK  163



>ref|XP_008357089.1| PREDICTED: expansin-A6 [Malus domestica]
Length=260

 Score =   254 bits (649),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 132/155 (85%), Gaps = 3/155 (2%)
 Frame = +3

Query  90   CIA--LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVN  263
            CIA  L   +    ARIPGVYT G WQGAHATFYGG+DASGTM GACGYGNLY+QGYGVN
Sbjct  9    CIATLLISLMWVAEARIPGVYTGGAWQGAHATFYGGSDASGTMXGACGYGNLYSQGYGVN  68

Query  264  NAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNGGWCN  440
              ALSTALFN GLSCGACFEIKC+ND R C +G+PSI +TATNFCPPNFA P+DNGGWCN
Sbjct  69   TGALSTALFNNGLSCGACFEIKCSNDPRWCHSGSPSIFITATNFCPPNFAQPSDNGGWCN  128

Query  441  PPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            PPR HFDLAMPMFLKIA YRAGIVPV +RRVPCRK
Sbjct  129  PPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRK  163



>ref|XP_003552923.2| PREDICTED: expansin-A3-like [Glycine max]
Length=262

 Score =   254 bits (649),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 134/160 (84%), Gaps = 2/160 (1%)
 Frame = +3

Query  69   MAALRVFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQ  248
            MA L +  I L   LT   A+IPGVY+ GPWQ AHATFYGG+DASGTM GACGYGNLY+Q
Sbjct  7    MAMLNIISI-LSLLLTQSHAKIPGVYSGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQ  65

Query  249  GYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDN  425
            GYGVN AALSTALFN G SCGACFEIKC +D + C  GNPSI+VTATNFCPPN+ALP DN
Sbjct  66   GYGVNTAALSTALFNNGFSCGACFEIKCTDDPKWCNPGNPSILVTATNFCPPNYALPTDN  125

Query  426  GGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            GGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RRV CRK
Sbjct  126  GGWCNPPRPHFDLAMPMFLKIAQYRAGIVPVSYRRVACRK  165



>ref|XP_002283358.1| PREDICTED: expansin-A4 [Vitis vinifera]
 emb|CBI31662.3| unnamed protein product [Vitis vinifera]
Length=258

 Score =   254 bits (648),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 136/161 (84%), Gaps = 2/161 (1%)
 Frame = +3

Query  69   MAALRVFC-IALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYT  245
            M  + V C +A+   L    ARIPGVYT G WQ AHATFYGG+DASGTM GACGYGNLY+
Sbjct  1    MGLVAVVCFVAMASVLKLGEARIPGVYTGGGWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  246  QGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPND  422
            QGYGVN AALSTALFN GLSCGACFE+KC ND   C +G+PSI++TATNFCPPN+ALP+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFELKCANDPEWCHSGSPSILITATNFCPPNYALPSD  120

Query  423  NGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            NGGWCNPPR HFDLAMPMFLKIA YRAGIVPV+FRRVPCRK
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRK  161



>ref|NP_001288852.1| expansin-A3 precursor [Brassica rapa]
 gb|AGM16345.1| alpha-expansin protein 3 [Brassica rapa]
 emb|CDX91376.1| BnaC04g07740D [Brassica napus]
Length=263

 Score =   254 bits (648),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 136/167 (81%), Gaps = 7/167 (4%)
 Frame = +3

Query  48   FKFKFMEMAALRVFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACG  227
            F  +FM +A      +     LT   A+IPGVYT GPWQ AHATFYGG+DASGTM GACG
Sbjct  6    FGIRFMWLA------VTASLMLTVTNAKIPGVYTGGPWQNAHATFYGGSDASGTMGGACG  59

Query  228  YGNLYTQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPN  404
            YGNLY+QGYGVN AALSTALFN G SCGACFE+KC +D R C+ GNPSI+VTATNFCPPN
Sbjct  60   YGNLYSQGYGVNTAALSTALFNNGFSCGACFELKCTDDPRWCVPGNPSILVTATNFCPPN  119

Query  405  FALPNDNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            FA P+D+GGWCNPPR HFDLAMPMFLKI  YRAGIVPV++RRVPCRK
Sbjct  120  FAQPSDDGGWCNPPREHFDLAMPMFLKIGLYRAGIVPVSYRRVPCRK  166



>gb|ACA05164.1| expansin 1 [Dimocarpus longan]
Length=256

 Score =   254 bits (648),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 133/160 (83%), Gaps = 2/160 (1%)
 Frame = +3

Query  69   MAALRVFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQ  248
            MA   V C     FLTA  A+IPGVYT  PW+  HATFYGG+DASGTM GACGYGNLY+Q
Sbjct  1    MAVFNVLCFLSLLFLTA-NAKIPGVYTGSPWESGHATFYGGSDASGTMGGACGYGNLYSQ  59

Query  249  GYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDN  425
            GYGVN AALSTALFN+GLSCGACFE+KC  D R CL GNPSI+VTATNFCPPNFA P+DN
Sbjct  60   GYGVNTAALSTALFNSGLSCGACFELKCVADPRWCLPGNPSILVTATNFCPPNFAQPSDN  119

Query  426  GGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            GGWCNPPR HFDLAMPMF  IA YRAGIVPV++RRVPCRK
Sbjct  120  GGWCNPPRTHFDLAMPMFFAIAQYRAGIVPVSYRRVPCRK  159



>emb|CDX74942.1| BnaA05g06880D [Brassica napus]
Length=263

 Score =   254 bits (648),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 136/167 (81%), Gaps = 7/167 (4%)
 Frame = +3

Query  48   FKFKFMEMAALRVFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACG  227
            F  +FM +A      +     LT   A+IPGVYT GPWQ AHATFYGG+DASGTM GACG
Sbjct  6    FGIRFMWLA------VTASLMLTVTNAKIPGVYTGGPWQNAHATFYGGSDASGTMGGACG  59

Query  228  YGNLYTQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPN  404
            YGNLY+QGYGVN AALSTALFN G SCGACFE+KC +D R C+ GNPSI+VTATNFCPPN
Sbjct  60   YGNLYSQGYGVNTAALSTALFNNGFSCGACFELKCTDDPRWCVPGNPSILVTATNFCPPN  119

Query  405  FALPNDNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            FA P+D+GGWCNPPR HFDLAMPMFLKI  YRAGIVPV++RRVPCRK
Sbjct  120  FAQPSDDGGWCNPPREHFDLAMPMFLKIGLYRAGIVPVSYRRVPCRK  166



>ref|XP_003547326.1| PREDICTED: expansin-A4-like [Glycine max]
Length=256

 Score =   253 bits (647),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 131/152 (86%), Gaps = 1/152 (1%)
 Frame = +3

Query  93   IALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVNNAA  272
            + L   +  V ARIPGVYT G WQ AHATFYGG+DASGTM GACGYGNLY+QGYGVN AA
Sbjct  8    LCLMSLMWMVEARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAA  67

Query  273  LSTALFNTGLSCGACFEIKCNNDRS-CLAGNPSIVVTATNFCPPNFALPNDNGGWCNPPR  449
            LSTALFN+GLSCGACFEIKC ND+  C +G+PSI +TATNFCPPN+ALPNDNGGWCNPPR
Sbjct  68   LSTALFNSGLSCGACFEIKCANDKQWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPR  127

Query  450  LHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
             HFDLAMPMFLKIA YRAGIVPV +RRV CRK
Sbjct  128  PHFDLAMPMFLKIAEYRAGIVPVAYRRVACRK  159



>gb|KHN17924.1| Expansin-A3 [Glycine soja]
Length=307

 Score =   255 bits (652),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 136/161 (84%), Gaps = 2/161 (1%)
 Frame = +3

Query  69   MAALRVFCI-ALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYT  245
            MA L +  I +L   +   +A+IPGVY+ GPWQ AHATFYGG+DASGTM GACGYGNLY+
Sbjct  1    MAMLNIIAIVSLLLLIIPSQAKIPGVYSGGPWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  246  QGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPND  422
            QGYGVN AALSTALFN G SCGACFEIKC +D + C  GNPSI VTATNFCPPN+ALP+D
Sbjct  61   QGYGVNTAALSTALFNNGFSCGACFEIKCTDDPKWCHPGNPSIFVTATNFCPPNYALPSD  120

Query  423  NGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            NGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAQYRAGIVPVSYRRVPCRK  161



>ref|XP_002266625.1| PREDICTED: expansin-A6 [Vitis vinifera]
 emb|CAN65872.1| hypothetical protein VITISV_000251 [Vitis vinifera]
 emb|CBI30547.3| unnamed protein product [Vitis vinifera]
Length=258

 Score =   253 bits (647),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 130/143 (91%), Gaps = 1/143 (1%)
 Frame = +3

Query  120  VRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVNNAALSTALFNTG  299
            V ARIPGVYTSGPW+ AHATFYGG+DASGTM GACGYGNLY+QGYGVN AALSTALFN+G
Sbjct  19   VHARIPGVYTSGPWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNSG  78

Query  300  LSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNGGWCNPPRLHFDLAMPM  476
            LSCGACFEIKC ND + C +G+PSI VTATNFCPPN+ALP+DNGGWCNPPR HFDLAMPM
Sbjct  79   LSCGACFEIKCANDPKWCHSGSPSIFVTATNFCPPNYALPSDNGGWCNPPRPHFDLAMPM  138

Query  477  FLKIAAYRAGIVPVNFRRVPCRK  545
            FLKIA YRAGIVPV FRRV CRK
Sbjct  139  FLKIAEYRAGIVPVAFRRVSCRK  161



>ref|XP_006410954.1| hypothetical protein EUTSA_v10017095mg [Eutrema salsugineum]
 dbj|BAJ34443.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ52407.1| hypothetical protein EUTSA_v10017095mg [Eutrema salsugineum]
Length=263

 Score =   254 bits (648),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 136/167 (81%), Gaps = 7/167 (4%)
 Frame = +3

Query  48   FKFKFMEMAALRVFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACG  227
            F  +F+ +A    F +A      A  A+IPGVYT GPWQ AHATFYGG+DASGTM GACG
Sbjct  6    FGIRFLWLAVTISFLLA------ATNAKIPGVYTGGPWQNAHATFYGGSDASGTMGGACG  59

Query  228  YGNLYTQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPN  404
            YGNLY+QGYGVN AALSTALFN G SCGACFEIKC +D R C+ GNPSI VTATNFCPPN
Sbjct  60   YGNLYSQGYGVNTAALSTALFNNGFSCGACFEIKCTDDPRWCVPGNPSIFVTATNFCPPN  119

Query  405  FALPNDNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            FA P+D+GGWCNPPR HFDLAMPMFLKI  YRAGIVPV++RRVPCRK
Sbjct  120  FAQPSDDGGWCNPPREHFDLAMPMFLKIGLYRAGIVPVSYRRVPCRK  166



>gb|KJB78839.1| hypothetical protein B456_013G022200 [Gossypium raimondii]
Length=258

 Score =   253 bits (647),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 131/152 (86%), Gaps = 1/152 (1%)
 Frame = +3

Query  93   IALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVNNAA  272
            ++L   +  V ARIPGVY+ G WQ AHATFYGG+DASGTM GACGYGNLY+QGYGVN AA
Sbjct  10   VSLLFIIVTVEARIPGVYSDGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAA  69

Query  273  LSTALFNTGLSCGACFEIKC-NNDRSCLAGNPSIVVTATNFCPPNFALPNDNGGWCNPPR  449
            LSTALFN G SCGACFEIKC N  + C +G+PSI +TATNFCPPN+ALPNDNGGWCNPPR
Sbjct  70   LSTALFNNGFSCGACFEIKCVNQPQWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPR  129

Query  450  LHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
             HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  130  SHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  161



>gb|KJB55836.1| hypothetical protein B456_009G098800 [Gossypium raimondii]
Length=259

 Score =   253 bits (646),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 134/162 (83%), Gaps = 1/162 (1%)
 Frame = +3

Query  63   MEMAALRVFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLY  242
            M +A      + L   +    ARIPGVY+ G WQ AHATFYGG+DASGTM GACGYGNLY
Sbjct  1    MGIAGAVCIIVGLISSMWMAEARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLY  60

Query  243  TQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPN  419
            +QGYGVN AALSTALFN GLSCGACFEIKC +D + C +G+PSI +TATNFCPPN+ALPN
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPN  120

Query  420  DNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  121  DNGGWCNPPRSHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  162



>ref|XP_010528418.1| PREDICTED: expansin-A3 [Tarenaya hassleriana]
Length=264

 Score =   253 bits (647),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 134/165 (81%), Gaps = 2/165 (1%)
 Frame = +3

Query  54   FKFMEMAALRVFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYG  233
            F F     L +   A F   +A  ARIPGVYT GPWQ AHATFYGG+DASGTM GACGYG
Sbjct  4    FAFAITFRLSLAITASFLVASAT-ARIPGVYTGGPWQSAHATFYGGSDASGTMGGACGYG  62

Query  234  NLYTQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFA  410
            NLY+QGYGVN AALSTALFN GLSCGACFEIKC  D + C  GNPSI VTATNFCPPNFA
Sbjct  63   NLYSQGYGVNTAALSTALFNNGLSCGACFEIKCTEDPKWCNPGNPSIFVTATNFCPPNFA  122

Query  411  LPNDNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
             P+D+GGWCNPPR HFDLAMPMFLKIA YRAGIVPV+FRRVPCRK
Sbjct  123  QPSDDGGWCNPPRQHFDLAMPMFLKIAQYRAGIVPVSFRRVPCRK  167



>gb|AEN70893.1| expansin [Gossypium schwendimanii]
Length=259

 Score =   253 bits (646),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 137/159 (86%), Gaps = 5/159 (3%)
 Frame = +3

Query  84   VFCIALFCFLTAV----RARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQG  251
            V  I++  F++++     ARIPGVY+ G WQ AHATFYGGADASGTM GACGYGNLY+QG
Sbjct  4    VNVISVLIFISSIWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLYSQG  63

Query  252  YGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNG  428
            YGV+ AALSTALFN GLSCGACFEIKC +D + C +G+PSI +TATNFCPPN+ALPNDNG
Sbjct  64   YGVSTAALSTALFNNGLSCGACFEIKCGSDPKWCHSGSPSIFITATNFCPPNYALPNDNG  123

Query  429  GWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            GWCNPPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  124  GWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  162



>gb|ACJ48968.2| expansin [Breonia chinensis]
 gb|ACT10284.2| expansin [Breonia chinensis]
Length=258

 Score =   253 bits (646),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 132/152 (87%), Gaps = 1/152 (1%)
 Frame = +3

Query  93   IALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVNNAA  272
            +AL   LT   ARIPGVY+ G WQ AHATFYGG+DASGTM GACGYGNLY+QGYGVN AA
Sbjct  10   VALSLLLTLAEARIPGVYSGGSWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAA  69

Query  273  LSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNGGWCNPPR  449
            LSTALFN GLSCGACFE+KC +D + C  G+PSI +TATNFCPPN+ALPNDNGGWCNPPR
Sbjct  70   LSTALFNNGLSCGACFELKCADDPQWCHPGSPSIFITATNFCPPNYALPNDNGGWCNPPR  129

Query  450  LHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
             HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  130  PHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  161



>ref|XP_010505357.1| PREDICTED: expansin-A3-like [Camelina sativa]
Length=262

 Score =   253 bits (646),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 130/147 (88%), Gaps = 1/147 (1%)
 Frame = +3

Query  108  FLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVNNAALSTAL  287
             LTA  A+IPGVY+ GPWQ AHATFYGG+DASGTM GACGYGNLY+QGYGVN AALSTAL
Sbjct  19   LLTATNAKIPGVYSGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTAL  78

Query  288  FNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNGGWCNPPRLHFDL  464
            FN G SCGACFEIKC +D R C+ GNPSI+VTATNFCPPNFA P+D+GGWCNPPR HFDL
Sbjct  79   FNNGFSCGACFEIKCTDDPRWCVPGNPSILVTATNFCPPNFAQPSDDGGWCNPPREHFDL  138

Query  465  AMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            AMPMFLKI  YRAGIVPV++RRVPCRK
Sbjct  139  AMPMFLKIGLYRAGIVPVSYRRVPCRK  165



>gb|AEN70914.1| expansin [Gossypium trilobum]
Length=259

 Score =   253 bits (646),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 137/159 (86%), Gaps = 5/159 (3%)
 Frame = +3

Query  84   VFCIALFCFLTAV----RARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQG  251
            V  I++  F++++     ARIPGVY+ G WQ AHATFYGGADASGTM GACGYGNLY+QG
Sbjct  4    VNVISVLIFISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLYSQG  63

Query  252  YGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNG  428
            YGV+ AALSTALFN GLSCGACFEIKC +D + C +G+PSI +TATNFCPPNFALPNDNG
Sbjct  64   YGVSTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNFALPNDNG  123

Query  429  GWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            GWCNPPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  124  GWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  162



>ref|XP_008457477.1| PREDICTED: expansin-A4-like [Cucumis melo]
Length=259

 Score =   253 bits (646),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 135/162 (83%), Gaps = 1/162 (1%)
 Frame = +3

Query  63   MEMAALRVFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLY  242
            M   A+ +   +L   +    ARIPGVY+ GPW+ AHATFYGG+DASGTM GACGYGNLY
Sbjct  1    MAQTAILLCIASLISTMWPATARIPGVYSGGPWESAHATFYGGSDASGTMGGACGYGNLY  60

Query  243  TQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPN  419
            +QGYGVN AALSTALFN GLSCGACFEIKC ND R C +G+PSIV+TATNFCPPNFALP+
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGACFEIKCANDPRWCHSGSPSIVITATNFCPPNFALPS  120

Query  420  DNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV +RRV CRK
Sbjct  121  DNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVACRK  162



>gb|KHG29956.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=258

 Score =   253 bits (646),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 131/155 (85%), Gaps = 1/155 (1%)
 Frame = +3

Query  84   VFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVN  263
             + + L    TAV ARIPG Y+ G WQ AHATFYGG DASGTM GACGYGNLY+QGYGV+
Sbjct  7    TYLVYLIIISTAVEARIPGFYSGGEWQSAHATFYGGNDASGTMGGACGYGNLYSQGYGVS  66

Query  264  NAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNGGWCN  440
             AALSTALFN G SCGACFEIKC ND + C +G+PSI +TATNFCPPN+ALPNDNGGWCN
Sbjct  67   TAALSTALFNNGFSCGACFEIKCANDPQWCHSGSPSIFITATNFCPPNYALPNDNGGWCN  126

Query  441  PPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            PPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  127  PPRSHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  161



>ref|XP_010517036.1| PREDICTED: expansin-A3 [Camelina sativa]
Length=262

 Score =   253 bits (646),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 130/147 (88%), Gaps = 1/147 (1%)
 Frame = +3

Query  108  FLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVNNAALSTAL  287
             LTA  A+IPGVY+ GPWQ AHATFYGG+DASGTM GACGYGNLY+QGYGVN AALSTAL
Sbjct  19   LLTATNAKIPGVYSGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTAL  78

Query  288  FNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNGGWCNPPRLHFDL  464
            FN G SCGACFEIKC +D R C+ GNPSI+VTATNFCPPNFA P+D+GGWCNPPR HFDL
Sbjct  79   FNNGFSCGACFEIKCTDDPRWCVPGNPSILVTATNFCPPNFAQPSDDGGWCNPPREHFDL  138

Query  465  AMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            AMPMFLKI  YRAGIVPV++RRVPCRK
Sbjct  139  AMPMFLKIGLYRAGIVPVSYRRVPCRK  165



>ref|XP_010043542.1| PREDICTED: expansin-A4-like [Eucalyptus grandis]
 ref|XP_010043543.1| PREDICTED: expansin-A4-like [Eucalyptus grandis]
 gb|KCW85556.1| hypothetical protein EUGRSUZ_B02355 [Eucalyptus grandis]
Length=260

 Score =   253 bits (646),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 134/157 (85%), Gaps = 3/157 (2%)
 Frame = +3

Query  84   VFCIAL--FCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYG  257
            VF  +L  F  +    ARIPGVY+ GPWQ AHATFYGG+DASGTM GACGYGNLY+QGYG
Sbjct  7    VFAASLISFSLMWLADARIPGVYSGGPWQTAHATFYGGSDASGTMGGACGYGNLYSQGYG  66

Query  258  VNNAALSTALFNTGLSCGACFEIKCNNDRS-CLAGNPSIVVTATNFCPPNFALPNDNGGW  434
            VN AALSTALFN GLSCGACFEIKC ND + C +G+PSI VTATNFCPPNFA P+DNGGW
Sbjct  67   VNTAALSTALFNNGLSCGACFEIKCANDPTWCHSGSPSIFVTATNFCPPNFAQPSDNGGW  126

Query  435  CNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            CNPPR HFDLAMPMFLKIA YRAGIVPV+FRRVPCRK
Sbjct  127  CNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRK  163



>emb|CDP09064.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   253 bits (646),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 135/163 (83%), Gaps = 4/163 (2%)
 Frame = +3

Query  69   MAALRVFCIA---LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNL  239
            MA + + CIA      F+    ARIPGVYT G WQ AHATFYGG+DASGTM GACGYGNL
Sbjct  1    MAVVGLVCIASVLALAFMLGAEARIPGVYTGGDWQSAHATFYGGSDASGTMGGACGYGNL  60

Query  240  YTQGYGVNNAALSTALFNTGLSCGACFEIKCNNDRS-CLAGNPSIVVTATNFCPPNFALP  416
            Y+QGYGVN AALSTALF++GLSCGACFEIKC +D   C  G+PSI VTATNFCPPN+ALP
Sbjct  61   YSQGYGVNTAALSTALFSSGLSCGACFEIKCASDPGWCHPGSPSIFVTATNFCPPNYALP  120

Query  417  NDNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            NDNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV +RRVPCRK
Sbjct  121  NDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVTYRRVPCRK  163



>gb|AAR82849.1| expansin-1 [Petunia x hybrida]
Length=260

 Score =   253 bits (645),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 133/155 (86%), Gaps = 2/155 (1%)
 Frame = +3

Query  84   VFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVN  263
            V  + L   LT V ARIPGVY+ G WQ AHATFYGG+DASGTM GACGYGNLY+QGYGVN
Sbjct  10   VTSLVLLMLLT-VEARIPGVYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVN  68

Query  264  NAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNGGWCN  440
            N ALSTALFN GLSCGACFEIKC+ D + C +G+PSI +TATNFCPPN+ALPNDNGGWCN
Sbjct  69   NGALSTALFNNGLSCGACFEIKCDKDPQWCHSGSPSIFITATNFCPPNYALPNDNGGWCN  128

Query  441  PPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            PPR HFDLAMPMFLKIA YRAGIVPV +RRVPCRK
Sbjct  129  PPRPHFDLAMPMFLKIAEYRAGIVPVVYRRVPCRK  163



>ref|XP_010920576.1| PREDICTED: expansin-A4-like [Elaeis guineensis]
Length=260

 Score =   253 bits (645),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 131/155 (85%), Gaps = 1/155 (1%)
 Frame = +3

Query  84   VFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVN  263
               ++L  FLT   ARIPGVY  G WQ AHATFYGG+DASGTM GACGYGNLY+QGYGV 
Sbjct  9    TIAVSLLAFLTLADARIPGVYAGGQWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVE  68

Query  264  NAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNGGWCN  440
             AALSTALFN GLSCGACFEIKC +D R C  G+PSI +TATNFCPPN+ALP+DNGGWCN
Sbjct  69   TAALSTALFNEGLSCGACFEIKCADDPRWCHPGSPSIFITATNFCPPNYALPSDNGGWCN  128

Query  441  PPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            PPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  129  PPRPHFDLAMPMFLKIAQYRAGIVPVSYRRVPCRK  163



>ref|XP_004492358.1| PREDICTED: expansin-A6-like [Cicer arietinum]
Length=258

 Score =   253 bits (645),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 134/161 (83%), Gaps = 2/161 (1%)
 Frame = +3

Query  69   MAALRVFCIA-LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYT  245
            MAA  +  IA L     A  ARIPG Y+ GPWQ AHATFYGG+DASGTM GACGYGNLY+
Sbjct  1    MAATVLLSIASLASLFVATTARIPGFYSGGPWQTAHATFYGGSDASGTMGGACGYGNLYS  60

Query  246  QGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPND  422
            QGYGVN AALSTALFN GLSCG+CFEIKC+ D R C  GNPSI++TATNFCPPNFA P+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGSCFEIKCDQDPRWCNPGNPSILITATNFCPPNFAQPSD  120

Query  423  NGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            NGGWCNPPR HFDLAMPMFLKIA YRAGIVPV +RRVPCRK
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAQYRAGIVPVAYRRVPCRK  161



>gb|AEN70907.1| expansin [Gossypium armourianum]
Length=259

 Score =   253 bits (645),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 137/159 (86%), Gaps = 5/159 (3%)
 Frame = +3

Query  84   VFCIALFCFLTAV----RARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQG  251
            V  I++  F++++     ARIPGVY+ G WQ AHATFYGGADASGTM GACGYGNLY+QG
Sbjct  4    VNVISVLIFISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLYSQG  63

Query  252  YGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNG  428
            YGV+ AALSTALFN GLSCGACFEIKC +D + C +G+PSI +TATNFCPPN+ALPNDNG
Sbjct  64   YGVSTAALSTALFNNGLSCGACFEIKCGSDPKWCHSGSPSIFITATNFCPPNYALPNDNG  123

Query  429  GWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            GWCNPPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  124  GWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  162



>gb|ADY68815.1| expansin [Gossypium barbadense]
 gb|ADY68819.1| expansin [Gossypium hirsutum]
 gb|AEN70892.1| expansin [Gossypium laxum]
 gb|AEN70894.1| expansin [Gossypium turneri]
 gb|AEN70896.1| expansin [Gossypium mustelinum]
 gb|AEN70898.1| expansin [Gossypium darwinii]
 gb|AEN70902.1| expansin [Gossypium barbadense var. brasiliense]
 gb|AEN70904.1| expansin [Gossypium barbadense var. peruvianum]
 gb|AEN70906.1| expansin [Gossypium hirsutum subsp. latifolium]
 gb|AEN70908.1| expansin [Gossypium harknessii]
 gb|AEN70911.1| expansin [Gossypium aridum]
 gb|AEN70912.1| expansin [Gossypium gossypioides]
 gb|AEN70913.1| expansin [Gossypium lobatum]
Length=259

 Score =   252 bits (644),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 137/159 (86%), Gaps = 5/159 (3%)
 Frame = +3

Query  84   VFCIALFCFLTAV----RARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQG  251
            V  I++  F++++     ARIPGVY+ G WQ AHATFYGGADASGTM GACGYGNLY+QG
Sbjct  4    VNVISVLIFISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLYSQG  63

Query  252  YGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNG  428
            YGV+ AALSTALFN GLSCGACFEIKC +D + C +G+PSI +TATNFCPPN+ALPNDNG
Sbjct  64   YGVSTAALSTALFNNGLSCGACFEIKCGSDPKWCHSGSPSIFITATNFCPPNYALPNDNG  123

Query  429  GWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            GWCNPPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  124  GWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  162



>emb|CAA59470.1| orf [Pisum sativum]
Length=258

 Score =   252 bits (644),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 135/161 (84%), Gaps = 2/161 (1%)
 Frame = +3

Query  69   MAALRVFCIALFCFLTA-VRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYT  245
            MAA+ +  IA    L A   ARIPGVYT GPW  AHATFYGG+DASGTM GACGYGNLY+
Sbjct  1    MAAILLLTIASLTSLFAPTTARIPGVYTGGPWTSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  246  QGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPND  422
            QGYGVN AALSTALFN GLSCGACFE+KC+ D R C  GNPSI++TATNFCPPNFA P+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFELKCDQDPRWCNPGNPSILITATNFCPPNFAEPSD  120

Query  423  NGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            NGGWCNPPR HFDLAMPMFLKIA YRAGIVPV +RRVPCRK
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAQYRAGIVPVAYRRVPCRK  161



>emb|CBI16120.3| unnamed protein product [Vitis vinifera]
Length=277

 Score =   253 bits (646),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 136/161 (84%), Gaps = 2/161 (1%)
 Frame = +3

Query  69   MAALRVFCIA-LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYT  245
            MA   V C A L    + V+A+IPG Y+ G WQ AHATFYGG+DASGTM GACGYGNLY+
Sbjct  1    MAVGVVVCFASLISLFSLVQAKIPGAYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  246  QGYGVNNAALSTALFNTGLSCGACFEIKCNNDRS-CLAGNPSIVVTATNFCPPNFALPND  422
            QGYGVN AALSTALFN GLSCGACFE+KC ND + C +G+PSI++TATNFCPPN+ALP+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFELKCANDPTWCHSGSPSILITATNFCPPNYALPSD  120

Query  423  NGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            NGGWCNPPR HFDLAMPMFLKIA YRAGIVPV FRRVPCRK
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAFRRVPCRK  161



>ref|XP_010033123.1| PREDICTED: expansin-A4 [Eucalyptus grandis]
 gb|KCW52678.1| hypothetical protein EUGRSUZ_J02048 [Eucalyptus grandis]
Length=263

 Score =   252 bits (644),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 137/166 (83%), Gaps = 7/166 (4%)
 Frame = +3

Query  69   MAALRVFCIALFCF---LTAVR---ARIPGVYTSGPWQGAHATFYGGADASGTMAGACGY  230
            MAA RV  +AL      L+A R   ARIPG+YT GPWQ AHATFYGGADASGTM GACGY
Sbjct  1    MAAARVMALALAFLGVALSATRMAEARIPGIYTGGPWQSAHATFYGGADASGTMGGACGY  60

Query  231  GNLYTQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNF  407
            GNLY+QGYGVN AALSTALFN G SCGACFEIKC ND + C +G+ SI VTATNFCPPN+
Sbjct  61   GNLYSQGYGVNTAALSTALFNNGFSCGACFEIKCANDPQWCHSGSSSIFVTATNFCPPNY  120

Query  408  ALPNDNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            A P+DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV +RRVPCRK
Sbjct  121  AQPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRK  166



>ref|XP_006424843.1| hypothetical protein CICLE_v10029094mg [Citrus clementina]
 gb|ESR38083.1| hypothetical protein CICLE_v10029094mg [Citrus clementina]
Length=259

 Score =   252 bits (644),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 134/152 (88%), Gaps = 1/152 (1%)
 Frame = +3

Query  93   IALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVNNAA  272
            ++L C +    AR+PG Y+ GPWQ AHATFYGG+DASGTM GACGYGNLY+QGYGVN AA
Sbjct  11   LSLVCLMWVADARLPGDYSGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAA  70

Query  273  LSTALFNTGLSCGACFEIKCNNDRS-CLAGNPSIVVTATNFCPPNFALPNDNGGWCNPPR  449
            LSTALFN GLSCGACFEIKC N+ + C +G+PSI+VTATNFCPPN+ALP+DNGGWCNPPR
Sbjct  71   LSTALFNNGLSCGACFEIKCANEPAWCHSGSPSILVTATNFCPPNYALPSDNGGWCNPPR  130

Query  450  LHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
             HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  131  PHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  162



>ref|XP_006488339.1| PREDICTED: expansin-A4-like [Citrus sinensis]
 gb|KDO72838.1| hypothetical protein CISIN_1g046524mg [Citrus sinensis]
Length=259

 Score =   252 bits (644),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 134/152 (88%), Gaps = 1/152 (1%)
 Frame = +3

Query  93   IALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVNNAA  272
            ++L C +    AR+PG Y+ GPWQ AHATFYGG+DASGTM GACGYGNLY+QGYGVN AA
Sbjct  11   LSLVCLMWVADARLPGDYSGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAA  70

Query  273  LSTALFNTGLSCGACFEIKCNNDRS-CLAGNPSIVVTATNFCPPNFALPNDNGGWCNPPR  449
            LSTALFN GLSCGACFEIKC N+ + C +G+PSI+VTATNFCPPN+ALP+DNGGWCNPPR
Sbjct  71   LSTALFNNGLSCGACFEIKCANEPAWCHSGSPSILVTATNFCPPNYALPSDNGGWCNPPR  130

Query  450  LHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
             HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  131  PHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  162



>ref|XP_008802710.1| PREDICTED: expansin-A4 [Phoenix dactylifera]
Length=258

 Score =   252 bits (644),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 138/161 (86%), Gaps = 2/161 (1%)
 Frame = +3

Query  69   MAALRVFCIA-LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYT  245
            MA LR+  +A L  FL    ARIPGVY+ G WQ AHATFYGG+DASGTM GACGYGNLY+
Sbjct  1    MAILRLVALASLLAFLVPAAARIPGVYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  246  QGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPND  422
            QGYGV+ AALSTALFN GLSCGACFEIKC ++ + C +G+PSI +TATNFCPPN+ALP+D
Sbjct  61   QGYGVDTAALSTALFNDGLSCGACFEIKCADEPQWCHSGSPSIFITATNFCPPNYALPSD  120

Query  423  NGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            +GGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  121  DGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  161



>gb|ADC35365.1| alpha-expansin 2 [Coffea arabica]
Length=258

 Score =   252 bits (644),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 137/161 (85%), Gaps = 2/161 (1%)
 Frame = +3

Query  69   MAALRVFCI-ALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYT  245
            MAA+ + CI AL   LT   ARIPGVYT   W+ AHATFYGG+DASGTM GACGYGNLY+
Sbjct  1    MAAMGLTCIVALSLLLTLTEARIPGVYTGDSWESAHATFYGGSDASGTMGGACGYGNLYS  60

Query  246  QGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPND  422
            QGYGVN AALSTALFN G SCG+CFE+KC +D + C  G+PSI++TATNFCPPN+ALPND
Sbjct  61   QGYGVNTAALSTALFNNGFSCGSCFELKCADDPQWCHPGSPSILITATNFCPPNYALPND  120

Query  423  NGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            NGGWCNPPR HFDLAMPMFL+IA YRAGIVPV++RRVPCRK
Sbjct  121  NGGWCNPPRPHFDLAMPMFLRIAEYRAGIVPVSYRRVPCRK  161



>ref|XP_009349313.1| PREDICTED: expansin-A6-like [Pyrus x bretschneideri]
Length=260

 Score =   252 bits (644),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 132/155 (85%), Gaps = 3/155 (2%)
 Frame = +3

Query  90   CIA--LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVN  263
            CIA  +   +    ARIPGVYT G WQGAHATFYGG+DASGTM GACGYGNLY+QGYGVN
Sbjct  9    CIASLIISLMWVAEARIPGVYTGGAWQGAHATFYGGSDASGTMGGACGYGNLYSQGYGVN  68

Query  264  NAALSTALFNTGLSCGACFEIKCNNDRS-CLAGNPSIVVTATNFCPPNFALPNDNGGWCN  440
             AALSTALFN GLSCGACFE+KC +D S C AG PSI +TATNFCPPNFA P+DNGGWCN
Sbjct  69   TAALSTALFNNGLSCGACFELKCADDPSWCHAGGPSIFITATNFCPPNFAQPSDNGGWCN  128

Query  441  PPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            PPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  129  PPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  163



>ref|XP_002283530.1| PREDICTED: expansin-A4 [Vitis vinifera]
Length=258

 Score =   252 bits (644),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 136/161 (84%), Gaps = 2/161 (1%)
 Frame = +3

Query  69   MAALRVFCIA-LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYT  245
            MA   V C A L    + V+A+IPG Y+ G WQ AHATFYGG+DASGTM GACGYGNLY+
Sbjct  1    MAVGVVVCFASLISLFSLVQAKIPGAYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  246  QGYGVNNAALSTALFNTGLSCGACFEIKCNNDRS-CLAGNPSIVVTATNFCPPNFALPND  422
            QGYGVN AALSTALFN GLSCGACFE+KC ND + C +G+PSI++TATNFCPPN+ALP+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFELKCANDPTWCHSGSPSILITATNFCPPNYALPSD  120

Query  423  NGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            NGGWCNPPR HFDLAMPMFLKIA YRAGIVPV FRRVPCRK
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAFRRVPCRK  161



>gb|AEQ55290.1| expansin [Breonia chinensis]
Length=259

 Score =   252 bits (644),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 124/162 (77%), Positives = 135/162 (83%), Gaps = 3/162 (2%)
 Frame = +3

Query  69   MAALRVFCIALFCFLTAV--RARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLY  242
            MA + + CIA    L  +   ARIPGVYT G WQ AHATFYGG+DASGTM GACGYGNLY
Sbjct  1    MAVVGLVCIASVLALAGLVAEARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLY  60

Query  243  TQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPN  419
            +QGYGVN AALSTALFN+GL CGACFEIKC N+ + C  G+PSI VTATNFCPPN+ALPN
Sbjct  61   SQGYGVNTAALSTALFNSGLRCGACFEIKCANEPQWCHPGSPSIFVTATNFCPPNYALPN  120

Query  420  DNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV +RRVPCRK
Sbjct  121  DNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVTYRRVPCRK  162



>ref|XP_010685747.1| PREDICTED: expansin-A4 [Beta vulgaris subsp. vulgaris]
Length=261

 Score =   252 bits (644),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 132/155 (85%), Gaps = 1/155 (1%)
 Frame = +3

Query  84   VFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVN  263
            V  + L+   T V ARIPG Y  G WQ AHATFYGG+DASGTM GACGYGNLY+QGYGVN
Sbjct  10   VSLMTLWVTSTLVDARIPGNYQGGSWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVN  69

Query  264  NAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNGGWCN  440
             AALSTALFN+GLSCGACFE+KC ND R C  G+PSI++TATNFCPPNFALPNDNGGWCN
Sbjct  70   TAALSTALFNSGLSCGACFELKCANDPRWCHPGSPSILITATNFCPPNFALPNDNGGWCN  129

Query  441  PPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            PPR HFDLAMPMFLK+A YRAGIVPV FRRVPCRK
Sbjct  130  PPRPHFDLAMPMFLKLAQYRAGIVPVAFRRVPCRK  164



>gb|AEN70901.1| expansin [Gossypium barbadense var. brasiliense]
Length=259

 Score =   252 bits (644),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 137/159 (86%), Gaps = 5/159 (3%)
 Frame = +3

Query  84   VFCIALFCFLTAV----RARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQG  251
            V  I++  F++++     ARIPGVY+ G WQ AHATFYGGADASGTM GACGYGNLY+QG
Sbjct  4    VNVISVLIFISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLYSQG  63

Query  252  YGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNG  428
            YGV+ AALSTALFN GLSCGACFEIKC +D + C +G+PSI +TATNFCPPN+ALPNDNG
Sbjct  64   YGVSTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPNDNG  123

Query  429  GWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            GWCNPPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  124  GWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  162



>ref|XP_008384848.1| PREDICTED: expansin-A4 [Malus domestica]
Length=260

 Score =   252 bits (644),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 129/150 (86%), Gaps = 1/150 (1%)
 Frame = +3

Query  99   LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVNNAALS  278
            +   +    ARIPGVYT G WQGAHATFYGG+DASGTM GACGYGNLY+QGYGVN AALS
Sbjct  14   IISLMWVAEARIPGVYTGGAWQGAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALS  73

Query  279  TALFNTGLSCGACFEIKCNNDRS-CLAGNPSIVVTATNFCPPNFALPNDNGGWCNPPRLH  455
            TALFN GLSCGACFE+KC  D S C AG+PSI +TATNFCPPNFA P+DNGGWCNPPR H
Sbjct  74   TALFNNGLSCGACFELKCAEDPSWCHAGSPSIFITATNFCPPNFAQPSDNGGWCNPPRPH  133

Query  456  FDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            FDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  134  FDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  163



>ref|XP_009353647.1| PREDICTED: expansin-A6-like [Pyrus x bretschneideri]
 ref|XP_009349875.1| PREDICTED: expansin-A6-like [Pyrus x bretschneideri]
Length=260

 Score =   252 bits (643),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 132/155 (85%), Gaps = 3/155 (2%)
 Frame = +3

Query  90   CIA--LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVN  263
            CIA  +   +    ARIPGVYT G WQGAHATFYGG+DASGTM GACGYGNLY+QGYGVN
Sbjct  9    CIASLIISLMWVAEARIPGVYTGGAWQGAHATFYGGSDASGTMGGACGYGNLYSQGYGVN  68

Query  264  NAALSTALFNTGLSCGACFEIKCNNDRS-CLAGNPSIVVTATNFCPPNFALPNDNGGWCN  440
             AALSTALFN GLSCGACFE+KC +D S C AG PSI +TATNFCPPNFA P+DNGGWCN
Sbjct  69   TAALSTALFNNGLSCGACFELKCADDPSWCHAGGPSIFITATNFCPPNFAQPSDNGGWCN  128

Query  441  PPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            PPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  129  PPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  163



>ref|XP_008799850.1| PREDICTED: expansin-A6-like [Phoenix dactylifera]
Length=260

 Score =   252 bits (643),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 130/155 (84%), Gaps = 1/155 (1%)
 Frame = +3

Query  84   VFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVN  263
               + L  FLT   ARIPGVYT GPWQ AHATFYGG+DASGTM GACGYGNLY+QGYGV 
Sbjct  9    TLAMTLLAFLTLGDARIPGVYTGGPWQQAHATFYGGSDASGTMGGACGYGNLYSQGYGVE  68

Query  264  NAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNGGWCN  440
             AALSTALFN G SCGACFEIKC  D + C  G+PSI +TATNFCPPN+ALP+DNGGWCN
Sbjct  69   TAALSTALFNDGQSCGACFEIKCGEDLKWCHHGSPSIFITATNFCPPNYALPSDNGGWCN  128

Query  441  PPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            PPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  129  PPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  163



>gb|AEN70891.1| expansin [Gossypium thurberi]
Length=259

 Score =   252 bits (643),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 137/159 (86%), Gaps = 5/159 (3%)
 Frame = +3

Query  84   VFCIALFCFLTAV----RARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQG  251
            V  I++  F++++     ARIPGVY+ G WQ AHATFYGGADASGTM GACGYGNLY+QG
Sbjct  4    VNVISVLIFISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLYSQG  63

Query  252  YGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNG  428
            YGV+ AALSTALFN GLSCGACFEIKC +D + C +G+PSI +TATNFCPPN+ALPNDNG
Sbjct  64   YGVSTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPNDNG  123

Query  429  GWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            GWCNPPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  124  GWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  162



>gb|ADY68817.1| expansin [Gossypium raimondii]
Length=259

 Score =   252 bits (643),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 137/159 (86%), Gaps = 5/159 (3%)
 Frame = +3

Query  84   VFCIALFCFLTAV----RARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQG  251
            V  I++  F++++     ARIPGVY+ G WQ AHATFYGGADASGTM GACGYGNLY+QG
Sbjct  4    VNVISVLIFISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLYSQG  63

Query  252  YGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNG  428
            YGV+ AALSTALFN GLSCGACFEIKC +D + C +G+PSI +TATNFCPPN+ALPNDNG
Sbjct  64   YGVSTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPNDNG  123

Query  429  GWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            GWCNPPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  124  GWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  162



>gb|ADY68814.1| expansin [Gossypium barbadense]
 gb|ADY68816.1| expansin [Gossypium herbaceum subsp. africanum]
 gb|AEN70897.1| expansin [Gossypium darwinii]
 gb|AEN70899.1| expansin [Gossypium tomentosum]
 gb|AEN70903.1| expansin [Gossypium barbadense var. peruvianum]
 gb|AEN70905.1| expansin [Gossypium hirsutum subsp. latifolium]
 gb|AEN70909.1| expansin [Gossypium davidsonii]
 gb|AEN70910.1| expansin [Gossypium klotzschianum]
 gb|KJB20062.1| hypothetical protein B456_003G131000 [Gossypium raimondii]
Length=259

 Score =   252 bits (643),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 137/159 (86%), Gaps = 5/159 (3%)
 Frame = +3

Query  84   VFCIALFCFLTAV----RARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQG  251
            V  I++  F++++     ARIPGVY+ G WQ AHATFYGGADASGTM GACGYGNLY+QG
Sbjct  4    VNVISVLIFISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLYSQG  63

Query  252  YGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNG  428
            YGV+ AALSTALFN GLSCGACFEIKC +D + C +G+PSI +TATNFCPPN+ALPNDNG
Sbjct  64   YGVSTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPNDNG  123

Query  429  GWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            GWCNPPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  124  GWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  162



>gb|KDP44940.1| hypothetical protein JCGZ_01440 [Jatropha curcas]
Length=258

 Score =   252 bits (643),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 136/155 (88%), Gaps = 4/155 (3%)
 Frame = +3

Query  93   IALFCFLTAVR---ARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVN  263
            I++FC L  ++   ARIPGVY+ G W+ AHATFYGG+DASGTM GACGYGNLY+QGYGVN
Sbjct  7    ISIFCLLLVLKLADARIPGVYSGGSWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVN  66

Query  264  NAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNGGWCN  440
             AALSTALFN GLSCGACFEIKC N+ + C +G+PSI +TATNFCPPN+ALP+DNGGWCN
Sbjct  67   TAALSTALFNNGLSCGACFEIKCANEPQWCHSGSPSIFITATNFCPPNYALPSDNGGWCN  126

Query  441  PPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            PPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  127  PPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  161



>ref|XP_007141864.1| hypothetical protein PHAVU_008G232200g [Phaseolus vulgaris]
 gb|ESW13858.1| hypothetical protein PHAVU_008G232200g [Phaseolus vulgaris]
Length=260

 Score =   252 bits (643),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 137/164 (84%), Gaps = 4/164 (2%)
 Frame = +3

Query  57   KFMEMAALRVFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGN  236
             F ++ A+      L   L +  ARIPGVY  G W+ AHATFYGG+DASGTM GACGYGN
Sbjct  3    SFQKLLAIVSLVTVL---LASAEARIPGVYGGGAWETAHATFYGGSDASGTMGGACGYGN  59

Query  237  LYTQGYGVNNAALSTALFNTGLSCGACFEIKCNNDRS-CLAGNPSIVVTATNFCPPNFAL  413
            LY+QGYGVN AALSTALFN+GLSCGACFEIKC +D S C AG+PSI+VTATNFCPPN+AL
Sbjct  60   LYSQGYGVNTAALSTALFNSGLSCGACFEIKCADDPSWCHAGSPSILVTATNFCPPNYAL  119

Query  414  PNDNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            P+DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  120  PSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  163



>gb|KEH22886.1| expansin-A1-like protein [Medicago truncatula]
Length=258

 Score =   252 bits (643),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 134/161 (83%), Gaps = 2/161 (1%)
 Frame = +3

Query  69   MAALRVFCIA-LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYT  245
            MA + +  IA L     A  ARIPGVY+ GPW  AHATFYGG+DASGTM GACGYGNLY+
Sbjct  1    MAGILLLTIASLASLFAATTARIPGVYSGGPWTSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  246  QGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPND  422
            QGYGVN AALSTALFN GLSCGACFE+KC+ D R C  GNPSI++TATNFCPPNFA P+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFELKCDQDPRWCNPGNPSILITATNFCPPNFAQPSD  120

Query  423  NGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            NGGWCNPPR HFDLAMPMFLKIA YRAGIVPV +RRVPCRK
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAQYRAGIVPVAYRRVPCRK  161



>ref|XP_007163413.1| hypothetical protein PHAVU_001G232600g [Phaseolus vulgaris]
 gb|ESW35407.1| hypothetical protein PHAVU_001G232600g [Phaseolus vulgaris]
Length=258

 Score =   252 bits (643),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 137/161 (85%), Gaps = 2/161 (1%)
 Frame = +3

Query  69   MAALRVFCI-ALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYT  245
            M  L +F I +L  FLT  +A+IPG ++ GPWQ AHATFYGG+DASGTM GACGYGNLY+
Sbjct  1    MPMLNIFAIVSLLPFLTPSQAKIPGAFSGGPWQTAHATFYGGSDASGTMGGACGYGNLYS  60

Query  246  QGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPND  422
            QGYGVN AALSTALFN G SCGACF+IKC +D + CL GNPSI VTATNFCPPN+ALP+D
Sbjct  61   QGYGVNTAALSTALFNNGFSCGACFQIKCTHDPKWCLPGNPSIFVTATNFCPPNYALPSD  120

Query  423  NGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            NGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RRV CRK
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAQYRAGIVPVSYRRVGCRK  161



>gb|AEQ55275.1| expansin [Breonia chinensis]
Length=259

 Score =   251 bits (642),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/162 (77%), Positives = 135/162 (83%), Gaps = 3/162 (2%)
 Frame = +3

Query  69   MAALRVFCIALFCFLTAV--RARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLY  242
            MA + + CIA    L  +   ARIPGVYT G WQ AHATFYGG+DASGTM GACGYGNLY
Sbjct  1    MAIVGLVCIASVLALAGLVAEARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLY  60

Query  243  TQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPN  419
            +QGYGVN AALSTALFN+GL CGACFEIKC N+ + C  G+PSI VTATNFCPPN+ALPN
Sbjct  61   SQGYGVNTAALSTALFNSGLRCGACFEIKCANEPQWCHPGSPSIFVTATNFCPPNYALPN  120

Query  420  DNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV +RRVPCRK
Sbjct  121  DNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVTYRRVPCRK  162



>gb|KHG20113.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=259

 Score =   251 bits (642),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 133/162 (82%), Gaps = 1/162 (1%)
 Frame = +3

Query  63   MEMAALRVFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLY  242
            M +A      +     +    ARIPGVY+ G WQ AHATFYGG+DASGTM GACGYGNLY
Sbjct  1    MGIAGAVCIIVGFISSMWMAEARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLY  60

Query  243  TQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPN  419
            +QGYGVN AALSTALFN GLSCGACFEIKC +D + C +G+PSI +TATNFCPPN+ALPN
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPN  120

Query  420  DNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  121  DNGGWCNPPRSHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  162



>ref|XP_004154408.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 ref|XP_004173564.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 gb|KGN65728.1| hypothetical protein Csa_1G522540 [Cucumis sativus]
Length=259

 Score =   251 bits (642),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 134/156 (86%), Gaps = 2/156 (1%)
 Frame = +3

Query  84   VFCIA-LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGV  260
            + CIA L   +    ARIPG+Y+ GPW+ AHATFYGG+DASGTM GACGYGNLY+QGYGV
Sbjct  7    LLCIASLISTMWPAAARIPGIYSGGPWESAHATFYGGSDASGTMGGACGYGNLYSQGYGV  66

Query  261  NNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNGGWC  437
            N AALSTALFN GLSCGACFEIKC ND R C +G+PSIV+TATNFCPPNFALP+DNGGWC
Sbjct  67   NTAALSTALFNNGLSCGACFEIKCANDPRWCHSGSPSIVITATNFCPPNFALPSDNGGWC  126

Query  438  NPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            NPPR HFDLAMPMFLKIA YRAGIVPV +RRV CRK
Sbjct  127  NPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVGCRK  162



>gb|AAL31477.1|AF319472_1 alpha-expansin 6 precursor [Cucumis sativus]
Length=259

 Score =   251 bits (642),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 134/156 (86%), Gaps = 2/156 (1%)
 Frame = +3

Query  84   VFCIA-LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGV  260
            + CIA L   +    ARIPG+Y+ GPW+ AHATFYGG+DASGTM GACGYGNLY+QGYGV
Sbjct  7    LLCIASLISTMWPAAARIPGIYSGGPWESAHATFYGGSDASGTMGGACGYGNLYSQGYGV  66

Query  261  NNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNGGWC  437
            N AALSTALFN GLSCGACFEIKC ND R C +G+PSIV+TATNFCPPNFALP+DNGGWC
Sbjct  67   NTAALSTALFNNGLSCGACFEIKCANDPRWCHSGSPSIVITATNFCPPNFALPSDNGGWC  126

Query  438  NPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            NPPR HFDLAMPMFLKIA YRAGIVPV +RRV CRK
Sbjct  127  NPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVGCRK  162



>ref|XP_002881524.1| ATEXPA3 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002881525.1| ATEXPA3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57783.1| ATEXPA3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57784.1| ATEXPA3 [Arabidopsis lyrata subsp. lyrata]
Length=262

 Score =   251 bits (642),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 134/158 (85%), Gaps = 2/158 (1%)
 Frame = +3

Query  75   ALRVFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGY  254
             L +   A F F TA  A+IPGVY+ GPWQ AHATFYGG+DASGTM GACGYGNLY+QGY
Sbjct  9    GLWLAVTASFLF-TASNAKIPGVYSGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQGY  67

Query  255  GVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNGG  431
            GVN AALSTALFN G SCGACFEIKC +D R C+ GNPSI+VTATNFCPPNFA P+D+GG
Sbjct  68   GVNTAALSTALFNNGFSCGACFEIKCTDDPRWCVPGNPSILVTATNFCPPNFAQPSDDGG  127

Query  432  WCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            WCNPPR HFDLAMPMFLKI  YRAGIVPV++RRVPCRK
Sbjct  128  WCNPPREHFDLAMPMFLKIGLYRAGIVPVSYRRVPCRK  165



>gb|EYU26594.1| hypothetical protein MIMGU_mgv1a012061mg [Erythranthe guttata]
Length=262

 Score =   251 bits (642),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 136/161 (84%), Gaps = 3/161 (2%)
 Frame = +3

Query  72   AALRVFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQG  251
            A L ++  ++ CF+T  RA+I GVY  GPWQ AHATFYGG+DASGTM GACGYGNLY+QG
Sbjct  5    ATLLLYIGSILCFITTARAKIFGVYAGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQG  64

Query  252  YGVNNAALSTALFNTGLSCGACFEIKCN---NDRSCLAGNPSIVVTATNFCPPNFALPND  422
            YGVN AALSTALFN GLSCGACFEIKC+   + +SC  G+PSI++TATNFCPPN ALPND
Sbjct  65   YGVNTAALSTALFNNGLSCGACFEIKCDAAQDSKSCNPGSPSILITATNFCPPNNALPND  124

Query  423  NGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            NGGWCNPPR HFDLA+PMF+KIA +RAGIV VN+RRV CRK
Sbjct  125  NGGWCNPPRTHFDLAVPMFIKIAEFRAGIVAVNYRRVACRK  165



>ref|XP_008240857.1| PREDICTED: expansin-A6-like [Prunus mume]
Length=258

 Score =   251 bits (641),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 135/161 (84%), Gaps = 2/161 (1%)
 Frame = +3

Query  69   MAALRVFCIA-LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYT  245
            MA + + CIA L     A  ARI G  T GPW+GAHATFYGG+DASGTM GACGYGNLY+
Sbjct  1    MAFVHMLCIASLLSLFMAANARIRGFDTGGPWEGAHATFYGGSDASGTMGGACGYGNLYS  60

Query  246  QGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPND  422
            +GYGVN AALSTALFN GLSCGACFEIKC +D + C  GNPSI +TATNFCPPN+ALPND
Sbjct  61   EGYGVNTAALSTALFNNGLSCGACFEIKCGDDPKWCHPGNPSIFITATNFCPPNYALPND  120

Query  423  NGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            +GGWCNPPR HFDLAMPMFL+IA Y+AGIVPV+FRRVPCRK
Sbjct  121  DGGWCNPPRTHFDLAMPMFLQIAEYKAGIVPVSFRRVPCRK  161



>gb|KHN30166.1| Expansin-A4 [Glycine soja]
Length=292

 Score =   252 bits (644),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 134/160 (84%), Gaps = 4/160 (3%)
 Frame = +3

Query  78   LRVFCIALFCFLT---AVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQ  248
            + VF   L C ++    V ARIPGVY+ G WQ AHATFYGG+DASGTM GACGYGNLY+Q
Sbjct  1    MGVFSTVLLCLMSLMWMVDARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQ  60

Query  249  GYGVNNAALSTALFNTGLSCGACFEIKCNNDRS-CLAGNPSIVVTATNFCPPNFALPNDN  425
            GYGVN AALSTALFN+GLSCGACFEIKC ND+  C +G+PSI +TATNFCP N+ALPNDN
Sbjct  61   GYGVNTAALSTALFNSGLSCGACFEIKCANDKQWCHSGSPSIFITATNFCPSNYALPNDN  120

Query  426  GGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            GGWCNPPR HFDLAMPMFLKIA YRAGIVPV FRRV CRK
Sbjct  121  GGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAFRRVACRK  160



>gb|KDP20458.1| hypothetical protein JCGZ_05303 [Jatropha curcas]
Length=260

 Score =   251 bits (640),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 134/163 (82%), Gaps = 4/163 (2%)
 Frame = +3

Query  69   MAALRVFCIA---LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNL  239
            MA +R+  +A   +        ARIPG Y  G WQ AHATFYGG+DASGTM GACGYGNL
Sbjct  1    MAMVRMLSVASVVMSLMWVVAEARIPGNYMGGAWQTAHATFYGGSDASGTMGGACGYGNL  60

Query  240  YTQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALP  416
            Y+QGYGVN AALSTALFN GLSCGACFEIKC ND + C +G+PSI +TATNFCPPN+ALP
Sbjct  61   YSQGYGVNTAALSTALFNNGLSCGACFEIKCANDPQWCHSGSPSIFITATNFCPPNYALP  120

Query  417  NDNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            NDNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  121  NDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  163



>ref|XP_002309061.1| expansin family protein [Populus trichocarpa]
 gb|ABK94860.1| unknown [Populus trichocarpa]
 gb|EEE92584.1| expansin family protein [Populus trichocarpa]
Length=260

 Score =   251 bits (640),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 136/166 (82%), Gaps = 8/166 (5%)
 Frame = +3

Query  63   MEMAALRVFCIALFCFLTAV----RARIPGVYTSGPWQGAHATFYGGADASGTMAGACGY  230
            M    L + CI    FLT+V     ARIPGV+T GPW+ AHATFYGG+DASGTM GACGY
Sbjct  1    MAHHRLGLLCIV---FLTSVFVLAHARIPGVFTGGPWESAHATFYGGSDASGTMGGACGY  57

Query  231  GNLYTQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNF  407
            GNLY+QGYGVN AALSTALFN GLSCGACFEIKC +D R C  GNPSI+VTATNFCPPNF
Sbjct  58   GNLYSQGYGVNTAALSTALFNNGLSCGACFEIKCADDPRWCNPGNPSILVTATNFCPPNF  117

Query  408  ALPNDNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            A P+DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV  RRVPCRK
Sbjct  118  AQPSDNGGWCNPPRPHFDLAMPMFLKIAQYRAGIVPVAHRRVPCRK  163



>emb|CAN73252.1| hypothetical protein VITISV_027049 [Vitis vinifera]
Length=247

 Score =   250 bits (639),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 128/142 (90%), Gaps = 1/142 (1%)
 Frame = +3

Query  123  RARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVNNAALSTALFNTGL  302
             ARIPGVYT G WQ AHATFYGG+DASGTM GACGYGNLY+QGYGVN AALSTALFN GL
Sbjct  9    EARIPGVYTGGGWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  68

Query  303  SCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNGGWCNPPRLHFDLAMPMF  479
            SCGACFE+KC ND   C +G+PSI++TATNFCPPN+ALP+DNGGWCNPPR HFDLAMPMF
Sbjct  69   SCGACFELKCANDPEWCHSGSPSILITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMF  128

Query  480  LKIAAYRAGIVPVNFRRVPCRK  545
            LKIA YRAGIVPV+FRRVPCRK
Sbjct  129  LKIAEYRAGIVPVSFRRVPCRK  150



>gb|ACO07292.1| expansin 10 [Cucumis sativus]
Length=259

 Score =   251 bits (640),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 126/142 (89%), Gaps = 1/142 (1%)
 Frame = +3

Query  123  RARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVNNAALSTALFNTGL  302
             ARIPGVY+ GPWQ AHATFYGG+DASGTM GACGYGNLY+QGYGVN AALSTALFN GL
Sbjct  21   HARIPGVYSGGPWQDAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  80

Query  303  SCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNGGWCNPPRLHFDLAMPMF  479
            SCGACFEIKC ND R C  G+PSI +TATNFCPPNFALPNDNGGWC PPR HFD AMPMF
Sbjct  81   SCGACFEIKCANDPRWCHPGSPSIFITATNFCPPNFALPNDNGGWCTPPRTHFDFAMPMF  140

Query  480  LKIAAYRAGIVPVNFRRVPCRK  545
            LKIA YRAGIVPV++RRVPCRK
Sbjct  141  LKIAEYRAGIVPVSYRRVPCRK  162



>gb|AAP48989.1| expansin [Sambucus nigra]
Length=256

 Score =   251 bits (640),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 134/162 (83%), Gaps = 4/162 (2%)
 Frame = +3

Query  63   MEMAALRVFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLY  242
            M +A +    I+LF   + V ARIPG Y  G W+ AHATFYGG+DASGTM GACGYGNLY
Sbjct  1    MSLACIASLVISLF---SVVEARIPGNYGGGAWESAHATFYGGSDASGTMGGACGYGNLY  57

Query  243  TQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPN  419
            +QGYGVN AALSTALFN G SCGACFEIKC ND   C +G+PSI+VTATNFCPPN+ALPN
Sbjct  58   SQGYGVNTAALSTALFNKGESCGACFEIKCANDPNWCHSGSPSIMVTATNFCPPNYALPN  117

Query  420  DNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV +RRVPCRK
Sbjct  118  DNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRK  159



>gb|ADY68818.1| expansin [Gossypium hirsutum]
Length=259

 Score =   251 bits (640),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 136/159 (86%), Gaps = 5/159 (3%)
 Frame = +3

Query  84   VFCIALFCFLTAV----RARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQG  251
            V  I++  F++++     ARIPGVY+ G WQ AHATFYGGADASGTM GACGYGNLY QG
Sbjct  4    VNVISVLIFISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLYGQG  63

Query  252  YGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNG  428
            YGV+ AALSTALFN GLSCGACFEIKC +D + C +G+PSI +TATNFCPPN+ALPNDNG
Sbjct  64   YGVSTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPNDNG  123

Query  429  GWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            GWCNPPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  124  GWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  162



>gb|ABK93258.1| unknown [Populus trichocarpa]
Length=182

 Score =   248 bits (633),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 137/165 (83%), Gaps = 4/165 (2%)
 Frame = +3

Query  63   MEMAALRVFCIALFCFLTAV---RARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYG  233
            M M +L  F  +L   ++ +    ARIPGVY+ G WQ AHATFYGGADASGTM GACGYG
Sbjct  1    MAMGSLLCFTTSLLIMMSLMWKGEARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYG  60

Query  234  NLYTQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFA  410
            NLY+QGYGV+ AALSTALFN GLSCGACFEIKC +D + C +G+PSI++TATNFCPPN+A
Sbjct  61   NLYSQGYGVSTAALSTALFNNGLSCGACFEIKCADDPQWCHSGSPSILITATNFCPPNYA  120

Query  411  LPNDNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            LP+DNGGWCNPPR HFDLAMPMFLKIA Y AGIVPV +RRVPCRK
Sbjct  121  LPSDNGGWCNPPRPHFDLAMPMFLKIAEYHAGIVPVAYRRVPCRK  165



>gb|AEN70900.1| expansin [Gossypium tomentosum]
Length=259

 Score =   251 bits (640),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 136/159 (86%), Gaps = 5/159 (3%)
 Frame = +3

Query  84   VFCIALFCFLTAV----RARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQG  251
            V  I++  F++++     ARIPGVY+ G WQ AHAT YGGADASGTM GACGYGNLY+QG
Sbjct  4    VNVISVLIFISSMWMMGEARIPGVYSGGAWQNAHATLYGGADASGTMGGACGYGNLYSQG  63

Query  252  YGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNG  428
            YGV+ AALSTALFN GLSCGACFEIKC +D + C +G+PSI +TATNFCPPN+ALPNDNG
Sbjct  64   YGVSTAALSTALFNNGLSCGACFEIKCGSDPKWCHSGSPSIFITATNFCPPNYALPNDNG  123

Query  429  GWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            GWCNPPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  124  GWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  162



>ref|XP_011035307.1| PREDICTED: expansin-A6 [Populus euphratica]
Length=262

 Score =   250 bits (639),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 138/165 (84%), Gaps = 4/165 (2%)
 Frame = +3

Query  63   MEMAALRVFCIALFCFLTAV---RARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYG  233
            M M++L     +L   ++++    ARIPGVY+ G WQ AHATFYGGADASGTM GACGYG
Sbjct  1    MAMSSLICIATSLLIIMSSLWMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYG  60

Query  234  NLYTQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFA  410
            NLY+QGYGV+ AALSTALFN GLSCG+CFEIKC +D R C +G+PSI +TATNFCPPN+A
Sbjct  61   NLYSQGYGVSTAALSTALFNNGLSCGSCFEIKCASDPRWCHSGSPSIFITATNFCPPNYA  120

Query  411  LPNDNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            LP+DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV +RRVPCRK
Sbjct  121  LPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRK  165



>gb|AFK34565.1| unknown [Medicago truncatula]
Length=191

 Score =   248 bits (633),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 136/164 (83%), Gaps = 4/164 (2%)
 Frame = +3

Query  63   MEMAALRVFCIALFCFLTA--VRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGN  236
            M M ++ V+ + L   LT   V ARIPGVY  G WQ AHATFYGG+DASGTM GACGYGN
Sbjct  1    MGMVSM-VYVVTLIMSLTMWMVDARIPGVYNGGAWQTAHATFYGGSDASGTMGGACGYGN  59

Query  237  LYTQGYGVNNAALSTALFNTGLSCGACFEIKCNNDRS-CLAGNPSIVVTATNFCPPNFAL  413
            LY+QGYGVN AALSTALFN GLSCG+CFE+KC ND+  C +G+PSI +TATNFCPPNFA 
Sbjct  60   LYSQGYGVNTAALSTALFNNGLSCGSCFELKCANDKQWCHSGSPSIFITATNFCPPNFAQ  119

Query  414  PNDNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            P+DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV FRRVPCRK
Sbjct  120  PSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAFRRVPCRK  163



>ref|XP_009409516.1| PREDICTED: expansin-A6-like [Musa acuminata subsp. malaccensis]
Length=261

 Score =   250 bits (639),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 118/141 (84%), Positives = 126/141 (89%), Gaps = 1/141 (1%)
 Frame = +3

Query  126  ARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVNNAALSTALFNTGLS  305
            ARIPGVYT GPWQ AHATFYGG+DASGTM GACGYGNLY+QGYGV  AALSTAL+N GL 
Sbjct  24   ARIPGVYTGGPWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAALSTALYNDGLR  83

Query  306  CGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNGGWCNPPRLHFDLAMPMFL  482
            CGACFEIKC +D R C  GNPSI +TATNFCPPN+ALP+DNGGWCNPPR HFDLAMPMFL
Sbjct  84   CGACFEIKCADDPRWCKGGNPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFL  143

Query  483  KIAAYRAGIVPVNFRRVPCRK  545
            KIA YRAGIVPV+FRRVPCRK
Sbjct  144  KIAEYRAGIVPVSFRRVPCRK  164



>ref|XP_010414459.1| PREDICTED: expansin-A6-like [Camelina sativa]
Length=257

 Score =   250 bits (638),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 135/162 (83%), Gaps = 3/162 (2%)
 Frame = +3

Query  63   MEMAALRVFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLY  242
            M M +L +F + +   L  + ARIPGVY  G W+ AHATFYGG+DASGTM GACGYGNLY
Sbjct  1    MTMLSLVLFVLTIL--LATIEARIPGVYNGGGWETAHATFYGGSDASGTMGGACGYGNLY  58

Query  243  TQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPN  419
            +QGYGVN AALSTALFN G SCGACFE+KC +D R C +G+PSI VTATNFCPPNFA P+
Sbjct  59   SQGYGVNTAALSTALFNNGFSCGACFELKCASDPRWCHSGSPSIFVTATNFCPPNFAQPS  118

Query  420  DNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV+FRRVPCRK
Sbjct  119  DNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRK  160



>ref|XP_010264435.1| PREDICTED: expansin-A4 [Nelumbo nucifera]
Length=260

 Score =   250 bits (638),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 128/143 (90%), Gaps = 1/143 (1%)
 Frame = +3

Query  120  VRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVNNAALSTALFNTG  299
            V ARIPGVY+ GPWQ AHATFYGG+DASGTM GACGYGNLY+QGYGVN AALSTALFN G
Sbjct  21   VDARIPGVYSGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNG  80

Query  300  LSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNGGWCNPPRLHFDLAMPM  476
            LSCGACFEIKC ND + C  G PSI++TATNFCPPNFALP+DNGGWCNPPR HFDLAMPM
Sbjct  81   LSCGACFEIKCANDPQWCHPGGPSILITATNFCPPNFALPSDNGGWCNPPRPHFDLAMPM  140

Query  477  FLKIAAYRAGIVPVNFRRVPCRK  545
            FLKIA YRAGIVPV +RRVPCRK
Sbjct  141  FLKIAEYRAGIVPVAYRRVPCRK  163



>emb|CDX80810.1| BnaC03g00640D [Brassica napus]
Length=261

 Score =   250 bits (638),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 133/160 (83%), Gaps = 2/160 (1%)
 Frame = +3

Query  69   MAALRVFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQ  248
            M A+ +  +A    LT V A+IPGVYT GPW  AHATFYG ADASGTM GACGYGNLY+Q
Sbjct  6    MTAMAIMVVAALT-LTTVNAKIPGVYTGGPWVNAHATFYGEADASGTMGGACGYGNLYSQ  64

Query  249  GYGVNNAALSTALFNTGLSCGACFEIKCNNDRS-CLAGNPSIVVTATNFCPPNFALPNDN  425
            GYGVN AALSTALFN GLSCGACFE+KC ND   CL GNPSI++TATNFCPPNFA  +DN
Sbjct  65   GYGVNTAALSTALFNNGLSCGACFELKCVNDPGWCLPGNPSILITATNFCPPNFAQASDN  124

Query  426  GGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            GGWCNPPR HFDLAMPMFL IA Y+AGIVPV++RR+PCRK
Sbjct  125  GGWCNPPREHFDLAMPMFLSIAKYKAGIVPVSYRRIPCRK  164



>ref|XP_008343537.1| PREDICTED: expansin-A4-like [Malus domestica]
Length=261

 Score =   250 bits (638),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 137/164 (84%), Gaps = 5/164 (3%)
 Frame = +3

Query  69   MAALR-VFCIALFCFLTA---VRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGN  236
            MAA+  + CIA    L +   V ARIPGVYT G WQ AHATFYGG+DASGTM GACGYGN
Sbjct  1    MAAMAPLLCIASLMALASTIVVEARIPGVYTGGAWQDAHATFYGGSDASGTMGGACGYGN  60

Query  237  LYTQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFAL  413
            LY+QGYGVN AALSTALFN GLSCGACFE+KC N  + C +G+PSI VTATNFCPPNFA 
Sbjct  61   LYSQGYGVNTAALSTALFNNGLSCGACFELKCANQPQWCKSGSPSIFVTATNFCPPNFAQ  120

Query  414  PNDNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            P+D+GGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  121  PSDDGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  164



>gb|KEH39447.1| expansin A10 [Medicago truncatula]
Length=260

 Score =   250 bits (638),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 136/164 (83%), Gaps = 4/164 (2%)
 Frame = +3

Query  63   MEMAALRVFCIALFCFLTA--VRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGN  236
            M M ++ V+ + L   LT   V ARIPGVY  G WQ AHATFYGG+DASGTM GACGYGN
Sbjct  1    MGMVSM-VYVVTLIMSLTMWMVDARIPGVYNGGAWQTAHATFYGGSDASGTMGGACGYGN  59

Query  237  LYTQGYGVNNAALSTALFNTGLSCGACFEIKCNNDRS-CLAGNPSIVVTATNFCPPNFAL  413
            LY+QGYGVN AALSTALFN GLSCG+CFE+KC ND+  C +G+PSI +TATNFCPPNFA 
Sbjct  60   LYSQGYGVNTAALSTALFNNGLSCGSCFELKCANDKQWCHSGSPSIFITATNFCPPNFAQ  119

Query  414  PNDNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            P+DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV FRRVPCRK
Sbjct  120  PSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAFRRVPCRK  163



>gb|AAL31480.1|AF319475_1 alpha-expansin 9 precursor [Cucumis sativus]
Length=245

 Score =   249 bits (637),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 129/143 (90%), Gaps = 1/143 (1%)
 Frame = +3

Query  120  VRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVNNAALSTALFNTG  299
            V ARIPGVY+ G WQ AHATFYGG+DASGTM GACGYGNLY+QGYGVN AALSTALFN G
Sbjct  20   VHARIPGVYSGGQWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNG  79

Query  300  LSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNGGWCNPPRLHFDLAMPM  476
            LSCGACFE+KC ND + C +G+PSI +TATNFCPPN+ALP+DNGGWCNPPR HFDLAMPM
Sbjct  80   LSCGACFELKCANDPQWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPM  139

Query  477  FLKIAAYRAGIVPVNFRRVPCRK  545
            FLKIA YRAGIVPV++RRVPCRK
Sbjct  140  FLKIAEYRAGIVPVSYRRVPCRK  162



>ref|XP_004486999.1| PREDICTED: expansin-A6-like [Cicer arietinum]
Length=257

 Score =   250 bits (638),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 133/156 (85%), Gaps = 2/156 (1%)
 Frame = +3

Query  84   VFCIALFCFLTAV-RARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGV  260
            V+ ++L   LT +  +RIPG Y  G W+ AHATFYGG+DASGTM GACGYGNLY+QGYGV
Sbjct  5    VYIVSLIMSLTWLAESRIPGNYNGGAWETAHATFYGGSDASGTMGGACGYGNLYSQGYGV  64

Query  261  NNAALSTALFNTGLSCGACFEIKCNNDRS-CLAGNPSIVVTATNFCPPNFALPNDNGGWC  437
            N AALSTALFN GLSCGACFEIKC ND+  C +G+PSI +TATNFCPPN+ALPNDNGGWC
Sbjct  65   NTAALSTALFNKGLSCGACFEIKCANDKEWCHSGSPSIFITATNFCPPNYALPNDNGGWC  124

Query  438  NPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            NPPR HFDLAMPMFLKIA YRAGIVPV FRRVPCRK
Sbjct  125  NPPRPHFDLAMPMFLKIAEYRAGIVPVAFRRVPCRK  160



>ref|XP_009130690.1| PREDICTED: expansin-A9-like [Brassica rapa]
 emb|CDY55128.1| BnaA03g55050D [Brassica napus]
Length=261

 Score =   250 bits (638),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 133/160 (83%), Gaps = 2/160 (1%)
 Frame = +3

Query  69   MAALRVFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQ  248
            M A+ +  +A    LT V A+IPGVYT GPW  AHATFYG ADASGTM GACGYGNLY+Q
Sbjct  6    MTAMAIMVVAALT-LTTVNAKIPGVYTGGPWVNAHATFYGEADASGTMGGACGYGNLYSQ  64

Query  249  GYGVNNAALSTALFNTGLSCGACFEIKCNNDRS-CLAGNPSIVVTATNFCPPNFALPNDN  425
            GYGVN AALSTALFN GLSCGACFE+KC ND   CL GNPSI++TATNFCPPNFA  +DN
Sbjct  65   GYGVNTAALSTALFNNGLSCGACFELKCVNDPGWCLPGNPSILITATNFCPPNFAQASDN  124

Query  426  GGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            GGWCNPPR HFDLAMPMFL IA Y+AGIVPV++RR+PCRK
Sbjct  125  GGWCNPPREHFDLAMPMFLSIAKYKAGIVPVSYRRIPCRK  164



>ref|XP_003597354.1| Cell wall protein Exp5 [Medicago truncatula]
Length=180

 Score =   247 bits (630),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 136/164 (83%), Gaps = 4/164 (2%)
 Frame = +3

Query  63   MEMAALRVFCIALFCFLTA--VRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGN  236
            M M ++ V+ + L   LT   V ARIPGVY  G WQ AHATFYGG+DASGTM GACGYGN
Sbjct  1    MGMVSM-VYVVTLIMSLTMWMVDARIPGVYNGGAWQTAHATFYGGSDASGTMGGACGYGN  59

Query  237  LYTQGYGVNNAALSTALFNTGLSCGACFEIKCNNDRS-CLAGNPSIVVTATNFCPPNFAL  413
            LY+QGYGVN AALSTALFN GLSCG+CFE+KC ND+  C +G+PSI +TATNFCPPNFA 
Sbjct  60   LYSQGYGVNTAALSTALFNNGLSCGSCFELKCANDKQWCHSGSPSIFITATNFCPPNFAQ  119

Query  414  PNDNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            P+DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV FRRVPCRK
Sbjct  120  PSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAFRRVPCRK  163



>ref|XP_002298353.1| alpha-expansin 1 family protein [Populus trichocarpa]
 gb|ABK92494.1| unknown [Populus trichocarpa]
 gb|EEE83158.1| alpha-expansin 1 family protein [Populus trichocarpa]
Length=262

 Score =   250 bits (638),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 138/165 (84%), Gaps = 4/165 (2%)
 Frame = +3

Query  63   MEMAALRVFCIALFCFLTAV---RARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYG  233
            M M++L     +L   ++++    ARIPGVY+ G WQ AHATFYGGADASGTM GACGYG
Sbjct  1    MAMSSLICIATSLLIIMSSLWMAEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYG  60

Query  234  NLYTQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFA  410
            NLY+QGYGV+ AALSTALFN GL+CG+CFEIKC +D R C +G+PSI +TATNFCPPN+A
Sbjct  61   NLYSQGYGVSTAALSTALFNNGLTCGSCFEIKCASDPRWCHSGSPSIFITATNFCPPNYA  120

Query  411  LPNDNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            LP+DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV +RRVPCRK
Sbjct  121  LPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRK  165



>ref|XP_003616412.1| Expansin [Medicago truncatula]
 gb|AES99370.1| expansin A10 [Medicago truncatula]
Length=259

 Score =   249 bits (637),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 135/162 (83%), Gaps = 3/162 (2%)
 Frame = +3

Query  69   MAALRVFCIALFC--FLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLY  242
            M  L +  I  F    LT+  AR+PGVY+ G WQ AHATFYGG+DASGTM GACGYGNLY
Sbjct  1    MTKLNITTIFSFLALLLTSTEARLPGVYSGGAWQTAHATFYGGSDASGTMGGACGYGNLY  60

Query  243  TQGYGVNNAALSTALFNTGLSCGACFEIKCNNDRS-CLAGNPSIVVTATNFCPPNFALPN  419
            +QGYGVN AALSTALFN GLSCG+CFE+KC+ND S C  G+PSI+VTATNFCPPNFA  +
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGSCFELKCSNDPSWCHPGSPSILVTATNFCPPNFAQAS  120

Query  420  DNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  121  DNGGWCNPPRPHFDLAMPMFLKIAQYRAGIVPVSYRRVPCRK  162



>ref|XP_008461679.1| PREDICTED: expansin-A4 [Cucumis melo]
Length=260

 Score =   249 bits (637),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 129/143 (90%), Gaps = 1/143 (1%)
 Frame = +3

Query  120  VRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVNNAALSTALFNTG  299
            V ARIPGVY+ G WQ AHATFYGG+DASGTM GACGYGNLY+QGYGVN AALSTALFN G
Sbjct  21   VHARIPGVYSGGQWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNG  80

Query  300  LSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNGGWCNPPRLHFDLAMPM  476
            LSCGACFE+KC ND + C +G+PSI +TATNFCPPN+ALP+DNGGWCNPPR HFDLAMPM
Sbjct  81   LSCGACFELKCANDPQWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPM  140

Query  477  FLKIAAYRAGIVPVNFRRVPCRK  545
            FLKIA YRAGIVPV++RRVPCRK
Sbjct  141  FLKIAEYRAGIVPVSYRRVPCRK  163



>ref|XP_002313434.1| alpha-expansin 1 family protein [Populus trichocarpa]
 gb|EEE87389.1| alpha-expansin 1 family protein [Populus trichocarpa]
Length=262

 Score =   249 bits (637),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 137/165 (83%), Gaps = 4/165 (2%)
 Frame = +3

Query  63   MEMAALRVFCIALFCFLTAV---RARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYG  233
            M M +L  F  +L   ++ +    ARIPGVY+ G WQ AHATFYGGADASGTM GACGYG
Sbjct  1    MAMGSLLCFTTSLLIMMSLMWKGEARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYG  60

Query  234  NLYTQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFA  410
            NLY+QGYGV+ AALSTALFN GLSCGACFEIKC +D + C +G+PSI++TATNFCPPN+A
Sbjct  61   NLYSQGYGVSTAALSTALFNNGLSCGACFEIKCADDPQWCHSGSPSILITATNFCPPNYA  120

Query  411  LPNDNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            LP+DNGGWCNPPR HFDLAMPMFLKIA Y AGIVPV +RRVPCRK
Sbjct  121  LPSDNGGWCNPPRPHFDLAMPMFLKIAEYHAGIVPVAYRRVPCRK  165



>ref|XP_004147685.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 ref|XP_004161909.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 gb|KGN50556.1| hypothetical protein Csa_5G182120 [Cucumis sativus]
Length=259

 Score =   249 bits (636),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 129/143 (90%), Gaps = 1/143 (1%)
 Frame = +3

Query  120  VRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVNNAALSTALFNTG  299
            V ARIPGVY+ G WQ AHATFYGG+DASGTM GACGYGNLY+QGYGVN AALSTALFN G
Sbjct  20   VHARIPGVYSGGQWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNG  79

Query  300  LSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNGGWCNPPRLHFDLAMPM  476
            LSCGACFE+KC ND + C +G+PSI +TATNFCPPN+ALP+DNGGWCNPPR HFDLAMPM
Sbjct  80   LSCGACFELKCANDPQWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPM  139

Query  477  FLKIAAYRAGIVPVNFRRVPCRK  545
            FLKIA YRAGIVPV++RRVPCRK
Sbjct  140  FLKIAEYRAGIVPVSYRRVPCRK  162



>ref|XP_009357738.1| PREDICTED: expansin-A4-like [Pyrus x bretschneideri]
 ref|XP_009357739.1| PREDICTED: expansin-A4-like [Pyrus x bretschneideri]
Length=261

 Score =   249 bits (636),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 136/164 (83%), Gaps = 5/164 (3%)
 Frame = +3

Query  69   MAALR-VFCIALFCFLTA---VRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGN  236
            MAA+  + CI     L +   V ARIPGVYT G WQ AHATFYGG+DASGTM GACGYGN
Sbjct  1    MAAMAPLLCIVSLMALASTIVVDARIPGVYTGGAWQDAHATFYGGSDASGTMGGACGYGN  60

Query  237  LYTQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFAL  413
            LY+QGYGVN AALSTALFN GLSCGACFE+KC N  + C +G+PSI VTATNFCPPNFA 
Sbjct  61   LYSQGYGVNTAALSTALFNNGLSCGACFELKCANQPQWCKSGSPSIFVTATNFCPPNFAQ  120

Query  414  PNDNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            P+DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  121  PSDNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  164



>ref|XP_010690765.1| PREDICTED: expansin-A4 [Beta vulgaris subsp. vulgaris]
Length=258

 Score =   249 bits (635),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 131/152 (86%), Gaps = 1/152 (1%)
 Frame = +3

Query  93   IALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVNNAA  272
            ++LF   + + AR PGVY+ G WQ AHATFYGG+DASGTM GACGYGNLY+QGYGVN AA
Sbjct  10   LSLFSLFSLIHARYPGVYSRGGWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAA  69

Query  273  LSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNGGWCNPPR  449
            LSTALFN+G SCGACFE+KC +D R C  G+PSI +TATNFCPPN+ALP+DNGGWCNPPR
Sbjct  70   LSTALFNSGQSCGACFELKCADDPRWCHPGSPSIFITATNFCPPNYALPSDNGGWCNPPR  129

Query  450  LHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
             HFDLAMPMFLKIA YRAGIVPV FRRVPCRK
Sbjct  130  PHFDLAMPMFLKIAEYRAGIVPVAFRRVPCRK  161



>ref|XP_010111142.1| hypothetical protein L484_010756 [Morus notabilis]
 gb|EXC30507.1| hypothetical protein L484_010756 [Morus notabilis]
Length=258

 Score =   249 bits (635),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 131/155 (85%), Gaps = 1/155 (1%)
 Frame = +3

Query  84   VFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVN  263
            +  ++L      V A+IPG Y  G WQ AHATFYGG+DASGTM GACGYGNLY+QGYGVN
Sbjct  7    IILLSLIACAAFVDAKIPGNYGGGSWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVN  66

Query  264  NAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNGGWCN  440
             AALSTALFN GLSCGACFEIKC ND + C +G+PSI+VTATNFCPPN+ALPNDNGGWCN
Sbjct  67   TAALSTALFNNGLSCGACFEIKCANDPQWCHSGSPSILVTATNFCPPNYALPNDNGGWCN  126

Query  441  PPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            PPR HFDLAMPMFLKIA YRAGIVPV +RRVPCRK
Sbjct  127  PPRSHFDLAMPMFLKIAEYRAGIVPVTYRRVPCRK  161



>emb|CDP00110.1| unnamed protein product [Coffea canephora]
Length=255

 Score =   249 bits (635),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 131/152 (86%), Gaps = 1/152 (1%)
 Frame = +3

Query  93   IALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVNNAA  272
            IAL   LT   ARIPGVYT   W+ AHATFYGG+DASGTM GACGYGNLY+QGYGVN AA
Sbjct  7    IALSLLLTPTEARIPGVYTGDSWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAA  66

Query  273  LSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNGGWCNPPR  449
            LSTALFN G SCG+CFE+KC +D + C  G+PSI++TATNFCPPN+ALPNDNGGWCNPPR
Sbjct  67   LSTALFNNGFSCGSCFELKCADDPQWCHPGSPSILITATNFCPPNYALPNDNGGWCNPPR  126

Query  450  LHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
             HFDLAMPMFL+IA YRAGIVPV++RRVPCRK
Sbjct  127  PHFDLAMPMFLRIAEYRAGIVPVSYRRVPCRK  158



>gb|ACU17612.1| unknown [Glycine max]
Length=165

 Score =   245 bits (626),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 131/156 (84%), Gaps = 2/156 (1%)
 Frame = +3

Query  69   MAALRVFCIA-LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYT  245
            MAA+    IA L     A  ARIPGVYT GPWQ AHATFYGG+DASGTM GACGYGNLY+
Sbjct  1    MAAIVFLHIASLASLFVATSARIPGVYTGGPWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  246  QGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPND  422
            QGYGVN AALSTALFN GLSCGACFEIKC+ D R C  G+PSI++TATNFCPPNFALPND
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCDQDPRWCNPGSPSILITATNFCPPNFALPND  120

Query  423  NGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRR  530
            NGGWCNPPR HFDLAMPMFLKIA YRAGIVPV +RR
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAQYRAGIVPVAYRR  156



>gb|AEN70895.1| expansin [Gossypium mustelinum]
Length=259

 Score =   249 bits (635),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 136/159 (86%), Gaps = 5/159 (3%)
 Frame = +3

Query  84   VFCIALFCFLTAV----RARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQG  251
            V  I++  F++++     ARIPGVY+ G WQ AHATFYGGADASGTM GACGYGNLY+QG
Sbjct  4    VNVISVLIFISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLYSQG  63

Query  252  YGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNG  428
            YGV+ AALSTALFN GLSCGACFEIKC +D + C +G+PSI +TATNFCPPN+ALPNDNG
Sbjct  64   YGVSTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPNDNG  123

Query  429  GWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            GWCNPPR  FDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  124  GWCNPPRTRFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  162



>ref|XP_008777004.1| PREDICTED: expansin-A4-like [Phoenix dactylifera]
Length=258

 Score =   249 bits (635),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 135/161 (84%), Gaps = 2/161 (1%)
 Frame = +3

Query  69   MAALRVFCIA-LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYT  245
            MA LR+  +A +  FL+   ARI GVYT G WQ AHATFYGG+DASGTM GACGYGNLY+
Sbjct  1    MAILRLVALASVLAFLSPAAARILGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  246  QGYGVNNAALSTALFNTGLSCGACFEIKCNNDRS-CLAGNPSIVVTATNFCPPNFALPND  422
            QGYGV  AALSTALFN G SCGACFEIKC +D S C  G+PSI +TATNFCPPN+ALP+D
Sbjct  61   QGYGVETAALSTALFNEGQSCGACFEIKCADDPSWCHRGSPSIFITATNFCPPNYALPSD  120

Query  423  NGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            NGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  161



>ref|XP_008371813.1| PREDICTED: expansin-A4-like [Malus domestica]
Length=261

 Score =   249 bits (635),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 137/164 (84%), Gaps = 5/164 (3%)
 Frame = +3

Query  69   MAALR-VFCIALFCFLTA---VRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGN  236
            MAA+  + CI     L +   V ARIPGVYT G WQ AHATFYGG+DASGTM GACGYGN
Sbjct  1    MAAMAPLLCIVSLMALASTIVVDARIPGVYTGGAWQDAHATFYGGSDASGTMGGACGYGN  60

Query  237  LYTQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFAL  413
            LY+QGYGVN AALSTALFN+GLSCGACFE+KC N  + C +G+PSI VTATNFCPPNFA 
Sbjct  61   LYSQGYGVNTAALSTALFNSGLSCGACFELKCANQPQWCKSGSPSIFVTATNFCPPNFAQ  120

Query  414  PNDNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            P+D+GGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  121  PSDDGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  164



>ref|XP_006366490.1| PREDICTED: expansin-A6 [Solanum tuberosum]
Length=257

 Score =   248 bits (634),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 127/144 (88%), Gaps = 1/144 (1%)
 Frame = +3

Query  117  AVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVNNAALSTALFNT  296
             V  RIPGVY+ G WQ AHATFYGG+DASGTM GACGYGNLY+QGYGVNNAALSTALFN 
Sbjct  17   GVEGRIPGVYSGGSWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTALFNN  76

Query  297  GLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNGGWCNPPRLHFDLAMP  473
            GLSCGACFEIKC+N  + C  G+PSI++TATNFCPPN+ALPNDNGGWCNPPR HFDLAMP
Sbjct  77   GLSCGACFEIKCDNQPQWCHPGSPSILITATNFCPPNYALPNDNGGWCNPPRTHFDLAMP  136

Query  474  MFLKIAAYRAGIVPVNFRRVPCRK  545
            MFLKIA YRAGIVPV +RRV CRK
Sbjct  137  MFLKIAEYRAGIVPVVYRRVSCRK  160



>ref|XP_007150329.1| hypothetical protein PHAVU_005G144500g [Phaseolus vulgaris]
 gb|ESW22323.1| hypothetical protein PHAVU_005G144500g [Phaseolus vulgaris]
Length=256

 Score =   248 bits (634),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 134/160 (84%), Gaps = 5/160 (3%)
 Frame = +3

Query  78   LRVFCIALFCF---LTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQ  248
            + V  IAL CF   +  V ARIPGVYT G WQ AHATFYGG+DASGTM GACGYGNLY+Q
Sbjct  1    MAVLGIAL-CFASIMWMVDARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQ  59

Query  249  GYGVNNAALSTALFNTGLSCGACFEIKCNNDRS-CLAGNPSIVVTATNFCPPNFALPNDN  425
            GYGVN AALSTALFN GLSCGACFEIKC ND+  C +G+PSI +TATNFCPPN+ALPNDN
Sbjct  60   GYGVNTAALSTALFNNGLSCGACFEIKCANDKEWCHSGSPSIFITATNFCPPNYALPNDN  119

Query  426  GGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            GGWCNPPR HFDLAMPMFLKIA YRAGIVPV +RRV C K
Sbjct  120  GGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVACMK  159



>ref|NP_001234761.1| expansin18 precursor [Solanum lycopersicum]
 emb|CAA06271.2| expansin18 [Solanum lycopersicum]
Length=260

 Score =   248 bits (634),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 133/156 (85%), Gaps = 3/156 (2%)
 Frame = +3

Query  87   FCIA-LFCF-LTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGV  260
            FC+A LF   L    ARIPGV+T+G WQ AHATFYGG+DASGTM GACGYGNLY+QGYGV
Sbjct  8    FCVASLFSLILLTAEARIPGVFTAGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGV  67

Query  261  NNAALSTALFNTGLSCGACFEIKCNN-DRSCLAGNPSIVVTATNFCPPNFALPNDNGGWC  437
            NN ALSTALFN GLSCGACFEIKC+N  + C  G+PSI +TATNFCPPNFALPNDNGGWC
Sbjct  68   NNGALSTALFNNGLSCGACFEIKCDNYPQWCHPGSPSIFITATNFCPPNFALPNDNGGWC  127

Query  438  NPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            NPPR HFDLAMPMFL IA YRAGIVPV +RRVPCRK
Sbjct  128  NPPRPHFDLAMPMFLHIAEYRAGIVPVVYRRVPCRK  163



>gb|AFZ78606.1| expansin protein [Populus tomentosa]
Length=262

 Score =   248 bits (634),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 135/165 (82%), Gaps = 6/165 (4%)
 Frame = +3

Query  69   MAALRVFCIA-----LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYG  233
            MA   + CIA     +   L    ARIPGVY+ G W+ AHATFYGGADASGTM GACGYG
Sbjct  1    MAMRSLICIATSLLIIVSSLWMAEARIPGVYSGGAWENAHATFYGGADASGTMGGACGYG  60

Query  234  NLYTQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFA  410
            NLY+QGYGV+ AALSTALFN GLSCG+CFEIKC +D R C +G+PSI +TATNFCPPN+A
Sbjct  61   NLYSQGYGVSTAALSTALFNNGLSCGSCFEIKCASDPRWCHSGSPSIFITATNFCPPNYA  120

Query  411  LPNDNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            LP+DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV +RRVPCRK
Sbjct  121  LPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRK  165



>ref|XP_006480833.1| PREDICTED: expansin-A4-like [Citrus sinensis]
 gb|KDO51152.1| hypothetical protein CISIN_1g025025mg [Citrus sinensis]
Length=259

 Score =   248 bits (633),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 137/163 (84%), Gaps = 5/163 (3%)
 Frame = +3

Query  69   MAALRVFC---IALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNL  239
            MA  R+ C   +AL  F TA  A+IPGV+  GPWQ AHATFYGG+DASGTM GACGYGNL
Sbjct  1    MALFRMLCFFSVALSLFATA-NAKIPGVFAGGPWQSAHATFYGGSDASGTMGGACGYGNL  59

Query  240  YTQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALP  416
            Y+QGYGVN AALSTALFN GLSCGACFE+KC  D + C  GNP+I++TATNFCPPNFA P
Sbjct  60   YSQGYGVNTAALSTALFNNGLSCGACFELKCGGDPQWCNPGNPAILITATNFCPPNFAQP  119

Query  417  NDNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            +DNGGWCNPPR HFDLAMPMFLK+A YRAGIVPV++RRVPCRK
Sbjct  120  SDNGGWCNPPRPHFDLAMPMFLKLAQYRAGIVPVSYRRVPCRK  162



>ref|XP_009122794.1| PREDICTED: expansin-A9 [Brassica rapa]
 emb|CDY40344.1| BnaA10g27240D [Brassica napus]
Length=258

 Score =   248 bits (633),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 129/159 (81%), Gaps = 1/159 (1%)
 Frame = +3

Query  72   AALRVFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQG  251
            A +    +      T V ARIPGVYT GPW  AHATFYG ADASGTM GACGYGNLY+QG
Sbjct  3    AKIMTLMVVAALVATTVNARIPGVYTGGPWVNAHATFYGEADASGTMGGACGYGNLYSQG  62

Query  252  YGVNNAALSTALFNTGLSCGACFEIKCNNDRS-CLAGNPSIVVTATNFCPPNFALPNDNG  428
            YGVN AALSTALFN GLSCGACFE+KC ND   CL GNPSI++TATNFCPPNFA  +DNG
Sbjct  63   YGVNTAALSTALFNNGLSCGACFELKCVNDPGWCLPGNPSILITATNFCPPNFAQASDNG  122

Query  429  GWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            GWCNPPR HFDLAMPMFL IA YRAGIVPV++RRVPCRK
Sbjct  123  GWCNPPREHFDLAMPMFLTIAKYRAGIVPVSYRRVPCRK  161



>ref|NP_001288956.1| expansin-A9-like precursor [Brassica rapa]
 gb|AGM16351.1| alpha-expansin protein 9 [Brassica rapa]
Length=261

 Score =   248 bits (634),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 127/145 (88%), Gaps = 1/145 (1%)
 Frame = +3

Query  114  TAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVNNAALSTALFN  293
            T V+ARIPGVYT GPW  AHATFYG ADASGTM GACGYGNLY+QGYGVN AALSTALFN
Sbjct  20   TTVKARIPGVYTGGPWVNAHATFYGEADASGTMGGACGYGNLYSQGYGVNTAALSTALFN  79

Query  294  TGLSCGACFEIKCNNDRS-CLAGNPSIVVTATNFCPPNFALPNDNGGWCNPPRLHFDLAM  470
             GLSCGACFE+KC ND   CL GNPSI++TATNFCPPNFA  +DNGGWCNPPR HFDLAM
Sbjct  80   NGLSCGACFELKCVNDPGWCLPGNPSILITATNFCPPNFAQASDNGGWCNPPREHFDLAM  139

Query  471  PMFLKIAAYRAGIVPVNFRRVPCRK  545
            PMFL IA YRAGIVPV++RRVPCRK
Sbjct  140  PMFLTIAKYRAGIVPVSYRRVPCRK  164



>ref|XP_004490888.1| PREDICTED: expansin-A4-like [Cicer arietinum]
Length=260

 Score =   248 bits (633),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 129/142 (91%), Gaps = 1/142 (1%)
 Frame = +3

Query  123  RARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVNNAALSTALFNTGL  302
             ARIPGVYT G WQ AHATFYGG+DASGTM GACGYGNLY+QGYGVN AALSTALFN GL
Sbjct  22   EARIPGVYTGGAWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNEGL  81

Query  303  SCGACFEIKCNNDRS-CLAGNPSIVVTATNFCPPNFALPNDNGGWCNPPRLHFDLAMPMF  479
            SCGACFEIKC++D + C AG+PSI+VTATNFCPPN+A P+DNGGWCNPPR HFDLAMPMF
Sbjct  82   SCGACFEIKCSDDPNWCHAGSPSILVTATNFCPPNYAQPSDNGGWCNPPRPHFDLAMPMF  141

Query  480  LKIAAYRAGIVPVNFRRVPCRK  545
            LKIA YRAGIVPV++RRVPCRK
Sbjct  142  LKIAQYRAGIVPVSYRRVPCRK  163



>ref|XP_006294816.1| hypothetical protein CARUB_v10023867mg [Capsella rubella]
 gb|EOA27714.1| hypothetical protein CARUB_v10023867mg [Capsella rubella]
Length=262

 Score =   248 bits (633),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 128/147 (87%), Gaps = 1/147 (1%)
 Frame = +3

Query  108  FLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVNNAALSTAL  287
             LTA  A+I GVY+ GPWQ AHATFYGG+DASGTM GACGYGNLY+QGYGVN AALSTAL
Sbjct  19   LLTASDAKIAGVYSGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTAL  78

Query  288  FNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNGGWCNPPRLHFDL  464
            FN G SCGACFEIKC +D R C+ GNPSI+VTATNFCPPNFA  +DNGGWCNPPR HFDL
Sbjct  79   FNNGYSCGACFEIKCTDDPRWCVPGNPSILVTATNFCPPNFAQASDNGGWCNPPREHFDL  138

Query  465  AMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            AMPMFLKI  YRAGIVPV++RRVPCRK
Sbjct  139  AMPMFLKIGLYRAGIVPVSYRRVPCRK  165



>gb|KJB08889.1| hypothetical protein B456_001G111100 [Gossypium raimondii]
Length=260

 Score =   248 bits (633),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 138/164 (84%), Gaps = 4/164 (2%)
 Frame = +3

Query  63   MEMAALRVFCIALFCFLTAV--RARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGN  236
            M +A++ V CI LF   T     ARIPGVY+ G WQ AHATFYGG+DASGTM GACGYGN
Sbjct  1    MAVASV-VACILLFLSSTMWMGEARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGN  59

Query  237  LYTQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFAL  413
            LY+QGYGVN AALSTALFN G SCGACFEIKC +D + C +G+PSI +TATNFCPPN+AL
Sbjct  60   LYSQGYGVNTAALSTALFNNGFSCGACFEIKCASDPQWCHSGSPSIFITATNFCPPNYAL  119

Query  414  PNDNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            P+DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  120  PSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  163



>gb|AAR09168.1| alpha-expansin 1 [Populus tremula x Populus tremuloides]
Length=262

 Score =   248 bits (633),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 138/165 (84%), Gaps = 4/165 (2%)
 Frame = +3

Query  63   MEMAALRVFCIALFCFLTAV---RARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYG  233
            M M++L     +L   ++++    ARIPGVY+ G W+ AHATFYGG+DASGTM GACGYG
Sbjct  1    MAMSSLICIATSLLIIVSSLWMAEARIPGVYSGGAWENAHATFYGGSDASGTMGGACGYG  60

Query  234  NLYTQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFA  410
            NLY+QGYGV+ AALSTALFN GLSCG+CFEIKC +D R C +G+PSI +TATNFCPPN+A
Sbjct  61   NLYSQGYGVSTAALSTALFNNGLSCGSCFEIKCASDPRWCHSGSPSIFITATNFCPPNYA  120

Query  411  LPNDNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            LP+DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV +RRVPCRK
Sbjct  121  LPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRK  165



>gb|AFK40565.1| unknown [Medicago truncatula]
Length=231

 Score =   247 bits (630),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 135/164 (82%), Gaps = 4/164 (2%)
 Frame = +3

Query  63   MEMAALRVFCIALFCFLTA--VRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGN  236
            M M ++ V+ + L   LT   V ARIPGVY  G WQ AHATFYGG+DASGTM GACGYGN
Sbjct  1    MGMVSM-VYVVTLIMSLTMWMVDARIPGVYNGGAWQTAHATFYGGSDASGTMGGACGYGN  59

Query  237  LYTQGYGVNNAALSTALFNTGLSCGACFEIKCNNDRS-CLAGNPSIVVTATNFCPPNFAL  413
            LY+QGYGVN AALSTALFN GLSCG+CFE+KC ND+  C +G+PSI +TATNFCPPNFA 
Sbjct  60   LYSQGYGVNTAALSTALFNNGLSCGSCFELKCANDKQWCHSGSPSIFITATNFCPPNFAQ  119

Query  414  PNDNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            P+DNGGWCNPPR HFDLAMP FLKIA YRAGIVPV FRRVPCRK
Sbjct  120  PSDNGGWCNPPRPHFDLAMPTFLKIAEYRAGIVPVAFRRVPCRK  163



>gb|AAM22625.1|AF428178_1 expansin 11 precursor [Rumex palustris]
Length=258

 Score =   248 bits (632),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 134/161 (83%), Gaps = 2/161 (1%)
 Frame = +3

Query  69   MAALR-VFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYT  245
            MAAL  + CI       +  ARIPGVY+ G W+ AHATFYGG+DASGTM GACG+GNLY+
Sbjct  1    MAALSALLCIVSVLSFYSADARIPGVYSGGGWETAHATFYGGSDASGTMGGACGFGNLYS  60

Query  246  QGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPND  422
            QGYGVN AALSTALFN GLSCGACFEIKC +D R C  G+PSI++TATNFCPPNFA P+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCADDPRWCHPGSPSILITATNFCPPNFAEPSD  120

Query  423  NGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            NGGWCNPPR HFDLAMPMFLKIA YRAGIVPV FRRVPCRK
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAFRRVPCRK  161



>ref|XP_006429095.1| hypothetical protein CICLE_v10012518mg [Citrus clementina]
 gb|ESR42335.1| hypothetical protein CICLE_v10012518mg [Citrus clementina]
Length=259

 Score =   248 bits (632),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 137/163 (84%), Gaps = 5/163 (3%)
 Frame = +3

Query  69   MAALRVFC---IALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNL  239
            MA  R+ C   +AL  F TA  A+IPGV+  GPWQ AHATFYGG+DASGTM GACGYGNL
Sbjct  1    MALFRMLCFFSLALSLFATA-NAKIPGVFAGGPWQSAHATFYGGSDASGTMGGACGYGNL  59

Query  240  YTQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALP  416
            Y+QGYGVN AALSTALFN GLSCGACFE+KC  D + C  GNP+I++TATNFCPPNFA P
Sbjct  60   YSQGYGVNTAALSTALFNNGLSCGACFELKCGGDPQWCNPGNPAILITATNFCPPNFAQP  119

Query  417  NDNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            +DNGGWCNPPR HFDLAMPMFLK+A YRAGIVPV++RRVPCRK
Sbjct  120  SDNGGWCNPPRPHFDLAMPMFLKLAQYRAGIVPVSYRRVPCRK  162



>ref|XP_010558331.1| PREDICTED: expansin-A9 [Tarenaya hassleriana]
Length=268

 Score =   248 bits (633),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 131/148 (89%), Gaps = 2/148 (1%)
 Frame = +3

Query  108  FLTA-VRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVNNAALSTA  284
            FL A V A+IPGVY+ GPW  AHATFYGGADASGTM GACGYGNLY+QGYGVN AALSTA
Sbjct  23   FLAAEVDAKIPGVYSGGPWIDAHATFYGGADASGTMGGACGYGNLYSQGYGVNTAALSTA  82

Query  285  LFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNGGWCNPPRLHFD  461
            LFN GLSCGACFE+KC +D R CL GNPSI++TATNFCPPNFA  +DNGGWCNPPR HFD
Sbjct  83   LFNNGLSCGACFELKCIDDPRWCLPGNPSILITATNFCPPNFAQASDNGGWCNPPREHFD  142

Query  462  LAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            LAMPMFLK+A Y+AGIVPV++RRVPCRK
Sbjct  143  LAMPMFLKLAQYKAGIVPVSYRRVPCRK  170



>ref|XP_011089478.1| PREDICTED: expansin-A6 [Sesamum indicum]
Length=260

 Score =   248 bits (632),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 133/163 (82%), Gaps = 2/163 (1%)
 Frame = +3

Query  63   MEMAALRVFCIALFCFLTA-VRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNL  239
            M + A+ V   +L   L     ARIPGVYT G WQ AHATFYGG+DASGTM GACGYGNL
Sbjct  1    MALLAVIVCIASLISVLQPPAEARIPGVYTGGGWQTAHATFYGGSDASGTMGGACGYGNL  60

Query  240  YTQGYGVNNAALSTALFNTGLSCGACFEIKCNNDRS-CLAGNPSIVVTATNFCPPNFALP  416
            Y+QGYGVN AALSTALFN G SCGACFEIKC  ++  C AG+PSI VTATNFCPPN+ALP
Sbjct  61   YSQGYGVNTAALSTALFNNGFSCGACFEIKCAMEKQWCHAGSPSIFVTATNFCPPNYALP  120

Query  417  NDNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            NDNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV +RRVPCRK
Sbjct  121  NDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVTYRRVPCRK  163



>ref|XP_002881024.1| ATEXPA6 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57283.1| ATEXPA6 [Arabidopsis lyrata subsp. lyrata]
Length=257

 Score =   248 bits (632),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 131/160 (82%), Gaps = 1/160 (1%)
 Frame = +3

Query  69   MAALRVFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQ  248
            MA L +    L   L    ARIPGVY  G W+ AHATFYGG+DASGTM GACGYGNLY+Q
Sbjct  1    MAMLGLVLSVLTTILALSEARIPGVYNGGGWETAHATFYGGSDASGTMGGACGYGNLYSQ  60

Query  249  GYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDN  425
            GYGVN AALSTALFN G SCGACFE+KC +D R C +G+PSI +TATNFCPPNFA P+DN
Sbjct  61   GYGVNTAALSTALFNNGFSCGACFELKCASDPRWCHSGSPSIFITATNFCPPNFAQPSDN  120

Query  426  GGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            GGWCNPPR HFDLAMPMFLKIA YRAGIVPV+FRRVPCRK
Sbjct  121  GGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRK  160



>emb|CDY10456.1| BnaCnng03570D [Brassica napus]
Length=258

 Score =   248 bits (632),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 129/159 (81%), Gaps = 1/159 (1%)
 Frame = +3

Query  72   AALRVFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQG  251
            A +    +      T V ARIPGVYT GPW  AHATFYG ADASGTM GACGYGNLY+QG
Sbjct  3    AKIMTLMVVAALVATTVNARIPGVYTGGPWVNAHATFYGEADASGTMGGACGYGNLYSQG  62

Query  252  YGVNNAALSTALFNTGLSCGACFEIKCNNDRS-CLAGNPSIVVTATNFCPPNFALPNDNG  428
            YGVN AALSTALFN GLSCGACFE+KC ND   CL GNPSI++TATNFCPPNFA  +DNG
Sbjct  63   YGVNTAALSTALFNNGLSCGACFELKCVNDPGWCLPGNPSILITATNFCPPNFAQASDNG  122

Query  429  GWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            GWCNPPR HFDLAMPMFL IA YRAGIVPV++RRVPCRK
Sbjct  123  GWCNPPREHFDLAMPMFLTIAKYRAGIVPVSYRRVPCRK  161



>ref|XP_006398690.1| hypothetical protein EUTSA_v10014430mg [Eutrema salsugineum]
 gb|ESQ40143.1| hypothetical protein EUTSA_v10014430mg [Eutrema salsugineum]
Length=261

 Score =   248 bits (632),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 133/164 (81%), Gaps = 3/164 (2%)
 Frame = +3

Query  63   MEMAALRVFCIALFCFLTA--VRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGN  236
            M    + V  + +   LTA  V A+IPGVYT GPW  AHATFYG ADASGTM GACGYGN
Sbjct  1    MAAKVITVMAVMVVAALTATTVSAKIPGVYTGGPWVNAHATFYGEADASGTMGGACGYGN  60

Query  237  LYTQGYGVNNAALSTALFNTGLSCGACFEIKCNNDRS-CLAGNPSIVVTATNFCPPNFAL  413
            LY+QGYGVN AALSTALFN G+SCGACFE+KC ND   CL GNPSI++TATNFCPPNFA 
Sbjct  61   LYSQGYGVNTAALSTALFNNGVSCGACFELKCVNDPGWCLPGNPSILITATNFCPPNFAQ  120

Query  414  PNDNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
             +DNGGWCNPPR HFDLAMPMFL IA YRAGIVPV++RR+PCRK
Sbjct  121  ASDNGGWCNPPREHFDLAMPMFLSIAKYRAGIVPVSYRRIPCRK  164



>ref|XP_006435550.1| hypothetical protein CICLE_v10032484mg [Citrus clementina]
 ref|XP_006486470.1| PREDICTED: expansin-A4-like [Citrus sinensis]
 gb|ESR48790.1| hypothetical protein CICLE_v10032484mg [Citrus clementina]
 gb|KDO69285.1| hypothetical protein CISIN_1g024916mg [Citrus sinensis]
Length=260

 Score =   248 bits (632),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 133/160 (83%), Gaps = 3/160 (2%)
 Frame = +3

Query  75   ALRVFCIALFCFLTA--VRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQ  248
            A+ + CI  F   ++  V ARIPGVY    WQ AHATFYGG DASGTM GACGYGNLY+Q
Sbjct  4    AVGIICIVTFVTFSSLSVDARIPGVYGGEAWQSAHATFYGGNDASGTMGGACGYGNLYSQ  63

Query  249  GYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDN  425
            GYGVN AALSTALFN GLSCGACFEIKC ND + C AG+PSI VTATNFCPPNFA P+DN
Sbjct  64   GYGVNTAALSTALFNNGLSCGACFEIKCANDPQWCHAGSPSIFVTATNFCPPNFAQPSDN  123

Query  426  GGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            GGWCNPPR HFDLAMPMFLK+A YRAGIVPV++RRVPCRK
Sbjct  124  GGWCNPPRPHFDLAMPMFLKMAEYRAGIVPVSYRRVPCRK  163



>emb|CDY31742.1| BnaA04g16780D [Brassica napus]
Length=260

 Score =   248 bits (632),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 136/164 (83%), Gaps = 4/164 (2%)
 Frame = +3

Query  63   MEMAALRVFCI--ALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGN  236
            M M +L V C+   L  F T   ARIPGVY+ G W+ AHATFYGG+DASGTM GACGYGN
Sbjct  1    MAMLSL-VLCVLTILADFTTISEARIPGVYSGGGWETAHATFYGGSDASGTMGGACGYGN  59

Query  237  LYTQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFAL  413
            LY+QGYGVN AALSTALFN G SCGACFE+KC +D + C +G+PSI VTATNFCPPNFA 
Sbjct  60   LYSQGYGVNTAALSTALFNNGFSCGACFELKCASDPKWCHSGSPSIFVTATNFCPPNFAQ  119

Query  414  PNDNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            P+DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV+FRRVPCRK
Sbjct  120  PSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRK  163



>gb|KHG24991.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=260

 Score =   248 bits (632),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 134/160 (84%), Gaps = 3/160 (2%)
 Frame = +3

Query  75   ALRVFCIALFCFLTAV--RARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQ  248
            A  V CI LF   T     ARIPGVY+ G WQ AHATFYGG+DASGTM GACGYGNLY+Q
Sbjct  4    ASAVACIFLFISSTMWMGEARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQ  63

Query  249  GYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDN  425
            GYGVN AALSTALFN G SCGACFEIKC +D + C +G+PSI +TATNFCPPN+ALP+DN
Sbjct  64   GYGVNTAALSTALFNNGFSCGACFEIKCASDPQWCHSGSPSIFITATNFCPPNYALPSDN  123

Query  426  GGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            GGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  124  GGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  163



>ref|NP_001288899.1| expansin-A6 precursor [Brassica rapa]
 gb|AGM16348.1| alpha-expansin protein 6 [Brassica rapa]
Length=260

 Score =   248 bits (632),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 136/164 (83%), Gaps = 4/164 (2%)
 Frame = +3

Query  63   MEMAALRVFCI--ALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGN  236
            M M +L V C+   L  F T   ARIPGVY+ G W+ AHATFYGG+DASGTM GACGYGN
Sbjct  1    MAMLSL-VLCVLTILADFTTISEARIPGVYSGGGWETAHATFYGGSDASGTMGGACGYGN  59

Query  237  LYTQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFAL  413
            LY+QGYGVN AALSTALFN G SCGACFE+KC +D + C +G+PSI VTATNFCPPNFA 
Sbjct  60   LYSQGYGVNTAALSTALFNNGFSCGACFELKCASDPKWCHSGSPSIFVTATNFCPPNFAQ  119

Query  414  PNDNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            P+DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV+FRRVPCRK
Sbjct  120  PSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRK  163



>ref|XP_010510558.1| PREDICTED: expansin-A6 [Camelina sativa]
 ref|XP_010470018.1| PREDICTED: expansin-A6 [Camelina sativa]
Length=256

 Score =   247 bits (631),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 134/162 (83%), Gaps = 4/162 (2%)
 Frame = +3

Query  63   MEMAALRVFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLY  242
            M M +L +F + +   L    ARIPGVY  G W+ AHATFYGG+DASGTM GACGYGNLY
Sbjct  1    MAMLSLVLFVLTI---LATSEARIPGVYNGGGWETAHATFYGGSDASGTMGGACGYGNLY  57

Query  243  TQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPN  419
            +QGYGVN AALSTALFN G SCGACFE+KC +D R C +G+PSI VTATNFCPPNFA P+
Sbjct  58   SQGYGVNTAALSTALFNNGFSCGACFELKCASDPRWCHSGSPSIFVTATNFCPPNFAQPS  117

Query  420  DNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV+FRRVPCRK
Sbjct  118  DNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRK  159



>ref|XP_009380637.1| PREDICTED: expansin-A4 [Musa acuminata subsp. malaccensis]
Length=262

 Score =   248 bits (632),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 126/141 (89%), Gaps = 1/141 (1%)
 Frame = +3

Query  126  ARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVNNAALSTALFNTGLS  305
            ARIPGVYT G WQ AHATFYGG+DASGTM GACGYGNLY+QGYGV  AALSTALFN GLS
Sbjct  25   ARIPGVYTGGQWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAALSTALFNDGLS  84

Query  306  CGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNGGWCNPPRLHFDLAMPMFL  482
            CGACFEIKC +D R C  G+PSI +TATNFCPPN+ALP+D+GGWCNPPR HFDLAMPMFL
Sbjct  85   CGACFEIKCADDPRWCKGGSPSIFITATNFCPPNYALPSDDGGWCNPPRPHFDLAMPMFL  144

Query  483  KIAAYRAGIVPVNFRRVPCRK  545
            KIA YRAGIVPV++RRVPCRK
Sbjct  145  KIAEYRAGIVPVSYRRVPCRK  165



>emb|CDY04847.1| BnaAnng00290D [Brassica napus]
Length=261

 Score =   248 bits (632),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 126/145 (87%), Gaps = 1/145 (1%)
 Frame = +3

Query  114  TAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVNNAALSTALFN  293
            T V ARIPGVYT GPW  AHATFYG ADASGTM GACGYGNLY+QGYGVN AALSTALFN
Sbjct  20   TTVEARIPGVYTGGPWVNAHATFYGEADASGTMGGACGYGNLYSQGYGVNTAALSTALFN  79

Query  294  TGLSCGACFEIKCNNDRS-CLAGNPSIVVTATNFCPPNFALPNDNGGWCNPPRLHFDLAM  470
             GLSCGACFE+KC ND   CL GNPSI++TATNFCPPNFA  +DNGGWCNPPR HFDLAM
Sbjct  80   NGLSCGACFELKCVNDPGWCLPGNPSILITATNFCPPNFAQASDNGGWCNPPREHFDLAM  139

Query  471  PMFLKIAAYRAGIVPVNFRRVPCRK  545
            PMFL IA YRAGIVPV++RRVPCRK
Sbjct  140  PMFLTIAKYRAGIVPVSYRRVPCRK  164



>ref|NP_001233958.1| expansin precursor [Solanum lycopersicum]
 gb|AAC63088.1| expansin [Solanum lycopersicum]
 gb|AAQ12264.1| expansin 1 protein [Solanum lycopersicum]
Length=261

 Score =   248 bits (632),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 134/165 (81%), Gaps = 7/165 (4%)
 Frame = +3

Query  69   MAALRVFCIALF---CFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNL  239
            M  +    + LF   CF   V  RIPGVY+ G W+ AHATFYGG+DASGTM GACGYGNL
Sbjct  1    MGIIIFILVLLFVDSCF-NIVEGRIPGVYSGGSWETAHATFYGGSDASGTMGGACGYGNL  59

Query  240  YTQGYGVNNAALSTALFNTGLSCGACFEIKCNND---RSCLAGNPSIVVTATNFCPPNFA  410
            Y+QGYGVN AALSTALFN GLSCGACFE+KC N    + CL GNPSI++TATNFCPPN+A
Sbjct  60   YSQGYGVNTAALSTALFNNGLSCGACFELKCTNTPNWKWCLPGNPSILITATNFCPPNYA  119

Query  411  LPNDNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            LPNDNGGWCNPPR HFDLAMPMFLK+A YRAGIVPV +RR+PCRK
Sbjct  120  LPNDNGGWCNPPRPHFDLAMPMFLKLAQYRAGIVPVTYRRIPCRK  164



>gb|AFK44569.1| unknown [Medicago truncatula]
Length=258

 Score =   247 bits (631),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 132/160 (83%), Gaps = 1/160 (1%)
 Frame = +3

Query  69   MAALRVFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQ  248
            +A +      +   +  V+ARIPGVY+ G WQ AHATFYGG+DASGTM GACGYGNLY+Q
Sbjct  2    VAKMLYIAFIIITSMYIVQARIPGVYSGGQWQDAHATFYGGSDASGTMGGACGYGNLYSQ  61

Query  249  GYGVNNAALSTALFNTGLSCGACFEIKCNNDRS-CLAGNPSIVVTATNFCPPNFALPNDN  425
            GYGVN AALSTALFN GLSCGACFEIKC ND+  C +G+PSI +TATNFCPPNFA  +DN
Sbjct  62   GYGVNTAALSTALFNNGLSCGACFEIKCANDKEWCRSGSPSIFITATNFCPPNFAQASDN  121

Query  426  GGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            GGWCNPPR HFDLAMPMFLKIA YRAGIVPV +RRVPCRK
Sbjct  122  GGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRK  161



>ref|XP_006409928.1| hypothetical protein EUTSA_v10017116mg [Eutrema salsugineum]
 gb|ESQ51381.1| hypothetical protein EUTSA_v10017116mg [Eutrema salsugineum]
Length=260

 Score =   247 bits (631),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 136/163 (83%), Gaps = 2/163 (1%)
 Frame = +3

Query  63   MEMAALRVFCIALFCFLTAV-RARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNL  239
            M + AL +  + +   LTA+  ARIPGVY  G W+ AHATFYGG+DASGTM GACGYGNL
Sbjct  1    MAVLALVLCVLTILADLTAIYEARIPGVYNGGGWESAHATFYGGSDASGTMGGACGYGNL  60

Query  240  YTQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALP  416
            Y+QGYGVN AALSTALFN G SCGACFE+KC +D + C +G+PSI +TATNFCPPNFA P
Sbjct  61   YSQGYGVNTAALSTALFNNGFSCGACFELKCASDPKWCHSGSPSIFITATNFCPPNFAQP  120

Query  417  NDNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            +DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV+FRRVPCRK
Sbjct  121  SDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRK  163



>gb|KEH30169.1| expansin A10 [Medicago truncatula]
Length=258

 Score =   247 bits (630),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 132/160 (83%), Gaps = 1/160 (1%)
 Frame = +3

Query  69   MAALRVFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQ  248
            +A +      +   +  V+ARIPGVY+ G WQ AHATFYGG+DASGTM GACGYGNLY+Q
Sbjct  2    VAKMLYIAFIIITSMYIVQARIPGVYSGGQWQDAHATFYGGSDASGTMGGACGYGNLYSQ  61

Query  249  GYGVNNAALSTALFNTGLSCGACFEIKCNNDRS-CLAGNPSIVVTATNFCPPNFALPNDN  425
            GYGVN AALSTALFN GLSCGACFEIKC ND+  C +G+PSI +TATNFCPPNFA  +DN
Sbjct  62   GYGVNTAALSTALFNNGLSCGACFEIKCANDKEWCHSGSPSIFITATNFCPPNFAQASDN  121

Query  426  GGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            GGWCNPPR HFDLAMPMFLKIA YRAGIVPV +RRVPCRK
Sbjct  122  GGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRK  161



>dbj|BAC67194.1| expansin [Pyrus communis]
Length=261

 Score =   247 bits (630),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 135/164 (82%), Gaps = 5/164 (3%)
 Frame = +3

Query  69   MAALR-VFCIALFCFLTA---VRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGN  236
            MAA+  + CI     L +   V ARIPGVYT   WQ AHATFYGG+DASGTM GACGYGN
Sbjct  1    MAAMAPLLCIVSLMALASTIVVDARIPGVYTGAAWQDAHATFYGGSDASGTMGGACGYGN  60

Query  237  LYTQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFAL  413
            LY+QGYGVN AALSTALFN GLSCGACFE+KC N  + C +G+PSI VTATNFCPPNFA 
Sbjct  61   LYSQGYGVNTAALSTALFNNGLSCGACFELKCANQPQWCKSGSPSIFVTATNFCPPNFAQ  120

Query  414  PNDNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            P+DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  121  PSDNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  164



>ref|XP_010534508.1| PREDICTED: expansin-A4 [Tarenaya hassleriana]
Length=261

 Score =   247 bits (630),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 132/159 (83%), Gaps = 4/159 (3%)
 Frame = +3

Query  81   RVFCIAL---FCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQG  251
            R+   AL     FL+   ARIPG+Y+   WQ AHATFYGG+DASGTM GACGYGNLY+QG
Sbjct  6    RILVTALPLFVLFLSFADARIPGIYSGSAWQSAHATFYGGSDASGTMGGACGYGNLYSQG  65

Query  252  YGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNG  428
            YGVN AALSTALFN G SCGACFEIKC ND + C +G+PSI +TATNFCPPNFA P+DNG
Sbjct  66   YGVNTAALSTALFNNGFSCGACFEIKCANDPQWCHSGSPSIFITATNFCPPNFAQPSDNG  125

Query  429  GWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            GWCNPPR HFDLAMPMFLKIA YRAGIVP+++RRVPCRK
Sbjct  126  GWCNPPRAHFDLAMPMFLKIAEYRAGIVPISYRRVPCRK  164



>emb|CDY48101.1| BnaC02g03580D [Brassica napus]
Length=261

 Score =   247 bits (630),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 126/145 (87%), Gaps = 1/145 (1%)
 Frame = +3

Query  114  TAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVNNAALSTALFN  293
            T V ARIPGVYT GPW  AHATFYG ADASGTM GACGYGNLY+QGYGVN AALSTALFN
Sbjct  20   TTVNARIPGVYTGGPWVNAHATFYGEADASGTMGGACGYGNLYSQGYGVNTAALSTALFN  79

Query  294  TGLSCGACFEIKCNNDRS-CLAGNPSIVVTATNFCPPNFALPNDNGGWCNPPRLHFDLAM  470
             GLSCGACFE+KC ND   CL GNPSI++TATNFCPPNFA  +DNGGWCNPPR HFDLAM
Sbjct  80   NGLSCGACFELKCVNDPGWCLPGNPSILITATNFCPPNFAQASDNGGWCNPPREHFDLAM  139

Query  471  PMFLKIAAYRAGIVPVNFRRVPCRK  545
            PMFL IA YRAGIVPV++RRVPCRK
Sbjct  140  PMFLTIAKYRAGIVPVSYRRVPCRK  164



>ref|XP_006288496.1| hypothetical protein CARUB_v10001761mg [Capsella rubella]
 gb|EOA21394.1| hypothetical protein CARUB_v10001761mg [Capsella rubella]
Length=258

 Score =   246 bits (629),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 132/160 (83%), Gaps = 3/160 (2%)
 Frame = +3

Query  75   ALRVFCIALFCFLTA--VRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQ  248
            A +V  +      TA  V ARIPGVYT GPW  AHATFYGGADASGTM GACGYGNLY+Q
Sbjct  2    AAKVITLMAVMLATAFTVHARIPGVYTGGPWVNAHATFYGGADASGTMGGACGYGNLYSQ  61

Query  249  GYGVNNAALSTALFNTGLSCGACFEIKCNNDRS-CLAGNPSIVVTATNFCPPNFALPNDN  425
            GYGVN AALSTALFN GLSCG+CFE+KC ND   CL GNPSI++TATNFCPPNFA  +DN
Sbjct  62   GYGVNTAALSTALFNNGLSCGSCFELKCINDPGWCLPGNPSILITATNFCPPNFAQASDN  121

Query  426  GGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            GGWCNPPR HFDLAMPMFL IA Y+AGIVPV++RR+PCRK
Sbjct  122  GGWCNPPREHFDLAMPMFLSIAKYKAGIVPVSYRRIPCRK  161



>ref|XP_007205740.1| hypothetical protein PRUPE_ppa010180mg [Prunus persica]
 dbj|BAC66787.1| expansin [Prunus persica]
 gb|EMJ06939.1| hypothetical protein PRUPE_ppa010180mg [Prunus persica]
Length=260

 Score =   247 bits (630),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 131/155 (85%), Gaps = 3/155 (2%)
 Frame = +3

Query  90   CIA--LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVN  263
            C+A  L   +    ARIPGVY+ G W+ AHATFYGG+DASGTM GACGYGNLY+QGYGV+
Sbjct  9    CLASLLISLMWVAEARIPGVYSGGAWEAAHATFYGGSDASGTMGGACGYGNLYSQGYGVS  68

Query  264  NAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNGGWCN  440
             AALSTALFN GLSCGACFEIKC ND   C +G+PSI +TATNFCPPNFA P+DNGGWCN
Sbjct  69   TAALSTALFNNGLSCGACFEIKCANDPNWCHSGSPSIFITATNFCPPNFAQPSDNGGWCN  128

Query  441  PPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            PPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  129  PPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  163



>ref|XP_006411198.1| hypothetical protein EUTSA_v10017119mg [Eutrema salsugineum]
 gb|ESQ52651.1| hypothetical protein EUTSA_v10017119mg [Eutrema salsugineum]
Length=258

 Score =   246 bits (629),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 134/161 (83%), Gaps = 2/161 (1%)
 Frame = +3

Query  69   MAALR-VFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYT  245
            MA ++ V     F FL    A+IPGVY+ G WQ AHATFYGG+DASGTM GACGYGNLY+
Sbjct  1    MAIVKLVILFTTFLFLNIADAKIPGVYSGGAWQTAHATFYGGSDASGTMGGACGYGNLYS  60

Query  246  QGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPND  422
            QGYG N AALSTALFN G+SCGACFE+KC ND + C +G+PSI++TATNFCPPN A P+D
Sbjct  61   QGYGTNTAALSTALFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNLAQPSD  120

Query  423  NGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            NGGWCNPPR HFDLAMP+FLKIA YRAGIVPV++RRVPCRK
Sbjct  121  NGGWCNPPRAHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRK  161



>ref|XP_010521846.1| PREDICTED: expansin-A6 [Tarenaya hassleriana]
Length=259

 Score =   246 bits (629),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 135/163 (83%), Gaps = 3/163 (2%)
 Frame = +3

Query  63   MEMAALRVFCIALFCFLTAV-RARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNL  239
            M M +L VF + +   LT +  ARIPGVY  G WQ AHATFYGG+DASGTM GACGYGNL
Sbjct  1    MAMISL-VFVLTILVSLTLMSEARIPGVYGGGAWQNAHATFYGGSDASGTMGGACGYGNL  59

Query  240  YTQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALP  416
            Y+QGYGVN AALSTALFN G  CGACFEIKC +D + C +G+PSI +TATNFCPPN+ALP
Sbjct  60   YSQGYGVNTAALSTALFNNGFRCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALP  119

Query  417  NDNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            +DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV +RRVPCRK
Sbjct  120  SDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRK  162



>ref|XP_011019858.1| PREDICTED: expansin-A6 [Populus euphratica]
Length=260

 Score =   246 bits (629),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 130/155 (84%), Gaps = 4/155 (3%)
 Frame = +3

Query  84   VFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVN  263
            VF I++F       ARIPGV+T GPW+ AHATFYGG+DASGTM GACGYGNLY+QGYGVN
Sbjct  12   VFLISVFVL---AHARIPGVFTGGPWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVN  68

Query  264  NAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNGGWCN  440
             AALSTALFN GLSCGACFEIKC +D R C  GNPSI VTATNFCPPNFA  +DNGGWCN
Sbjct  69   TAALSTALFNNGLSCGACFEIKCADDPRWCNPGNPSIFVTATNFCPPNFAQASDNGGWCN  128

Query  441  PPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            PPR HFDLAMPMFLKIA YRAGIVPV  RRVPCRK
Sbjct  129  PPRPHFDLAMPMFLKIAQYRAGIVPVAHRRVPCRK  163



>emb|CDX77222.1| BnaC04g40170D [Brassica napus]
Length=260

 Score =   246 bits (629),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 135/164 (82%), Gaps = 4/164 (2%)
 Frame = +3

Query  63   MEMAALRVFCI--ALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGN  236
            M M  L V C+   L  F T   ARIPGVY+ G W+ AHATFYGG+DASGTM GACGYGN
Sbjct  1    MAMLGL-VLCLLTILADFTTISEARIPGVYSGGGWETAHATFYGGSDASGTMGGACGYGN  59

Query  237  LYTQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFAL  413
            LY+QGYGVN AALSTALFN G SCGACFE+KC +D + C +G+PSI VTATNFCPPNFA 
Sbjct  60   LYSQGYGVNTAALSTALFNNGFSCGACFELKCASDPKWCHSGSPSIFVTATNFCPPNFAQ  119

Query  414  PNDNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            P+DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV+FRRVPCRK
Sbjct  120  PSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRK  163



>gb|EPS67093.1| hypothetical protein M569_07682, partial [Genlisea aurea]
Length=261

 Score =   246 bits (629),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 130/159 (82%), Gaps = 3/159 (2%)
 Frame = +3

Query  78   LRVFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYG  257
            L +F  A   F+ +  ARIPGVY    W+ AHATFYGGADASGTM GACGYGNLY+QGYG
Sbjct  6    LFLFVSAALSFIASSHARIPGVYAGTGWESAHATFYGGADASGTMGGACGYGNLYSQGYG  65

Query  258  VNNAALSTALFNTGLSCGACFEIKCN---NDRSCLAGNPSIVVTATNFCPPNFALPNDNG  428
            VN AALSTALFNTGLSCGACFEI+C+   + R C  G PSI VTATNFCPPN+ALP+D G
Sbjct  66   VNTAALSTALFNTGLSCGACFEIRCDESQDGRWCSPGRPSISVTATNFCPPNYALPSDKG  125

Query  429  GWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            GWCNPPR HFDLAMPMFLKIA YRAGIV VNFRR+PCRK
Sbjct  126  GWCNPPRPHFDLAMPMFLKIAEYRAGIVAVNFRRIPCRK  164



>ref|XP_008223717.1| PREDICTED: expansin-A4 [Prunus mume]
Length=260

 Score =   246 bits (629),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 131/155 (85%), Gaps = 3/155 (2%)
 Frame = +3

Query  90   CIA--LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVN  263
            C+A  L   +    ARIPGVY+ G W+ AHATFYGG+DASGTM GACGYGNLY+QGYGV+
Sbjct  9    CLASLLISLMWVAEARIPGVYSGGAWEAAHATFYGGSDASGTMGGACGYGNLYSQGYGVS  68

Query  264  NAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNGGWCN  440
             AALSTALFN GLSCGACFEIKC ND   C +G+PSI +TATNFCPPNFA P+DNGGWCN
Sbjct  69   TAALSTALFNNGLSCGACFEIKCANDPNWCHSGSPSIFITATNFCPPNFAQPSDNGGWCN  128

Query  441  PPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            PPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  129  PPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  163



>ref|XP_006350774.1| PREDICTED: expansin-A6 [Solanum tuberosum]
Length=260

 Score =   246 bits (628),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 132/163 (81%), Gaps = 4/163 (2%)
 Frame = +3

Query  69   MAALRVFCIALFCF---LTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNL  239
            M  L V C     F   L    ARIPGV+T+G WQ AHATFYGG+DASGTM GACGYGNL
Sbjct  1    MGFLNVACCVASLFSLILLTAEARIPGVFTAGAWQSAHATFYGGSDASGTMGGACGYGNL  60

Query  240  YTQGYGVNNAALSTALFNTGLSCGACFEIKCNN-DRSCLAGNPSIVVTATNFCPPNFALP  416
            Y+QGYGVNN ALSTALFN GLSCGACFEIKC+N  + C  G+PSI +TATNFCPPNFALP
Sbjct  61   YSQGYGVNNGALSTALFNNGLSCGACFEIKCDNYPQWCHPGSPSIFITATNFCPPNFALP  120

Query  417  NDNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            NDNGGWCNPPR HFDLAMPMFL IA YRAGIVPV +RRVPCRK
Sbjct  121  NDNGGWCNPPRPHFDLAMPMFLHIAEYRAGIVPVVYRRVPCRK  163



>ref|XP_010937609.1| PREDICTED: expansin-A4 [Elaeis guineensis]
Length=260

 Score =   246 bits (628),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 128/155 (83%), Gaps = 1/155 (1%)
 Frame = +3

Query  84   VFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVN  263
               + L  F T   ARIPGVYT   WQ AHATFYGG+DASGTM GACGYGNLY+QGYGV 
Sbjct  9    TLVMTLLAFATLGDARIPGVYTGESWQKAHATFYGGSDASGTMGGACGYGNLYSQGYGVE  68

Query  264  NAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNGGWCN  440
             AALSTALFN GLSCGACFEIKC +D + C  G PSI +TATNFCPPN+ALP+DNGGWCN
Sbjct  69   TAALSTALFNDGLSCGACFEIKCADDPQWCHHGGPSIFITATNFCPPNYALPSDNGGWCN  128

Query  441  PPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            PPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  129  PPRPHFDLAMPMFLKIAQYRAGIVPVSYRRVPCRK  163



>gb|KFK32246.1| hypothetical protein AALP_AA6G217100 [Arabis alpina]
Length=257

 Score =   246 bits (628),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 131/160 (82%), Gaps = 1/160 (1%)
 Frame = +3

Query  69   MAALRVFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQ  248
            MA L +  + L        ARIPGVY  G W+ AHATFYGG+DASGTM GACGYGNLY+Q
Sbjct  1    MAMLGLVLLVLTILADLTEARIPGVYNGGGWETAHATFYGGSDASGTMGGACGYGNLYSQ  60

Query  249  GYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDN  425
            GYGVN AALSTALFN G SCGACFE+KC +D + C +G+PSI +TATNFCPPNFA P+DN
Sbjct  61   GYGVNTAALSTALFNNGYSCGACFELKCASDPKWCHSGSPSIFITATNFCPPNFAQPSDN  120

Query  426  GGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            GGWCNPPR HFDLAMPMFLKIA YRAGIVPV+FRRVPCRK
Sbjct  121  GGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRK  160



>emb|CDY47883.1| BnaA07g14280D [Brassica napus]
Length=260

 Score =   246 bits (628),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 134/164 (82%), Gaps = 4/164 (2%)
 Frame = +3

Query  63   MEMAALRVFCI--ALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGN  236
            M+M  L V CI   L  F T    RIPGVY  G W+ AHATFYGG+DASGTM GACGYGN
Sbjct  1    MKMLGL-VLCILTILADFTTITEGRIPGVYNGGGWETAHATFYGGSDASGTMGGACGYGN  59

Query  237  LYTQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFAL  413
            LY+QGYGVN AALSTALFN G SCGACFE+KC +D + C +G+PSI VTATNFCPPNFA 
Sbjct  60   LYSQGYGVNTAALSTALFNNGYSCGACFELKCASDPKWCHSGSPSIFVTATNFCPPNFAQ  119

Query  414  PNDNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            P+DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV+FRRVPCRK
Sbjct  120  PSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRK  163



>gb|AAM22626.1|AF428179_1 expansin 12 precursor [Rumex palustris]
Length=258

 Score =   246 bits (627),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 133/161 (83%), Gaps = 2/161 (1%)
 Frame = +3

Query  69   MAALR-VFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYT  245
            MAAL  + CI       +  ARIPGVY+ G W+ AHATFYGG+DASGTM GACG+GNLY+
Sbjct  1    MAALSALLCIVSVLSFYSADARIPGVYSGGGWETAHATFYGGSDASGTMGGACGFGNLYS  60

Query  246  QGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPND  422
            QGYGVN AALSTALFN GLSCGACFEIKC +D R C  G+PSI++TATNFCPPNFA P+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCADDPRWCHPGSPSILITATNFCPPNFAEPSD  120

Query  423  NGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            NGGWCNPPR HFDLAMPMFLK A YRAGIVPV FRRVPCRK
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKFAEYRAGIVPVAFRRVPCRK  161



>ref|NP_180461.1| expansin A6 [Arabidopsis thaliana]
 sp|Q38865.2|EXPA6_ARATH RecName: Full=Expansin-A6; Short=AtEXPA6; AltName: Full=Alpha-expansin-6; 
Short=At-EXP6; Short=AtEx6; AltName: Full=Ath-ExpAlpha-1.8; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC33223.1| expansin AtEx6 [Arabidopsis thaliana]
 gb|AAL25606.1| At2g28950/F8N16.24 [Arabidopsis thaliana]
 gb|AAB38072.2| expansin At-EXPA6 [Arabidopsis thaliana]
 gb|AAL62401.1| expansin AtEx6 [Arabidopsis thaliana]
 gb|AAM15074.1| expansin AtEx6 [Arabidopsis thaliana]
 gb|AAO30068.1| expansin AtEx6 [Arabidopsis thaliana]
 gb|AEC08194.1| expansin A6 [Arabidopsis thaliana]
Length=257

 Score =   246 bits (627),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 131/160 (82%), Gaps = 1/160 (1%)
 Frame = +3

Query  69   MAALRVFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQ  248
            MA L +    L   L    ARIPGVY  G W+ AHATFYGG+DASGTM GACGYGNLY+Q
Sbjct  1    MAMLGLVLSVLTTILALSEARIPGVYNGGGWETAHATFYGGSDASGTMGGACGYGNLYSQ  60

Query  249  GYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDN  425
            GYGVN AALSTALFN G SCGACFE+KC +D + C +G+PSI +TATNFCPPNFA P+DN
Sbjct  61   GYGVNTAALSTALFNNGFSCGACFELKCASDPKWCHSGSPSIFITATNFCPPNFAQPSDN  120

Query  426  GGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            GGWCNPPR HFDLAMPMFLKIA YRAGIVPV+FRRVPCRK
Sbjct  121  GGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRK  160



>gb|AAM22624.1|AF428177_1 expansin 10 precursor [Rumex palustris]
Length=258

 Score =   246 bits (627),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 133/161 (83%), Gaps = 2/161 (1%)
 Frame = +3

Query  69   MAALR-VFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYT  245
            MAAL  + CI       +  ARIPGVY+ G W+ AHATFYGG+DASGTM GACG+GNLY+
Sbjct  1    MAALSALLCIVSVLSFYSADARIPGVYSGGGWETAHATFYGGSDASGTMGGACGFGNLYS  60

Query  246  QGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPND  422
            QGYGVN AALSTALFN G+SCGACFEIKC +D R C  GNPSI++TATNFCPPNFA P+D
Sbjct  61   QGYGVNTAALSTALFNNGMSCGACFEIKCADDPRWCHPGNPSILITATNFCPPNFAEPSD  120

Query  423  NGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            NGGWCNPP  HFDLAMPMFLKIA YRAGIVPV FRRVPCRK
Sbjct  121  NGGWCNPPLPHFDLAMPMFLKIAEYRAGIVPVAFRRVPCRK  161



>ref|XP_010423881.1| PREDICTED: expansin-A9-like [Camelina sativa]
Length=258

 Score =   245 bits (626),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 132/162 (81%), Gaps = 2/162 (1%)
 Frame = +3

Query  63   MEMAALRVFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLY  242
            M    L +  + +   LT V A+IPGVY  GPW  AHATFYGGADASGTM GACGYGNLY
Sbjct  1    MAAKVLTLMAVMVVTALT-VNAKIPGVYNGGPWVNAHATFYGGADASGTMGGACGYGNLY  59

Query  243  TQGYGVNNAALSTALFNTGLSCGACFEIKCNNDRS-CLAGNPSIVVTATNFCPPNFALPN  419
            +QGYGVN AALSTALFN GLSCG+CFE+KC ND   CL GNPSI++TATNFCPPNFA  +
Sbjct  60   SQGYGVNTAALSTALFNNGLSCGSCFELKCVNDPGWCLPGNPSILITATNFCPPNFAQAS  119

Query  420  DNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            DNGGWCNPPR HFDLAMPMFL IA Y+AGIVPV++RR+PCRK
Sbjct  120  DNGGWCNPPREHFDLAMPMFLSIAKYKAGIVPVSYRRIPCRK  161



>ref|XP_004145295.1| PREDICTED: expansin-A4-like [Cucumis sativus]
Length=258

 Score =   245 bits (626),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 133/156 (85%), Gaps = 3/156 (2%)
 Frame = +3

Query  84   VFCIA-LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGV  260
            + CIA L   +    ARIPG+Y+ GPW+ AHATFYGG+DASGTM G CGYGNLY+QGYGV
Sbjct  7    LLCIASLISTMWPAAARIPGIYSGGPWESAHATFYGGSDASGTM-GRCGYGNLYSQGYGV  65

Query  261  NNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNGGWC  437
            N AALSTALFN GLSCGACFEIKC ND R C +G+PSIV+TATNFCPPNFALP+DNGGWC
Sbjct  66   NTAALSTALFNNGLSCGACFEIKCANDPRWCHSGSPSIVITATNFCPPNFALPSDNGGWC  125

Query  438  NPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            NPPR HFDLAMPMFLKIA YRAGIVPV +RRV CRK
Sbjct  126  NPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVGCRK  161



>ref|XP_011077214.1| PREDICTED: expansin-A6-like [Sesamum indicum]
Length=259

 Score =   245 bits (626),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 134/162 (83%), Gaps = 3/162 (2%)
 Frame = +3

Query  69   MAALRVFCIA--LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLY  242
            MA +   CIA  L   L+ V  RIPGVYT G WQ AHATFYGG+DASGTM GACGYGNLY
Sbjct  1    MATMGFSCIAALLLLLLSYVECRIPGVYTGGAWQTAHATFYGGSDASGTMGGACGYGNLY  60

Query  243  TQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPN  419
            +QGYGVN AALSTALFN G SCGACFEIKC ++ + C  G+PSI +TATNFCPPN+ALPN
Sbjct  61   SQGYGVNTAALSTALFNNGFSCGACFEIKCRDEPQWCHPGSPSIFITATNFCPPNYALPN  120

Query  420  DNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RRVPC K
Sbjct  121  DNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCHK  162



>ref|XP_009409019.1| PREDICTED: expansin-A4-like [Musa acuminata subsp. malaccensis]
Length=257

 Score =   245 bits (625),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 130/160 (81%), Gaps = 1/160 (1%)
 Frame = +3

Query  69   MAALRVFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQ  248
            MA      +AL   L  V ARIPG+Y  G WQ AHATFYGG+DASGTM GACGYGNLY+Q
Sbjct  1    MALASFVSVALLALLAPVTARIPGLYAGGQWQNAHATFYGGSDASGTMGGACGYGNLYSQ  60

Query  249  GYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDN  425
            GYGV  AALSTALFN G SCGACFEIKC  D + C  G+PSI +TATNFCPPN+ALP+D+
Sbjct  61   GYGVQTAALSTALFNEGQSCGACFEIKCAGDPQWCHGGSPSIFITATNFCPPNYALPSDD  120

Query  426  GGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            GGWCNPPR HFDL+MPMFLKIA YRAGIVPV++RRVPCR+
Sbjct  121  GGWCNPPRPHFDLSMPMFLKIAEYRAGIVPVSYRRVPCRR  160



>emb|CDY07024.1| BnaA04g22910D [Brassica napus]
Length=258

 Score =   245 bits (625),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 133/162 (82%), Gaps = 2/162 (1%)
 Frame = +3

Query  63   MEMAALRVFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLY  242
            M +  L V     F   T   A+IPGVY+ G WQ AHATFYGG+DASGTM GACGYGNLY
Sbjct  1    MAITKLAVL-FTTFVLFTLTDAKIPGVYSGGAWQTAHATFYGGSDASGTMGGACGYGNLY  59

Query  243  TQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPN  419
            +QGYG N AALSTALFN+G+SCGACFE+KC ND + C +G+PSI++TATNFCPPNFA  +
Sbjct  60   SQGYGTNTAALSTALFNSGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNFAQAS  119

Query  420  DNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            DNGGWCNPPR HFDLAMP+FLKIA YRAGIVPV++RRVPCRK
Sbjct  120  DNGGWCNPPRAHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRK  161



>gb|AEU08407.1| expansin 2 [Prunus salicina]
Length=260

 Score =   245 bits (625),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 131/155 (85%), Gaps = 3/155 (2%)
 Frame = +3

Query  90   CIA--LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVN  263
            C+A  L   +    ARIPGVY+ G W+ AHATFYGG+DASGTM GACGYGNLY+QGYGV+
Sbjct  9    CLASLLISLMWVAEARIPGVYSGGAWEAAHATFYGGSDASGTMGGACGYGNLYSQGYGVS  68

Query  264  NAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNGGWCN  440
             AALSTALFN GLSCGACFEIKC ND   C +G+PSI +TATNFCPPNFA P+D+GGWCN
Sbjct  69   TAALSTALFNNGLSCGACFEIKCANDPNWCHSGSPSIFITATNFCPPNFAQPSDDGGWCN  128

Query  441  PPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            PPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  129  PPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  163



>ref|XP_006294843.1| hypothetical protein CARUB_v10023894mg [Capsella rubella]
 gb|EOA27741.1| hypothetical protein CARUB_v10023894mg [Capsella rubella]
Length=257

 Score =   245 bits (625),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 130/160 (81%), Gaps = 1/160 (1%)
 Frame = +3

Query  69   MAALRVFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQ  248
            MA         F   +   ARIPGVY+ G WQ AHATFYGG+DASGTM GACGYGNLY+Q
Sbjct  1    MAIKLAILFTTFVLFSLADARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQ  60

Query  249  GYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDN  425
            GYG N AALSTALFN G+SCGACFE+KC ND + C +G+PSI++TATNFCPPN A P+DN
Sbjct  61   GYGTNTAALSTALFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNLAQPSDN  120

Query  426  GGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            GGWCNPPR HFDLAMP+FLKIA YRAGIVPV++RRVPCRK
Sbjct  121  GGWCNPPREHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRK  160



>ref|XP_009141827.1| PREDICTED: expansin-A4-like [Brassica rapa]
Length=258

 Score =   245 bits (625),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 133/162 (82%), Gaps = 2/162 (1%)
 Frame = +3

Query  63   MEMAALRVFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLY  242
            M +  L V     F   T   A+IPGVY+ G WQ AHATFYGG+DASGTM GACGYGNLY
Sbjct  1    MAITKLAVL-FTTFVLFTLTDAKIPGVYSGGAWQTAHATFYGGSDASGTMGGACGYGNLY  59

Query  243  TQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPN  419
            +QGYG N AALSTALFN+G+SCGACFE+KC ND + C +G+PSI++TATNFCPPNFA  +
Sbjct  60   SQGYGTNTAALSTALFNSGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNFAQAS  119

Query  420  DNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            DNGGWCNPPR HFDLAMP+FLKIA YRAGIVPV++RRVPCRK
Sbjct  120  DNGGWCNPPRAHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRK  161



>ref|XP_011031225.1| PREDICTED: expansin-A4-like [Populus euphratica]
Length=258

 Score =   245 bits (625),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 126/142 (89%), Gaps = 1/142 (1%)
 Frame = +3

Query  123  RARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVNNAALSTALFNTGL  302
             ARIPGVYT   WQ AHATFYGG DASGTM GACGYGNLY+QGYGVN AALSTALFN GL
Sbjct  20   EARIPGVYTGAAWQSAHATFYGGNDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  79

Query  303  SCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNGGWCNPPRLHFDLAMPMF  479
            SCGACFEIKC N+ + C +G+PSI +TATNFCPPN+ALP+DNGGWCNPPR HFDLAMPMF
Sbjct  80   SCGACFEIKCANEPQWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMF  139

Query  480  LKIAAYRAGIVPVNFRRVPCRK  545
            LKIA YRAGIVPV++RRVPCRK
Sbjct  140  LKIAEYRAGIVPVSYRRVPCRK  161



>ref|NP_181500.1| expansin A4 [Arabidopsis thaliana]
 sp|O48818.1|EXPA4_ARATH RecName: Full=Expansin-A4; Short=AtEXPA4; AltName: Full=Alpha-expansin-4; 
Short=At-EXP4; Short=AtEx4; AltName: Full=Ath-ExpAlpha-1.6; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAK95263.1|AF410277_1 At2g39700/F17A14.7 [Arabidopsis thaliana]
 gb|AAB97125.1| putative expansin [Arabidopsis thaliana]
 gb|AAL32761.1| putative expansin [Arabidopsis thaliana]
 gb|AAM13337.1| putative expansin [Arabidopsis thaliana]
 gb|AEC09708.1| expansin A4 [Arabidopsis thaliana]
Length=257

 Score =   245 bits (625),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 130/160 (81%), Gaps = 1/160 (1%)
 Frame = +3

Query  69   MAALRVFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQ  248
            MA         F   +   ARIPG+Y+ G WQ AHATFYGG+DASGTM GACGYGNLY+Q
Sbjct  1    MAIKLAILFTTFVLFSLADARIPGIYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQ  60

Query  249  GYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDN  425
            GYG N AALSTALFN G+SCGACFE+KC ND + C +G+PSI++TATNFCPPN A P+DN
Sbjct  61   GYGTNTAALSTALFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNLAQPSDN  120

Query  426  GGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            GGWCNPPR HFDLAMP+FLKIA YRAGIVPV++RRVPCRK
Sbjct  121  GGWCNPPREHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRK  160



>gb|AAV85475.1| expansin [Populus tomentosa]
Length=258

 Score =   244 bits (624),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 127/142 (89%), Gaps = 1/142 (1%)
 Frame = +3

Query  123  RARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVNNAALSTALFNTGL  302
             ARIPGVYT   WQ AHATFYGG+DASGTM GACGYGNLY+QGYGVN AALSTALFN GL
Sbjct  20   EARIPGVYTGADWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  79

Query  303  SCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNGGWCNPPRLHFDLAMPMF  479
            SCGACFEIKC N+ + C +G+PSI +TATNFCPPN+ALP+DNGGWCNPPR HFDLAMPMF
Sbjct  80   SCGACFEIKCANEPQWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMF  139

Query  480  LKIAAYRAGIVPVNFRRVPCRK  545
            LKIA YRAGIVPV++RRVPCR+
Sbjct  140  LKIAEYRAGIVPVSYRRVPCRE  161



>ref|XP_010532011.1| PREDICTED: expansin-A4-like [Tarenaya hassleriana]
Length=261

 Score =   244 bits (624),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 135/164 (82%), Gaps = 3/164 (2%)
 Frame = +3

Query  63   MEMAA-LRVFCIALFC-FLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGN  236
            MEM   + +  + LF  F +   ARIPGVY+ G WQ AHATFYGG DASGTM GACGYGN
Sbjct  1    MEMRQRILLNTLPLFVLFFSFADARIPGVYSGGAWQSAHATFYGGNDASGTMGGACGYGN  60

Query  237  LYTQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFAL  413
            LY+QGYGVN AALSTALFN G SCGACFEIKC +D + C +G+PSI +TATNFCPPNFA 
Sbjct  61   LYSQGYGVNTAALSTALFNNGFSCGACFEIKCADDPQWCHSGSPSIFITATNFCPPNFAQ  120

Query  414  PNDNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            P+DNGGWCNPPR HFDLAMPMFLK+A YRAGIVPV++RRVPCRK
Sbjct  121  PSDNGGWCNPPRAHFDLAMPMFLKLAEYRAGIVPVSYRRVPCRK  164



>ref|XP_002312101.1| alpha-expansin 9 precursor family protein [Populus trichocarpa]
 gb|EEE89468.1| alpha-expansin 9 precursor family protein [Populus trichocarpa]
Length=258

 Score =   244 bits (624),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 126/142 (89%), Gaps = 1/142 (1%)
 Frame = +3

Query  123  RARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVNNAALSTALFNTGL  302
             ARIPGVYT   WQ AHATFYGG DASGTM GACGYGNLY+QGYGVN AALSTALFN GL
Sbjct  20   EARIPGVYTGAAWQSAHATFYGGNDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  79

Query  303  SCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNGGWCNPPRLHFDLAMPMF  479
            SCGACFEIKC N+ + C +G+PSI +TATNFCPPN+ALP+DNGGWCNPPR HFDLAMPMF
Sbjct  80   SCGACFEIKCANEPQWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMF  139

Query  480  LKIAAYRAGIVPVNFRRVPCRK  545
            LKIA YRAGIVPV++RRVPCRK
Sbjct  140  LKIAEYRAGIVPVSYRRVPCRK  161



>gb|AAK48848.1|AF350939_1 expansin [Prunus cerasus]
Length=260

 Score =   244 bits (624),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 130/155 (84%), Gaps = 3/155 (2%)
 Frame = +3

Query  90   CIA--LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVN  263
            C+A  L   +    ARIPGVYT   W+ AHATFYGG+DASGTM GACGYGNLY+QGYGV+
Sbjct  9    CLASLLISVMWVAEARIPGVYTGDAWEAAHATFYGGSDASGTMGGACGYGNLYSQGYGVS  68

Query  264  NAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNGGWCN  440
             AALSTALFN GLSCGACFEIKC ND   C +G+PSI +TATNFCPPNFA P+DNGGWCN
Sbjct  69   TAALSTALFNNGLSCGACFEIKCANDPNWCHSGSPSIFITATNFCPPNFAQPSDNGGWCN  128

Query  441  PPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            PPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  129  PPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  163



>emb|CDY07642.1| BnaA03g18690D [Brassica napus]
Length=258

 Score =   244 bits (624),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 132/162 (81%), Gaps = 2/162 (1%)
 Frame = +3

Query  63   MEMAALRVFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLY  242
            M +  L V     F   T   A+IPGVY+ G WQ AHATFYGG+DASGTM GACGYGNLY
Sbjct  1    MAITKLAVL-FTTFVLFTLTDAKIPGVYSGGAWQTAHATFYGGSDASGTMGGACGYGNLY  59

Query  243  TQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPN  419
            +QGYG N AALSTALFN G+SCGACFE+KC ND + C +G+PSI++TATNFCPPNFA  +
Sbjct  60   SQGYGTNTAALSTALFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNFAQAS  119

Query  420  DNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            DNGGWCNPPR HFDLAMP+FLKIA YRAGIVPV++RRVPCRK
Sbjct  120  DNGGWCNPPREHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRK  161



>ref|XP_010557251.1| PREDICTED: expansin-A6-like [Tarenaya hassleriana]
Length=259

 Score =   244 bits (624),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 132/156 (85%), Gaps = 2/156 (1%)
 Frame = +3

Query  84   VFCIALFCFLTAV-RARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGV  260
            VF + +   LT++  ARIPGVY  G WQ AHATFYGG+DASGTM GACGYGNLY+QGYGV
Sbjct  7    VFVLTVLVGLTSMSEARIPGVYRGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGV  66

Query  261  NNAALSTALFNTGLSCGACFEIKCNNDRS-CLAGNPSIVVTATNFCPPNFALPNDNGGWC  437
            + AALSTALFN G  CGACFEIKC ND + C +G+PSI +TATNFCPPNFALP+DNGGWC
Sbjct  67   STAALSTALFNNGYRCGACFEIKCANDPTWCHSGSPSIFITATNFCPPNFALPSDNGGWC  126

Query  438  NPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            NPPR HFDLAMPMFL+IA YRAGIVPV +RRVPCRK
Sbjct  127  NPPRPHFDLAMPMFLRIAEYRAGIVPVAYRRVPCRK  162



>ref|XP_011042710.1| PREDICTED: expansin-A4-like [Populus euphratica]
Length=262

 Score =   244 bits (624),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 134/165 (81%), Gaps = 6/165 (4%)
 Frame = +3

Query  69   MAALRVFC-----IALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYG  233
            MA  R+ C     + +   +    ARIPGVY+ G W+ AHATFYGGADASGTM GACGYG
Sbjct  1    MATSRLLCFTTTLLIMMSLMWKGEARIPGVYSGGAWETAHATFYGGADASGTMGGACGYG  60

Query  234  NLYTQGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFA  410
            NLY+QGYGV+ AALSTALFN GLSCGACFEIKC +D + C +G+PSI++TATNFCPPN+A
Sbjct  61   NLYSQGYGVSTAALSTALFNNGLSCGACFEIKCADDPQWCHSGSPSILITATNFCPPNYA  120

Query  411  LPNDNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            LP+DNGGWC PPR HFDLAMPMFLKIA Y AGIVPV +RRVPCRK
Sbjct  121  LPSDNGGWCTPPRPHFDLAMPMFLKIAEYHAGIVPVAYRRVPCRK  165



>ref|NP_001150534.1| alpha-expansin 6 precursor [Zea mays]
 gb|ACG39445.1| alpha-expansin 6 precursor [Zea mays]
Length=263

 Score =   244 bits (624),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 129/157 (82%), Gaps = 3/157 (2%)
 Frame = +3

Query  84   VFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVN  263
            +  +A     +   ARIPGVY  G WQ AHATFYGG+DASGTM GACGYGNLY+QGYGVN
Sbjct  9    LLVVATAMMFSPAAARIPGVYGGGGWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVN  68

Query  264  NAALSTALFNTGLSCGACFEIKCNND---RSCLAGNPSIVVTATNFCPPNFALPNDNGGW  434
            NAALSTALFN GLSCGACFEIKC +    R C  G+PSI+VTATNFCPPN+ALP+D+GGW
Sbjct  69   NAALSTALFNQGLSCGACFEIKCEDQPGWRWCRPGSPSILVTATNFCPPNYALPSDDGGW  128

Query  435  CNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            CNPPR HFDLAMPMFL IA YRAGIVPV +RRVPCRK
Sbjct  129  CNPPRPHFDLAMPMFLHIAEYRAGIVPVTYRRVPCRK  165



>ref|XP_010452058.1| PREDICTED: expansin-A9-like [Camelina sativa]
Length=258

 Score =   244 bits (623),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 132/162 (81%), Gaps = 2/162 (1%)
 Frame = +3

Query  63   MEMAALRVFCIALFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLY  242
            M    L +  + +   LT V A+IPGVY  GPW  AHATFYGGADASGTM GACGYGNLY
Sbjct  1    MAAKVLTLMAVMVATALT-VNAKIPGVYNGGPWINAHATFYGGADASGTMGGACGYGNLY  59

Query  243  TQGYGVNNAALSTALFNTGLSCGACFEIKCNNDRS-CLAGNPSIVVTATNFCPPNFALPN  419
            +QGYGVN AALSTALFN GLSCG+CFE+KC ND   CL GNPSI++TATNFCPPNFA  +
Sbjct  60   SQGYGVNTAALSTALFNNGLSCGSCFELKCVNDPGWCLPGNPSILITATNFCPPNFAQAS  119

Query  420  DNGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            DNGGWCNPPR HFDLAMPMFL IA Y+AGIVPV++RR+PCRK
Sbjct  120  DNGGWCNPPREHFDLAMPMFLSIAKYKAGIVPVSYRRIPCRK  161



>gb|ABK93541.1| unknown [Populus trichocarpa]
Length=258

 Score =   244 bits (623),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 126/142 (89%), Gaps = 1/142 (1%)
 Frame = +3

Query  123  RARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYTQGYGVNNAALSTALFNTGL  302
             ARIPGVYT   WQ AHATFYGG DASGTM GACGYGNLY+QGYGVN AALSTALFN GL
Sbjct  20   EARIPGVYTGAAWQSAHATFYGGNDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  79

Query  303  SCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPNDNGGWCNPPRLHFDLAMPMF  479
            SCGACFEIKC N+ + C +G+PSI +TATNFCPPN+ALP+DNGGWCNPPR HFDLAMPMF
Sbjct  80   SCGACFEIKCANEPQWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMF  139

Query  480  LKIAAYRAGIVPVNFRRVPCRK  545
            LKIA YRAGIVPV++RRVPCRK
Sbjct  140  LKIAEYRAGIVPVSYRRVPCRK  161



>ref|XP_010931278.1| PREDICTED: LOW QUALITY PROTEIN: expansin-A7 [Elaeis guineensis]
Length=258

 Score =   244 bits (623),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 134/161 (83%), Gaps = 2/161 (1%)
 Frame = +3

Query  69   MAALRVFCIA-LFCFLTAVRARIPGVYTSGPWQGAHATFYGGADASGTMAGACGYGNLYT  245
            M  +R+  +A +  F +   ARI GV+T GPWQ AHATFYGG+DASGTM GACGYGNLY+
Sbjct  1    MGIMRLVALASILAFFSPAAARIMGVFTGGPWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  246  QGYGVNNAALSTALFNTGLSCGACFEIKCNND-RSCLAGNPSIVVTATNFCPPNFALPND  422
            QGYGV  AALSTALFN G SCGACFEIKC ++ + C  G+PSI +TATNFCPPN+ALP+D
Sbjct  61   QGYGVETAALSTALFNDGQSCGACFEIKCVDEPQWCHPGSPSIFITATNFCPPNYALPSD  120

Query  423  NGGWCNPPRLHFDLAMPMFLKIAAYRAGIVPVNFRRVPCRK  545
            NGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RRVPCRK
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRK  161



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 579015689490