BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001D20

Length=580
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008373693.1|  PREDICTED: AP-2 complex subunit mu-like            306   3e-102   
gb|KDO51121.1|  hypothetical protein CISIN_1g013671mg                   308   4e-101   Citrus sinensis [apfelsine]
ref|XP_010941233.1|  PREDICTED: AP-2 complex subunit mu                 310   6e-101   Elaeis guineensis
ref|XP_011082368.1|  PREDICTED: AP-2 complex subunit mu                 308   3e-100   Sesamum indicum [beniseed]
ref|XP_007039526.1|  Clathrin adaptor complexes medium subunit fa...    306   3e-100   
gb|KHN42609.1|  AP-2 complex subunit mu                                 308   3e-100   Glycine soja [wild soybean]
gb|ACL53413.1|  unknown                                                 308   3e-100   Zea mays [maize]
ref|XP_006573688.1|  PREDICTED: AP-2 complex subunit mu-like            308   4e-100   Glycine max [soybeans]
ref|NP_001047793.1|  Os02g0690700                                       308   4e-100   
ref|XP_006436725.1|  hypothetical protein CICLE_v10031568mg             308   4e-100   Citrus clementina [clementine]
ref|NP_001149848.1|  LOC100283476                                       308   4e-100   Zea mays [maize]
ref|XP_004148486.1|  PREDICTED: AP-2 complex subunit mu-like            308   4e-100   Cucumis sativus [cucumbers]
ref|XP_002454449.1|  hypothetical protein SORBIDRAFT_04g031270          308   4e-100   Sorghum bicolor [broomcorn]
ref|XP_010559292.1|  PREDICTED: AP-2 complex subunit mu                 308   5e-100   Tarenaya hassleriana [spider flower]
ref|XP_009389091.1|  PREDICTED: AP-2 complex subunit mu                 308   5e-100   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009397662.1|  PREDICTED: AP-2 complex subunit mu-like isof...    305   6e-100   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006647711.1|  PREDICTED: AP-2 complex subunit mu-like            308   6e-100   Oryza brachyantha
ref|XP_006579975.1|  PREDICTED: AP-2 complex subunit mu-like isof...    306   7e-100   Glycine max [soybeans]
ref|XP_003539189.1|  PREDICTED: AP-2 complex subunit mu-like isof...    307   7e-100   Glycine max [soybeans]
ref|XP_006385641.1|  AP47/50p mRNA family protein                       307   8e-100   Populus trichocarpa [western balsam poplar]
ref|XP_007039527.1|  Clathrin adaptor complexes medium subunit fa...    305   9e-100   
emb|CDY67244.1|  BnaA02g36610D                                          301   9e-100   Brassica napus [oilseed rape]
gb|AFK39198.1|  unknown                                                 307   1e-99    Lotus japonicus
ref|XP_007155773.1|  hypothetical protein PHAVU_003G230400g             307   1e-99    Phaseolus vulgaris [French bean]
ref|XP_003611474.1|  AP-2 complex subunit mu                            306   1e-99    
ref|XP_006847724.1|  hypothetical protein AMTR_s00149p00084380          306   1e-99    Amborella trichopoda
ref|XP_003524713.1|  PREDICTED: AP-2 complex subunit mu-like isof...    306   2e-99    Glycine max [soybeans]
ref|XP_010935003.1|  PREDICTED: AP-2 complex subunit mu-like            306   3e-99    Elaeis guineensis
ref|XP_006361186.1|  PREDICTED: AP-2 complex subunit mu-like isof...    306   3e-99    Solanum tuberosum [potatoes]
gb|KDP33153.1|  hypothetical protein JCGZ_13593                         306   3e-99    Jatropha curcas
ref|XP_009397661.1|  PREDICTED: AP-2 complex subunit mu-like isof...    306   3e-99    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007039523.1|  Clathrin adaptor complexes medium subunit fa...    306   3e-99    
ref|XP_004241965.1|  PREDICTED: AP-2 complex subunit mu isoform X2      306   3e-99    Solanum lycopersicum
emb|CDY63050.1|  BnaA06g40410D                                          306   3e-99    Brassica napus [oilseed rape]
ref|XP_002281297.1|  PREDICTED: AP-2 complex subunit mu                 306   3e-99    Vitis vinifera
ref|XP_007209151.1|  hypothetical protein PRUPE_ppa005912mg             306   3e-99    Prunus persica
gb|KJB39798.1|  hypothetical protein B456_007G031400                    306   4e-99    Gossypium raimondii
ref|XP_008788675.1|  PREDICTED: AP-2 complex subunit mu isoform X1      306   4e-99    Phoenix dactylifera
ref|XP_009601582.1|  PREDICTED: AP-2 complex subunit mu isoform X2      305   4e-99    Nicotiana tomentosiformis
ref|XP_004511783.1|  PREDICTED: AP-2 complex subunit mu-like            305   4e-99    Cicer arietinum [garbanzo]
ref|XP_004300247.1|  PREDICTED: AP-2 complex subunit mu                 305   4e-99    Fragaria vesca subsp. vesca
ref|XP_006368418.1|  AP47/50p mRNA family protein                       305   5e-99    Populus trichocarpa [western balsam poplar]
ref|XP_003570135.1|  PREDICTED: AP-2 complex subunit mu                 305   5e-99    Brachypodium distachyon [annual false brome]
ref|XP_010481431.1|  PREDICTED: AP-2 complex subunit mu-like            303   5e-99    Camelina sativa [gold-of-pleasure]
ref|XP_004953508.1|  PREDICTED: AP-2 complex subunit mu-like            305   5e-99    Setaria italica
ref|XP_003611473.1|  AP-2 complex subunit mu                            305   5e-99    Medicago truncatula
gb|ACN50177.1|  AP-2 complex subunit                                    305   6e-99    Annona cherimola [cherimoya]
ref|XP_010275249.1|  PREDICTED: AP-2 complex subunit mu                 305   8e-99    Nelumbo nucifera [Indian lotus]
ref|XP_010269992.1|  PREDICTED: AP-2 complex subunit mu-like            305   1e-98    Nelumbo nucifera [Indian lotus]
ref|XP_008341080.1|  PREDICTED: AP-2 complex subunit mu isoform X1      304   1e-98    Malus domestica [apple tree]
ref|XP_009101502.1|  PREDICTED: AP-2 complex subunit mu-like            304   1e-98    Brassica rapa
gb|KJB21219.1|  hypothetical protein B456_003G181000                    302   1e-98    Gossypium raimondii
ref|XP_006398358.1|  hypothetical protein EUTSA_v10000887mg             303   1e-98    
ref|XP_009782271.1|  PREDICTED: AP-2 complex subunit mu isoform X2      304   2e-98    Nicotiana sylvestris
ref|XP_003549984.1|  PREDICTED: AP-2 complex subunit mu-like isof...    304   2e-98    Glycine max [soybeans]
gb|KHN01692.1|  AP-2 complex subunit mu                                 304   2e-98    Glycine soja [wild soybean]
ref|XP_010104328.1|  AP-2 complex subunit mu                            309   2e-98    
ref|NP_974895.1|  clathrin adaptor complexes medium subunit famil...    304   2e-98    Arabidopsis thaliana [mouse-ear cress]
gb|ABR18145.1|  unknown                                                 303   2e-98    Picea sitchensis
ref|XP_008799382.1|  PREDICTED: AP-2 complex subunit mu-like isof...    303   3e-98    Phoenix dactylifera
ref|XP_010055331.1|  PREDICTED: AP-2 complex subunit mu                 303   3e-98    Eucalyptus grandis [rose gum]
gb|KJB39799.1|  hypothetical protein B456_007G031400                    303   4e-98    Gossypium raimondii
ref|XP_006361185.1|  PREDICTED: AP-2 complex subunit mu-like isof...    303   4e-98    Solanum tuberosum [potatoes]
ref|NP_199475.1|  clathrin adaptor complexes medium subunit famil...    303   4e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010322865.1|  PREDICTED: AP-2 complex subunit mu isoform X1      303   4e-98    Solanum lycopersicum
emb|CDX87692.1|  BnaC02g32570D                                          303   4e-98    
ref|XP_006281627.1|  hypothetical protein CARUB_v10027758mg             303   5e-98    Capsella rubella
ref|XP_009601580.1|  PREDICTED: AP-2 complex subunit mu isoform X1      303   6e-98    Nicotiana tomentosiformis
gb|KJB21220.1|  hypothetical protein B456_003G181000                    301   6e-98    Gossypium raimondii
ref|XP_010677254.1|  PREDICTED: AP-2 complex subunit mu                 302   7e-98    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_001762397.1|  predicted protein                                  302   8e-98    
gb|KJB21218.1|  hypothetical protein B456_003G181000                    301   9e-98    Gossypium raimondii
ref|XP_009128888.1|  PREDICTED: AP-2 complex subunit mu                 302   1e-97    Brassica rapa
ref|XP_009114341.1|  PREDICTED: AP-2 complex subunit mu-like            301   1e-97    Brassica rapa
gb|EYU44097.1|  hypothetical protein MIMGU_mgv1a006588mg                301   1e-97    Erythranthe guttata [common monkey flower]
ref|XP_011070241.1|  PREDICTED: AP-2 complex subunit mu-like            301   1e-97    Sesamum indicum [beniseed]
gb|KJB21217.1|  hypothetical protein B456_003G181000                    301   2e-97    Gossypium raimondii
ref|XP_009782270.1|  PREDICTED: AP-2 complex subunit mu isoform X1      301   2e-97    Nicotiana sylvestris
emb|CDX77680.1|  BnaC07g19340D                                          301   2e-97    
gb|EPS61852.1|  hypothetical protein M569_12940                         301   3e-97    Genlisea aurea
gb|KHG11980.1|  AP-2 complex subunit mu                                 301   3e-97    Gossypium arboreum [tree cotton]
emb|CDP13003.1|  unnamed protein product                                301   3e-97    Coffea canephora [robusta coffee]
ref|XP_006362503.1|  PREDICTED: AP-2 complex subunit mu-like            299   1e-96    Solanum tuberosum [potatoes]
ref|XP_004244539.1|  PREDICTED: AP-2 complex subunit mu-like            299   1e-96    
ref|XP_009791064.1|  PREDICTED: AP-2 complex subunit mu-like            299   1e-96    Nicotiana sylvestris
ref|XP_009616007.1|  PREDICTED: AP-2 complex subunit mu-like            299   1e-96    Nicotiana tomentosiformis
ref|XP_002973295.1|  hypothetical protein SELMODRAFT_173172             298   2e-96    Selaginella moellendorffii
gb|EMT22034.1|  AP-2 complex subunit mu                                 306   3e-96    
ref|XP_006590608.1|  PREDICTED: AP-2 complex subunit mu-like isof...    296   2e-95    Glycine max [soybeans]
ref|XP_001775791.1|  predicted protein                                  296   3e-95    
gb|AHB86967.1|  AP-2 complex subunit mu-like protein                    292   1e-93    Sedum alfredii
gb|KHG25485.1|  AP-2 complex subunit mu                                 288   3e-92    Gossypium arboreum [tree cotton]
ref|XP_007039524.1|  Clathrin adaptor complexes medium subunit fa...    266   8e-84    
dbj|BAJ61940.1|  adaptor complexes medium subunit                       252   1e-81    Nymphaea hybrid cultivar
ref|XP_008788676.1|  PREDICTED: AP-2 complex subunit mu isoform X2      245   6e-76    
ref|XP_008341081.1|  PREDICTED: AP-2 complex subunit mu isoform X2      244   1e-75    Malus domestica [apple tree]
ref|XP_008799383.1|  PREDICTED: AP-2 complex subunit mu-like isof...    243   5e-75    
ref|XP_002519831.1|  clathrin coat associated protein ap-50, puta...    243   5e-75    
gb|AEI28162.1|  putative clathrin adapter complex subunit               204   6e-63    Lobularia maritima [sweet alyssum]
ref|XP_009377081.1|  PREDICTED: LOW QUALITY PROTEIN: AP-2 complex...    201   1e-60    
ref|XP_007039525.1|  Clathrin adaptor complexes medium subunit fa...    177   3e-50    
ref|XP_005645393.1|  clathrin adaptor complexes medium subunit fa...    173   4e-48    Coccomyxa subellipsoidea C-169
ref|XP_002506503.1|  predicted protein                                  164   2e-44    Micromonas commoda
ref|XP_003063509.1|  predicted protein                                  161   3e-43    Micromonas pusilla CCMP1545
emb|CAN82079.1|  hypothetical protein VITISV_035642                     151   1e-42    Vitis vinifera
ref|XP_002952903.1|  hypothetical protein VOLCADRAFT_93610              152   4e-40    Volvox carteri f. nagariensis
ref|XP_004333095.1|  clathrin adaptor complex small chain subfami...    145   7e-40    Acanthamoeba castellanii str. Neff
ref|XP_005831595.1|  Adaptor protein complex 2 subunit MU               149   3e-39    Guillardia theta CCMP2712
gb|EWM25769.1|  ap-2 complex subunit mu                                 149   5e-39    Nannochloropsis gaditana
gb|EWM25770.1|  ap-2 complex subunit mu                                 149   6e-39    Nannochloropsis gaditana
emb|CCF51877.1|  probable clathrin-associated adaptor complex med...    149   7e-39    Ustilago hordei
ref|XP_008863053.1|  hypothetical protein H310_01648                    148   9e-39    Aphanomyces invadans
ref|XP_008615292.1|  hypothetical protein SDRG_11050                    148   1e-38    Saprolegnia diclina VS20
gb|KDO33493.1|  hypothetical protein SPRG_02301                         147   2e-38    Saprolegnia parasitica CBS 223.65
ref|XP_004352407.1|  clathrin-adaptor medium chain AP-2                 147   3e-38    Cavenderia fasciculata
ref|XP_009820939.1|  hypothetical protein H257_00108                    147   4e-38    Aphanomyces astaci
emb|CBQ73573.1|  probable clathrin-associated adaptor complex med...    146   4e-38    Sporisorium reilianum SRZ2
gb|EFA80309.1|  clathrin-adaptor medium chain AP-2                      146   5e-38    Heterostelium album PN500
emb|CDI54008.1|  probable clathrin-associated adaptor complex med...    146   6e-38    Melanopsichium pennsylvanicum 4
emb|CCI42631.1|  unnamed protein product                                144   8e-38    Albugo candida
gb|EST05073.1|  adaptor complexes medium subunit family                 145   8e-38    Kalmanozyma brasiliensis GHG001
ref|XP_011389607.1|  putative clathrin-associated adaptor complex...    145   8e-38    Ustilago maydis 521
ref|XP_001698863.1|  Mu2-Adaptin                                        145   9e-38    Chlamydomonas reinhardtii
ref|XP_007881243.1|  hypothetical protein PFL1_05516                    145   1e-37    Anthracocystis flocculosa PF-1
ref|XP_008889873.1|  hypothetical protein PPTG_00246                    145   1e-37    Phytophthora parasitica INRA-310
ref|XP_007414674.1|  hypothetical protein MELLADRAFT_91641              145   1e-37    Melampsora larici-populina 98AG31
gb|KIH63373.1|  clathrin adaptor complex small chain                    140   1e-37    Ancylostoma duodenale
ref|XP_642749.1|  clathrin-adaptor medium chain AP-2                    145   1e-37    Dictyostelium discoideum AX4
ref|XP_003289748.1|  AP-2 medium chain                                  145   1e-37    Dictyostelium purpureum
emb|CCI42632.1|  unnamed protein product                                144   1e-37    Albugo candida
ref|XP_006819890.1|  PREDICTED: LOW QUALITY PROTEIN: AP-2 complex...    144   2e-37    Saccoglossus kowalevskii
emb|CCA23532.1|  AP2 complex subunit mu putative                        145   2e-37    Albugo laibachii Nc14
emb|CCI42630.1|  unnamed protein product                                144   2e-37    Albugo candida
dbj|GAC75228.1|  adaptor complexes medium subunit family                144   2e-37    Moesziomyces antarcticus T-34
dbj|GAM22943.1|  hypothetical protein SAMD00019534_061180               144   3e-37    Acytostelium subglobosum LB1
ref|XP_005762576.1|  Apm2, medium subunit of the adaptin 2 complex      144   3e-37    Emiliania huxleyi CCMP1516
ref|XP_009532744.1|  hypothetical protein PHYSODRAFT_317496             144   3e-37    Phytophthora sojae
ref|XP_002998051.1|  AP-2 complex subunit mu                            144   4e-37    Phytophthora infestans T30-4
dbj|GAK64805.1|  intracellular protein transport-related protein        147   6e-37    Moesziomyces antarcticus
gb|AAB41282.1|  DdApm1                                                  143   7e-37    Dictyostelium discoideum
ref|XP_006738213.1|  PREDICTED: AP-2 complex subunit mu                 137   8e-37    Leptonychotes weddellii
ref|XP_002177952.1|  predicted protein                                  143   8e-37    Phaeodactylum tricornutum CCAP 1055/1
ref|XP_009059469.1|  hypothetical protein LOTGIDRAFT_204295             142   1e-36    Lottia gigantea
gb|ESA03787.1|  hypothetical protein GLOINDRAFT_238585                  141   1e-36    
dbj|GAC95247.1|  hypothetical protein PHSY_002822                       147   1e-36    Pseudozyma hubeiensis SY62
ref|XP_011398931.1|  AP-2 complex subunit mu                            142   1e-36    Auxenochlorella protothecoides
ref|XP_011192818.1|  PREDICTED: AP-2 complex subunit mu                 142   2e-36    Zeugodacus cucurbitae [melon fruit fly]
gb|ACO12761.1|  AP-2 complex subunit mu-1                               142   2e-36    Lepeophtheirus salmonis
gb|ADD38021.1|  AP-2 complex subunit mu-1                               141   3e-36    Lepeophtheirus salmonis
ref|XP_011451811.1|  PREDICTED: AP-2 complex subunit mu                 141   3e-36    Crassostrea gigas
gb|EKC19414.1|  AP-2 complex subunit mu-1                               142   3e-36    Crassostrea gigas
gb|ADX97050.1|  AP-2 complex subunit mu-1-a                             135   4e-36    Perca flavescens
ref|NP_001280510.1|  AP-2 complex subunit mu                            141   5e-36    Tribolium castaneum [rust-red flour beetle]
gb|KFM82180.1|  AP-2 complex subunit mu                                 141   5e-36    Stegodyphus mimosarum
ref|XP_009011992.1|  hypothetical protein HELRODRAFT_156400             140   6e-36    Helobdella robusta
gb|EXX69942.1|  Apm1p                                                   138   7e-36    Rhizophagus irregularis DAOM 197198w
ref|XP_001606373.1|  PREDICTED: AP-2 complex subunit mu                 140   7e-36    Nasonia vitripennis
gb|AEE63100.1|  unknown                                                 140   8e-36    Dendroctonus ponderosae
ref|XP_011500815.1|  PREDICTED: AP-2 complex subunit mu                 140   8e-36    Ceratosolen solmsi marchali
gb|AAL75583.1|AF467697_1  clathrin-adaptor protein                      140   9e-36    Dermacentor variabilis
gb|KDE04314.1|  AP-2 complex subunit mu                                 140   9e-36    Microbotryum lychnidis-dioicae p1A1 Lamole
gb|EXX69943.1|  Apm4p                                                   138   1e-35    Rhizophagus irregularis DAOM 197198w
dbj|GAA93418.1|  hypothetical protein E5Q_00059                         140   1e-35    Mixia osmundae IAM 14324
ref|XP_003748524.1|  PREDICTED: AP-2 complex subunit mu-like            140   1e-35    Galendromus occidentalis
ref|XP_003704237.1|  PREDICTED: AP-2 complex subunit mu-like            140   1e-35    Megachile rotundata
gb|ERG79534.1|  ap-2 complex subunit mu                                 139   1e-35    
dbj|BAN20844.1|  clathrin coat associated protein ap-50                 140   1e-35    Riptortus pedestris
gb|EYB96138.1|  hypothetical protein Y032_0153g2927                     140   1e-35    Ancylostoma ceylanicum
ref|XP_391965.1|  PREDICTED: AP-2 complex subunit mu isoform 1          140   1e-35    Apis mellifera [bee]
gb|EPB90458.1|  hypothetical protein HMPREF1544_02666                   139   2e-35    Mucor circinelloides f. circinelloides 1006PhL
gb|AAF68477.1|AF252643_1  clathrin adaptor protein AP-50                139   2e-35    Drosophila simulans
gb|AAF68608.1|AF255311_1  clathrin adaptor protein AP50                 139   2e-35    Drosophila yakuba
ref|XP_002412443.1|  clathrin-adaptor protein, putative                 139   2e-35    Ixodes scapularis [blacklegged tick]
ref|NP_732744.1|  adaptor protein complex 2, mu subunit, isoform A      139   2e-35    Drosophila melanogaster
gb|EXX69941.1|  Apm4p                                                   139   2e-35    Rhizophagus irregularis DAOM 197198w
ref|XP_002427003.1|  AP-2 complex subunit mu-1, putative                139   2e-35    Pediculus humanus corporis [human body lice]
ref|XP_002058393.1|  GJ14336                                            139   2e-35    Drosophila virilis
ref|XP_002001435.1|  GI21976                                            139   3e-35    Drosophila mojavensis
ref|XP_001950328.1|  PREDICTED: AP-2 complex subunit mu                 139   3e-35    Acyrthosiphon pisum
ref|XP_004530702.1|  PREDICTED: AP-2 complex subunit mu-like            139   3e-35    Ceratitis capitata [medfly]
ref|XP_005184259.1|  PREDICTED: AP-2 complex subunit mu                 139   3e-35    Musca domestica
gb|KDR22341.1|  AP-2 complex subunit mu-1                               139   3e-35    Zootermopsis nevadensis
gb|KFZ67005.1|  AP-2 complex subunit mu                                 134   3e-35    Podiceps cristatus
gb|ACH44121.1|  putative adaptor-related protein complex 2 mu 1 s...    137   3e-35    Taeniopygia guttata
ref|XP_002671925.1|  predicted protein                                  138   3e-35    Naegleria gruberi strain NEG-M
gb|EHJ72965.1|  hypothetical protein KGM_11335                          139   3e-35    
dbj|BAE29493.1|  unnamed protein product                                137   4e-35    Mus musculus [mouse]
gb|KHN83994.1|  AP-2 complex subunit mu                                 139   4e-35    Toxocara canis
gb|EYB96136.1|  hypothetical protein Y032_0153g2927                     139   4e-35    Ancylostoma ceylanicum
gb|ACH44122.1|  putative adaptor-related protein complex 2 mu 1 s...    137   4e-35    Taeniopygia guttata
ref|XP_009015103.1|  hypothetical protein HELRODRAFT_98900              138   4e-35    Helobdella robusta
gb|EYB96137.1|  hypothetical protein Y032_0153g2927                     139   4e-35    Ancylostoma ceylanicum
gb|EIE89728.1|  hypothetical protein RO3G_14439                         137   5e-35    Rhizopus delemar RA 99-880
gb|KFD56903.1|  hypothetical protein M513_02160                         138   5e-35    Trichuris suis
gb|EFX87558.1|  hypothetical protein DAPPUDRAFT_306409                  138   5e-35    Daphnia pulex
emb|CDW56487.1|  AP 2 complex subunit mu                                138   5e-35    Trichuris trichiura
ref|XP_007905949.1|  PREDICTED: AP-2 complex subunit mu isoform X1      138   6e-35    Callorhinchus milii [Australian ghost shark]
ref|XP_308629.2|  AGAP007131-PA                                         138   6e-35    Anopheles gambiae str. PEST
ref|XP_001663168.1|  AAEL003106-PA                                      138   6e-35    
ref|XP_003844294.1|  hypothetical protein LEMA_P019450.1                132   6e-35    Leptosphaeria maculans JN3
gb|KGO36057.1|  Clathrin adaptor, mu subunit, C-terminal                138   6e-35    Penicillium expansum
gb|EJU00787.1|  intracellular protein transport-related protein         137   6e-35    Dacryopinax primogenitus
ref|XP_001259892.1|  AP-2 adaptor complex subunit mu, putative          138   7e-35    Aspergillus fischeri NRRL 181
emb|CEI97932.1|  Putative Adaptor complexes medium subunit family       135   8e-35    Rhizopus microsporus
ref|XP_011267285.1|  PREDICTED: AP-2 complex subunit mu                 137   8e-35    Camponotus floridanus
ref|XP_011304989.1|  PREDICTED: AP-2 complex subunit mu                 137   8e-35    Fopius arisanus
ref|XP_003138186.1|  shorter than wild-type protein 23                  137   8e-35    
ref|XP_011141784.1|  PREDICTED: AP-2 complex subunit mu                 137   8e-35    Harpegnathos saltator
gb|EFO25885.2|  AP-2 complex subunit mu                                 137   8e-35    Loa loa
ref|XP_008558828.1|  PREDICTED: AP-2 complex subunit mu                 137   9e-35    Microplitis demolitor
ref|XP_011053672.1|  PREDICTED: AP-2 complex subunit mu                 137   9e-35    Acromyrmex echinatior
ref|XP_011164437.1|  PREDICTED: AP-2 complex subunit mu                 137   9e-35    Solenopsis invicta [imported red fire ant]
ref|XP_003118234.1|  CRE-DPY-23 protein                                 137   9e-35    Caenorhabditis remanei
ref|NP_001024865.1|  Protein DPY-23, isoform b                          137   1e-34    Caenorhabditis elegans [roundworm]
ref|NP_741770.1|  Protein DPY-23, isoform a                             137   1e-34    Caenorhabditis elegans [roundworm]
emb|CDS12488.1|  hypothetical protein LRAMOSA04682                      137   1e-34    Lichtheimia ramosa
emb|CDH58383.1|  ap-2 complex subunit mu-1                              137   1e-34    Lichtheimia corymbifera JMRC:FSU:9682
emb|CDQ69254.1|  unnamed protein product                                133   1e-34    Oncorhynchus mykiss
gb|KEY78854.1|  AP 2 adaptor complex subunit mu                         137   1e-34    Aspergillus fumigatus var. RP-2014
gb|ACO08109.1|  AP-2 complex subunit mu-1                               137   1e-34    Oncorhynchus mykiss
ref|XP_753843.1|  AP-2 adaptor complex subunit mu                       137   1e-34    Aspergillus fumigatus Af293
ref|XP_002644536.1|  C. briggsae CBR-DPY-23 protein                     137   1e-34    Caenorhabditis briggsae
ref|XP_003323240.2|  hypothetical protein PGTG_04777                    137   1e-34    Puccinia graminis f. sp. tritici CRL 75-36-700-3
ref|XP_004415189.1|  PREDICTED: AP-2 complex subunit mu-like            137   1e-34    
pir||T33569  hypothetical protein R160.1 - Caenorhabditis elegans       137   1e-34 
emb|CDM36002.1|  AP-2 complex subunit mu                                137   1e-34    Penicillium roqueforti FM164
emb|CDP94571.1|  Protein BM-DPY-23, isoform b                           137   1e-34    
ref|XP_004003146.1|  PREDICTED: AP-2 complex subunit mu isoform 1       137   1e-34    
ref|XP_001899245.1|  Dumpy : shorter than wild-type protein 23, i...    137   1e-34    Brugia malayi [agent of lymphatic filariasis]
ref|XP_004997970.1|  hypothetical protein PTSG_01983                    137   1e-34    Salpingoeca rosetta
gb|KGO77934.1|  Clathrin coat associated protein AP-50                  137   1e-34    Penicillium italicum
ref|XP_006260842.1|  PREDICTED: AP-2 complex subunit mu isoform X1      137   1e-34    
ref|XP_007529878.1|  PREDICTED: AP-2 complex subunit mu                 137   1e-34    Erinaceus europaeus [common hedgehog]
ref|XP_002565488.1|  Pc22g15720                                         137   1e-34    Penicillium rubens Wisconsin 54-1255
ref|XP_009973139.1|  PREDICTED: AP-2 complex subunit mu isoform X2      137   2e-34    Tyto alba [Schleiereule]
dbj|BAE40329.1|  unnamed protein product                                137   2e-34    Mus musculus [mouse]
ref|NP_988975.1|  AP-2 complex subunit mu                               137   2e-34    Xenopus tropicalis [western clawed frog]
ref|XP_007431580.1|  PREDICTED: AP-2 complex subunit mu isoform X2      137   2e-34    Python bivittatus
ref|XP_003224375.1|  PREDICTED: AP-2 complex subunit mu                 137   2e-34    Anolis carolinensis [Carolina anole]
dbj|BAA09762.2|  KIAA0109                                               137   2e-34    
emb|CAH93147.1|  hypothetical protein                                   137   2e-34    Pongo abelii [orang utan]
ref|XP_005909584.1|  PREDICTED: AP-2 complex subunit mu isoform X1      137   2e-34    Bos mutus
ref|XP_006637891.1|  PREDICTED: AP-2 complex subunit mu-like isof...    137   2e-34    Lepisosteus oculatus
gb|KIK46523.1|  hypothetical protein CY34DRAFT_401490                   132   2e-34    Suillus luteus UH-Slu-Lm8-n1
ref|XP_005051256.1|  PREDICTED: AP-2 complex subunit mu isoform X4      137   2e-34    
ref|NP_033809.1|  AP-2 complex subunit mu isoform 1                     137   2e-34    Mus musculus [mouse]
ref|NP_001080803.1|  AP-2 complex subunit mu                            137   2e-34    Xenopus laevis [clawed frog]
pdb|2XA7|M  Chain M, Ap2 Clathrin Adaptor Core In Active Complex ...    137   2e-34    Mus musculus [mouse]
ref|XP_003412933.1|  PREDICTED: AP-2 complex subunit mu                 137   2e-34    Loxodonta africana [African bush elephant]
ref|NP_001267275.1|  AP-2 complex subunit mu                            136   2e-34    Pan troglodytes
emb|CAH93114.1|  hypothetical protein                                   136   2e-34    Pongo abelii [orang utan]
ref|XP_010853989.1|  PREDICTED: AP-2 complex subunit mu isoform X1      136   2e-34    Bison bison bison
ref|XP_003340594.1|  PREDICTED: AP-2 complex subunit mu                 136   2e-34    Monodelphis domestica
ref|XP_005159313.1|  PREDICTED: AP-2 complex subunit mu-B isoform X1    136   2e-34    Danio rerio [leopard danio]
gb|AAA27981.1|  clathrin-associated protein homologue                   136   2e-34    Caenorhabditis elegans [roundworm]
ref|XP_008479181.1|  PREDICTED: AP-2 complex subunit mu isoform X1      136   2e-34    
gb|EYE93091.1|  AP-2 complex subunit MU                                 136   2e-34    Aspergillus ruber CBS 135680
ref|XP_007257834.1|  PREDICTED: AP-2 complex subunit mu-B-like is...    136   2e-34    
ref|XP_009292135.1|  PREDICTED: AP-2 complex subunit mu-B isoform X2    136   2e-34    Danio rerio [leopard danio]
ref|NP_001127643.1|  AP-2 complex subunit mu                            136   2e-34    Pongo abelii [orang utan]
ref|XP_007257833.1|  PREDICTED: AP-2 complex subunit mu-B-like is...    136   2e-34    
ref|XP_010901588.1|  PREDICTED: AP-2 complex subunit mu-B isoform X3    136   3e-34    Esox lucius
ref|XP_010901585.1|  PREDICTED: AP-2 complex subunit mu-B isoform X1    136   3e-34    Esox lucius
gb|KDN51074.1|  hypothetical protein RSAG8_00703                        136   3e-34    Rhizoctonia solani AG-8 WAC10335
ref|XP_681010.1|  hypothetical protein AN7741.2                         136   3e-34    Aspergillus nidulans FGSC A4
gb|KDQ19754.1|  hypothetical protein BOTBODRAFT_27183                   136   3e-34    Botryobasidium botryosum FD-172 SS1
ref|NP_001279069.1|  adaptor-related protein complex 2, mu 1 subunit    136   3e-34    Callorhinchus milii [Australian ghost shark]
ref|XP_003374298.1|  AP-2 complex subunit mu                            136   3e-34    Trichinella spiralis
ref|XP_005104428.1|  PREDICTED: AP-2 complex subunit mu-like            136   3e-34    Aplysia californica
emb|CEG75132.1|  Putative AP-2 complex subunit mu-1                     135   3e-34    Rhizopus microsporus
emb|CEI93327.1|  Putative AP-2 complex subunit mu-1                     135   3e-34    Rhizopus microsporus
gb|EMS25299.1|  AP-2 complex subunit mu-1                               135   3e-34    Rhodotorula toruloides NP11
ref|XP_008296664.1|  PREDICTED: AP-2 complex subunit mu                 135   4e-34    Stegastes partitus
gb|EUC57867.1|  AP-2 adaptor complex subunit mu, putative               135   4e-34    Rhizoctonia solani AG-3 Rhs1AP
gb|EJK48489.1|  hypothetical protein THAOC_32705                        135   4e-34    Thalassiosira oceanica
emb|CEL59651.1|  AP-2 complex subunit mu OS=Dictyostelium discoid...    135   4e-34    Rhizoctonia solani AG-1 IB
gb|AAA93254.1|  assembly protein 50                                     135   4e-34    Homo sapiens [man]
ref|NP_001154125.1|  AP-2 complex subunit mu-1                          135   5e-34    Oncorhynchus mykiss
ref|XP_010748077.1|  PREDICTED: AP-2 complex subunit mu-like isof...    134   5e-34    
ref|XP_007338754.1|  clathrin adaptor, mu subunit                       135   5e-34    
gb|KDN50833.1|  clathrin adaptor, mu subunit                            135   5e-34    
ref|NP_957320.1|  AP-2 complex subunit mu-B                             135   5e-34    
ref|XP_002167060.2|  PREDICTED: AP-2 complex subunit mu-A-like          135   5e-34    
gb|AIC54189.1|  AP2M1                                                   135   6e-34    
ref|XP_004079210.1|  PREDICTED: AP-2 complex subunit mu isoform X2      135   6e-34    
emb|CDQ69021.1|  unnamed protein product                                135   6e-34    
ref|XP_010768353.1|  PREDICTED: AP-2 complex subunit mu isoform X2      135   6e-34    
ref|XP_009543019.1|  hypothetical protein HETIRDRAFT_167529             135   7e-34    
ref|XP_003438252.1|  PREDICTED: AP-2 complex subunit mu-A-like is...    135   7e-34    
ref|NP_997742.1|  AP-2 complex subunit mu-A isoform 2                   135   7e-34    
ref|XP_003975721.1|  PREDICTED: AP-2 complex subunit mu-A-like          135   7e-34    
gb|KFO87859.1|  AP-2 complex subunit mu                                 135   7e-34    
ref|NP_001230573.1|  adaptor-related protein complex 2, mu 1 subunit    135   7e-34    
emb|CDO73662.1|  hypothetical protein BN946_scf185014.g132              135   7e-34    
gb|KFV60859.1|  AP-2 complex subunit mu                                 135   7e-34    
ref|XP_003069525.1|  Adaptor complexes medium subunit family protein    135   7e-34    
ref|XP_005797134.1|  PREDICTED: AP-2 complex subunit mu-A-like is...    135   7e-34    
ref|XP_009973141.1|  PREDICTED: AP-2 complex subunit mu isoform X4      135   7e-34    
ref|XP_003192284.1|  intracellular protein transport-related protein    135   7e-34    
gb|ELU18519.1|  hypothetical protein CAPTEDRAFT_168189                  135   7e-34    
ref|XP_010768352.1|  PREDICTED: AP-2 complex subunit mu isoform X1      135   8e-34    
gb|KIY70431.1|  clathrin adaptor, mu subunit                            135   8e-34    
ref|XP_008036262.1|  clathrin adaptor mu subunit                        135   8e-34    
ref|NP_001278284.1|  AP-2 complex subunit mu-A isoform 1                135   8e-34    
ref|XP_011484957.1|  PREDICTED: AP-2 complex subunit mu isoform X1      135   8e-34    
ref|NP_001072962.1|  AP-2 complex subunit mu                            135   8e-34    
ref|XP_004003147.1|  PREDICTED: AP-2 complex subunit mu isoform 2       135   8e-34    
ref|XP_006260843.1|  PREDICTED: AP-2 complex subunit mu isoform X2      135   8e-34    
ref|XP_004542497.1|  PREDICTED: AP-2 complex subunit mu-A-like is...    135   8e-34    
ref|XP_003770330.1|  PREDICTED: AP-2 complex subunit mu isoform 3       134   8e-34    
ref|XP_005484921.1|  PREDICTED: AP-2 complex subunit mu isoform X5      135   8e-34    
ref|XP_010747784.1|  PREDICTED: AP-2 complex subunit mu-A               135   8e-34    
gb|EPS94769.1|  clathrin adaptor mu subunit                             134   8e-34    
ref|XP_006637892.1|  PREDICTED: AP-2 complex subunit mu-like isof...    135   8e-34    
dbj|GAM27282.1|  hypothetical protein SAMD00019534_104570               137   8e-34    
ref|XP_010853990.1|  PREDICTED: AP-2 complex subunit mu isoform X2      135   8e-34    
dbj|BAD32167.1|  mKIAA0109 protein                                      135   9e-34    
ref|NP_001133612.1|  AP-2 complex subunit mu-1                          135   9e-34    
gb|EMP27501.1|  AP-2 complex subunit mu-1                               135   9e-34    
ref|XP_005797133.1|  PREDICTED: AP-2 complex subunit mu-A-like is...    135   9e-34    
ref|XP_005909585.1|  PREDICTED: AP-2 complex subunit mu isoform X2      134   9e-34    
ref|NP_001020376.1|  AP-2 complex subunit mu isoform b                  134   9e-34    
ref|XP_003509661.1|  PREDICTED: AP-2 complex subunit mu isoform X2      134   9e-34    
emb|CAH92511.1|  hypothetical protein                                   134   9e-34    
ref|XP_002288778.1|  clathrin adaptor complex subunit                   134   9e-34    
ref|XP_001823509.2|  AP-2 complex subunit mu                            134   1e-33    
ref|XP_002378913.1|  AP-2 adaptor complex subunit mu, putative          134   1e-33    
ref|XP_002147918.1|  AP-2 adaptor complex subunit mu, putative          134   1e-33    
gb|KIL67004.1|  hypothetical protein M378DRAFT_123224                   134   1e-33    
ref|XP_010748073.1|  PREDICTED: AP-2 complex subunit mu-like isof...    134   1e-33    
ref|XP_001216955.1|  AP-2 complex subunit mu-1                          134   1e-33    
ref|XP_007361470.1|  clathrin adaptor mu subunit                        134   1e-33    
dbj|BAF63024.1|  adaptor-related protein complex 1 mu 1 subunit         134   1e-33    
gb|EPY82362.1|  AP-2 complex subunit mu isoform 2                       134   1e-33    
gb|KIR50550.1|  AP-2 complex subunit mu-1                               134   2e-33    
gb|KIR84543.1|  AP-2 complex subunit mu-1                               134   2e-33    
gb|KGB74255.1|  AP-2 complex subunit mu-1                               134   2e-33    
ref|XP_001633898.1|  predicted protein                                  134   2e-33    
dbj|GAD97397.1|  AP-2 complex subunit mu                                134   2e-33    
ref|XP_569119.1|  intracellular protein transport-related protein       134   2e-33    
gb|EDL26877.1|  mCG9691                                                 134   2e-33    
emb|CCX09643.1|  Similar to AP-2 complex subunit mu; acc. no. P84092    132   2e-33    
ref|XP_002544710.1|  AP-2 complex subunit mu                            134   2e-33    
ref|XP_007300817.1|  clathrin adaptor mu subunit                        134   2e-33    
gb|AFR93196.2|  AP-2 complex subunit mu-1                               134   2e-33    
ref|XP_007395578.1|  hypothetical protein PHACADRAFT_208759             134   2e-33    
gb|KFX41703.1|  AP-2 complex subunit mu                                 134   2e-33    
dbj|GAM27654.1|  hypothetical protein SAMD00019534_108300               134   2e-33    
gb|KIM27550.1|  hypothetical protein M408DRAFT_329989                   134   2e-33    
ref|XP_011114799.1|  hypothetical protein H072_9164                     134   2e-33    
gb|EPS34609.1|  hypothetical protein PDE_09573                          134   2e-33    
ref|XP_011128168.1|  hypothetical protein AOL_s00215g664                133   2e-33    
ref|XP_009862049.1|  PREDICTED: AP-2 complex subunit mu isoform X2      133   3e-33    
sp|Q5NVF7.1|AP2M1_PONAB  RecName: Full=AP-2 complex subunit mu; A...    133   3e-33    
ref|XP_002126024.2|  PREDICTED: AP-2 complex subunit mu isoform X1      133   3e-33    
ref|XP_009945197.1|  PREDICTED: AP-2 complex subunit mu                 133   3e-33    
ref|XP_010901589.1|  PREDICTED: AP-2 complex subunit mu isoform X4      133   3e-33    
gb|KIK91344.1|  hypothetical protein PAXRUDRAFT_635188                  133   3e-33    
ref|XP_010901587.1|  PREDICTED: AP-2 complex subunit mu isoform X2      133   3e-33    
gb|EMD38134.1|  hypothetical protein CERSUDRAFT_113280                  133   3e-33    
ref|XP_007004463.1|  hypothetical protein TREMEDRAFT_30756              133   3e-33    
emb|CAG01987.1|  unnamed protein product                                133   3e-33    
ref|XP_006049366.1|  PREDICTED: AP-2 complex subunit mu-like            133   3e-33    
ref|XP_010886914.1|  PREDICTED: AP-2 complex subunit mu-A               133   3e-33    
ref|XP_007863128.1|  clathrin adaptor, mu subunit                       133   3e-33    
gb|KIJ16707.1|  hypothetical protein PAXINDRAFT_168211                  133   4e-33    
ref|XP_779923.2|  PREDICTED: AP-2 complex subunit mu-like isoform 1     132   4e-33    
ref|XP_002838715.1|  hypothetical protein                               133   4e-33    
gb|EEH10423.1|  AP-2 complex subunit mu-1                               133   4e-33    
gb|KIJ68897.1|  hypothetical protein HYDPIDRAFT_122738                  133   4e-33    
ref|XP_007684415.1|  hypothetical protein COCMIDRAFT_33539              132   4e-33    
emb|CDQ67792.1|  unnamed protein product                                133   4e-33    
gb|EUN23426.1|  hypothetical protein COCVIDRAFT_19018                   133   4e-33    
ref|XP_007585846.1|  putative ap-2 complex subunit mu-1 protein         135   5e-33    
ref|XP_001592075.1|  conserved hypothetical protein                     132   5e-33    
ref|XP_008023044.1|  hypothetical protein SETTUDRAFT_127772             132   5e-33    
gb|KFD66141.1|  hypothetical protein M514_02160                         132   5e-33    
gb|AAX07648.1|  clathrin coat assembly protein-like protein             132   5e-33    
ref|XP_010131395.1|  PREDICTED: AP-2 complex subunit mu                 132   5e-33    
gb|KIN05892.1|  hypothetical protein OIDMADRAFT_38317                   132   5e-33    
ref|XP_007697172.1|  hypothetical protein COCSADRAFT_197318             132   5e-33    
ref|XP_001931501.1|  AP-2 complex subunit mu-1                          132   5e-33    
ref|XP_003710350.1|  AP-2 complex subunit mu-1                          132   5e-33    
ref|XP_001555699.1|  conserved hypothetical protein                     132   5e-33    
ref|XP_009973138.1|  PREDICTED: AP-2 complex subunit mu isoform X1      132   6e-33    
ref|XP_005051258.1|  PREDICTED: AP-2 complex subunit mu isoform X6      132   6e-33    
gb|ELT98131.1|  hypothetical protein CAPTEDRAFT_178783                  132   6e-33    
ref|XP_005383404.1|  PREDICTED: AP-2 complex subunit mu isoform X1      132   6e-33    
ref|XP_007431579.1|  PREDICTED: AP-2 complex subunit mu isoform X1      132   6e-33    
ref|XP_008087197.1|  Second of Mu2 adaptin subunit (ap50) of ap2 ...    132   6e-33    
ref|XP_005051253.1|  PREDICTED: AP-2 complex subunit mu isoform X1      132   6e-33    
ref|XP_006987825.1|  PREDICTED: AP-2 complex subunit mu isoform X1      132   6e-33    
ref|XP_007288847.1|  adaptor complexes medium subunit family protein    132   7e-33    
ref|XP_779903.1|  PREDICTED: AP-2 complex subunit mu-like isoform 1     132   7e-33    
ref|XP_009508677.1|  PREDICTED: AP-2 complex subunit mu isoform X1      132   7e-33    
ref|XP_009557545.1|  PREDICTED: AP-2 complex subunit mu isoform X1      132   7e-33    
ref|XP_001799674.1|  hypothetical protein SNOG_09379                    132   7e-33    
gb|KFA51318.1|  hypothetical protein S40293_04387                       132   7e-33    
emb|CBN77778.1|  Clathrin assembly complex, medium subunit              132   7e-33    
ref|XP_003303864.1|  hypothetical protein PTT_16248                     133   7e-33    
gb|EGE83211.1|  AP-2 complex subunit mu                                 132   8e-33    
ref|XP_002849436.1|  AP-2 complex subunit mu-1                          132   8e-33    
gb|EEQ85999.1|  AP-2 complex subunit mu                                 132   8e-33    
ref|XP_001274256.1|  AP-2 adaptor complex subunit mu, putative          132   8e-33    
ref|XP_007326074.1|  hypothetical protein AGABI1DRAFT_34253             132   8e-33    
emb|CCA74557.1|  probable clathrin-associated adaptor complex med...    132   9e-33    
ref|XP_006457787.1|  hypothetical protein AGABI2DRAFT_63164             132   9e-33    
emb|CCJ29251.1|  unnamed protein product                                132   9e-33    
ref|XP_002621101.1|  AP-2 complex subunit mu                            132   1e-32    
gb|KIM86237.1|  hypothetical protein PILCRDRAFT_816169                  132   1e-32    
gb|ERT01050.1|  hypothetical protein HMPREF1624_02287                   132   1e-32    
ref|XP_001749457.1|  hypothetical protein                               131   1e-32    
gb|EEH23278.1|  hypothetical protein PABG_05489                         131   1e-32    
gb|EQL29519.1|  hypothetical protein BDFG_07834                         132   1e-32    
gb|EZF75306.1|  hypothetical protein H105_03124                         131   1e-32    
ref|XP_003025557.1|  hypothetical protein TRV_00320                     131   1e-32    
dbj|GAM90906.1|  hypothetical protein ANO11243_089520                   131   1e-32    
gb|EMF12264.1|  clathrin adaptor, mu subunit                            131   2e-32    
gb|KIW09305.1|  hypothetical protein PV09_00220                         131   2e-32    
ref|XP_007594396.1|  adaptor complexes medium subunit family protein    131   2e-32    
ref|XP_009654409.1|  AP-2 complex subunit mu-1                          131   2e-32    
gb|EFX86177.1|  hypothetical protein DAPPUDRAFT_222170                  131   2e-32    
emb|CCF34693.1|  adaptor complexes medium subunit family protein        131   2e-32    
gb|KJA24291.1|  hypothetical protein HYPSUDRAFT_39062                   131   2e-32    
ref|XP_007855079.1|  ap-2 complex subunit mu-1                          131   2e-32    
ref|XP_005847723.1|  hypothetical protein CHLNCDRAFT_35389              131   2e-32    
gb|AAH47180.1|  Zgc:85653                                               131   2e-32    
dbj|GAA91311.1|  AP-2 complex subunit mu-1                              131   2e-32    
gb|KFX41706.1|  AP-2 complex subunit mu                                 134   2e-32    
ref|XP_001390293.2|  AP-2 complex subunit mu                            131   2e-32    
gb|EFQ25808.1|  adaptor complexes medium subunit family protein         131   2e-32    
ref|XP_010761579.1|  hypothetical protein PADG_11986                    131   2e-32    
emb|CAK47851.1|  unnamed protein product                                131   2e-32    
gb|ELR09496.1|  AP-2 complex subunit mu-1                               131   2e-32    
ref|XP_002790764.1|  AP-2 complex subunit mu                            131   2e-32    
gb|KFX41705.1|  AP-2 complex subunit mu                                 134   2e-32    
ref|XP_001242267.1|  conserved hypothetical protein                     134   2e-32    
gb|EEH36883.2|  AP-2 complex subunit mu                                 131   2e-32    
ref|XP_007322158.1|  hypothetical protein SERLADRAFT_476085             130   2e-32    
gb|EGC44898.1|  AP-2 complex subunit mu-1                               131   2e-32    
ref|XP_003648561.1|  hypothetical protein THITE_2106174                 130   2e-32    
ref|XP_968639.1|  PREDICTED: AP-1 complex subunit mu-1                  130   2e-32    
gb|KDQ61224.1|  hypothetical protein JAAARDRAFT_152340                  130   2e-32    
ref|XP_005110316.1|  PREDICTED: AP-1 complex subunit mu-1-like is...    130   2e-32    
gb|EER36638.1|  AP-2 complex subunit mu-1                               131   2e-32    
gb|EGD99026.1|  AP-2 adaptor complex subunit mu                         130   2e-32    
ref|XP_007926961.1|  hypothetical protein MYCFIDRAFT_32614              130   2e-32    
ref|XP_001886027.1|  predicted protein                                  130   2e-32    
gb|KIK06101.1|  hypothetical protein K443DRAFT_674665                   130   2e-32    
ref|XP_003346788.1|  hypothetical protein SMAC_05046                    130   2e-32    
ref|XP_004923800.1|  PREDICTED: AP-1 complex subunit mu-1-like          130   3e-32    
gb|KIM53041.1|  hypothetical protein SCLCIDRAFT_139801                  131   3e-32    
gb|EHJ64804.1|  hypothetical protein KGM_02865                          130   3e-32    
gb|EME42801.1|  hypothetical protein DOTSEDRAFT_24820                   130   3e-32    
ref|XP_009973140.1|  PREDICTED: AP-2 complex subunit mu isoform X3      130   3e-32    
dbj|BAM18015.1|  clathrin coat assembly protein ap-1                    130   3e-32    
ref|XP_007431581.1|  PREDICTED: AP-2 complex subunit mu isoform X3      130   3e-32    
ref|XP_003975436.1|  PREDICTED: AP-1 complex subunit mu-1-like          130   3e-32    
ref|XP_005051257.1|  PREDICTED: AP-2 complex subunit mu isoform X5      130   3e-32    
gb|KFX41702.1|  AP-2 complex subunit mu                                 134   3e-32    
gb|KFX41704.1|  AP-2 complex subunit mu                                 134   3e-32    
ref|XP_007195387.1|  PREDICTED: AP-2 complex subunit mu isoform X3      130   3e-32    
ref|XP_005484923.1|  PREDICTED: AP-2 complex subunit mu isoform X7      130   3e-32    
gb|EHK19467.1|  hypothetical protein TRIVIDRAFT_203591                  130   3e-32    
gb|EHK49480.1|  hypothetical protein TRIATDRAFT_289548                  130   3e-32    
ref|XP_006969311.1|  adaptor protein complex AP-2, medium chain         130   3e-32    
ref|XP_002482147.1|  AP-2 adaptor complex subunit mu, putative          130   3e-32    
ref|XP_009079676.1|  PREDICTED: AP-1 complex subunit mu-1               127   4e-32    
ref|XP_007781272.1|  hypothetical protein W97_05197                     130   4e-32    
ref|XP_002602503.1|  hypothetical protein BRAFLDRAFT_266579             130   4e-32    
gb|EGU79137.1|  hypothetical protein FOXB_10375                         130   4e-32    
gb|KGQ03357.1|  AP-2 complex subunit mu                                 130   4e-32    
ref|XP_008332791.1|  PREDICTED: AP-1 complex subunit mu-1               130   4e-32    
ref|XP_002113320.1|  expressed hypothetical protein                     130   4e-32    
gb|EWZ00432.1|  hypothetical protein FOYG_00303                         130   4e-32    
ref|XP_008603384.1|  adaptor complexes medium subunit family protein    130   5e-32    
gb|KFQ31531.1|  AP-1 complex subunit mu-1                               128   5e-32    
gb|EPE10520.1|  ap-2 adaptor complex subunit                            130   5e-32    
ref|XP_003047853.1|  predicted protein                                  130   5e-32    
gb|KFH71985.1|  hypothetical protein MVEG_02279                         129   5e-32    
emb|CDW55306.1|  clathrin coat assembly protein ap 1                    129   5e-32    
emb|CEJ92891.1|  Putative Ap-2 complex subunit mu-1                     129   6e-32    
ref|XP_007820694.1|  adaptor protein complex AP-2, medium chain         129   6e-32    
ref|XP_003448533.1|  PREDICTED: AP-1 complex subunit mu-1               129   6e-32    
gb|KDR73730.1|  hypothetical protein GALMADRAFT_251539                  129   6e-32    
gb|EQL04218.1|  adaptor protein complex AP-2, medium chain              129   6e-32    
gb|KFP71226.1|  AP-1 complex subunit mu-1                               127   6e-32    
gb|EXV06769.1|  Mu-like subunit of the clathrin associated protei...    129   6e-32    
ref|XP_009251924.1|  hypothetical protein FPSE_00529                    129   6e-32    
ref|XP_007811895.1|  AP-2 complex subunit mu-1                          129   6e-32    
ref|XP_007385283.1|  clathrin adaptor mu subunit                        130   6e-32    
gb|EQB57974.1|  adaptor complexes medium subunit family protein         129   6e-32    
gb|EWG47486.1|  hypothetical protein FVEG_07568                         129   6e-32    
gb|KFD56950.1|  hypothetical protein M513_02207                         129   7e-32    
ref|XP_007279341.1|  ap-2 complex subunit mu-1                          129   7e-32    
gb|KIV91084.1|  hypothetical protein PV10_05666                         129   7e-32    
emb|CCT72151.1|  probable clathrin-associated adaptor complex med...    129   7e-32    
ref|XP_010178417.1|  PREDICTED: AP-1 complex subunit mu-1               128   7e-32    
gb|KEY64910.1|  hypothetical protein S7711_03902                        129   7e-32    
gb|KIL90379.1|  ap-2 complex subunit mu-1                               129   7e-32    



>ref|XP_008373693.1| PREDICTED: AP-2 complex subunit mu-like [Malus domestica]
Length=227

 Score =   306 bits (784),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSF Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>gb|KDO51121.1| hypothetical protein CISIN_1g013671mg [Citrus sinensis]
Length=359

 Score =   308 bits (789),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSF Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>ref|XP_010941233.1| PREDICTED: AP-2 complex subunit mu [Elaeis guineensis]
Length=438

 Score =   310 bits (795),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 150/150 (100%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>ref|XP_011082368.1| PREDICTED: AP-2 complex subunit mu [Sesamum indicum]
Length=438

 Score =   308 bits (790),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSF Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>ref|XP_007039526.1| Clathrin adaptor complexes medium subunit family protein isoform 
4 [Theobroma cacao]
 gb|EOY24027.1| Clathrin adaptor complexes medium subunit family protein isoform 
4 [Theobroma cacao]
Length=359

 Score =   306 bits (783),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQTKELGTCPVRQIGGCSF Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRMHIMQTKELGTCPVRQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>gb|KHN42609.1| AP-2 complex subunit mu [Glycine soja]
Length=426

 Score =   308 bits (789),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSF Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>gb|ACL53413.1| unknown [Zea mays]
Length=438

 Score =   308 bits (790),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQTKELGTCPVRQIGGCSFLY
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRMHIMQTKELGTCPVRQIGGCSFLY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>ref|XP_006573688.1| PREDICTED: AP-2 complex subunit mu-like [Glycine max]
Length=438

 Score =   308 bits (789),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSF Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>ref|NP_001047793.1| Os02g0690700 [Oryza sativa Japonica Group]
 dbj|BAD07683.1| putative Clathrin coat assembly protein AP50 [Oryza sativa Japonica 
Group]
 dbj|BAF09707.1| Os02g0690700 [Oryza sativa Japonica Group]
 gb|EAZ24244.1| hypothetical protein OsJ_07994 [Oryza sativa Japonica Group]
 dbj|BAG95509.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC73817.1| hypothetical protein OsI_08536 [Oryza sativa Indica Group]
Length=438

 Score =   308 bits (789),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQTKELGTCPVRQIGGCSFLY
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRMHIMQTKELGTCPVRQIGGCSFLY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>ref|XP_006436725.1| hypothetical protein CICLE_v10031568mg [Citrus clementina]
 ref|XP_006436726.1| hypothetical protein CICLE_v10031568mg [Citrus clementina]
 ref|XP_006436727.1| hypothetical protein CICLE_v10031568mg [Citrus clementina]
 ref|XP_006485572.1| PREDICTED: AP-2 complex subunit mu-like [Citrus sinensis]
 gb|ESR49965.1| hypothetical protein CICLE_v10031568mg [Citrus clementina]
 gb|ESR49966.1| hypothetical protein CICLE_v10031568mg [Citrus clementina]
 gb|ESR49967.1| hypothetical protein CICLE_v10031568mg [Citrus clementina]
 gb|KDO51118.1| hypothetical protein CISIN_1g013671mg [Citrus sinensis]
 gb|KDO51119.1| hypothetical protein CISIN_1g013671mg [Citrus sinensis]
 gb|KDO51120.1| hypothetical protein CISIN_1g013671mg [Citrus sinensis]
Length=438

 Score =   308 bits (789),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSF Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>ref|NP_001149848.1| LOC100283476 [Zea mays]
 gb|ACG36987.1| AP-2 complex subunit mu [Zea mays]
 gb|AFW72877.1| LOW QUALITY PROTEIN: AP-2 complex subunit mu [Zea mays]
Length=438

 Score =   308 bits (789),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQTKELGTCPVRQIGGCSFLY
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRMHIMQTKELGTCPVRQIGGCSFLY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>ref|XP_004148486.1| PREDICTED: AP-2 complex subunit mu-like [Cucumis sativus]
 ref|XP_008465961.1| PREDICTED: AP-2 complex subunit mu [Cucumis melo]
 gb|KGN60402.1| hypothetical protein Csa_3G902930 [Cucumis sativus]
Length=438

 Score =   308 bits (789),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSF Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>ref|XP_002454449.1| hypothetical protein SORBIDRAFT_04g031270 [Sorghum bicolor]
 gb|EES07425.1| hypothetical protein SORBIDRAFT_04g031270 [Sorghum bicolor]
Length=438

 Score =   308 bits (789),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQTKELGTCPVRQIGGCSFLY
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRMHIMQTKELGTCPVRQIGGCSFLY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>ref|XP_010559292.1| PREDICTED: AP-2 complex subunit mu [Tarenaya hassleriana]
Length=438

 Score =   308 bits (788),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELG CPVRQIGGCSFLY
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGNCPVRQIGGCSFLY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>ref|XP_009389091.1| PREDICTED: AP-2 complex subunit mu [Musa acuminata subsp. malaccensis]
Length=438

 Score =   308 bits (788),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQTKELGTCPVRQIGGCSFLY
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRMHIMQTKELGTCPVRQIGGCSFLY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>ref|XP_009397662.1| PREDICTED: AP-2 complex subunit mu-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=360

 Score =   305 bits (781),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQTKELGTCPVRQIGGCSFLY
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRMHIMQTKELGTCPVRQIGGCSFLY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS NANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSKNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNL+PEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLAPEILKLYITQEGVRSPFSSKP  150



>ref|XP_006647711.1| PREDICTED: AP-2 complex subunit mu-like [Oryza brachyantha]
Length=438

 Score =   308 bits (788),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQTKELGTCPVRQIGGCSFLY
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRMHIMQTKELGTCPVRQIGGCSFLY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEG+RSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGIRSPFSSKP  150



>ref|XP_006579975.1| PREDICTED: AP-2 complex subunit mu-like isoform X2 [Glycine max]
Length=399

 Score =   306 bits (784),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSF Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS NANVACAFKFVVEAVALF+SYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSNNANVACAFKFVVEAVALFRSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>ref|XP_003539189.1| PREDICTED: AP-2 complex subunit mu-like isoform X1 [Glycine max]
Length=438

 Score =   307 bits (787),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPV+QIGGCSF Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVKQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>ref|XP_006385641.1| AP47/50p mRNA family protein [Populus trichocarpa]
 ref|XP_011028194.1| PREDICTED: AP-2 complex subunit mu [Populus euphratica]
 gb|ABK94434.1| unknown [Populus trichocarpa]
 gb|ERP63438.1| AP47/50p mRNA family protein [Populus trichocarpa]
Length=438

 Score =   307 bits (787),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASA+YFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSF Y
Sbjct  1    MPVAASAVYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>ref|XP_007039527.1| Clathrin adaptor complexes medium subunit family protein isoform 
5 [Theobroma cacao]
 gb|EOY24028.1| Clathrin adaptor complexes medium subunit family protein isoform 
5 [Theobroma cacao]
Length=383

 Score =   305 bits (782),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQTKELGTCPVRQIGGCSF Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRMHIMQTKELGTCPVRQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>emb|CDY67244.1| BnaA02g36610D, partial [Brassica napus]
Length=265

 Score =   301 bits (771),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 144/150 (96%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINR YRDDVGGNMVDAFRTHIMQTKELG CPVRQIGGCSF+Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRTYRDDVGGNMVDAFRTHIMQTKELGNCPVRQIGGCSFVY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVAC FKFVVEAVALFKSYFGGAFDEDAI+NNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACGFKFVVEAVALFKSYFGGAFDEDAIKNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>gb|AFK39198.1| unknown [Lotus japonicus]
Length=438

 Score =   307 bits (787),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPV+QIGGCSF Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVKQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>ref|XP_007155773.1| hypothetical protein PHAVU_003G230400g [Phaseolus vulgaris]
 gb|ESW27767.1| hypothetical protein PHAVU_003G230400g [Phaseolus vulgaris]
Length=438

 Score =   307 bits (786),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSF Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS NANVACAFKFVVEAVALF+SYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSNNANVACAFKFVVEAVALFRSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>ref|XP_003611474.1| AP-2 complex subunit mu [Medicago truncatula]
 gb|AES94432.1| clathrin-adaptor medium chain AP-2 [Medicago truncatula]
Length=407

 Score =   306 bits (783),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 146/149 (98%), Positives = 148/149 (99%), Gaps = 0/149 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASA+YFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPV+QIGGCSF Y
Sbjct  1    MPVAASAVYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVKQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSK  575
            DFGYPQNLSPEILKLYITQEGVRSPFSSK
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSK  149



>ref|XP_006847724.1| hypothetical protein AMTR_s00149p00084380 [Amborella trichopoda]
 gb|ERN09305.1| hypothetical protein AMTR_s00149p00084380 [Amborella trichopoda]
Length=438

 Score =   306 bits (785),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQTKELGTCPVRQIGGCSF+Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRMHIMQTKELGTCPVRQIGGCSFIY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>ref|XP_003524713.1| PREDICTED: AP-2 complex subunit mu-like isoform X1 [Glycine max]
 gb|KHN45967.1| AP-2 complex subunit mu [Glycine soja]
Length=438

 Score =   306 bits (785),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSF Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS NANVACAFKFVVEAVALF+SYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSNNANVACAFKFVVEAVALFRSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>ref|XP_010935003.1| PREDICTED: AP-2 complex subunit mu-like [Elaeis guineensis]
Length=438

 Score =   306 bits (784),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQTKELGTCPVRQIGGCSFLY
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRMHIMQTKELGTCPVRQIGGCSFLY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVACAFKFV EAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVCEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>ref|XP_006361186.1| PREDICTED: AP-2 complex subunit mu-like isoform X2 [Solanum tuberosum]
Length=438

 Score =   306 bits (784),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 146/150 (97%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASA+YFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQTKELGTCPVRQIGGCSF Y
Sbjct  1    MPVAASAVYFLNLRGDVLINRLYRDDVGGNMVDAFRMHIMQTKELGTCPVRQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGG+FDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGSFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>gb|KDP33153.1| hypothetical protein JCGZ_13593 [Jatropha curcas]
Length=438

 Score =   306 bits (783),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQTKELGTCPVRQIGGCSF Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRMHIMQTKELGTCPVRQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>ref|XP_009397661.1| PREDICTED: AP-2 complex subunit mu-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=438

 Score =   306 bits (783),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQTKELGTCPVRQIGGCSFLY
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRMHIMQTKELGTCPVRQIGGCSFLY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS NANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSKNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNL+PEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLAPEILKLYITQEGVRSPFSSKP  150



>ref|XP_007039523.1| Clathrin adaptor complexes medium subunit family protein isoform 
1 [Theobroma cacao]
 gb|EOY24024.1| Clathrin adaptor complexes medium subunit family protein isoform 
1 [Theobroma cacao]
Length=438

 Score =   306 bits (783),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQTKELGTCPVRQIGGCSF Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRMHIMQTKELGTCPVRQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>ref|XP_004241965.1| PREDICTED: AP-2 complex subunit mu isoform X2 [Solanum lycopersicum]
Length=438

 Score =   306 bits (783),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 146/150 (97%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASA+YFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQTKELGTCPVRQIGGCSF Y
Sbjct  1    MPVAASAVYFLNLRGDVLINRLYRDDVGGNMVDAFRMHIMQTKELGTCPVRQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGG+FDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGSFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>emb|CDY63050.1| BnaA06g40410D [Brassica napus]
Length=438

 Score =   306 bits (783),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINR YRDDVGGNMVDAFRTHIMQTKELG CPVRQIGGCSF+Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRTYRDDVGGNMVDAFRTHIMQTKELGNCPVRQIGGCSFVY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>ref|XP_002281297.1| PREDICTED: AP-2 complex subunit mu [Vitis vinifera]
 emb|CBI33916.3| unnamed protein product [Vitis vinifera]
Length=438

 Score =   306 bits (783),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQTKELGTCPVRQIGGCSF Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRMHIMQTKELGTCPVRQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>ref|XP_007209151.1| hypothetical protein PRUPE_ppa005912mg [Prunus persica]
 ref|XP_008238273.1| PREDICTED: AP-2 complex subunit mu [Prunus mume]
 gb|EMJ10350.1| hypothetical protein PRUPE_ppa005912mg [Prunus persica]
Length=438

 Score =   306 bits (783),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQTKELGTCPVRQIGGCSF Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRMHIMQTKELGTCPVRQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>gb|KJB39798.1| hypothetical protein B456_007G031400 [Gossypium raimondii]
Length=438

 Score =   306 bits (783),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQTKELGTCPVRQIGGCSF Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRMHIMQTKELGTCPVRQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>ref|XP_008788675.1| PREDICTED: AP-2 complex subunit mu isoform X1 [Phoenix dactylifera]
Length=438

 Score =   306 bits (783),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQTKELGTCPVRQIGGCS LY
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRMHIMQTKELGTCPVRQIGGCSILY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>ref|XP_009601582.1| PREDICTED: AP-2 complex subunit mu isoform X2 [Nicotiana tomentosiformis]
Length=438

 Score =   305 bits (782),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 146/150 (97%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASA+YFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQTKELGTCPVRQIGGCSF Y
Sbjct  1    MPVAASAVYFLNLRGDVLINRLYRDDVGGNMVDAFRMHIMQTKELGTCPVRQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>ref|XP_004511783.1| PREDICTED: AP-2 complex subunit mu-like [Cicer arietinum]
Length=438

 Score =   305 bits (782),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 146/149 (98%), Positives = 148/149 (99%), Gaps = 0/149 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASA+YFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPV+QIGGCSF Y
Sbjct  1    MPVAASAVYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVKQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSK  575
            DFGYPQNLSPEILKLYITQEGVRSPFSSK
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSK  149



>ref|XP_004300247.1| PREDICTED: AP-2 complex subunit mu [Fragaria vesca subsp. vesca]
Length=438

 Score =   305 bits (782),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 146/150 (97%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASA+YFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQTKELGTCPVRQIGGCSF Y
Sbjct  1    MPVAASAVYFLNLRGDVLINRLYRDDVGGNMVDAFRMHIMQTKELGTCPVRQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>ref|XP_006368418.1| AP47/50p mRNA family protein [Populus trichocarpa]
 gb|ERP64987.1| AP47/50p mRNA family protein [Populus trichocarpa]
Length=438

 Score =   305 bits (782),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQTKELGTCPVRQIGGCSF Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRLHIMQTKELGTCPVRQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>ref|XP_003570135.1| PREDICTED: AP-2 complex subunit mu [Brachypodium distachyon]
Length=438

 Score =   305 bits (782),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 146/150 (97%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQTKELGTCPVRQIGGCSFLY
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRMHIMQTKELGTCPVRQIGGCSFLY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANV+CAFKFVVEAVALFKSYFGG FDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVSCAFKFVVEAVALFKSYFGGTFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>ref|XP_010481431.1| PREDICTED: AP-2 complex subunit mu-like [Camelina sativa]
 ref|XP_010481432.1| PREDICTED: AP-2 complex subunit mu-like [Camelina sativa]
Length=359

 Score =   303 bits (775),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 145/150 (97%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINR YRDDVGGNMVDAFRTHIMQTKELG CPVRQIGGCSF+Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRTYRDDVGGNMVDAFRTHIMQTKELGNCPVRQIGGCSFVY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVAC FKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACGFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>ref|XP_004953508.1| PREDICTED: AP-2 complex subunit mu-like [Setaria italica]
Length=438

 Score =   305 bits (782),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 147/149 (99%), Positives = 148/149 (99%), Gaps = 0/149 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQTKELGTCPVRQIGGCSFLY
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRMHIMQTKELGTCPVRQIGGCSFLY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSK  575
            DFGYPQNLSPEILKLYITQEGVRSPFSSK
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSK  149



>ref|XP_003611473.1| AP-2 complex subunit mu [Medicago truncatula]
 gb|AES94431.1| clathrin-adaptor medium chain AP-2 [Medicago truncatula]
Length=438

 Score =   305 bits (782),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 146/149 (98%), Positives = 148/149 (99%), Gaps = 0/149 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASA+YFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPV+QIGGCSF Y
Sbjct  1    MPVAASAVYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVKQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSK  575
            DFGYPQNLSPEILKLYITQEGVRSPFSSK
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSK  149



>gb|ACN50177.1| AP-2 complex subunit [Annona cherimola]
Length=437

 Score =   305 bits (781),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 146/150 (97%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSF Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVAC  KFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACGLKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>ref|XP_010275249.1| PREDICTED: AP-2 complex subunit mu [Nelumbo nucifera]
Length=438

 Score =   305 bits (780),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 146/150 (97%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQTKELGTCPVRQIGGCSF Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRMHIMQTKELGTCPVRQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVACAFKFVVEAV+LFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVVEAVSLFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>ref|XP_010269992.1| PREDICTED: AP-2 complex subunit mu-like [Nelumbo nucifera]
Length=438

 Score =   305 bits (780),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 146/150 (97%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQTKELGTCPVRQIGGCSF Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRMHIMQTKELGTCPVRQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNL+PEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLAPEILKLYITQEGVRSPFSSKP  150



>ref|XP_008341080.1| PREDICTED: AP-2 complex subunit mu isoform X1 [Malus domestica]
Length=438

 Score =   304 bits (779),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 145/150 (97%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASA+YFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQTKELGTCPVRQIGGCSF Y
Sbjct  1    MPVAASAVYFLNLRGDVLINRLYRDDVGGNMVDAFRMHIMQTKELGTCPVRQIGGCSFCY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NAN+ACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANIACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>ref|XP_009101502.1| PREDICTED: AP-2 complex subunit mu-like [Brassica rapa]
Length=438

 Score =   304 bits (779),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 146/150 (97%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINR YRDDVGGNMVDAFRTHIMQTKELG CPVRQIGGCSF+Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRTYRDDVGGNMVDAFRTHIMQTKELGNCPVRQIGGCSFVY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>gb|KJB21219.1| hypothetical protein B456_003G181000 [Gossypium raimondii]
Length=372

 Score =   302 bits (773),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 144/149 (97%), Positives = 147/149 (99%), Gaps = 0/149 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQTKELGTCPVRQIGGCSF Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRMHIMQTKELGTCPVRQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVACAFKFVVEAV++FKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVVEAVSMFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSK  575
            DFGYPQNLSPEILKLYITQEGVRSPFSSK
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSK  149



>ref|XP_006398358.1| hypothetical protein EUTSA_v10000887mg [Eutrema salsugineum]
 gb|ESQ39811.1| hypothetical protein EUTSA_v10000887mg [Eutrema salsugineum]
Length=416

 Score =   303 bits (777),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 145/150 (97%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINR YRDDVGGNMVDAFRTHIMQTKELG CPVRQIGGCSF+Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRTYRDDVGGNMVDAFRTHIMQTKELGNCPVRQIGGCSFVY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVAC FKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACGFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>ref|XP_009782271.1| PREDICTED: AP-2 complex subunit mu isoform X2 [Nicotiana sylvestris]
Length=438

 Score =   304 bits (778),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 145/150 (97%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASA+YFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQTKELGTCPVRQIGGCSF Y
Sbjct  1    MPVAASAVYFLNLRGDVLINRLYRDDVGGNMVDAFRMHIMQTKELGTCPVRQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRI+NVYIVIVVS+NANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRINNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>ref|XP_003549984.1| PREDICTED: AP-2 complex subunit mu-like isoform 1 [Glycine max]
Length=438

 Score =   304 bits (778),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 145/150 (97%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTH+MQTKELGTCPVRQIGGCSF Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHVMQTKELGTCPVRQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS NANVACAFKFVVEAVALF+SYFGG FDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSNNANVACAFKFVVEAVALFRSYFGGVFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>gb|KHN01692.1| AP-2 complex subunit mu [Glycine soja]
Length=438

 Score =   304 bits (778),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 145/150 (97%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTH+MQTKELGTCPVRQIGGCSF Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHVMQTKELGTCPVRQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS NANVACAFKFVVEAVALF+SYFGG FDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSNNANVACAFKFVVEAVALFRSYFGGVFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>ref|XP_010104328.1| AP-2 complex subunit mu [Morus notabilis]
 gb|EXB99748.1| AP-2 complex subunit mu [Morus notabilis]
Length=601

 Score =   309 bits (791),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSF Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>ref|NP_974895.1| clathrin adaptor complexes medium subunit family protein [Arabidopsis 
thaliana]
 gb|AED95408.1| clathrin adaptor complexes medium subunit family protein [Arabidopsis 
thaliana]
Length=441

 Score =   304 bits (778),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 145/150 (97%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINR YRDDVGGNMVDAFRTHIMQTKELG CPVRQIGGCSF+Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRTYRDDVGGNMVDAFRTHIMQTKELGNCPVRQIGGCSFVY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVAC FKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACGFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>gb|ABR18145.1| unknown [Picea sitchensis]
Length=438

 Score =   303 bits (777),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/149 (98%), Positives = 147/149 (99%), Gaps = 0/149 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NAN ACA KFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANAACALKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSK  575
            DFGYPQNLSPEILKLYITQEGVRSPFSSK
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSK  149



>ref|XP_008799382.1| PREDICTED: AP-2 complex subunit mu-like isoform X1 [Phoenix dactylifera]
Length=438

 Score =   303 bits (777),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQTKELGTCPVRQIGGCSFLY
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRMHIMQTKELGTCPVRQIGGCSFLY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS NANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSGNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRS FSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSSFSSKP  150



>ref|XP_010055331.1| PREDICTED: AP-2 complex subunit mu [Eucalyptus grandis]
 gb|KCW71798.1| hypothetical protein EUGRSUZ_E00287 [Eucalyptus grandis]
Length=438

 Score =   303 bits (777),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 145/150 (97%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQTKELGTCPVRQIGGCSF Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRMHIMQTKELGTCPVRQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVACAFKFVVEAV+LFKSYFGG+FDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVVEAVSLFKSYFGGSFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>gb|KJB39799.1| hypothetical protein B456_007G031400 [Gossypium raimondii]
Length=437

 Score =   303 bits (776),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 146/149 (98%), Positives = 147/149 (99%), Gaps = 0/149 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQTKELGTCPVRQIGGCSF Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRMHIMQTKELGTCPVRQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSK  575
            DFGYPQNLSPEILKLYITQEGVRSPFSSK
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSK  149



>ref|XP_006361185.1| PREDICTED: AP-2 complex subunit mu-like isoform X1 [Solanum tuberosum]
Length=439

 Score =   303 bits (776),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 145/149 (97%), Positives = 147/149 (99%), Gaps = 0/149 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASA+YFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQTKELGTCPVRQIGGCSF Y
Sbjct  1    MPVAASAVYFLNLRGDVLINRLYRDDVGGNMVDAFRMHIMQTKELGTCPVRQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGG+FDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGSFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSK  575
            DFGYPQNLSPEILKLYITQEGVRSPFSSK
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSK  149



>ref|NP_199475.1| clathrin adaptor complexes medium subunit family protein [Arabidopsis 
thaliana]
 ref|XP_002865173.1| clathrin adaptor complexes medium subunit family protein [Arabidopsis 
lyrata subsp. lyrata]
 ref|XP_006398359.1| hypothetical protein EUTSA_v10000887mg [Eutrema salsugineum]
 ref|XP_010441562.1| PREDICTED: AP-2 complex subunit mu [Camelina sativa]
 ref|XP_010494843.1| PREDICTED: AP-2 complex subunit mu [Camelina sativa]
 sp|O23140.1|AP2M_ARATH RecName: Full=AP-2 complex subunit mu; AltName: Full=Adaptor 
protein complex AP-2 subunit mu; AltName: Full=Adaptor protein-2 
mu-adaptin; AltName: Full=Adaptor-related protein complex 
2 subunit mu; AltName: Full=At-muA-Ad; AltName: Full=Clathrin 
assembly protein complex 2 mu medium chain; AltName: Full=Mu2-adaptin; 
AltName: Full=Protein AP47/50; Short=AtAP47/50 
[Arabidopsis thaliana]
 gb|AAB88283.1| AP47/50p [Arabidopsis thaliana]
 dbj|BAB08907.1| AP47/50p [Arabidopsis thaliana]
 gb|EFH41432.1| clathrin adaptor complexes medium subunit family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|AED95407.1| clathrin adaptor complexes medium subunit family protein [Arabidopsis 
thaliana]
 gb|ESQ39812.1| hypothetical protein EUTSA_v10000887mg [Eutrema salsugineum]
 gb|KFK31446.1| hypothetical protein AALP_AA6G112900 [Arabis alpina]
Length=438

 Score =   303 bits (776),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 145/150 (97%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINR YRDDVGGNMVDAFRTHIMQTKELG CPVRQIGGCSF+Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRTYRDDVGGNMVDAFRTHIMQTKELGNCPVRQIGGCSFVY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVAC FKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACGFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>ref|XP_010322865.1| PREDICTED: AP-2 complex subunit mu isoform X1 [Solanum lycopersicum]
 ref|XP_010322866.1| PREDICTED: AP-2 complex subunit mu isoform X1 [Solanum lycopersicum]
Length=439

 Score =   303 bits (776),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 145/149 (97%), Positives = 147/149 (99%), Gaps = 0/149 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASA+YFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQTKELGTCPVRQIGGCSF Y
Sbjct  1    MPVAASAVYFLNLRGDVLINRLYRDDVGGNMVDAFRMHIMQTKELGTCPVRQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGG+FDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGSFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSK  575
            DFGYPQNLSPEILKLYITQEGVRSPFSSK
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSK  149



>emb|CDX87692.1| BnaC02g32570D [Brassica napus]
Length=438

 Score =   303 bits (776),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 145/150 (97%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINR YRDDVGGNMVDAFRTHIMQTKELG CPVRQIGGCSF+Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRTYRDDVGGNMVDAFRTHIMQTKELGNCPVRQIGGCSFVY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVAC FKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACGFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>ref|XP_006281627.1| hypothetical protein CARUB_v10027758mg [Capsella rubella]
 gb|EOA14525.1| hypothetical protein CARUB_v10027758mg [Capsella rubella]
Length=438

 Score =   303 bits (775),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 145/150 (97%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINR YRDDVGGNMVDAFRTHIMQTKELG CPVRQIGGCSF+Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRTYRDDVGGNMVDAFRTHIMQTKELGNCPVRQIGGCSFVY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVAC FKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACGFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>ref|XP_009601580.1| PREDICTED: AP-2 complex subunit mu isoform X1 [Nicotiana tomentosiformis]
Length=439

 Score =   303 bits (775),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 145/149 (97%), Positives = 147/149 (99%), Gaps = 0/149 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASA+YFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQTKELGTCPVRQIGGCSF Y
Sbjct  1    MPVAASAVYFLNLRGDVLINRLYRDDVGGNMVDAFRMHIMQTKELGTCPVRQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSK  575
            DFGYPQNLSPEILKLYITQEGVRSPFSSK
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSK  149



>gb|KJB21220.1| hypothetical protein B456_003G181000 [Gossypium raimondii]
Length=405

 Score =   301 bits (772),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 144/149 (97%), Positives = 147/149 (99%), Gaps = 0/149 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQTKELGTCPVRQIGGCSF Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRMHIMQTKELGTCPVRQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVACAFKFVVEAV++FKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVVEAVSMFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSK  575
            DFGYPQNLSPEILKLYITQEGVRSPFSSK
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSK  149



>ref|XP_010677254.1| PREDICTED: AP-2 complex subunit mu [Beta vulgaris subsp. vulgaris]
 ref|XP_010677255.1| PREDICTED: AP-2 complex subunit mu [Beta vulgaris subsp. vulgaris]
Length=438

 Score =   302 bits (774),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 145/150 (97%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQTKELGTCPVRQIGGCSF Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRMHIMQTKELGTCPVRQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVACAFKFVVEAV LFKSYFGG FDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVVEAVNLFKSYFGGQFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>ref|XP_001762397.1| predicted protein [Physcomitrella patens]
 gb|EDQ72864.1| predicted protein [Physcomitrella patens]
Length=439

 Score =   302 bits (774),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 145/149 (97%), Positives = 147/149 (99%), Gaps = 0/149 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTK+LGTCPVRQIGGCSFLY
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKDLGTCPVRQIGGCSFLY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIV VVS+NAN ACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVTVVSSNANAACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSK  575
            DFGYPQNLSPEILKLYITQEGVRSPFSSK
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSK  149



>gb|KJB21218.1| hypothetical protein B456_003G181000 [Gossypium raimondii]
Length=397

 Score =   301 bits (770),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 144/149 (97%), Positives = 147/149 (99%), Gaps = 0/149 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQTKELGTCPVRQIGGCSF Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRMHIMQTKELGTCPVRQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVACAFKFVVEAV++FKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVVEAVSMFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSK  575
            DFGYPQNLSPEILKLYITQEGVRSPFSSK
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSK  149



>ref|XP_009128888.1| PREDICTED: AP-2 complex subunit mu [Brassica rapa]
Length=438

 Score =   302 bits (773),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 144/150 (96%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINR YRDDVGGNMVDAFRTHIMQTKELG CPVRQIGGCSF+Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRTYRDDVGGNMVDAFRTHIMQTKELGNCPVRQIGGCSFVY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVAC FKFVVEAVALFKSYFGGAFDEDAI+NNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACGFKFVVEAVALFKSYFGGAFDEDAIKNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>ref|XP_009114341.1| PREDICTED: AP-2 complex subunit mu-like [Brassica rapa]
 emb|CDY35171.1| BnaA09g18080D [Brassica napus]
 emb|CDY03204.1| BnaC09g19520D [Brassica napus]
Length=438

 Score =   301 bits (772),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 144/150 (96%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINR YRDDVGGNMVDAFRTHIMQTKELG CPVRQIGGCSF+Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRTYRDDVGGNMVDAFRTHIMQTKELGNCPVRQIGGCSFVY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVAC FKFVVEAVALFKSYFGGAFDEDAI+NNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACGFKFVVEAVALFKSYFGGAFDEDAIKNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>gb|EYU44097.1| hypothetical protein MIMGU_mgv1a006588mg [Erythranthe guttata]
Length=438

 Score =   301 bits (772),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/149 (97%), Positives = 146/149 (98%), Gaps = 0/149 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQTKELGTCPVRQIGGCSF Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRVHIMQTKELGTCPVRQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVACAFKFVVEAV LFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVVEAVTLFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSK  575
            DFGYPQNLSPEILKLYITQEGVRSPFSSK
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSK  149



>ref|XP_011070241.1| PREDICTED: AP-2 complex subunit mu-like [Sesamum indicum]
Length=438

 Score =   301 bits (772),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/149 (97%), Positives = 146/149 (98%), Gaps = 0/149 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQTKELGTCPVRQIGGCSF Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRVHIMQTKELGTCPVRQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVACAFKFVVEAV LFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVVEAVTLFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSK  575
            DFGYPQNLSPEILKLYITQEGVRSPFSSK
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSK  149



>gb|KJB21217.1| hypothetical protein B456_003G181000 [Gossypium raimondii]
Length=438

 Score =   301 bits (771),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 144/149 (97%), Positives = 147/149 (99%), Gaps = 0/149 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQTKELGTCPVRQIGGCSF Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRMHIMQTKELGTCPVRQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVACAFKFVVEAV++FKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVVEAVSMFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSK  575
            DFGYPQNLSPEILKLYITQEGVRSPFSSK
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSK  149



>ref|XP_009782270.1| PREDICTED: AP-2 complex subunit mu isoform X1 [Nicotiana sylvestris]
Length=439

 Score =   301 bits (771),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 144/149 (97%), Positives = 147/149 (99%), Gaps = 0/149 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASA+YFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQTKELGTCPVRQIGGCSF Y
Sbjct  1    MPVAASAVYFLNLRGDVLINRLYRDDVGGNMVDAFRMHIMQTKELGTCPVRQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRI+NVYIVIVVS+NANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRINNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSK  575
            DFGYPQNLSPEILKLYITQEGVRSPFSSK
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSK  149



>emb|CDX77680.1| BnaC07g19340D [Brassica napus]
Length=438

 Score =   301 bits (771),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 144/150 (96%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINR YRDDVGGNMVDAFRTHIMQTKELG CPVRQIGGCSF+Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRTYRDDVGGNMVDAFRTHIMQTKELGNCPVRQIGGCSFVY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIV S+NANVAC FKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVASSNANVACGFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  150



>gb|EPS61852.1| hypothetical protein M569_12940 [Genlisea aurea]
Length=438

 Score =   301 bits (770),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 145/149 (97%), Positives = 146/149 (98%), Gaps = 0/149 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQTKELGTCPVRQIGGCSF Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRVHIMQTKELGTCPVRQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVACAFKFVVEAV LFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVVEAVMLFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSK  575
            DFGYPQNLSPEILKLYITQEGVRSPFSSK
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSK  149



>gb|KHG11980.1| AP-2 complex subunit mu [Gossypium arboreum]
Length=448

 Score =   301 bits (771),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 143/149 (96%), Positives = 147/149 (99%), Gaps = 0/149 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQTKELGTCPVRQIGGCSF Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRMHIMQTKELGTCPVRQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVY+VIVVS+NANVACAFKFVVEAV++FKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYVVIVVSSNANVACAFKFVVEAVSMFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSK  575
            DFGYPQNLSPEILKLYITQEGVRSPFSSK
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSK  149



>emb|CDP13003.1| unnamed protein product [Coffea canephora]
Length=438

 Score =   301 bits (770),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 145/149 (97%), Positives = 146/149 (98%), Gaps = 0/149 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQTKELGTCPVRQIGGCSF Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRMHIMQTKELGTCPVRQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVACAFKFVVEAV LFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVVEAVNLFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSK  575
            DFGYPQNLSPEILKLYITQEGVRSPFSSK
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSK  149



>ref|XP_006362503.1| PREDICTED: AP-2 complex subunit mu-like [Solanum tuberosum]
Length=438

 Score =   299 bits (766),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/149 (97%), Positives = 146/149 (98%), Gaps = 0/149 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQ+KELGTCPVRQIGGCSFLY
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRMHIMQSKELGTCPVRQIGGCSFLY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVACAFKFVVEAV LFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVVEAVTLFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSK  575
            DFGYPQNLSPEILKLYITQEGVRS FSSK
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSSFSSK  149



>ref|XP_004244539.1| PREDICTED: AP-2 complex subunit mu-like [Solanum lycopersicum]
Length=438

 Score =   299 bits (766),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/149 (97%), Positives = 146/149 (98%), Gaps = 0/149 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQ+KELGTCPVRQIGGCSFLY
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRMHIMQSKELGTCPVRQIGGCSFLY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVACAFKFVVEAV LFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVVEAVTLFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSK  575
            DFGYPQNLSPEILKLYITQEGVRS FSSK
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSSFSSK  149



>ref|XP_009791064.1| PREDICTED: AP-2 complex subunit mu-like [Nicotiana sylvestris]
Length=438

 Score =   299 bits (765),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/149 (97%), Positives = 146/149 (98%), Gaps = 0/149 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQ+KELGTCPVRQIGGCSFLY
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRMHIMQSKELGTCPVRQIGGCSFLY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVACAFKFVVEAV LFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVVEAVTLFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSK  575
            DFGYPQNLSPEILKLYITQEGVRS FSSK
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSSFSSK  149



>ref|XP_009616007.1| PREDICTED: AP-2 complex subunit mu-like [Nicotiana tomentosiformis]
Length=438

 Score =   299 bits (765),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/149 (97%), Positives = 146/149 (98%), Gaps = 0/149 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQ+KELGTCPVRQIGGCSFLY
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRMHIMQSKELGTCPVRQIGGCSFLY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVACAFKFVVEAV LFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVVEAVTLFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSK  575
            DFGYPQNLSPEILKLYITQEGVRS FSSK
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSSFSSK  149



>ref|XP_002973295.1| hypothetical protein SELMODRAFT_173172 [Selaginella moellendorffii]
 ref|XP_002976609.1| hypothetical protein SELMODRAFT_271210 [Selaginella moellendorffii]
 gb|EFJ22278.1| hypothetical protein SELMODRAFT_271210 [Selaginella moellendorffii]
 gb|EFJ25669.1| hypothetical protein SELMODRAFT_173172 [Selaginella moellendorffii]
Length=438

 Score =   298 bits (764),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/150 (97%), Positives = 147/150 (98%), Gaps = 1/150 (1%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTK+LGTCPVRQIGGCSFLY
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKDLGTCPVRQIGGCSFLY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NAN ACA KFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANAACALKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPF SKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPF-SKP  149



>gb|EMT22034.1| AP-2 complex subunit mu [Aegilops tauschii]
Length=711

 Score =   306 bits (783),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 146/150 (97%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQTKELGTCPVRQIGGCSFLY
Sbjct  274  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRMHIMQTKELGTCPVRQIGGCSFLY  333

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANV+CAFKFVVEAVALFKSYFGG FDEDAIRNNFVLIYELLDEIM
Sbjct  334  MRISNVYIVIVVSSNANVSCAFKFVVEAVALFKSYFGGTFDEDAIRNNFVLIYELLDEIM  393

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  394  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  423



>ref|XP_006590608.1| PREDICTED: AP-2 complex subunit mu-like isoform X2 [Glycine max]
 gb|KHN13044.1| AP-2 complex subunit mu [Glycine soja]
Length=455

 Score =   296 bits (759),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 147/167 (88%), Positives = 149/167 (89%), Gaps = 17/167 (10%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPV+QIGGCSF Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVKQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVE-----------------AVALFKSYFGGAFDED  437
            MRISNVYIVIVVS+NANVACAFKFVVE                 AVALFKSYFGGAFDED
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVVEVYCIPSFLNSDTKALLLAVALFKSYFGGAFDED  120

Query  438  AIRNNFVLIYELLDEIMDFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            AIRNNFVLIYELLDEIMDFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  121  AIRNNFVLIYELLDEIMDFGYPQNLSPEILKLYITQEGVRSPFSSKP  167



>ref|XP_001775791.1| predicted protein [Physcomitrella patens]
 gb|EDQ59330.1| predicted protein [Physcomitrella patens]
Length=439

 Score =   296 bits (757),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 140/149 (94%), Positives = 145/149 (97%), Gaps = 0/149 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTK+LGTCPVRQ+GGCSFLY
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKDLGTCPVRQVGGCSFLY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRI NVY+V VVS+NAN ACAFKF+VE VALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRIMNVYVVAVVSSNANAACAFKFMVETVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSK  575
            DFGYPQNLSPEILKLYITQEGVRSPFSSK
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSPFSSK  149



>gb|AHB86967.1| AP-2 complex subunit mu-like protein [Sedum alfredii]
Length=437

 Score =   292 bits (747),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 141/150 (94%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQTKELGTCPVRQIGGCSF Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRVHIMQTKELGTCPVRQIGGCSFYY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVAC  KFVVEAV LFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACGLKFVVEAVNLFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRS   SKP
Sbjct  121  DFGYPQNLSPEILKLYITQEGVRSHLMSKP  150



>gb|KHG25485.1| AP-2 complex subunit mu [Gossypium arboreum]
Length=430

 Score =   288 bits (736),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQTKELGTCPVRQIGGCSF Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRMHIMQTKELGTCPVRQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIVVS+NANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  120

Query  489  DFGYPQNLSPEILKLYITQEG  551
            DFGYPQNLSPEILKLYITQEG
Sbjct  121  DFGYPQNLSPEILKLYITQEG  141



>ref|XP_007039524.1| Clathrin adaptor complexes medium subunit family protein isoform 
2 [Theobroma cacao]
 gb|EOY24025.1| Clathrin adaptor complexes medium subunit family protein isoform 
2 [Theobroma cacao]
Length=422

 Score =   266 bits (679),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 132/150 (88%), Gaps = 16/150 (11%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQTKELGTCPVRQIGGCSF Y
Sbjct  1    MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRMHIMQTKELGTCPVRQIGGCSFFY  60

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
            MRISNVYIVIV                AVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct  61   MRISNVYIVIV----------------AVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  104

Query  489  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            DFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  105  DFGYPQNLSPEILKLYITQEGVRSPFSSKP  134



>dbj|BAJ61940.1| adaptor complexes medium subunit [Nymphaea hybrid cultivar]
Length=196

 Score =   252 bits (644),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = +3

Query  207  VGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNVYIVIVVSTNANVACAFKFVV  386
            VGGNMVDAFR HIMQTKELGTCPVRQIGGCSF+YMRISNVYIVIVVS+NANVACAFKF+V
Sbjct  1    VGGNMVDAFRMHIMQTKELGTCPVRQIGGCSFIYMRISNVYIVIVVSSNANVACAFKFIV  60

Query  387  EAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQNLSPEILKLYITQEGVRSPF  566
            EAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQNLSPEILKLYITQEGVRSPF
Sbjct  61   EAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQNLSPEILKLYITQEGVRSPF  120

Query  567  SSKP  578
            SSKP
Sbjct  121  SSKP  124



>ref|XP_008788676.1| PREDICTED: AP-2 complex subunit mu isoform X2 [Phoenix dactylifera]
Length=408

 Score =   245 bits (625),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 117/120 (98%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = +3

Query  219  MVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNVYIVIVVSTNANVACAFKFVVEAVA  398
            MVDAFR HIMQTKELGTCPVRQIGGCS LYMRISNVYIVIVVS+NANVACAFKFVVEAVA
Sbjct  1    MVDAFRMHIMQTKELGTCPVRQIGGCSILYMRISNVYIVIVVSSNANVACAFKFVVEAVA  60

Query  399  LFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            LFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  61   LFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQNLSPEILKLYITQEGVRSPFSSKP  120



>ref|XP_008341081.1| PREDICTED: AP-2 complex subunit mu isoform X2 [Malus domestica]
Length=408

 Score =   244 bits (623),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/120 (97%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = +3

Query  219  MVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNVYIVIVVSTNANVACAFKFVVEAVA  398
            MVDAFR HIMQTKELGTCPVRQIGGCSF YMRISNVYIVIVVS+NAN+ACAFKFVVEAVA
Sbjct  1    MVDAFRMHIMQTKELGTCPVRQIGGCSFCYMRISNVYIVIVVSSNANIACAFKFVVEAVA  60

Query  399  LFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            LFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  61   LFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQNLSPEILKLYITQEGVRSPFSSKP  120



>ref|XP_008799383.1| PREDICTED: AP-2 complex subunit mu-like isoform X2 [Phoenix dactylifera]
Length=408

 Score =   243 bits (619),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 117/120 (98%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = +3

Query  219  MVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNVYIVIVVSTNANVACAFKFVVEAVA  398
            MVDAFR HIMQTKELGTCPVRQIGGCSFLYMRISNVYIVIVVS NANVACAFKFVVEAVA
Sbjct  1    MVDAFRMHIMQTKELGTCPVRQIGGCSFLYMRISNVYIVIVVSGNANVACAFKFVVEAVA  60

Query  399  LFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            LFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQNLSPEILKLYITQEGVRS FSSKP
Sbjct  61   LFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQNLSPEILKLYITQEGVRSSFSSKP  120



>ref|XP_002519831.1| clathrin coat associated protein ap-50, putative [Ricinus communis]
 gb|EEF42435.1| clathrin coat associated protein ap-50, putative [Ricinus communis]
Length=408

 Score =   243 bits (619),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 115/120 (96%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = +3

Query  219  MVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNVYIVIVVSTNANVACAFKFVVEAVA  398
            MVDAFR HIMQTKELGTCPVRQIGGCSF YMRISNVYIVIVVS+NANVACAFKFV EAVA
Sbjct  1    MVDAFRMHIMQTKELGTCPVRQIGGCSFFYMRISNVYIVIVVSSNANVACAFKFVAEAVA  60

Query  399  LFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            LFKSYFGG+FDEDAIRNNFVLIYELLDEIMDFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  61   LFKSYFGGSFDEDAIRNNFVLIYELLDEIMDFGYPQNLSPEILKLYITQEGVRSPFSSKP  120



>gb|AEI28162.1| putative clathrin adapter complex subunit [Lobularia maritima]
Length=171

 Score =   204 bits (519),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 98/102 (96%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  273  PVRQIGGCSFLYMRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNN  452
            PVRQIGGCSF+YMRISNVYIVIVVS+NANVAC FKFVVEAVALFKSYFGGAFDEDAI+NN
Sbjct  1    PVRQIGGCSFVYMRISNVYIVIVVSSNANVACGFKFVVEAVALFKSYFGGAFDEDAIKNN  60

Query  453  FVLIYELLDEIMDFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            FVLIYELLDEIMDFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  61   FVLIYELLDEIMDFGYPQNLSPEILKLYITQEGVRSPFSSKP  102



>ref|XP_009377081.1| PREDICTED: LOW QUALITY PROTEIN: AP-2 complex subunit mu [Pyrus 
x bretschneideri]
Length=246

 Score =   201 bits (510),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/112 (88%), Positives = 105/112 (94%), Gaps = 4/112 (4%)
 Frame = +3

Query  246  MQTKELGTCPV-RQIGGCSFLYMRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGG  422
            +QTK    C + ++IGGCSF YMRISNVYIVIVVS+NAN+ACAFKFVVEAVALFKSYFGG
Sbjct  7    LQTK---XCVINKEIGGCSFFYMRISNVYIVIVVSSNANIACAFKFVVEAVALFKSYFGG  63

Query  423  AFDEDAIRNNFVLIYELLDEIMDFGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            AFDEDAIRNNFVLIYELLDEIMDFGYPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  64   AFDEDAIRNNFVLIYELLDEIMDFGYPQNLSPEILKLYITQEGVRSPFSSKP  115



>ref|XP_007039525.1| Clathrin adaptor complexes medium subunit family protein isoform 
3, partial [Theobroma cacao]
 gb|EOY24026.1| Clathrin adaptor complexes medium subunit family protein isoform 
3, partial [Theobroma cacao]
Length=364

 Score =   177 bits (449),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 86/87 (99%), Positives = 87/87 (100%), Gaps = 0/87 (0%)
 Frame = +3

Query  318  SNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFG  497
            SNVYIVIVVS+NANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFG
Sbjct  1    SNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFG  60

Query  498  YPQNLSPEILKLYITQEGVRSPFSSKP  578
            YPQNLSPEILKLYITQEGVRSPFSSKP
Sbjct  61   YPQNLSPEILKLYITQEGVRSPFSSKP  87



>ref|XP_005645393.1| clathrin adaptor complexes medium subunit family protein [Coccomyxa 
subellipsoidea C-169]
 gb|EIE20849.1| clathrin adaptor complexes medium subunit family protein [Coccomyxa 
subellipsoidea C-169]
Length=421

 Score =   173 bits (438),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 103/145 (71%), Gaps = 4/145 (3%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGT----CPVRQIGGC  296
            M  A SAIYFLN++GD+LI R YRDDV  N+   FRTHI+ ++E        PVR +G C
Sbjct  1    MASACSAIYFLNMKGDILIQRTYRDDVERNLAATFRTHILNSREADNISNLTPVRVLGSC  60

Query  297  SFLYMRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELL  476
            SF+YMR  +VYI+ V  +NANV  AF+F+   V L K+YFGG   E +I+NNFVLIYELL
Sbjct  61   SFMYMRHGDVYILGVTKSNANVMMAFQFMTNVVTLCKAYFGGECSEQSIKNNFVLIYELL  120

Query  477  DEIMDFGYPQNLSPEILKLYITQEG  551
            DEIMDFGYPQ + P ILK YI Q+G
Sbjct  121  DEIMDFGYPQIVDPSILKQYIFQKG  145



>ref|XP_002506503.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67761.1| predicted protein [Micromonas sp. RCC299]
Length=462

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 101/143 (71%), Gaps = 1/143 (1%)
 Frame = +3

Query  132  PVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYM  311
            PVA SA+YFLNLRGDV++ R YRDDV  NM  AF+T I+  K+ G  PV  +G CSF+Y 
Sbjct  16   PVALSALYFLNLRGDVILERQYRDDVDRNMATAFKTEIINGKDRGGNPVVNLGMCSFMYT  75

Query  312  RISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMD  491
            R  NVY+V V   NAN   AF F+ + ++LFKSYF   F+E  +++NFV+IYELLDE+ D
Sbjct  76   REENVYVVAVTRANANAMLAFTFMHQLISLFKSYF-NKFNEKVLKSNFVIIYELLDEVCD  134

Query  492  FGYPQNLSPEILKLYITQEGVRS  560
             GYPQ  SPE+LK +ITQ   R+
Sbjct  135  HGYPQITSPEVLKSFITQRADRA  157



>ref|XP_003063509.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH52645.1| predicted protein [Micromonas pusilla CCMP1545]
Length=455

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 99/144 (69%), Gaps = 1/144 (1%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            +PV  SA+YF+NLRG++++ R YRDDV   M  AF+T I+  K+ G  PV  +G CSFLY
Sbjct  3    VPVCLSALYFMNLRGEIIMERQYRDDVTRTMAKAFQTEIINGKDRGNVPVVNLGACSFLY  62

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM  488
             R +NVY+V V   N N    F F+ E VALFKSYF     E +++NNFV+IYELLDEI 
Sbjct  63   RRENNVYLVAVTRQNVNAMLCFTFLNEVVALFKSYF-NKVSEKSLKNNFVVIYELLDEIC  121

Query  489  DFGYPQNLSPEILKLYITQEGVRS  560
            D GYPQ  S E+LK YITQ+ VRS
Sbjct  122  DHGYPQITSAEVLKSYITQKSVRS  145



>emb|CAN82079.1| hypothetical protein VITISV_035642 [Vitis vinifera]
Length=161

 Score =   151 bits (382),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLY  308
            M VA S IYFL LRGDV INRLYRDDVGGNM DAFR HI QTKEL TCPV+QIGGC F Y
Sbjct  44   MSVAVSDIYFLILRGDVFINRLYRDDVGGNMADAFRMHITQTKELSTCPVQQIGGCFFFY  103

Query  309  MRISNVYIVIVVSTNANVACAFKFVVEAVAL  401
            MRISN YIV VVS+NANV C FKFVVEAV L
Sbjct  104  MRISNAYIVTVVSSNANVTCTFKFVVEAVTL  134



>ref|XP_002952903.1| hypothetical protein VOLCADRAFT_93610 [Volvox carteri f. nagariensis]
 gb|EFJ46153.1| hypothetical protein VOLCADRAFT_93610 [Volvox carteri f. nagariensis]
Length=439

 Score =   152 bits (384),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 101/151 (67%), Gaps = 4/151 (3%)
 Frame = +3

Query  129  MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTC----PVRQIGGC  296
            M  AASAIYFLNLRGD+L+ R Y+DDV   + ++FR  I+  ++        P+R +G  
Sbjct  1    MASAASAIYFLNLRGDILLERRYKDDVDREIAESFRDRILNARDRDATAVHGPIRTLGSV  60

Query  297  SFLYMRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELL  476
            +F+Y+R ++VYI+++   N N   +F+F+   V+LF+SYF G   E +IR NFVL+YELL
Sbjct  61   TFMYLRHADVYILLLTRGNGNAMLSFQFMTSLVSLFQSYFEGDLTESSIRANFVLMYELL  120

Query  477  DEIMDFGYPQNLSPEILKLYITQEGVRSPFS  569
            DE+MD+G PQ   P ILK  I Q+G RS FS
Sbjct  121  DEVMDYGLPQLTEPAILKTLILQKGYRSDFS  151



>ref|XP_004333095.1| clathrin adaptor complex small chain subfamily protein [Acanthamoeba 
castellanii str. Neff]
 gb|ELR11082.1| clathrin adaptor complex small chain subfamily protein [Acanthamoeba 
castellanii str. Neff]
Length=202

 Score =   145 bits (367),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 93/134 (69%), Gaps = 1/134 (1%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISN  323
            SAI+ LN RGDVLI+RL+RDDV   + D FR  ++  KE+ + P+  I G S L++R  +
Sbjct  3    SAIFVLNSRGDVLISRLFRDDVSRGVADTFRLQVINAKEVRS-PISSISGTSLLHVRSGD  61

Query  324  VYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYP  503
            +Y++     N + A  F  + + V +F+SYFGG FDED IR NFVLIYELLDE++D+G+P
Sbjct  62   IYLLAATKQNVDCALVFSLLNQLVLIFRSYFGGKFDEDHIRKNFVLIYELLDEVIDYGHP  121

Query  504  QNLSPEILKLYITQ  545
            QN   E LKLYITQ
Sbjct  122  QNSDIEALKLYITQ  135



>ref|XP_005831595.1| Adaptor protein complex 2 subunit MU [Guillardia theta CCMP2712]
 gb|EKX44615.1| Adaptor protein complex 2 subunit MU [Guillardia theta CCMP2712]
Length=426

 Score =   149 bits (377),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 95/136 (70%), Gaps = 1/136 (1%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISN  323
            SA+Y +NL+G++LI R YRDDV     DAFR  ++  KE  + PV+     SF ++R SN
Sbjct  3    SAVYLINLKGEILIYRAYRDDVSRAAADAFRMQVLAAKEFRS-PVQVFEKASFFHIRSSN  61

Query  324  VYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYP  503
            VY+V     N N + AF+F+   V +FK YFGGAF+E+A+R NF L+YELLDE+MDFGYP
Sbjct  62   VYLVAATRENVNASMAFQFLFALVEVFKGYFGGAFEEEAVRENFPLVYELLDEVMDFGYP  121

Query  504  QNLSPEILKLYITQEG  551
            Q+ S ++LK +I QEG
Sbjct  122  QSCSVDLLKTFIMQEG  137



>gb|EWM25769.1| ap-2 complex subunit mu [Nannochloropsis gaditana]
Length=433

 Score =   149 bits (376),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 97/133 (73%), Gaps = 1/133 (1%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGT-CPVRQIGGCSFLYMRIS  320
            SAI+ +N +G+V++NRLYRDDV  +MVD FR  ++ +KE G+  P++ I   +FLY+R  
Sbjct  3    SAIFLVNQKGEVVVNRLYRDDVSRSMVDTFRHKVIASKETGSQAPIKVIENATFLYIRHH  62

Query  321  NVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGY  500
            ++Y+V V  +N N A  F+F+   V +FK+YFG  FDE A+RN+F L+YELLDE MDFGY
Sbjct  63   HLYLVAVTRSNLNPALVFEFLFRMVRIFKAYFGEHFDESAVRNHFTLVYELLDETMDFGY  122

Query  501  PQNLSPEILKLYI  539
            PQN + E+L+ YI
Sbjct  123  PQNCAIEVLRQYI  135



>gb|EWM25770.1| ap-2 complex subunit mu [Nannochloropsis gaditana]
Length=452

 Score =   149 bits (376),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 97/133 (73%), Gaps = 1/133 (1%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGT-CPVRQIGGCSFLYMRIS  320
            SAI+ +N +G+V++NRLYRDDV  +MVD FR  ++ +KE G+  P++ I   +FLY+R  
Sbjct  3    SAIFLVNQKGEVVVNRLYRDDVSRSMVDTFRHKVIASKETGSQAPIKVIENATFLYIRHH  62

Query  321  NVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGY  500
            ++Y+V V  +N N A  F+F+   V +FK+YFG  FDE A+RN+F L+YELLDE MDFGY
Sbjct  63   HLYLVAVTRSNLNPALVFEFLFRMVRIFKAYFGEHFDESAVRNHFTLVYELLDETMDFGY  122

Query  501  PQNLSPEILKLYI  539
            PQN + E+L+ YI
Sbjct  123  PQNCAIEVLRQYI  135



>emb|CCF51877.1| probable clathrin-associated adaptor complex medium chain [Ustilago 
hordei]
Length=427

 Score =   149 bits (375),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 99/139 (71%), Gaps = 1/139 (1%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISN  323
            SA +  NL+G+VLI+RL+R+D+  ++ D FR  ++   ++ + P+  +G  SF ++R  N
Sbjct  3    SAFFIFNLKGEVLISRLFRNDLRRSIADIFRIQVVSNADVRS-PIITLGSTSFFHVRHEN  61

Query  324  VYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYP  503
            +YIV V   NAN A  F+F    +++ +SYFGG  DE+A++NNFVLIYELLDEI+DFGYP
Sbjct  62   LYIVAVTKCNANAALVFEFCYRVISIGRSYFGGKLDEEAVKNNFVLIYELLDEILDFGYP  121

Query  504  QNLSPEILKLYITQEGVRS  560
            QN   E LK+YIT EGV+S
Sbjct  122  QNSEIETLKMYITTEGVKS  140



>ref|XP_008863053.1| hypothetical protein H310_01648 [Aphanomyces invadans]
 gb|ETW09248.1| hypothetical protein H310_01648 [Aphanomyces invadans]
Length=435

 Score =   148 bits (374),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 92/133 (69%), Gaps = 1/133 (1%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCP-VRQIGGCSFLYMRIS  320
            S ++ ++ +G+V++NRLYRDDV     DAFR  ++  KE G+ P ++ I GCSFLY R  
Sbjct  3    SGLFLISQKGEVVLNRLYRDDVSRRAADAFRLQVIAAKETGSLPPIKSIDGCSFLYTRHE  62

Query  321  NVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGY  500
            N+Y+V V   N N A  F+F+     +F+ Y G  ++E++IRNNF L+YELLDE MD+GY
Sbjct  63   NLYLVAVSRANINTALVFQFLTNINGIFQDYMGKKYNEESIRNNFTLVYELLDETMDYGY  122

Query  501  PQNLSPEILKLYI  539
            PQN S E+LK+YI
Sbjct  123  PQNCSSEVLKMYI  135



>ref|XP_008615292.1| hypothetical protein SDRG_11050 [Saprolegnia diclina VS20]
 gb|EQC31451.1| hypothetical protein SDRG_11050 [Saprolegnia diclina VS20]
Length=435

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCP-VRQIGGCSFLYMRIS  320
            S ++ ++ +G+V++NRLYRDDV     DAFR  ++  KE G+ P ++ I GCSFLY R  
Sbjct  3    SGLFLISQKGEVVLNRLYRDDVSRRAADAFRLQVIAAKETGSLPPIKSIDGCSFLYTRHE  62

Query  321  NVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGY  500
            N+Y+V V   N N+A  F+F+     +F+ Y G  ++E++IRNNF L+YELLDE MD+GY
Sbjct  63   NLYLVAVSRANINIALVFQFLTNLNGIFQDYLGKKYNEESIRNNFTLVYELLDETMDYGY  122

Query  501  PQNLSPEILKLYI  539
            PQN S ++LK+YI
Sbjct  123  PQNCSSDVLKMYI  135



>gb|KDO33493.1| hypothetical protein SPRG_02301 [Saprolegnia parasitica CBS 223.65]
Length=435

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCP-VRQIGGCSFLYMRIS  320
            S ++ ++ +G+V++NRLYRDDV     DAFR  ++  KE G+ P ++ I GCSFLY R  
Sbjct  3    SGLFLISQKGEVVLNRLYRDDVSRRAADAFRLQVIAAKETGSLPPIKSIDGCSFLYTRHE  62

Query  321  NVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGY  500
            N+Y+V V   N N+A  F+F+     +F+ Y G  ++E++IRNNF L+YELLDE MD+GY
Sbjct  63   NLYLVAVSRANINIALVFQFLTNLNGIFQDYMGKKYNEESIRNNFTLVYELLDETMDYGY  122

Query  501  PQNLSPEILKLYI  539
            PQN S ++LK+YI
Sbjct  123  PQNCSSDVLKMYI  135



>ref|XP_004352407.1| clathrin-adaptor medium chain AP-2 [Dictyostelium fasciculatum]
 gb|EGG16082.1| clathrin-adaptor medium chain AP-2 [Dictyostelium fasciculatum]
Length=436

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 98/134 (73%), Gaps = 2/134 (1%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISN  323
            SA++ +N +G+VLI+R+YRDD+   + +AFR  ++ +KE    PV+ IG  SF+Y+++  
Sbjct  3    SALFLMNGKGEVLISRIYRDDISRGVANAFRLEVVSSKE-NRSPVKLIGSTSFMYIKVGG  61

Query  324  VYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYP  503
            +Y+V V   N N    F+ + + V +FKSYF   FDED+IRNNFVL+YELLDEI+DFGYP
Sbjct  62   IYVVGVTRQNVNACLVFEVLHQLVDIFKSYFDN-FDEDSIRNNFVLVYELLDEILDFGYP  120

Query  504  QNLSPEILKLYITQ  545
            QN S ++LKLYITQ
Sbjct  121  QNCSTDVLKLYITQ  134



>ref|XP_009820939.1| hypothetical protein H257_00108 [Aphanomyces astaci]
 gb|ETV88539.1| hypothetical protein H257_00108 [Aphanomyces astaci]
Length=435

 Score =   147 bits (370),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 92/133 (69%), Gaps = 1/133 (1%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCP-VRQIGGCSFLYMRIS  320
            S ++ ++ +G+V++NRLYRDDV     DAFR  ++  KE G+ P ++ I GCSFLY R  
Sbjct  3    SGLFLISQKGEVVLNRLYRDDVSRRAADAFRLQVIAAKETGSLPPIKSIDGCSFLYTRHE  62

Query  321  NVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGY  500
            N+Y+V V   N N A  F+F+     +F+ Y G  ++E++IRNNF L+YELLDE MD+GY
Sbjct  63   NLYLVAVSRANINTALVFQFLTNINGIFQDYMGKKYNEESIRNNFTLVYELLDETMDYGY  122

Query  501  PQNLSPEILKLYI  539
            PQN + E+LK+YI
Sbjct  123  PQNCASEVLKMYI  135



>emb|CBQ73573.1| probable clathrin-associated adaptor complex medium chain [Sporisorium 
reilianum SRZ2]
Length=427

 Score =   146 bits (369),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 98/139 (71%), Gaps = 1/139 (1%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISN  323
            SA +  N +G+VLI+RL+R+D+  ++ D FR  ++   ++ + P+  +G  SF ++R  N
Sbjct  3    SAFFIFNQKGEVLISRLFRNDLRRSIADIFRIQVVSNPDVRS-PIITLGSTSFFHVRHEN  61

Query  324  VYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYP  503
            +YIV V   NAN A  F+F    + + +SYFGG FDE+A++NNFVLIYELLDEI+DFGYP
Sbjct  62   LYIVAVTKCNANAALVFEFCYRVITIGRSYFGGKFDEEAVKNNFVLIYELLDEILDFGYP  121

Query  504  QNLSPEILKLYITQEGVRS  560
            QN   + LK+YIT EGV+S
Sbjct  122  QNSEIDTLKMYITTEGVKS  140



>gb|EFA80309.1| clathrin-adaptor medium chain AP-2 [Polysphondylium pallidum 
PN500]
Length=435

 Score =   146 bits (368),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 98/134 (73%), Gaps = 2/134 (1%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISN  323
            SA++ +N +G+VLI+R+YRDD+   + +AFR  ++ +KE    PV+ IG  SF+Y+++  
Sbjct  3    SALFLMNGKGEVLISRIYRDDISRGVANAFRLEVVSSKE-NRSPVKLIGSTSFMYIKVGG  61

Query  324  VYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYP  503
            +Y+V V   N N    F+ + + V +FKSYF   FDED+IRNNFVL+YELLDEI+DFGYP
Sbjct  62   IYVVGVSRQNVNACMVFEVLHQLVDIFKSYFDN-FDEDSIRNNFVLVYELLDEILDFGYP  120

Query  504  QNLSPEILKLYITQ  545
            QN S ++LKLYITQ
Sbjct  121  QNCSTDVLKLYITQ  134



>emb|CDI54008.1| probable clathrin-associated adaptor complex medium chain [Melanopsichium 
pennsylvanicum 4]
Length=427

 Score =   146 bits (368),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 98/139 (71%), Gaps = 1/139 (1%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISN  323
            SA +  N +G+VLI+RL+R+D+  ++ D FR  ++   ++ + P+  +G  SF ++R  N
Sbjct  3    SAFFIFNQKGEVLISRLFRNDLRRSIADIFRIQVVSNPDVRS-PIITLGSTSFFHVRHEN  61

Query  324  VYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYP  503
            +YIV V   NAN A  F+F    + + +SYFGG FDE+A++NNFVLIYELLDEI+DFGYP
Sbjct  62   LYIVAVTKCNANAALVFEFCYRVITIGRSYFGGKFDEEAVKNNFVLIYELLDEILDFGYP  121

Query  504  QNLSPEILKLYITQEGVRS  560
            QN   + LK+YIT EGV+S
Sbjct  122  QNSDIDTLKMYITTEGVKS  140



>emb|CCI42631.1| unnamed protein product [Albugo candida]
Length=338

 Score =   144 bits (363),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 98/149 (66%), Gaps = 4/149 (3%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCP-VRQIGGCSFLYMRIS  320
            SA++ L  +G+++++R YRDDV     D FR  ++  KE G+ P ++ I GCSFLY R  
Sbjct  3    SALFLLGQKGEIVLHRFYRDDVSRRAADTFRMQVIAAKETGSLPPIKHIDGCSFLYTRHE  62

Query  321  NVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGY  500
            N+Y+V V   N N A  F+F+ +   +FK YFG  + E++IR+NF L+YELLDE +D+GY
Sbjct  63   NLYLVAVTRANINTALVFQFLYQLNGIFKEYFGKKYSEESIRDNFTLVYELLDETVDYGY  122

Query  501  PQNLSPEILKLYITQEGVRS---PFSSKP  578
            PQN S ++LK+YI    + S   P +++P
Sbjct  123  PQNCSIDVLKMYINLGSLSSSDGPLATQP  151



>gb|EST05073.1| adaptor complexes medium subunit family [Pseudozyma brasiliensis 
GHG001]
Length=427

 Score =   145 bits (367),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 98/139 (71%), Gaps = 1/139 (1%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISN  323
            SA +  N +G+VLI+RL+R+D+  ++ D FR  ++   ++ + P+  +G  SF ++R  N
Sbjct  3    SAFFIFNQKGEVLISRLFRNDLRRSIADIFRIQVVSNPDVRS-PIITLGSTSFFHVRHEN  61

Query  324  VYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYP  503
            +YIV V   NAN A  F+F    + + +SYFGG FDE+A++NNFVLIYELLDE++DFGYP
Sbjct  62   LYIVAVTKCNANAALVFEFCYRVITIGRSYFGGKFDEEAVKNNFVLIYELLDEVLDFGYP  121

Query  504  QNLSPEILKLYITQEGVRS  560
            QN   + LK+YIT EGV+S
Sbjct  122  QNSEIDTLKMYITTEGVKS  140



>ref|XP_011389607.1| putative clathrin-associated adaptor complex medium chain [Ustilago 
maydis 521]
 gb|KIS68571.1| putative clathrin-associated adaptor complex medium chain [Ustilago 
maydis 521]
Length=427

 Score =   145 bits (367),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 98/139 (71%), Gaps = 1/139 (1%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISN  323
            SA +  N +G+VLI+RL+R+D+  ++ D FR  ++   ++ + P+  +G  SF ++R  N
Sbjct  3    SAFFIFNQKGEVLISRLFRNDLRRSIADIFRIQVVSNPDVRS-PIITLGSTSFFHVRHEN  61

Query  324  VYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYP  503
            +YIV V   NAN A  F+F    + + +SYFGG FDE+A++NNFVLIYELLDEI+DFGYP
Sbjct  62   LYIVAVTKCNANAALIFEFCYRVITIGRSYFGGKFDEEAVKNNFVLIYELLDEILDFGYP  121

Query  504  QNLSPEILKLYITQEGVRS  560
            QN   + LK+YIT EGV+S
Sbjct  122  QNSEIDTLKMYITTEGVKS  140



>ref|XP_001698863.1| Mu2-Adaptin [Chlamydomonas reinhardtii]
 gb|EDO99145.1| Mu2-Adaptin [Chlamydomonas reinhardtii]
Length=438

 Score =   145 bits (367),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 100/146 (68%), Gaps = 5/146 (3%)
 Frame = +3

Query  138  AASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELG-----TCPVRQIGGCSF  302
            A SAIYFLNLRGD+L+ R Y+DDV   + ++FR  I+  +        + P+R +G  +F
Sbjct  5    ACSAIYFLNLRGDILLERKYKDDVDREIAESFRDRILNAQHQSVNPGQSGPIRTLGSVTF  64

Query  303  LYMRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDE  482
            +Y+R S++Y++++  +N N   +F+F+   V+LF+SYF G  +E +IR+NFVL+YELLDE
Sbjct  65   MYLRHSDIYVLMLTRSNGNAMLSFRFMTSLVSLFQSYFEGDLNESSIRSNFVLMYELLDE  124

Query  483  IMDFGYPQNLSPEILKLYITQEGVRS  560
            +MD+G PQ   P ILK  I Q+G +S
Sbjct  125  VMDYGLPQMSDPAILKTLILQKGYKS  150



>ref|XP_007881243.1| hypothetical protein PFL1_05516 [Pseudozyma flocculosa PF-1]
 gb|EPQ26881.1| hypothetical protein PFL1_05516 [Pseudozyma flocculosa PF-1]
Length=427

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 97/139 (70%), Gaps = 1/139 (1%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISN  323
            SA +  N +G+VLI+RL+R D+  ++ D FR  ++   ++ + P+  +G  SF ++R  N
Sbjct  3    SAFFIFNQKGEVLISRLFRSDLKRSIADIFRIQVVSNPDVRS-PIITLGSTSFFHVRHEN  61

Query  324  VYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYP  503
            +Y+V V   NAN A  F+F    + + +SYFGG FDE+A++NNFVLIYELLDEI+DFGYP
Sbjct  62   LYLVAVTKCNANAALVFEFCYRVIGIGRSYFGGKFDEEAVKNNFVLIYELLDEILDFGYP  121

Query  504  QNLSPEILKLYITQEGVRS  560
            QN   + LK+YIT EGV+S
Sbjct  122  QNSEIDTLKMYITTEGVKS  140



>ref|XP_008889873.1| hypothetical protein PPTG_00246 [Phytophthora parasitica INRA-310]
 gb|ETI57404.1| hypothetical protein F443_00318 [Phytophthora parasitica P1569]
 gb|ETK97140.1| hypothetical protein L915_00280 [Phytophthora parasitica]
 gb|ETL50493.1| hypothetical protein L916_00278 [Phytophthora parasitica]
 gb|ETM03533.1| hypothetical protein L917_00263 [Phytophthora parasitica]
 gb|ETM56806.1| hypothetical protein L914_00285 [Phytophthora parasitica]
 gb|ETN23710.1| hypothetical protein PPTG_00246 [Phytophthora parasitica INRA-310]
 gb|ETO86126.1| hypothetical protein F444_00300 [Phytophthora parasitica P1976]
 gb|ETP27185.1| hypothetical protein F441_00296 [Phytophthora parasitica CJ01A1]
 gb|ETP55116.1| hypothetical protein F442_00303 [Phytophthora parasitica P10297]
Length=437

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 91/133 (68%), Gaps = 1/133 (1%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCP-VRQIGGCSFLYMRIS  320
            SA++ ++ +G+V++NR YRDDV     D FR  ++  KE GT P V+ I GCSFLY R  
Sbjct  3    SALFLISQKGEVVLNRFYRDDVSRRAADNFRLQVIAAKETGTLPPVKVIDGCSFLYTRHE  62

Query  321  NVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGY  500
            N+Y+V V   N N A  F+F+ +   +FK YFG  ++ED IR+NF L+YELLDE MD GY
Sbjct  63   NLYLVAVSRANINAALVFQFLYQLNIIFKEYFGKKYNEDTIRDNFTLVYELLDETMDHGY  122

Query  501  PQNLSPEILKLYI  539
            PQN S ++LKL+I
Sbjct  123  PQNCSSDVLKLFI  135



>ref|XP_007414674.1| hypothetical protein MELLADRAFT_91641 [Melampsora larici-populina 
98AG31]
 gb|EGG02137.1| hypothetical protein MELLADRAFT_91641 [Melampsora larici-populina 
98AG31]
Length=431

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 100/139 (72%), Gaps = 2/139 (1%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISN  323
            SA++ LNL+G+VLI+RLYR D+  ++ D FR H++   ++ + P+  +G  SF ++R  N
Sbjct  3    SALFILNLKGEVLISRLYRPDIKRSIADIFRIHVISNPDVRS-PIITLGSTSFFHVRHQN  61

Query  324  VYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYP  503
            +Y+  V  +NAN A  F+F+   + L +SYFG   DE++++NNFVLIYELLDEI+DFGYP
Sbjct  62   LYLAAVTKSNANAAIVFEFLYRLINLTRSYFG-KMDEESVKNNFVLIYELLDEILDFGYP  120

Query  504  QNLSPEILKLYITQEGVRS  560
            QN   + LK+YIT EGV+S
Sbjct  121  QNSEIDTLKMYITTEGVKS  139



>gb|KIH63373.1| clathrin adaptor complex small chain [Ancylostoma duodenale]
Length=219

 Score =   140 bits (354),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 96/149 (64%), Gaps = 1/149 (1%)
 Frame = +3

Query  132  PVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYM  311
            P     ++  N +G+VLI+R+YRDDV  N VDAFR +++  ++    PV  +   SF ++
Sbjct  10   PAMIGGLFVYNHKGEVLISRIYRDDVTRNAVDAFRVNVIHARQQVRTPVTNMARTSFFHV  69

Query  312  RISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMD  491
            +  NV+I  V   N N A  F+F+       +SYF G  +E+ ++NNFVLIYELLDEI+D
Sbjct  70   KRGNVWICAVTRQNVNAAMVFEFLNRFADTMQSYF-GKLNEENVKNNFVLIYELLDEILD  128

Query  492  FGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            FGYPQN  P +LK +ITQ+GVR+  ++ P
Sbjct  129  FGYPQNTDPGVLKTFITQQGVRTADATAP  157



>ref|XP_642749.1| clathrin-adaptor medium chain AP-2 [Dictyostelium discoideum 
AX4]
 sp|P54672.2|AP2M_DICDI RecName: Full=AP-2 complex subunit mu; AltName: Full=Clathrin 
assembly protein complex 2 mu medium chain; AltName: Full=Clathrin 
coat assembly protein AP50; AltName: Full=Clathrin coat-associated 
protein AP50; AltName: Full=Clathrin-adaptor 
medium chain Apm2; AltName: Full=Mu2-adaptin; AltName: Full=Plasma 
membrane adaptor AP-2 50 kDa protein [Dictyostelium discoideum]
 gb|EAL68755.1| clathrin-adaptor medium chain AP-2 [Dictyostelium discoideum 
AX4]
Length=439

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 99/134 (74%), Gaps = 2/134 (1%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISN  323
            SA++ +N +G+VLI+R+YRDD+   + +AFR  ++ ++E  + PV+ IG  SF+Y+++ N
Sbjct  3    SALFLMNGKGEVLISRIYRDDISRGVANAFRLEVIGSQETRS-PVKLIGSTSFMYIKVGN  61

Query  324  VYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYP  503
            +YIV V   N N    F+ + + V +FKSYF    DED+IRNNFVL+YELLDEI+DFGYP
Sbjct  62   IYIVGVSRQNVNACMVFEVLHQLVDIFKSYFDN-LDEDSIRNNFVLVYELLDEILDFGYP  120

Query  504  QNLSPEILKLYITQ  545
            QN S ++LKLYITQ
Sbjct  121  QNCSTDVLKLYITQ  134



>ref|XP_003289748.1| AP-2 medium chain [Dictyostelium purpureum]
 gb|EGC33709.1| AP-2 medium chain [Dictyostelium purpureum]
Length=436

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 99/134 (74%), Gaps = 2/134 (1%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISN  323
            SA++ +N +G+VLI+R+YRDD+   + +AFR  ++ ++E  + PV+ IG  SF+Y+++ N
Sbjct  3    SALFLMNGKGEVLISRIYRDDISRGVANAFRLEVIGSQETRS-PVKLIGSTSFMYIKVGN  61

Query  324  VYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYP  503
            +YIV V   N N    F+ + + V +FKSYF    DED+IRNNFVL+YELLDEI+DFGYP
Sbjct  62   IYIVGVSRQNVNACMVFEVLHQLVDIFKSYFD-TIDEDSIRNNFVLVYELLDEILDFGYP  120

Query  504  QNLSPEILKLYITQ  545
            QN S ++LKLYITQ
Sbjct  121  QNCSTDVLKLYITQ  134



>emb|CCI42632.1| unnamed protein product [Albugo candida]
Length=405

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 98/149 (66%), Gaps = 4/149 (3%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCP-VRQIGGCSFLYMRIS  320
            SA++ L  +G+++++R YRDDV     D FR  ++  KE G+ P ++ I GCSFLY R  
Sbjct  3    SALFLLGQKGEIVLHRFYRDDVSRRAADTFRMQVIAAKETGSLPPIKHIDGCSFLYTRHE  62

Query  321  NVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGY  500
            N+Y+V V   N N A  F+F+ +   +FK YFG  + E++IR+NF L+YELLDE +D+GY
Sbjct  63   NLYLVAVTRANINTALVFQFLYQLNGIFKEYFGKKYSEESIRDNFTLVYELLDETVDYGY  122

Query  501  PQNLSPEILKLYITQEGVRS---PFSSKP  578
            PQN S ++LK+YI    + S   P +++P
Sbjct  123  PQNCSIDVLKMYINLGSLSSSDGPLATQP  151



>ref|XP_006819890.1| PREDICTED: LOW QUALITY PROTEIN: AP-2 complex subunit mu-like 
[Saccoglossus kowalevskii]
Length=398

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 96/138 (70%), Gaps = 1/138 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +I+  ++    PV  I   SF +++ SN+
Sbjct  4    GLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNIIHARQQVRSPVTNIARTSFFHIKRSNI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N    F+F+++ V + +SYF G  +ED I+NNFVLIYELLDEI+D+GYPQ
Sbjct  64   WLACVTKQNVNATMVFEFLIKMVDVMQSYF-GKINEDNIKNNFVLIYELLDEILDYGYPQ  122

Query  507  NLSPEILKLYITQEGVRS  560
            N    ILK YITQ+G++S
Sbjct  123  NTDTGILKTYITQQGIKS  140



>emb|CCA23532.1| AP2 complex subunit mu putative [Albugo laibachii Nc14]
Length=436

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 98/149 (66%), Gaps = 4/149 (3%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCP-VRQIGGCSFLYMRIS  320
            SA++ L  +G+++++R YRDDV     D FR  ++  KE G+ P V+ I GCSFLY R  
Sbjct  3    SALFLLGQKGEIVLHRFYRDDVSRRAADTFRMQVIAAKETGSLPPVKHIDGCSFLYTRHE  62

Query  321  NVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGY  500
            N+Y+V V   N N A  F+F+ +   +FK YFG  + E++IR+NF L+YELLDE +D+GY
Sbjct  63   NLYLVAVTRANINTALVFQFLYQLNGIFKEYFGKKYSEESIRDNFTLVYELLDETVDYGY  122

Query  501  PQNLSPEILKLYITQEGVRS---PFSSKP  578
            PQN S ++LK+YI    + +   P S++P
Sbjct  123  PQNCSIDVLKMYINLGSLSNSDGPLSTQP  151



>emb|CCI42630.1| unnamed protein product [Albugo candida]
Length=436

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 98/149 (66%), Gaps = 4/149 (3%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCP-VRQIGGCSFLYMRIS  320
            SA++ L  +G+++++R YRDDV     D FR  ++  KE G+ P ++ I GCSFLY R  
Sbjct  3    SALFLLGQKGEIVLHRFYRDDVSRRAADTFRMQVIAAKETGSLPPIKHIDGCSFLYTRHE  62

Query  321  NVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGY  500
            N+Y+V V   N N A  F+F+ +   +FK YFG  + E++IR+NF L+YELLDE +D+GY
Sbjct  63   NLYLVAVTRANINTALVFQFLYQLNGIFKEYFGKKYSEESIRDNFTLVYELLDETVDYGY  122

Query  501  PQNLSPEILKLYITQEGVRS---PFSSKP  578
            PQN S ++LK+YI    + S   P +++P
Sbjct  123  PQNCSIDVLKMYINLGSLSSSDGPLATQP  151



>dbj|GAC75228.1| adaptor complexes medium subunit family [Pseudozyma antarctica 
T-34]
 gb|ETS60070.1| hypothetical protein PaG_06064 [Pseudozyma aphidis DSM 70725]
Length=427

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 98/139 (71%), Gaps = 1/139 (1%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISN  323
            SA +  N +G+VLI+RL+R+D+  ++ D FR  ++   ++ + P+  +G  SF ++R  N
Sbjct  3    SAFFIFNQKGEVLISRLFRNDLRRSIADIFRIQVVSNPDVRS-PIITLGSTSFFHVRHEN  61

Query  324  VYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYP  503
            +YIV V   NAN A  F+F    +++ +SYFG  FDE+A++NNFVLIYELLDEI+DFGYP
Sbjct  62   LYIVAVTKCNANAALVFEFCYRVISIGRSYFGAKFDEEAVKNNFVLIYELLDEILDFGYP  121

Query  504  QNLSPEILKLYITQEGVRS  560
            QN   + LK+YIT EGV+S
Sbjct  122  QNSEIDTLKMYITTEGVKS  140



>dbj|GAM22943.1| hypothetical protein SAMD00019534_061180 [Acytostelium subglobosum 
LB1]
Length=437

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 99/134 (74%), Gaps = 2/134 (1%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISN  323
            SA++ +N +G+VLI+R+YRDD+   + +AFR  ++ ++E    PV+QIG  +F+Y++   
Sbjct  3    SALFLMNSKGEVLISRIYRDDISRGVGNAFRLEVVMSQE-NRSPVKQIGSSTFMYIQQGG  61

Query  324  VYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYP  503
            +Y+V V S N N    F+ + + V LFKSYF   F+E++I+NNFVL+YELLDEI+DFGYP
Sbjct  62   LYVVAVTSKNVNACMVFEVLHQLVDLFKSYFD-TFNEESIKNNFVLVYELLDEILDFGYP  120

Query  504  QNLSPEILKLYITQ  545
            QN S E+LKLYITQ
Sbjct  121  QNCSTEVLKLYITQ  134



>ref|XP_005762576.1| Apm2, medium subunit of the adaptin 2 complex [Emiliania huxleyi 
CCMP1516]
 ref|XP_005777158.1| Apm2, medium subunit of the adaptin 2 complex [Emiliania huxleyi 
CCMP1516]
 gb|EOD10147.1| Apm2, medium subunit of the adaptin 2 complex [Emiliania huxleyi 
CCMP1516]
 gb|EOD24729.1| Apm2, medium subunit of the adaptin 2 complex [Emiliania huxleyi 
CCMP1516]
Length=433

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 99/144 (69%), Gaps = 1/144 (1%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISN  323
            S +  +N +G+V+I+R+YR+      +D FR  ++ +KE G  PV+ +   +F++++  N
Sbjct  3    SNVLLINQKGEVVISRIYREGASQKTIDTFRNQVIASKEAGRLPVKVLDHTAFMFIKHGN  62

Query  324  VYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYP  503
            +Y V V S NA  A AF+F+ E + + KSYFG  F E+++RNNF+LIYELLDE++D+GYP
Sbjct  63   MYAVAVSSGNAQAALAFQFLHELIKVLKSYFGD-FTEESVRNNFILIYELLDEVLDYGYP  121

Query  504  QNLSPEILKLYITQEGVRSPFSSK  575
            QN S ++LK+YITQEG R     +
Sbjct  122  QNTSDDVLKMYITQEGNRKAMQDR  145



>ref|XP_009532744.1| hypothetical protein PHYSODRAFT_317496 [Phytophthora sojae]
 gb|EGZ12411.1| hypothetical protein PHYSODRAFT_317496 [Phytophthora sojae]
Length=437

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 91/133 (68%), Gaps = 1/133 (1%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCP-VRQIGGCSFLYMRIS  320
            SA++ ++ +G+V++NR YRDDV     D FR  ++  KE GT P V+ I GCSFLY R  
Sbjct  3    SALFLISQKGEVVLNRFYRDDVSRRAADNFRLQVIAAKETGTLPPVKVIDGCSFLYTRHE  62

Query  321  NVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGY  500
            N+Y+V V   N N A  F+F+ +   +FK YFG  ++E+ IR+NF L+YELLDE MD GY
Sbjct  63   NLYLVAVSRANINAALVFQFLYQLNVIFKEYFGKKYNEETIRDNFTLVYELLDETMDHGY  122

Query  501  PQNLSPEILKLYI  539
            PQN S ++LKL+I
Sbjct  123  PQNCSSDVLKLFI  135



>ref|XP_002998051.1| AP-2 complex subunit mu [Phytophthora infestans T30-4]
 gb|EEY70397.1| AP-2 complex subunit mu [Phytophthora infestans T30-4]
Length=437

 Score =   144 bits (362),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 91/133 (68%), Gaps = 1/133 (1%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCP-VRQIGGCSFLYMRIS  320
            SA++ ++ +G+V++NR YRDDV     D FR  ++  KE GT P V+ I GCSFLY R  
Sbjct  3    SALFLISQKGEVVLNRFYRDDVSRRAADNFRLQVIAAKETGTLPPVKVIDGCSFLYTRHE  62

Query  321  NVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGY  500
            N+Y+V V   N N A  F+F+ +   +FK YFG  ++E+ IR+NF L+YELLDE MD GY
Sbjct  63   NLYLVAVSRANINAALVFQFLYQLNIIFKEYFGKKYNEETIRDNFTLVYELLDETMDHGY  122

Query  501  PQNLSPEILKLYI  539
            PQN S ++LKL+I
Sbjct  123  PQNCSSDVLKLFI  135



>dbj|GAK64805.1| intracellular protein transport-related protein [Pseudozyma antarctica]
Length=896

 Score =   147 bits (370),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 68/143 (48%), Positives = 99/143 (69%), Gaps = 1/143 (1%)
 Frame = +3

Query  132  PVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYM  311
            P   SA +  N +G+VLI+RL+R+D+  ++ D FR  ++   ++ + P+  +G  SF ++
Sbjct  468  PAMISAFFIFNQKGEVLISRLFRNDLRRSIADIFRIQVVSNPDVRS-PIITLGSTSFFHV  526

Query  312  RISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMD  491
            R  N+YIV V   NAN A  F+F    +++ +SYFG  FDE+A++NNFVLIYELLDEI+D
Sbjct  527  RHENLYIVAVTKCNANAAIVFEFCYRVISIGRSYFGAKFDEEAVKNNFVLIYELLDEILD  586

Query  492  FGYPQNLSPEILKLYITQEGVRS  560
            FGYPQN   + LK+YIT EGV+S
Sbjct  587  FGYPQNSEIDTLKMYITTEGVKS  609



>gb|AAB41282.1| DdApm1 [Dictyostelium discoideum]
Length=439

 Score =   143 bits (361),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 98/134 (73%), Gaps = 2/134 (1%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISN  323
            SA++ +N +G+VLI+R+YRDD+   + +AFR  ++  +E  + PV+ IG  SF+Y+++ N
Sbjct  3    SALFLMNGKGEVLISRIYRDDISRGVGNAFRLEVIGVQETRS-PVKLIGSTSFMYIKVGN  61

Query  324  VYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYP  503
            +YIV V   N N    F+ + + V +FKSYF    DED+IRNNFVL+YELLDEI+DFGYP
Sbjct  62   IYIVGVSRQNVNACMVFEVLHQLVDIFKSYFDN-LDEDSIRNNFVLVYELLDEILDFGYP  120

Query  504  QNLSPEILKLYITQ  545
            QN S ++LKLYITQ
Sbjct  121  QNCSTDVLKLYITQ  134



>ref|XP_006738213.1| PREDICTED: AP-2 complex subunit mu, partial [Leptonychotes weddellii]
Length=189

 Score =   137 bits (346),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 94/144 (65%), Gaps = 1/144 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ SN+
Sbjct  4    GLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+ +   +  +YF G   E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WLAAVTKQNVNAAMVFEFLYKMCDVMAAYF-GKISEENIKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRSPFSSKP  578
            N     LK +ITQ+G++S   +K 
Sbjct  123  NSETGALKTFITQQGIKSQHQTKE  146



>ref|XP_002177952.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC50766.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=425

 Score =   143 bits (360),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 91/133 (68%), Gaps = 1/133 (1%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGT-CPVRQIGGCSFLYMRIS  320
            S I  LN +GD++I+R YRDDVG    D+FR  ++  KE GT  PV++I  CSFLY R  
Sbjct  3    SMIMVLNQKGDIMISRQYRDDVGRAAADSFRLQVVAAKETGTEAPVKRIENCSFLYTRHL  62

Query  321  NVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGY  500
            N+Y V +  +N N A  F+++ + + + K+Y G  FDE A+RNN  LIYEL+DE MDFGY
Sbjct  63   NMYFVALTRSNVNPALVFEYLFQLIKILKAYLGEEFDETAMRNNMTLIYELMDETMDFGY  122

Query  501  PQNLSPEILKLYI  539
            PQN + ++L+LYI
Sbjct  123  PQNCAVDVLRLYI  135



>ref|XP_009059469.1| hypothetical protein LOTGIDRAFT_204295 [Lottia gigantea]
 gb|ESO90004.1| hypothetical protein LOTGIDRAFT_204295 [Lottia gigantea]
Length=436

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 95/138 (69%), Gaps = 1/138 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ SN+
Sbjct  4    GMFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+ + V + +SYF G   ED I+NNFVLIYE+LDEI+DFGYPQ
Sbjct  64   WLAAVTKQNVNAAMVFEFLFKMVEVMQSYF-GKISEDNIKNNFVLIYEILDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRS  560
            N    ILK +ITQ+GV+S
Sbjct  123  NTDTGILKTFITQQGVKS  140



>gb|ESA03787.1| hypothetical protein GLOINDRAFT_238585 [Rhizophagus irregularis 
DAOM 181602]
Length=351

 Score =   141 bits (356),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 98/144 (68%), Gaps = 2/144 (1%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISN  323
            SA +  N +G+VLI+RLYR D+  ++ D FR  ++   ++ + P+  +G  SF ++R  N
Sbjct  3    SAFFIYNQKGEVLISRLYRQDLKRSVADIFRIQVISNTDVRS-PIITLGSTSFFHVRHDN  61

Query  324  VYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYP  503
            +YIV V   NAN A  F+F    V + K+YFG  FDE+A++NNFVLIYELLDE++DFGYP
Sbjct  62   LYIVAVTKCNANAALVFEFCYRLVNIGKAYFG-KFDEEAVKNNFVLIYELLDEVLDFGYP  120

Query  504  QNLSPEILKLYITQEGVRSPFSSK  575
            QN   E LK+YIT EGV+S  + K
Sbjct  121  QNSETETLKMYITTEGVKSQRAVK  144



>dbj|GAC95247.1| hypothetical protein PHSY_002822 [Pseudozyma hubeiensis SY62]
Length=1520

 Score =   147 bits (371),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 98/139 (71%), Gaps = 1/139 (1%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISN  323
            SA +  N +G+VLI+RL+R+D+  ++ D FR  ++   ++ + P+  +G  SF ++R  N
Sbjct  3    SAFFIFNQKGEVLISRLFRNDLRRSIADIFRIQVVSNPDVRS-PIITLGSTSFFHVRHEN  61

Query  324  VYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYP  503
            +YIV V   NAN A  F+F    + + +SYFGG FDE+A++NNFVLIYELLDEI+DFGYP
Sbjct  62   LYIVAVTKCNANAALVFEFCYRVITIGRSYFGGKFDEEAVKNNFVLIYELLDEILDFGYP  121

Query  504  QNLSPEILKLYITQEGVRS  560
            QN   + LK+YIT EGV+S
Sbjct  122  QNSEIDTLKMYITTEGVKS  140



>ref|XP_011398931.1| AP-2 complex subunit mu [Auxenochlorella protothecoides]
 gb|KFM26035.1| AP-2 complex subunit mu [Auxenochlorella protothecoides]
Length=428

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 95/138 (69%), Gaps = 3/138 (2%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKEL---GTCPVRQIGGCSFLYMRI  317
            AIYF++ RGDVLI R YRDD+  N+  AFRT+++ +K L    T PVRQ  G SF+++R 
Sbjct  6    AIYFISGRGDVLIQRTYRDDIDKNIPAAFRTNVINSKSLDSASTAPVRQFIGSSFIHLRA  65

Query  318  SNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFG  497
             +VY++ +  TN+N     +F+ + V L KSY  G F+E+ I+ NFVLIYELLDEI+DFG
Sbjct  66   GSVYLLAITRTNSNAMMILQFLSKVVDLIKSYCHGDFNEEVIKANFVLIYELLDEILDFG  125

Query  498  YPQNLSPEILKLYITQEG  551
            YPQ   P +LK  I Q+G
Sbjct  126  YPQISEPAVLKSLIFQKG  143



>ref|XP_011192818.1| PREDICTED: AP-2 complex subunit mu [Bactrocera cucurbitae]
Length=437

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 96/138 (70%), Gaps = 1/138 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ +N+
Sbjct  4    GLFVYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHIKRANI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+++ + + +SYF G   E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WLAAVTKQNVNAAMVFEFLLKIIEVMQSYF-GKISEENIKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRS  560
            N  P  LK +ITQ+G++S
Sbjct  123  NTDPGTLKTFITQQGIKS  140



>gb|ACO12761.1| AP-2 complex subunit mu-1 [Lepeophtheirus salmonis]
Length=429

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 94/138 (68%), Gaps = 1/138 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR H++  ++    PV  I   SF +++ SN+
Sbjct  4    GLFIYNHKGEVLISRVYRDDIGRNAVDAFRVHVIHARQQVRSPVTNIARTSFFHIKKSNI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N    F+F+++   + ++YF G   E+ ++NNFVLIYELLDE++DFGYPQ
Sbjct  64   WLAAVTKQNVNAGMVFEFLLKMCVVMEAYF-GKISEENVKNNFVLIYELLDELLDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRS  560
            N    ILK YITQ+G++S
Sbjct  123  NTDTGILKTYITQQGIKS  140



>gb|ADD38021.1| AP-2 complex subunit mu-1 [Lepeophtheirus salmonis]
Length=429

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 94/138 (68%), Gaps = 1/138 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR H++  ++    PV  I   SF +++ SN+
Sbjct  4    GLFIYNHKGEVLISRVYRDDIGRNAVDAFRVHVIHARQQVRSPVTNIARTSFFHIKKSNI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N    F+F+++   + ++YF G   E+ ++NNFVLIYELLDE++DFGYPQ
Sbjct  64   WLAAVTKQNVNAGMVFEFLLKMCVVMEAYF-GKISEENVKNNFVLIYELLDELLDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRS  560
            N    ILK YITQ+G++S
Sbjct  123  NTDTGILKTYITQQGIKS  140



>ref|XP_011451811.1| PREDICTED: AP-2 complex subunit mu [Crassostrea gigas]
 ref|XP_011451812.1| PREDICTED: AP-2 complex subunit mu [Crassostrea gigas]
 ref|XP_011451813.1| PREDICTED: AP-2 complex subunit mu [Crassostrea gigas]
 ref|XP_011451814.1| PREDICTED: AP-2 complex subunit mu [Crassostrea gigas]
Length=438

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 96/138 (70%), Gaps = 1/138 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ SN+
Sbjct  4    GLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHIKRSNI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+++ V + +SYF G   E+ ++NNFVLIYE+LDEI+DFGYPQ
Sbjct  64   WLAAVTKQNVNAAMVFEFLLKMVEVMQSYF-GKITEENVKNNFVLIYEILDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRS  560
            N    ILK +ITQ+GV+S
Sbjct  123  NTDTGILKTFITQQGVKS  140



>gb|EKC19414.1| AP-2 complex subunit mu-1 [Crassostrea gigas]
Length=455

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 96/138 (70%), Gaps = 1/138 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ SN+
Sbjct  21   GLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHIKRSNI  80

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+++ V + +SYF G   E+ ++NNFVLIYE+LDEI+DFGYPQ
Sbjct  81   WLAAVTKQNVNAAMVFEFLLKMVEVMQSYF-GKITEENVKNNFVLIYEILDEILDFGYPQ  139

Query  507  NLSPEILKLYITQEGVRS  560
            N    ILK +ITQ+GV+S
Sbjct  140  NTDTGILKTFITQQGVKS  157



>gb|ADX97050.1| AP-2 complex subunit mu-1-a, partial [Perca flavescens]
Length=187

 Score =   135 bits (341),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 93/144 (65%), Gaps = 1/144 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ SN+
Sbjct  4    GLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+ +   +  +YF G   E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WLAAVTKQNVNAAMVFEFLYKMCDVMTAYF-GKISEENIKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRSPFSSKP  578
            N     LK +ITQ+G++    +K 
Sbjct  123  NSETGALKTFITQQGIKGQHQTKE  146



>ref|NP_001280510.1| AP-2 complex subunit mu [Tribolium castaneum]
 gb|EFA09781.1| hypothetical protein TcasGA2_TC011923 [Tribolium castaneum]
 gb|AHY84715.1| AP-2 complex subunit mu [Tribolium castaneum]
Length=438

 Score =   141 bits (355),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 96/138 (70%), Gaps = 1/138 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ +N+
Sbjct  4    GLFVYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHIKRANI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            +I  V   N N A  F+F+++ + + +SYF G   E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WIAAVTKQNVNAAMVFEFLLKIIEVMQSYF-GKISEENIKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRS  560
            N    +LK +ITQ+G++S
Sbjct  123  NTDTGVLKTFITQQGIKS  140



>gb|KFM82180.1| AP-2 complex subunit mu, partial [Stegodyphus mimosarum]
Length=435

 Score =   141 bits (355),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 96/138 (70%), Gaps = 1/138 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VL++R++RDD+G N VDAFR +++  ++    PV  I   SF +++ SN+
Sbjct  4    GLFIYNHKGEVLVSRVFRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHIKRSNI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+++ V + +SYF G   E+ ++NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WLAAVTKQNVNAAMVFEFLLKMVEVMQSYF-GKISEENVKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRS  560
            N    ILK +ITQ+GV+S
Sbjct  123  NTDTGILKTFITQQGVKS  140



>ref|XP_009011992.1| hypothetical protein HELRODRAFT_156400 [Helobdella robusta]
 gb|ESO10178.1| hypothetical protein HELRODRAFT_156400 [Helobdella robusta]
Length=434

 Score =   140 bits (354),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 95/138 (69%), Gaps = 1/138 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR  ++  ++    PV  I   SF +++ SNV
Sbjct  4    GLFIYNHKGEVLISRVYRDDIGRNAVDAFRVSVIHARQQVRSPVTNIARTSFFHIKRSNV  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+++ V + +SYFG   +E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WLAAVTKQNVNAAMVFEFLIKMVNIMQSYFGKVSEEN-IKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRS  560
            N    +LK +ITQ G++S
Sbjct  123  NTDMGVLKTFITQAGIKS  140



>gb|EXX69942.1| Apm1p [Rhizophagus irregularis DAOM 197198w]
Length=314

 Score =   138 bits (348),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 97/144 (67%), Gaps = 2/144 (1%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISN  323
            SA +  N +G+VLI+RLYR D+  ++ D FR  ++   ++ + P+  +G  SF ++R  N
Sbjct  3    SAFFIYNQKGEVLISRLYRQDLKRSVADIFRIQVISNTDVRS-PIITLGSTSFFHVRHDN  61

Query  324  VYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYP  503
            +YIV V   NAN A  F+F      + K+YFG  FDE+A++NNFVLIYELLDE++DFGYP
Sbjct  62   LYIVAVTKCNANAALVFEFCYRLGNIGKAYFG-KFDEEAVKNNFVLIYELLDEVLDFGYP  120

Query  504  QNLSPEILKLYITQEGVRSPFSSK  575
            QN   E LK+YIT EGV+S  + K
Sbjct  121  QNSETETLKMYITTEGVKSQRAVK  144



>ref|XP_001606373.1| PREDICTED: AP-2 complex subunit mu [Nasonia vitripennis]
 ref|XP_003425668.1| PREDICTED: AP-2 complex subunit mu [Nasonia vitripennis]
 ref|XP_008203517.1| PREDICTED: AP-2 complex subunit mu [Nasonia vitripennis]
 ref|XP_008203518.1| PREDICTED: AP-2 complex subunit mu [Nasonia vitripennis]
Length=443

 Score =   140 bits (354),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 97/138 (70%), Gaps = 1/138 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ +N+
Sbjct  4    GLFVYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHIKRANI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+++ + + +SYF G   E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WLAAVTKQNVNAAMVFEFLLKIIDVMQSYF-GKISEENIKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRS  560
            N    +LK++ITQ+GV+S
Sbjct  123  NCDTGVLKIFITQQGVKS  140



>gb|AEE63100.1| unknown [Dendroctonus ponderosae]
 gb|ENN81590.1| hypothetical protein YQE_02000, partial [Dendroctonus ponderosae]
 gb|ERL85582.1| hypothetical protein D910_03001 [Dendroctonus ponderosae]
Length=438

 Score =   140 bits (353),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 96/138 (70%), Gaps = 1/138 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ +N+
Sbjct  4    GLFVYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHIKRANI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            +I  V   N N A  F+F+++ + + +SYF G   E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WIAAVTKQNVNAAMVFEFLLKIIEVMQSYF-GKISEENIKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRS  560
            N    +LK +ITQ+G++S
Sbjct  123  NSDTGVLKTFITQQGIKS  140



>ref|XP_011500815.1| PREDICTED: AP-2 complex subunit mu [Ceratosolen solmsi marchali]
 ref|XP_011500816.1| PREDICTED: AP-2 complex subunit mu [Ceratosolen solmsi marchali]
Length=442

 Score =   140 bits (353),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 97/138 (70%), Gaps = 1/138 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ +NV
Sbjct  4    GLFVYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHIKRANV  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+++ + + +SYFG   +E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WLAAVTKQNVNAAMVFEFLLKIIEVMQSYFGKVSEEN-IKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRS  560
            N    +LK +ITQ+GV+S
Sbjct  123  NCDTGVLKTFITQQGVKS  140



>gb|AAL75583.1|AF467697_1 clathrin-adaptor protein [Dermacentor variabilis]
Length=435

 Score =   140 bits (353),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 95/138 (69%), Gaps = 1/138 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +M+ +N+
Sbjct  4    GLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHMKRANI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+++   + +SYF G   E+ ++NNFVLIYELLDE++DFGYPQ
Sbjct  64   WLAAVTRQNVNAAMVFEFLLKMCEVMQSYF-GKISEENVKNNFVLIYELLDELLDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRS  560
            N    ILK +ITQ+GV+S
Sbjct  123  NTDTGILKTFITQQGVKS  140



>gb|KDE04314.1| AP-2 complex subunit mu [Microbotryum violaceum p1A1 Lamole]
Length=431

 Score =   140 bits (353),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 96/139 (69%), Gaps = 1/139 (1%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISN  323
            SA + LNL+G+VLI+RL+R D+  ++ D FR H++ +    T P+  +G  +F ++R   
Sbjct  3    SAFFILNLKGEVLISRLFRPDLKRSISDIFRIHVIASSTPPTSPLVTLGNTTFFHVRHGG  62

Query  324  VYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYP  503
            +++V V   NAN A  F+F    + L ++YF G  DE++++NNFVLIYELLDEI+DFGYP
Sbjct  63   LWLVTVCKNNANAALVFEFTYRFINLGRAYF-GKLDEESVKNNFVLIYELLDEILDFGYP  121

Query  504  QNLSPEILKLYITQEGVRS  560
            QN   + LK+YIT EGV+S
Sbjct  122  QNSESDTLKMYITNEGVKS  140



>gb|EXX69943.1| Apm4p [Rhizophagus irregularis DAOM 197198w]
Length=351

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 97/144 (67%), Gaps = 2/144 (1%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISN  323
            SA +  N +G+VLI+RLYR D+  ++ D FR  ++   ++ + P+  +G  SF ++R  N
Sbjct  3    SAFFIYNQKGEVLISRLYRQDLKRSVADIFRIQVISNTDVRS-PIITLGSTSFFHVRHDN  61

Query  324  VYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYP  503
            +YIV V   NAN A  F+F      + K+YFG  FDE+A++NNFVLIYELLDE++DFGYP
Sbjct  62   LYIVAVTKCNANAALVFEFCYRLGNIGKAYFG-KFDEEAVKNNFVLIYELLDEVLDFGYP  120

Query  504  QNLSPEILKLYITQEGVRSPFSSK  575
            QN   E LK+YIT EGV+S  + K
Sbjct  121  QNSETETLKMYITTEGVKSQRAVK  144



>dbj|GAA93418.1| hypothetical protein E5Q_00059 [Mixia osmundae IAM 14324]
 gb|KEI37528.1| hypothetical protein L969DRAFT_96056 [Mixia osmundae IAM 14324]
Length=488

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 97/139 (70%), Gaps = 2/139 (1%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISN  323
            SA + LNL+G+VLI+RLYR D   ++ D FR H++   ++ + P+  +G  SF ++R  N
Sbjct  61   SAFFILNLKGEVLISRLYRPDAKRSISDIFRIHVVANPDVRS-PIITLGSTSFFHVRHQN  119

Query  324  VYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYP  503
            +Y+  V   NA+ A  F+F    +++ +SYFG   DE++++NNFVLIYELLDEI+DFGYP
Sbjct  120  LYLAAVTKNNASAALVFEFCYRVISVGRSYFG-KLDEESVKNNFVLIYELLDEILDFGYP  178

Query  504  QNLSPEILKLYITQEGVRS  560
            QN   + LK+YIT EGV+S
Sbjct  179  QNSETDTLKMYITTEGVKS  197



>ref|XP_003748524.1| PREDICTED: AP-2 complex subunit mu-like [Metaseiulus occidentalis]
Length=443

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 95/138 (69%), Gaps = 1/138 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ +N+
Sbjct  4    GLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHIKRANI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+++   + +SYF G   E+ ++NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WLAAVTKQNVNAAMVFEFLLKMCEVMQSYF-GKLSEENVKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRS  560
            N    ILK +ITQ+G++S
Sbjct  123  NTDTGILKTFITQQGIKS  140



>ref|XP_003704237.1| PREDICTED: AP-2 complex subunit mu-like [Megachile rotundata]
Length=442

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 96/138 (70%), Gaps = 1/138 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ +N+
Sbjct  4    GLFVYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHIKRANI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+++ + + +SYF G   E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WLAAVTKQNVNAAMVFEFLLKIIDVMQSYF-GKISEENIKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRS  560
            N    +LK +ITQ+GV+S
Sbjct  123  NCDTGVLKTFITQQGVKS  140



>gb|ERG79534.1| ap-2 complex subunit mu [Ascaris suum]
Length=428

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 95/143 (66%), Gaps = 1/143 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDDV  N VDAFR +++  ++    PV  +   SF +++  NV
Sbjct  4    GLFVYNHKGEVLISRIYRDDVSRNAVDAFRVNVIHARQQVRSPVTNMARTSFFHIKRGNV  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            +I  V   N N A  F+F+       +SYFG   +E+ ++NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WICAVTRQNVNAAMVFEFLNRFADTMQSYFG-KLNEENVKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRSPFSSK  575
            N  P +LK +ITQ+GVR+  +S+
Sbjct  123  NTDPGVLKTFITQQGVRTAITSQ  145



>dbj|BAN20844.1| clathrin coat associated protein ap-50 [Riptortus pedestris]
Length=443

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 96/138 (70%), Gaps = 1/138 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ +N+
Sbjct  4    GLFVYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHIKRANI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+++ + + +SYF G   E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WLAAVTKQNVNAAMVFEFLLKVIDVMQSYF-GKISEENIKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRS  560
            N    +LK +ITQ+GV+S
Sbjct  123  NSDTGVLKTFITQQGVKS  140



>gb|EYB96138.1| hypothetical protein Y032_0153g2927 [Ancylostoma ceylanicum]
Length=483

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 96/149 (64%), Gaps = 1/149 (1%)
 Frame = +3

Query  132  PVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYM  311
            P     ++  N +G+VLI+R+YRDDV  N VDAFR +++  ++    PV  +   SF ++
Sbjct  42   PAMIGGLFVYNHKGEVLISRIYRDDVTRNAVDAFRVNVIHARQQVRTPVTNMARTSFFHV  101

Query  312  RISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMD  491
            +  NV+I  V   N N A  F+F+       +SYF G  +E+ ++NNFVLIYELLDEI+D
Sbjct  102  KRGNVWICAVTRQNVNAAMVFEFLNRFADTMQSYF-GKLNEENVKNNFVLIYELLDEILD  160

Query  492  FGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            FGYPQN  P +LK +ITQ+GVR+  ++ P
Sbjct  161  FGYPQNTDPGVLKTFITQQGVRTADANAP  189



>ref|XP_391965.1| PREDICTED: AP-2 complex subunit mu isoform 1 [Apis mellifera]
 ref|XP_003400299.1| PREDICTED: AP-2 complex subunit mu-1-like [Bombus terrestris]
 ref|XP_003487642.1| PREDICTED: AP-2 complex subunit mu-1-like [Bombus impatiens]
 ref|XP_003689894.1| PREDICTED: AP-2 complex subunit mu-like [Apis florea]
 ref|XP_006609441.1| PREDICTED: AP-2 complex subunit mu-like [Apis dorsata]
Length=442

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 96/138 (70%), Gaps = 1/138 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ +N+
Sbjct  4    GLFVYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHIKRANI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+++ + + +SYF G   E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WLAAVTKQNVNAAMVFEFLLKIIDVMQSYF-GKISEENIKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRS  560
            N    +LK +ITQ+GV+S
Sbjct  123  NCDTGVLKTFITQQGVKS  140



>gb|EPB90458.1| hypothetical protein HMPREF1544_02666 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=428

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 96/139 (69%), Gaps = 2/139 (1%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISN  323
            SA +  N +G+VLI+RLYR D+  ++ D FR  ++   ++ + P+  +G  SF ++R  N
Sbjct  3    SAFFIYNQKGEVLISRLYRHDLRRSVADIFRIQVISNTDVRS-PIVTLGSTSFFHVRHEN  61

Query  324  VYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYP  503
            +YIV V   NAN A  F+F    V + +SYFG  FDE+A++NNFVLIYELLDEI+DFGYP
Sbjct  62   LYIVAVTKWNANAALIFEFCYRVVNIGRSYFG-KFDEEAVKNNFVLIYELLDEILDFGYP  120

Query  504  QNLSPEILKLYITQEGVRS  560
            QN   + LK+YIT EGV+S
Sbjct  121  QNSETDTLKMYITTEGVKS  139



>gb|AAF68477.1|AF252643_1 clathrin adaptor protein AP-50, partial [Drosophila simulans]
 gb|AAF68478.1|AF252644_1 clathrin adaptor protein AP-50, partial [Drosophila simulans]
 gb|AAF68479.1|AF252645_1 clathrin adaptor protein AP-50, partial [Drosophila simulans]
 gb|AAF68480.1|AF252646_1 clathrin adaptor protein AP-50, partial [Drosophila simulans]
 gb|AAF68481.1|AF252647_1 clathrin adaptor protein AP-50, partial [Drosophila simulans]
 gb|AAF68482.1|AF252648_1 clathrin adaptor protein AP-50, partial [Drosophila simulans]
 gb|AAF68483.1|AF252649_1 clathrin adaptor protein AP-50, partial [Drosophila simulans]
 gb|AAF68484.1|AF252650_1 clathrin adaptor protein AP-50, partial [Drosophila simulans]
Length=425

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 95/138 (69%), Gaps = 1/138 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ +N+
Sbjct  1    GLFVYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHIKRANI  60

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+++ + + +SYF G   E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  61   WLAAVTKQNVNAAMVFEFLLKIIEVMQSYF-GKISEENIKNNFVLIYELLDEILDFGYPQ  119

Query  507  NLSPEILKLYITQEGVRS  560
            N     LK +ITQ+G++S
Sbjct  120  NTDSGTLKTFITQQGIKS  137



>gb|AAF68608.1|AF255311_1 clathrin adaptor protein AP50, partial [Drosophila yakuba]
Length=425

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 95/138 (69%), Gaps = 1/138 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ +N+
Sbjct  1    GLFVYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHIKRANI  60

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+++ + + +SYF G   E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  61   WLAAVTKQNVNAAMVFEFLLKIIEVMQSYF-GKISEENIKNNFVLIYELLDEILDFGYPQ  119

Query  507  NLSPEILKLYITQEGVRS  560
            N     LK +ITQ+G++S
Sbjct  120  NTDSGTLKTFITQQGIKS  137



>ref|XP_002412443.1| clathrin-adaptor protein, putative [Ixodes scapularis]
 gb|EEC15336.1| clathrin-adaptor protein, putative, partial [Ixodes scapularis]
Length=436

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 95/138 (69%), Gaps = 1/138 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ +N+
Sbjct  7    GLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHIKRANI  66

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+++   + +SYF G   E+ ++NNFVLIYELLDEI+DFGYPQ
Sbjct  67   WLAAVTRQNVNAAMVFEFLLKMCEVMQSYF-GKISEENVKNNFVLIYELLDEILDFGYPQ  125

Query  507  NLSPEILKLYITQEGVRS  560
            N    ILK +ITQ+GV+S
Sbjct  126  NTDTGILKTFITQQGVKS  143



>ref|NP_732744.1| adaptor protein complex 2, mu subunit, isoform A [Drosophila 
melanogaster]
 ref|NP_651049.3| adaptor protein complex 2, mu subunit, isoform B [Drosophila 
melanogaster]
 ref|NP_001163686.1| adaptor protein complex 2, mu subunit, isoform C [Drosophila 
melanogaster]
 ref|XP_001358717.1| GA20066 [Drosophila pseudoobscura pseudoobscura]
 ref|XP_001964786.1| GF23377 [Drosophila ananassae]
 ref|XP_001982273.1| AP-50 [Drosophila erecta]
 ref|XP_001993913.1| GH22222 [Drosophila grimshawi]
 ref|XP_002013574.1| GL24218 [Drosophila persimilis]
 ref|XP_002032205.1| GM26435 [Drosophila sechellia]
 ref|XP_002069767.1| GK11695 [Drosophila willistoni]
 ref|XP_002098293.1| AP-50 [Drosophila yakuba]
 ref|XP_002104425.1| AP-50 [Drosophila simulans]
 gb|AAF14248.1|AF110232_1 clathrin-associated adaptor complex AP-2 medium chain [Drosophila 
melanogaster]
 emb|CAA06785.1| clathrin-associated protein [Drosophila melanogaster]
 gb|AAF56001.1| adaptor protein complex 2, mu subunit, isoform A [Drosophila 
melanogaster]
 gb|AAL48183.1| SD05403p [Drosophila melanogaster]
 gb|AAF56002.3| adaptor protein complex 2, mu subunit, isoform B [Drosophila 
melanogaster]
 gb|EAL27860.1| GA20066 [Drosophila pseudoobscura pseudoobscura]
 gb|ABB29496.1| putative clathrin-associated protein [Drosophila erecta]
 gb|ABB29497.1| putative clathrin-associated protein [Drosophila orena]
 gb|ABB29498.1| putative clathrin-associated protein [Drosophila teissieri]
 gb|EDV30582.1| GF23377 [Drosophila ananassae]
 gb|EDV54143.1| AP-50 [Drosophila erecta]
 gb|EDV94649.1| GH22222 [Drosophila grimshawi]
 gb|EDW24560.1| GL24218 [Drosophila persimilis]
 gb|EDW43191.1| GM26435 [Drosophila sechellia]
 gb|EDW80753.1| GK11695 [Drosophila willistoni]
 gb|EDW98005.1| AP-50 [Drosophila yakuba]
 gb|EDX13928.1| AP-50 [Drosophila simulans]
 gb|ACZ94982.1| adaptor protein complex 2, mu subunit, isoform C [Drosophila 
melanogaster]
Length=437

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 95/138 (69%), Gaps = 1/138 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ +N+
Sbjct  4    GLFVYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHIKRANI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+++ + + +SYF G   E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WLAAVTKQNVNAAMVFEFLLKIIEVMQSYF-GKISEENIKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRS  560
            N     LK +ITQ+G++S
Sbjct  123  NTDSGTLKTFITQQGIKS  140



>gb|EXX69941.1| Apm4p [Rhizophagus irregularis DAOM 197198w]
Length=429

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 95/139 (68%), Gaps = 2/139 (1%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISN  323
            SA +  N +G+VLI+RLYR D+  ++ D FR  ++   ++ + P+  +G  SF ++R  N
Sbjct  3    SAFFIYNQKGEVLISRLYRQDLKRSVADIFRIQVISNTDVRS-PIITLGSTSFFHVRHDN  61

Query  324  VYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYP  503
            +YIV V   NAN A  F+F      + K+YFG  FDE+A++NNFVLIYELLDE++DFGYP
Sbjct  62   LYIVAVTKCNANAALVFEFCYRLGNIGKAYFG-KFDEEAVKNNFVLIYELLDEVLDFGYP  120

Query  504  QNLSPEILKLYITQEGVRS  560
            QN   E LK+YIT EGV+S
Sbjct  121  QNSETETLKMYITTEGVKS  139



>ref|XP_002427003.1| AP-2 complex subunit mu-1, putative [Pediculus humanus corporis]
 gb|EEB14265.1| AP-2 complex subunit mu-1, putative [Pediculus humanus corporis]
Length=436

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 95/138 (69%), Gaps = 1/138 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ +N+
Sbjct  4    GLFVYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHIKRANI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+++ + L +SYF G   E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WLAAVTKQNVNAALVFEFLLKIIDLMQSYF-GKISEENIKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRS  560
            N    +LK +ITQ G++S
Sbjct  123  NSDTGVLKTFITQTGIKS  140



>ref|XP_002058393.1| GJ14336 [Drosophila virilis]
 gb|EDW58361.1| GJ14336 [Drosophila virilis]
Length=437

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 95/138 (69%), Gaps = 1/138 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ +N+
Sbjct  4    GLFVYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHIKRANI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+++ + + +SYF G   E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WLAAVTKQNVNAAMVFEFLLKIIEVMQSYF-GKISEENIKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRS  560
            N     LK +ITQ+G++S
Sbjct  123  NTDSGTLKTFITQQGIKS  140



>ref|XP_002001435.1| GI21976 [Drosophila mojavensis]
 gb|EDW16896.1| GI21976 [Drosophila mojavensis]
Length=437

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 95/138 (69%), Gaps = 1/138 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ +N+
Sbjct  4    GLFVYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHIKRANI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+++ + + +SYF G   E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WLAAVTKQNVNAAMVFEFLLKIIEVMQSYF-GKISEENIKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRS  560
            N     LK +ITQ+G++S
Sbjct  123  NTDSGTLKTFITQQGIKS  140



>ref|XP_001950328.1| PREDICTED: AP-2 complex subunit mu [Acyrthosiphon pisum]
 ref|XP_001947094.1| PREDICTED: AP-2 complex subunit mu [Acyrthosiphon pisum]
Length=436

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 94/138 (68%), Gaps = 1/138 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF ++R +N+
Sbjct  4    GLFMYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHIRRANI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F++    + +SYF G  +E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WLAAVTKQNVNGAMVFEFLIRFTQVMQSYF-GKINEENIKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRS  560
            N    +LK +ITQ GV+S
Sbjct  123  NCDTGVLKTFITQTGVKS  140



>ref|XP_004530702.1| PREDICTED: AP-2 complex subunit mu-like [Ceratitis capitata]
 ref|XP_011198595.1| PREDICTED: AP-2 complex subunit mu [Bactrocera dorsalis]
Length=437

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 95/138 (69%), Gaps = 1/138 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ +N+
Sbjct  4    GLFVYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHIKRANI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+++ + + +SYF G   E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WLAAVTKQNVNAAMVFEFLLKIIEVMQSYF-GKISEENIKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRS  560
            N     LK +ITQ+G++S
Sbjct  123  NTDSGTLKTFITQQGIKS  140



>ref|XP_005184259.1| PREDICTED: AP-2 complex subunit mu [Musca domestica]
Length=437

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 95/138 (69%), Gaps = 1/138 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ +N+
Sbjct  4    GLFVYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHIKRANI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+++ + + +SYF G   E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WLAAVTKQNVNAAMVFEFLLKIIEVMQSYF-GKISEENIKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRS  560
            N     LK +ITQ+G++S
Sbjct  123  NTDSGTLKTFITQQGIKS  140



>gb|KDR22341.1| AP-2 complex subunit mu-1 [Zootermopsis nevadensis]
Length=436

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 96/138 (70%), Gaps = 1/138 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ +N+
Sbjct  4    GLFVYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHIKRANI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+++ + + +SYF G   E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WLAAVTKQNVNAAMVFEFLLKIIDVMQSYF-GKISEENIKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRS  560
            N    +LK +ITQ+G++S
Sbjct  123  NSDTGVLKTFITQQGIKS  140



>gb|KFZ67005.1| AP-2 complex subunit mu, partial [Podiceps cristatus]
Length=233

 Score =   134 bits (338),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 92/138 (67%), Gaps = 1/138 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ SN+
Sbjct  4    GLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+ +   +  +YF G   E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WLAAVTKQNVNAAMVFEFLYKMCDVMTAYF-GKISEENIKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRS  560
            N     LK +ITQ+G++S
Sbjct  123  NSETGALKTFITQQGIKS  140



>gb|ACH44121.1| putative adaptor-related protein complex 2 mu 1 subunit variant 
2, partial [Taeniopygia guttata]
Length=324

 Score =   137 bits (344),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 94/143 (66%), Gaps = 1/143 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ SN+
Sbjct  4    GLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+ +   +  +YF G   E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WLAAVTKQNVNAAMVFEFLYKMCDVMTAYF-GKISEENIKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRSPFSSK  575
            N     LK +ITQ+G++S   +K
Sbjct  123  NSETGALKTFITQQGIKSQHQTK  145



>ref|XP_002671925.1| predicted protein [Naegleria gruberi]
 gb|EFC39181.1| predicted protein [Naegleria gruberi]
Length=425

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 92/138 (67%), Gaps = 4/138 (3%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISN  323
            SA+  LN RG  LI+R YRDDV      AFR+ I+  K    CPV+ IG  +F+++R   
Sbjct  3    SAVLILNSRGHTLISRAYRDDVE----TAFRSQILAAKIADRCPVKTIGSVTFMFIRHEE  58

Query  324  VYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYP  503
            +Y++ V   NA+ A  F+F+ + + +F+SYF G F EDA++ NF L+YELLDEI+DFGYP
Sbjct  59   MYLLAVTKQNASAALVFEFLYKLIFIFQSYFDGKFTEDALKENFSLVYELLDEILDFGYP  118

Query  504  QNLSPEILKLYITQEGVR  557
            QN  P++LK  I Q G++
Sbjct  119  QNCEPQVLKNIIVQGGMK  136



>gb|EHJ72965.1| hypothetical protein KGM_11335 [Danaus plexippus]
Length=440

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 96/138 (70%), Gaps = 1/138 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ +N+
Sbjct  4    GLFVYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHIKRANI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+++ + + +SYF G   E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WLAAVTKQNVNAAMVFEFLLKIIDVMQSYF-GKISEENIKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRS  560
            N    +LK +ITQ+G++S
Sbjct  123  NSDTGVLKTFITQQGIKS  140



>dbj|BAE29493.1| unnamed protein product [Mus musculus]
Length=322

 Score =   137 bits (344),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 94/143 (66%), Gaps = 1/143 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ SN+
Sbjct  4    GLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+ +   +  +YF G   E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WLAAVTKQNVNAAMVFEFLYKMCDVMAAYF-GKISEENIKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRSPFSSK  575
            N     LK +ITQ+G++S   +K
Sbjct  123  NSETGALKTFITQQGIKSQHQTK  145



>gb|KHN83994.1| AP-2 complex subunit mu [Toxocara canis]
Length=475

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 99/160 (62%), Gaps = 9/160 (6%)
 Frame = +3

Query  105  RQIYWVA-AMPVAAS-------AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKE  260
            R++YW     P+           ++  N +G+VLI+R+YRDDV  N VDAFR +++  ++
Sbjct  22   RELYWSGLKAPLTQGHGDAMIGGLFVYNHKGEVLISRIYRDDVSRNAVDAFRVNVIHARQ  81

Query  261  LGTCPVRQIGGCSFLYMRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDA  440
                PV  +   SF +++  NV+I  V   N N A  F+F+       +SYF G  +E+ 
Sbjct  82   QVRSPVTNMARTSFFHIKRGNVWICAVTRQNVNAAMVFEFLNRFADTMQSYF-GKLNEEN  140

Query  441  IRNNFVLIYELLDEIMDFGYPQNLSPEILKLYITQEGVRS  560
            ++NNFVLIYELLDEI+DFGYPQN  P +LK +ITQ+GVR+
Sbjct  141  VKNNFVLIYELLDEILDFGYPQNTDPGVLKTFITQQGVRT  180



>gb|EYB96136.1| hypothetical protein Y032_0153g2927 [Ancylostoma ceylanicum]
Length=452

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 93/143 (65%), Gaps = 1/143 (1%)
 Frame = +3

Query  132  PVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYM  311
            P     ++  N +G+VLI+R+YRDDV  N VDAFR +++  ++    PV  +   SF ++
Sbjct  17   PAMIGGLFVYNHKGEVLISRIYRDDVTRNAVDAFRVNVIHARQQVRTPVTNMARTSFFHV  76

Query  312  RISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMD  491
            +  NV+I  V   N N A  F+F+       +SYF G  +E+ ++NNFVLIYELLDEI+D
Sbjct  77   KRGNVWICAVTRQNVNAAMVFEFLNRFADTMQSYF-GKLNEENVKNNFVLIYELLDEILD  135

Query  492  FGYPQNLSPEILKLYITQEGVRS  560
            FGYPQN  P +LK +ITQ+GVR+
Sbjct  136  FGYPQNTDPGVLKTFITQQGVRT  158



>gb|ACH44122.1| putative adaptor-related protein complex 2 mu 1 subunit variant 
2, partial [Taeniopygia guttata]
Length=328

 Score =   137 bits (344),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 94/143 (66%), Gaps = 1/143 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ SN+
Sbjct  4    GLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+ +   +  +YF G   E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WLAAVTKQNVNAAMVFEFLYKMCDVMTAYF-GKISEENIKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRSPFSSK  575
            N     LK +ITQ+G++S   +K
Sbjct  123  NSETGALKTFITQQGIKSQHQTK  145



>ref|XP_009015103.1| hypothetical protein HELRODRAFT_98900 [Helobdella robusta]
 gb|ESO07007.1| hypothetical protein HELRODRAFT_98900 [Helobdella robusta]
Length=422

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 101/149 (68%), Gaps = 2/149 (1%)
 Frame = +3

Query  135  VAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGT-CPVRQIGGCSFLYM  311
            +++S +Y L+L+G VLI+R YR D+  N++D F   +M+ +E G   P+ Q G  SF Y+
Sbjct  1    MSSSVVYILDLKGKVLISRNYRGDIDSNVIDKFMPLVMEKEEEGNVTPIIQHGNVSFAYI  60

Query  312  RISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMD  491
            + +N+Y+V +   NAN+   F+F+ + V +F  YF    +E++IR+NFV+IYELLDE+MD
Sbjct  61   KYNNLYLVSLTKKNANIVMVFQFLHKMVQVFLEYFK-ELEEESIRDNFVIIYELLDELMD  119

Query  492  FGYPQNLSPEILKLYITQEGVRSPFSSKP  578
            FGYPQ    +IL+ YITQEG +   + KP
Sbjct  120  FGYPQTTDSKILQEYITQEGHKLEIAPKP  148



>gb|EYB96137.1| hypothetical protein Y032_0153g2927 [Ancylostoma ceylanicum]
Length=477

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 93/143 (65%), Gaps = 1/143 (1%)
 Frame = +3

Query  132  PVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYM  311
            P     ++  N +G+VLI+R+YRDDV  N VDAFR +++  ++    PV  +   SF ++
Sbjct  42   PAMIGGLFVYNHKGEVLISRIYRDDVTRNAVDAFRVNVIHARQQVRTPVTNMARTSFFHV  101

Query  312  RISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMD  491
            +  NV+I  V   N N A  F+F+       +SYF G  +E+ ++NNFVLIYELLDEI+D
Sbjct  102  KRGNVWICAVTRQNVNAAMVFEFLNRFADTMQSYF-GKLNEENVKNNFVLIYELLDEILD  160

Query  492  FGYPQNLSPEILKLYITQEGVRS  560
            FGYPQN  P +LK +ITQ+GVR+
Sbjct  161  FGYPQNTDPGVLKTFITQQGVRT  183



>gb|EIE89728.1| hypothetical protein RO3G_14439 [Rhizopus delemar RA 99-880]
Length=347

 Score =   137 bits (344),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 94/139 (68%), Gaps = 2/139 (1%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISN  323
            SA +  N +G+VLI+RLYR D+  ++ D FR  ++   ++ + P+  IG  SF ++R  N
Sbjct  3    SAFFIYNQKGEVLISRLYRHDLRRSVADIFRIQVISNTDVRS-PIVTIGSTSFFHVRHEN  61

Query  324  VYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYP  503
            +YIV V   N N A  F+F    V + + YFG  FDE+A++NNFVLIYELLDEI+DFGYP
Sbjct  62   LYIVAVTKWNTNAALVFEFCYRMVNIGRGYFG-KFDEEAVKNNFVLIYELLDEILDFGYP  120

Query  504  QNLSPEILKLYITQEGVRS  560
            QN   + LK+YIT EGV+S
Sbjct  121  QNSETDTLKMYITTEGVKS  139



>gb|KFD56903.1| hypothetical protein M513_02160 [Trichuris suis]
 gb|KHJ47349.1| adaptor complexe medium subunit family protein [Trichuris suis]
Length=433

 Score =   138 bits (347),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 95/138 (69%), Gaps = 1/138 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VL++R+YRDD+G N VDAFR  ++  ++    P+  I   SF +++  N+
Sbjct  4    GLFVYNHKGEVLVSRIYRDDIGRNAVDAFRVSVIHARQQVRSPITVIARTSFFHIKRGNI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N NVA  F+F+ +  A  +SYF G  +E+ +++NFVLIYELLDE++D+GYPQ
Sbjct  64   WLCAVSKQNVNVATVFEFLTKFAATMQSYF-GKLNEENVKSNFVLIYELLDEVLDYGYPQ  122

Query  507  NLSPEILKLYITQEGVRS  560
            N  P +LK +ITQ+G+RS
Sbjct  123  NSDPGVLKTFITQQGIRS  140



>gb|EFX87558.1| hypothetical protein DAPPUDRAFT_306409 [Daphnia pulex]
Length=434

 Score =   138 bits (347),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 95/138 (69%), Gaps = 1/138 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ +N+
Sbjct  4    GLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRANI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N +  F+F+++     +SYFG   +E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WVAAVTKQNVNASMVFEFLLKVTDCMQSYFGKVSEEN-IKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRS  560
            N    +LK +ITQ+G+R+
Sbjct  123  NTDTGVLKTFITQQGIRT  140



>emb|CDW56487.1| AP 2 complex subunit mu [Trichuris trichiura]
Length=433

 Score =   138 bits (347),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 95/138 (69%), Gaps = 1/138 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VL++R+YRDD+G N VDAFR  ++  ++    P+  I   SF +++  N+
Sbjct  4    GLFVYNHKGEVLVSRIYRDDIGRNAVDAFRVSVIHARQQVRSPITVIARTSFFHIKRGNI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N NVA  F+F+ +  A  +SYF G  +E+ +++NFVLIYELLDE++D+GYPQ
Sbjct  64   WLCAVSKQNVNVATVFEFLTKFAATMQSYF-GKLNEENVKSNFVLIYELLDEVLDYGYPQ  122

Query  507  NLSPEILKLYITQEGVRS  560
            N  P +LK +ITQ+G+RS
Sbjct  123  NSDPGVLKTFITQQGIRS  140



>ref|XP_007905949.1| PREDICTED: AP-2 complex subunit mu isoform X1 [Callorhinchus 
milii]
 ref|XP_007905950.1| PREDICTED: AP-2 complex subunit mu isoform X1 [Callorhinchus 
milii]
Length=435

 Score =   138 bits (347),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 94/143 (66%), Gaps = 1/143 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ SN+
Sbjct  4    GLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+ +   +  SYF G   E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WLAAVTKQNVNAAMVFEFLYKMCDVMTSYF-GKISEENIKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRSPFSSK  575
            N     LK +ITQ+G++S   +K
Sbjct  123  NSETGALKTFITQQGIKSQHQTK  145



>ref|XP_308629.2| AGAP007131-PA [Anopheles gambiae str. PEST]
 ref|XP_001845524.1| clathrin coat assembly protein AP50 [Culex quinquefasciatus]
 gb|EAA04151.2| AGAP007131-PA [Anopheles gambiae str. PEST]
 gb|EDS40648.1| clathrin coat assembly protein AP50 [Culex quinquefasciatus]
 gb|ETN63889.1| clathrin coat assembly protein AP50 [Anopheles darlingi]
 gb|KFB50626.1| AGAP007131-PA-like protein [Anopheles sinensis]
Length=438

 Score =   138 bits (347),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 96/138 (70%), Gaps = 1/138 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ +N+
Sbjct  4    GLFVYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHIKRANI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+++ + + +SYF G   E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WLAAVTKQNVNAAMVFEFLLKIIDVMQSYF-GKISEENIKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRS  560
            N    +LK +ITQ+G+++
Sbjct  123  NSDTGVLKTFITQQGIKT  140



>ref|XP_001663168.1| AAEL003106-PA, partial [Aedes aegypti]
 gb|EAT45645.1| AAEL003106-PA, partial [Aedes aegypti]
Length=435

 Score =   138 bits (347),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 96/138 (70%), Gaps = 1/138 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ +N+
Sbjct  1    GLFVYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHIKRANI  60

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+++ + + +SYF G   E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  61   WLAAVTKQNVNAAMVFEFLLKIIDVMQSYF-GKISEENIKNNFVLIYELLDEILDFGYPQ  119

Query  507  NLSPEILKLYITQEGVRS  560
            N    +LK +ITQ+G+++
Sbjct  120  NSDTGVLKTFITQQGIKT  137



>ref|XP_003844294.1| hypothetical protein LEMA_P019450.1 [Leptosphaeria maculans JN3]
 emb|CBY00815.1| hypothetical protein LEMA_P019450.1 [Leptosphaeria maculans JN3]
Length=161

 Score =   132 bits (331),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 93/140 (66%), Gaps = 2/140 (1%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISN  323
            S I   N +G+ LI R +R+D    + D FR  ++   ++ + P+  +G  +F +++  N
Sbjct  3    SGILIFNQKGENLIFRAFRNDCRPRLADVFRIQVISNAQVRS-PILTLGSTTFSHVKHEN  61

Query  324  VYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYP  503
            +Y+V V  +NAN A  F+F+   V L K+YFG  FDE+A++NNFVL+YELLDEI+DFGYP
Sbjct  62   IYLVAVTKSNANAALVFEFLYRLVGLGKAYFG-KFDEEAVKNNFVLVYELLDEILDFGYP  120

Query  504  QNLSPEILKLYITQEGVRSP  563
            QN   + LK+YIT EGV+S 
Sbjct  121  QNTETDTLKMYITTEGVKSE  140



>gb|KGO36057.1| Clathrin adaptor, mu subunit, C-terminal [Penicillium expansum]
 gb|KGO59379.1| Clathrin adaptor, mu subunit, C-terminal [Penicillium expansum]
 gb|KGO59423.1| Clathrin adaptor, mu subunit, C-terminal [Penicillium expansum]
Length=444

 Score =   138 bits (347),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 96/145 (66%), Gaps = 2/145 (1%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISN  323
            S +   N +G+ LI R +R D    + D FR  ++   ++ + P+  +G  +F +++  N
Sbjct  3    SGVLVFNQKGENLIFRAFRSDCRPRLADIFRIQVISNPQVRS-PILTLGSTTFSHVKHEN  61

Query  324  VYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYP  503
            +Y+V V  +NAN A  F+F+   + L KSYFG  FDE+A++NNFVLIYELLDEI+DFGYP
Sbjct  62   IYLVAVTKSNANAALVFEFLYRLIMLGKSYFG-KFDEEAVKNNFVLIYELLDEILDFGYP  120

Query  504  QNLSPEILKLYITQEGVRSPFSSKP  578
            QN  P+ LK+YIT EGV+S  ++ P
Sbjct  121  QNTDPDTLKMYITTEGVKSAIANSP  145



>gb|EJU00787.1| intracellular protein transport-related protein [Dacryopinax 
sp. DJM-731 SS1]
Length=428

 Score =   137 bits (346),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 95/139 (68%), Gaps = 2/139 (1%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISN  323
            S  +  N +G+VLI+RLYR D+  ++ D FR  ++   ++ + P+  +G  SF ++R++N
Sbjct  3    SGFFIFNQKGEVLISRLYRTDLKRSVADVFRVQVVSNTDVRS-PIITLGSTSFFHVRVAN  61

Query  324  VYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYP  503
            VY++ V   N N A  F+F+   +++ KSYFG   DE+A++NNFV+IYEL+DEI+DFGYP
Sbjct  62   VYVLAVTKCNTNAALVFEFIYRFISIAKSYFG-KLDEEAVKNNFVMIYELIDEILDFGYP  120

Query  504  QNLSPEILKLYITQEGVRS  560
            QN   E LK YIT E VRS
Sbjct  121  QNSEIETLKHYITSESVRS  139



>ref|XP_001259892.1| AP-2 adaptor complex subunit mu, putative [Neosartorya fischeri 
NRRL 181]
 gb|EAW17995.1| AP-2 adaptor complex subunit mu, putative [Neosartorya fischeri 
NRRL 181]
Length=460

 Score =   138 bits (347),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 96/145 (66%), Gaps = 2/145 (1%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISN  323
            S I   N +G+ LI R +R+D    + D FR  ++   ++ + P+  +G  +F +++  N
Sbjct  3    SGILVFNQKGENLIFRAFRNDCRPRLADIFRIQVISNPQVRS-PILTLGSTTFSHVKHEN  61

Query  324  VYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYP  503
            +Y+V V  +NAN A  F+F+   V L KSYFG  FDE+A++NNFVLIYELLDEI+DFGYP
Sbjct  62   IYLVAVTKSNANAALVFEFLYRLVLLGKSYFG-KFDEEAVKNNFVLIYELLDEILDFGYP  120

Query  504  QNLSPEILKLYITQEGVRSPFSSKP  578
            QN  P+ LK+YIT EGV+S   + P
Sbjct  121  QNTDPDTLKMYITTEGVKSAIVNNP  145



>emb|CEI97932.1| Putative Adaptor complexes medium subunit family [Rhizopus microsporus]
Length=291

 Score =   135 bits (339),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 94/140 (67%), Gaps = 2/140 (1%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISN  323
            SA +  N +G+VLI+RLYR D+  ++ D FR  ++   ++ + P+  IG  +F ++R  N
Sbjct  3    SAFFIYNQKGEVLISRLYRHDLRRSVADIFRIQVISNTDVRS-PIVTIGSTTFFHVRHEN  61

Query  324  VYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYP  503
            +YIV V   N N A  F+F    V + + YFG  FDE+A++NNFVLIYELLDEI+DFGYP
Sbjct  62   LYIVAVSKWNTNAALVFEFCYRVVNIGRGYFG-KFDEEAVKNNFVLIYELLDEILDFGYP  120

Query  504  QNLSPEILKLYITQEGVRSP  563
            QN   + LK+YIT EGV+S 
Sbjct  121  QNSETDTLKMYITTEGVKSE  140



>ref|XP_011267285.1| PREDICTED: AP-2 complex subunit mu [Camponotus floridanus]
 gb|EFN60783.1| AP-2 complex subunit mu-1 [Camponotus floridanus]
Length=442

 Score =   137 bits (346),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 95/138 (69%), Gaps = 1/138 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ +N+
Sbjct  4    GLFVYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHIKRANI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+ +++ + + +SYF G   E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WLAAVTKQNVNAAMVFELLLKIIDVMQSYF-GKISEENIKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRS  560
            N    +LK +ITQ+GV+S
Sbjct  123  NCDTGVLKTFITQQGVKS  140



>ref|XP_011304989.1| PREDICTED: AP-2 complex subunit mu [Fopius arisanus]
Length=441

 Score =   137 bits (346),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 95/138 (69%), Gaps = 1/138 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ +N+
Sbjct  4    GLFVYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHIKRANI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+++   + +SYF G   E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WLAAVTKQNVNAAMVFEFLLKINDVMQSYF-GKISEENIKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRS  560
            N    +LK +ITQ+GV+S
Sbjct  123  NCDTGVLKTFITQQGVKS  140



>ref|XP_003138186.1| shorter than wild-type protein 23 [Loa loa]
Length=447

 Score =   137 bits (346),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 92/138 (67%), Gaps = 1/138 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDDV  N VDAFR +++  ++    PV  +   SF +++  NV
Sbjct  4    GLFVYNHKGEVLISRIYRDDVSRNAVDAFRVNVIHARQQVRSPVTNMARTSFFHIKRGNV  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            +I  V   N N A  F+F+       +SYF G  +E+ ++NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WICAVTRQNVNAAMVFEFLNRFADTMQSYF-GKLNEENVKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRS  560
            N  P +LK +ITQ+GVR+
Sbjct  123  NTDPGVLKTFITQQGVRT  140



>ref|XP_011141784.1| PREDICTED: AP-2 complex subunit mu [Harpegnathos saltator]
 ref|XP_011141791.1| PREDICTED: AP-2 complex subunit mu [Harpegnathos saltator]
 gb|EFN89426.1| AP-2 complex subunit mu-1 [Harpegnathos saltator]
Length=442

 Score =   137 bits (346),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 95/138 (69%), Gaps = 1/138 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ +N+
Sbjct  4    GLFVYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHIKRANI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+ +++ + + +SYF G   E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WLAAVTKQNVNAAMVFELLLKIIDVMQSYF-GKISEENIKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRS  560
            N    +LK +ITQ+GV+S
Sbjct  123  NCDTGVLKTFITQQGVKS  140



>gb|EFO25885.2| AP-2 complex subunit mu [Loa loa]
Length=435

 Score =   137 bits (346),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 92/138 (67%), Gaps = 1/138 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDDV  N VDAFR +++  ++    PV  +   SF +++  NV
Sbjct  4    GLFVYNHKGEVLISRIYRDDVSRNAVDAFRVNVIHARQQVRSPVTNMARTSFFHIKRGNV  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            +I  V   N N A  F+F+       +SYF G  +E+ ++NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WICAVTRQNVNAAMVFEFLNRFADTMQSYF-GKLNEENVKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRS  560
            N  P +LK +ITQ+GVR+
Sbjct  123  NTDPGVLKTFITQQGVRT  140



>ref|XP_008558828.1| PREDICTED: AP-2 complex subunit mu [Microplitis demolitor]
Length=442

 Score =   137 bits (346),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 95/138 (69%), Gaps = 1/138 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ +N+
Sbjct  4    GLFVYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHIKRANI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+++   + +SYF G   E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WLAAVTKQNVNAAMVFEFLLKINDVMQSYF-GKISEENIKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRS  560
            N    +LK +ITQ+GV+S
Sbjct  123  NCDTGVLKTFITQQGVKS  140



>ref|XP_011053672.1| PREDICTED: AP-2 complex subunit mu [Acromyrmex echinatior]
 gb|EGI65878.1| AP-2 complex subunit mu-1 [Acromyrmex echinatior]
Length=442

 Score =   137 bits (346),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 95/138 (69%), Gaps = 1/138 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ +N+
Sbjct  4    GLFVYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHIKRANI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+ +++ + + +SYF G   E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WLAAVTKQNVNAAMVFELLLKIIDVMQSYF-GKISEENIKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRS  560
            N    +LK +ITQ+GV+S
Sbjct  123  NCDTGVLKTFITQQGVKS  140



>ref|XP_011164437.1| PREDICTED: AP-2 complex subunit mu [Solenopsis invicta]
 ref|XP_011347994.1| PREDICTED: AP-2 complex subunit mu [Cerapachys biroi]
 gb|EFZ15149.1| hypothetical protein SINV_02143 [Solenopsis invicta]
 gb|EZA48575.1| AP-2 complex subunit mu-1 [Cerapachys biroi]
Length=442

 Score =   137 bits (346),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 95/138 (69%), Gaps = 1/138 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ +N+
Sbjct  4    GLFVYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHIKRANI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+ +++ + + +SYF G   E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WLAAVTKQNVNAAMVFELLLKIIDVMQSYF-GKISEENIKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRS  560
            N    +LK +ITQ+GV+S
Sbjct  123  NCDTGVLKTFITQQGVKS  140



>ref|XP_003118234.1| CRE-DPY-23 protein [Caenorhabditis remanei]
 gb|EFO82832.1| CRE-DPY-23 protein [Caenorhabditis remanei]
 emb|CAP32975.2| Protein CBR-DPY-23 [Caenorhabditis briggsae]
 gb|EGT30167.1| CBN-DPY-23 protein [Caenorhabditis brenneri]
Length=435

 Score =   137 bits (345),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 92/138 (67%), Gaps = 1/138 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDDV  N VDAFR +++  ++    PV  +   SF +++  NV
Sbjct  4    GLFVYNHKGEVLISRIYRDDVTRNAVDAFRVNVIHARQQVRSPVTNMARTSFFHVKRGNV  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            +I  V   N N A  F+F+       +SYF G  +E+ ++NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WICAVTRQNVNAAMVFEFLKRFADTMQSYF-GKLNEENVKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRS  560
            N  P +LK +ITQ+GVR+
Sbjct  123  NTDPGVLKTFITQQGVRT  140



>ref|NP_001024865.1| Protein DPY-23, isoform b [Caenorhabditis elegans]
 emb|CCD68419.1| DPY-23, isoform b [Caenorhabditis elegans]
Length=435

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 92/138 (67%), Gaps = 1/138 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDDV  N VDAFR +++  ++    PV  +   SF +++  NV
Sbjct  4    GLFVYNHKGEVLISRIYRDDVTRNAVDAFRVNVIHARQQVRSPVTNMARTSFFHVKRGNV  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            +I  V   N N A  F+F+       +SYF G  +E+ ++NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WICAVTRQNVNAAMVFEFLKRFADTMQSYF-GKLNEENVKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRS  560
            N  P +LK +ITQ+GVR+
Sbjct  123  NTDPGVLKTFITQQGVRT  140



>ref|NP_741770.1| Protein DPY-23, isoform a [Caenorhabditis elegans]
 sp|P35603.2|AP2M_CAEEL RecName: Full=AP-2 complex subunit mu; AltName: Full=Clathrin 
assembly protein complex 2 mu medium chain; AltName: Full=Clathrin 
coat assembly protein AP50; AltName: Full=Clathrin coat-associated 
protein AP50; AltName: Full=Mu2-adaptin; AltName: 
Full=Plasma membrane adaptor AP-2 50 kDa protein; AltName: 
Full=Protein dumpy-23 [Caenorhabditis elegans]
 emb|CCD68418.1| DPY-23, isoform a [Caenorhabditis elegans]
Length=441

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 94/144 (65%), Gaps = 1/144 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDDV  N VDAFR +++  ++    PV  +   SF +++  NV
Sbjct  4    GLFVYNHKGEVLISRIYRDDVTRNAVDAFRVNVIHARQQVRSPVTNMARTSFFHVKRGNV  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            +I  V   N N A  F+F+       +SYF G  +E+ ++NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WICAVTRQNVNAAMVFEFLKRFADTMQSYF-GKLNEENVKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRSPFSSKP  578
            N  P +LK +ITQ+GVR+  +  P
Sbjct  123  NTDPGVLKTFITQQGVRTADAPVP  146



>emb|CDS12488.1| hypothetical protein LRAMOSA04682 [Absidia idahoensis var. thermophila]
Length=428

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 95/139 (68%), Gaps = 2/139 (1%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISN  323
            SA +  N +G+VLI+RLYR D+  ++ D FR  ++   ++ + P+  +G  SF ++R  N
Sbjct  3    SAFFIYNQKGEVLISRLYRHDLKRSVADIFRIQVISNTDVRS-PIITLGSTSFFHVRHEN  61

Query  324  VYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYP  503
            +YIV V   NAN A  F+F    V +  SYFG  FDE+A++NNFVLIYELLDEI+DFGYP
Sbjct  62   LYIVAVTRWNANAALIFEFCYRVVNIGLSYFG-KFDEEAVKNNFVLIYELLDEILDFGYP  120

Query  504  QNLSPEILKLYITQEGVRS  560
            QN   + LK+YIT EGV+S
Sbjct  121  QNSETDTLKMYITTEGVKS  139



>emb|CDH58383.1| ap-2 complex subunit mu-1 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=428

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 95/139 (68%), Gaps = 2/139 (1%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISN  323
            SA +  N +G+VLI+RLYR D+  ++ D FR  ++   ++ + P+  +G  SF ++R  N
Sbjct  3    SAFFIYNQKGEVLISRLYRHDLKRSVADIFRIQVISNTDVRS-PIITLGSTSFFHVRHEN  61

Query  324  VYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYP  503
            +YIV V   NAN A  F+F    V +  SYFG  FDE+A++NNFVLIYELLDEI+DFGYP
Sbjct  62   LYIVAVTRWNANAALIFEFCYRVVNIGLSYFG-KFDEEAVKNNFVLIYELLDEILDFGYP  120

Query  504  QNLSPEILKLYITQEGVRS  560
            QN   + LK+YIT EGV+S
Sbjct  121  QNSETDTLKMYITTEGVKS  139



>emb|CDQ69254.1| unnamed protein product [Oncorhynchus mykiss]
Length=228

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/139 (45%), Positives = 91/139 (65%), Gaps = 1/139 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ SN+
Sbjct  4    GLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+ +   +  +YF G   E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WLAAVTKQNVNAAMVFEFLYKMCDVMTAYF-GKISEENIKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRSP  563
            N     LK +ITQ G++S 
Sbjct  123  NSETGALKTFITQTGIKSQ  141



>gb|KEY78854.1| AP 2 adaptor complex subunit mu [Aspergillus fumigatus var. RP-2014]
Length=445

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 95/145 (66%), Gaps = 2/145 (1%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISN  323
            S I   N +G+ LI R +R D    + D FR  ++   ++ + P+  +G  +F +++  N
Sbjct  3    SGILVFNQKGENLIFRAFRSDCRPRLADIFRIQVISNPQVRS-PILTLGSTTFSHVKHEN  61

Query  324  VYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYP  503
            +Y+V V  +NAN A  F+F+   V L KSYFG  FDE+A++NNFVLIYELLDEI+DFGYP
Sbjct  62   IYLVAVTKSNANAALVFEFLYRLVLLGKSYFG-KFDEEAVKNNFVLIYELLDEILDFGYP  120

Query  504  QNLSPEILKLYITQEGVRSPFSSKP  578
            QN  P+ LK+YIT EGV+S   + P
Sbjct  121  QNTDPDTLKMYITTEGVKSAIVNNP  145



>gb|ACO08109.1| AP-2 complex subunit mu-1 [Oncorhynchus mykiss]
Length=438

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 94/143 (66%), Gaps = 1/143 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ SN+
Sbjct  4    GLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++ +V   N N A  F+F+ +   +  SYF G   E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WLAVVTKQNVNAAMVFEFLYKMCDVMASYF-GKISEENIKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRSPFSSK  575
            N     LK +ITQ+G++    +K
Sbjct  123  NSETGSLKTFITQQGIKGQHQTK  145



>ref|XP_753843.1| AP-2 adaptor complex subunit mu [Aspergillus fumigatus Af293]
 gb|EAL91805.1| AP-2 adaptor complex subunit mu, putative [Aspergillus fumigatus 
Af293]
 gb|EDP51536.1| AP-2 adaptor complex subunit mu, putative [Aspergillus fumigatus 
A1163]
Length=445

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 95/145 (66%), Gaps = 2/145 (1%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISN  323
            S I   N +G+ LI R +R D    + D FR  ++   ++ + P+  +G  +F +++  N
Sbjct  3    SGILVFNQKGENLIFRAFRSDCRPRLADIFRIQVISNPQVRS-PILTLGSTTFSHVKHEN  61

Query  324  VYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYP  503
            +Y+V V  +NAN A  F+F+   V L KSYFG  FDE+A++NNFVLIYELLDEI+DFGYP
Sbjct  62   IYLVAVTKSNANAALVFEFLYRLVLLGKSYFG-KFDEEAVKNNFVLIYELLDEILDFGYP  120

Query  504  QNLSPEILKLYITQEGVRSPFSSKP  578
            QN  P+ LK+YIT EGV+S   + P
Sbjct  121  QNTDPDTLKMYITTEGVKSAIVNNP  145



>ref|XP_002644536.1| C. briggsae CBR-DPY-23 protein [Caenorhabditis briggsae]
Length=441

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 92/138 (67%), Gaps = 1/138 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDDV  N VDAFR +++  ++    PV  +   SF +++  NV
Sbjct  4    GLFVYNHKGEVLISRIYRDDVTRNAVDAFRVNVIHARQQVRSPVTNMARTSFFHVKRGNV  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            +I  V   N N A  F+F+       +SYF G  +E+ ++NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WICAVTRQNVNAAMVFEFLKRFADTMQSYF-GKLNEENVKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRS  560
            N  P +LK +ITQ+GVR+
Sbjct  123  NTDPGVLKTFITQQGVRT  140



>ref|XP_003323240.2| hypothetical protein PGTG_04777 [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
 gb|EFP78821.2| hypothetical protein PGTG_04777 [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
Length=432

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 97/139 (70%), Gaps = 2/139 (1%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISN  323
            SA++ LN +G+VLI++L+R D+  ++ D FR H++   ++ + P+  +G  SF ++R  N
Sbjct  3    SALFILNQKGEVLISKLFRPDLKRSIADIFRIHVISNPDVRS-PIITLGSTSFFHVRHQN  61

Query  324  VYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYP  503
            +Y+  V  TNAN A  F+ +   + + KSYFG   DE+AI+NNFV+IYELLDEI+DFGYP
Sbjct  62   LYLTAVTKTNANAAIVFELLYRIINIAKSYFGKV-DEEAIKNNFVMIYELLDEILDFGYP  120

Query  504  QNLSPEILKLYITQEGVRS  560
            QN   + LK+YIT E ++S
Sbjct  121  QNSEIDTLKMYITTESIKS  139



>ref|XP_004415189.1| PREDICTED: AP-2 complex subunit mu-like [Odobenus rosmarus divergens]
Length=472

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 95/153 (62%), Gaps = 1/153 (1%)
 Frame = +3

Query  117  WVAAMPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGC  296
            W          ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   
Sbjct  29   WDLETAAVIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVHSPVTNITRT  88

Query  297  SFLYMRISNVYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELL  476
            SF +++ SN+++  V   N N A  F+F+ +   +  +YF G   E+ I+NNFVLIYELL
Sbjct  89   SFFHVKRSNIWLAAVTKQNVNAAMVFEFLYKRCDVMAAYF-GKISEENIKNNFVLIYELL  147

Query  477  DEIMDFGYPQNLSPEILKLYITQEGVRSPFSSK  575
            DEI+DFGYPQN     LK +ITQ+G++S   +K
Sbjct  148  DEILDFGYPQNSETGALKTFITQQGIKSQHQTK  180



>pir||T33569 hypothetical protein R160.1 - Caenorhabditis elegans
Length=493

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 92/138 (67%), Gaps = 1/138 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDDV  N VDAFR +++  ++    PV  +   SF +++  NV
Sbjct  4    GLFVYNHKGEVLISRIYRDDVTRNAVDAFRVNVIHARQQVRSPVTNMARTSFFHVKRGNV  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            +I  V   N N A  F+F+       +SYF G  +E+ ++NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WICAVTRQNVNAAMVFEFLKRFADTMQSYF-GKLNEENVKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRS  560
            N  P +LK +ITQ+GVR+
Sbjct  123  NTDPGVLKTFITQQGVRT  140



>emb|CDM36002.1| AP-2 complex subunit mu [Penicillium roqueforti FM164]
Length=444

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 95/145 (66%), Gaps = 2/145 (1%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISN  323
            S I   N +G+ LI R +R D    + D FR  ++   ++ + P+  +G  +F +++  N
Sbjct  3    SGILIFNQKGENLIFRAFRSDCRPRLADIFRIQVISNPQVRS-PILTLGSTTFSHVKHEN  61

Query  324  VYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYP  503
            +Y+V V  +NAN A  F+F+   V L KSYFG   DE+A++NNFVLIYELLDEI+DFGYP
Sbjct  62   IYLVAVTKSNANAALIFEFLYRLVMLGKSYFG-KLDEEAVKNNFVLIYELLDEILDFGYP  120

Query  504  QNLSPEILKLYITQEGVRSPFSSKP  578
            QN  P+ LK+YIT EGV+S  ++ P
Sbjct  121  QNTDPDTLKMYITTEGVKSAITNSP  145



>emb|CDP94571.1| Protein BM-DPY-23, isoform b [Brugia malayi]
Length=435

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 92/138 (67%), Gaps = 1/138 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDDV  N VDAFR +++  ++    PV  +   SF +++  NV
Sbjct  4    GLFVYNHKGEVLISRIYRDDVSRNAVDAFRVNVIHARQQVRSPVTNMARTSFFHIKRGNV  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            +I  V   N N A  F+F+       +SYF G  +E+ ++NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WICAVTRQNINAAMVFEFLNRFADTMQSYF-GKLNEENVKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRS  560
            N  P +LK +ITQ+GVR+
Sbjct  123  NTDPGVLKTFITQQGVRT  140



>ref|XP_004003146.1| PREDICTED: AP-2 complex subunit mu isoform 1 [Ovis aries]
Length=431

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 94/143 (66%), Gaps = 1/143 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ SN+
Sbjct  4    GLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+ +   +  +YF G   E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WLAAVTKQNVNAAMVFEFLYKMCDVMAAYF-GKISEENIKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRSPFSSK  575
            N     LK +ITQ+G++S   +K
Sbjct  123  NSETGALKTFITQQGIKSQHQTK  145



>ref|XP_001899245.1| Dumpy : shorter than wild-type protein 23, isoform b [Brugia 
malayi]
 gb|EJW88310.1| AP-2 complex subunit mu [Wuchereria bancrofti]
Length=435

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 92/138 (67%), Gaps = 1/138 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDDV  N VDAFR +++  ++    PV  +   SF +++  NV
Sbjct  4    GLFVYNHKGEVLISRIYRDDVSRNAVDAFRVNVIHARQQVRSPVTNMARTSFFHIKRGNV  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            +I  V   N N A  F+F+       +SYF G  +E+ ++NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WICAVTRQNINAAMVFEFLNRFADTMQSYF-GKLNEENVKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRS  560
            N  P +LK +ITQ+GVR+
Sbjct  123  NTDPGVLKTFITQQGVRT  140



>ref|XP_004997970.1| hypothetical protein PTSG_01983 [Salpingoeca rosetta]
 gb|EGD79014.1| hypothetical protein PTSG_01983 [Salpingoeca rosetta]
Length=440

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 94/136 (69%), Gaps = 1/136 (1%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISN  323
            S ++  N +GD +I+R+YRDD+  ++VDAFR H++ ++     PV  IG  S+ +M+  N
Sbjct  3    SGVFVYNNKGDCIISRIYRDDITRSVVDAFRVHVIHSRHEIRSPVTNIGRTSYFHMKREN  62

Query  324  VYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYP  503
            +++V V   NAN A  F+++ + + L  SYF G F+E  ++NNF LIYELLDE++D+GYP
Sbjct  63   LWLVTVTRLNANAAMVFEYMAKFIELTSSYF-GQFNELNVKNNFSLIYELLDEVIDYGYP  121

Query  504  QNLSPEILKLYITQEG  551
            Q+  P +LKL ITQEG
Sbjct  122  QSTDPNVLKLLITQEG  137



>gb|KGO77934.1| Clathrin coat associated protein AP-50 [Penicillium italicum]
Length=444

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 95/145 (66%), Gaps = 2/145 (1%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISN  323
            S I   N +G+ LI R +R D    + D FR  ++   ++ + P+  +G  +F +++  N
Sbjct  3    SGILIFNQKGENLIFRAFRSDCRPRLADIFRIQVISNPQVRS-PILTLGSTTFSHVKHEN  61

Query  324  VYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYP  503
            +Y+V V  +NAN A  F+F+   V L KSYFG   DE+A++NNFVLIYELLDEI+DFGYP
Sbjct  62   IYLVAVTKSNANAALVFEFLYRLVMLGKSYFG-KLDEEAVKNNFVLIYELLDEILDFGYP  120

Query  504  QNLSPEILKLYITQEGVRSPFSSKP  578
            QN  P+ LK+YIT EGV+S  ++ P
Sbjct  121  QNTDPDTLKMYITTEGVKSAIANSP  145



>ref|XP_006260842.1| PREDICTED: AP-2 complex subunit mu isoform X1 [Alligator mississippiensis]
Length=435

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 94/143 (66%), Gaps = 1/143 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ SN+
Sbjct  4    GLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+ +   +  +YF G   E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WLAAVTKQNVNAAMVFEFLYKMCDVMTAYF-GKISEENIKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRSPFSSK  575
            N     LK +ITQ+G++S   +K
Sbjct  123  NSETGALKTFITQQGIKSQHQTK  145



>ref|XP_007529878.1| PREDICTED: AP-2 complex subunit mu [Erinaceus europaeus]
Length=529

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 94/143 (66%), Gaps = 1/143 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ SN+
Sbjct  4    GLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+ +   +  +YF G   E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WLAAVTKQNVNAAMVFEFLYKMCDVMAAYF-GKISEENIKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRSPFSSK  575
            N     LK +ITQ+G++S   +K
Sbjct  123  NSETGALKTFITQQGIKSQHQTK  145



>ref|XP_002565488.1| Pc22g15720 [Penicillium rubens Wisconsin 54-1255]
 emb|CAP98860.1| Pc22g15720 [Penicillium rubens Wisconsin 54-1255]
Length=509

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 95/145 (66%), Gaps = 2/145 (1%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISN  323
            S I   N +G+ LI R +R D    + D FR  ++   ++ + P+  +G  +F +++  N
Sbjct  3    SGILIFNQKGENLIFRAFRSDCRPRLADIFRIQVISNPQVRS-PILTLGSTTFSHVKHEN  61

Query  324  VYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYP  503
            +Y+V V  +NAN A  F+F+   V L KSYFG   DE+A++NNFVLIYELLDEI+DFGYP
Sbjct  62   IYLVAVTKSNANAALVFEFLYRLVMLGKSYFG-KLDEEAVKNNFVLIYELLDEILDFGYP  120

Query  504  QNLSPEILKLYITQEGVRSPFSSKP  578
            QN  P+ LK+YIT EGV+S  ++ P
Sbjct  121  QNTDPDTLKMYITTEGVKSAIANSP  145



>ref|XP_009973139.1| PREDICTED: AP-2 complex subunit mu isoform X2 [Tyto alba]
Length=430

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 94/143 (66%), Gaps = 1/143 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ SN+
Sbjct  4    GLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+ +   +  +YF G   E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WLAAVTKQNVNAAMVFEFLYKMCDVMTAYF-GKISEENIKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRSPFSSK  575
            N     LK +ITQ+G++S   +K
Sbjct  123  NSETGALKTFITQQGIKSQHQTK  145



>dbj|BAE40329.1| unnamed protein product [Mus musculus]
Length=435

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 94/143 (66%), Gaps = 1/143 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ SN+
Sbjct  4    GLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+ +   +  +YF G   E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WLAAVTKQNVNAAMVFEFLYKMCDVMAAYF-GKISEENIKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRSPFSSK  575
            N     LK +ITQ+G++S   +K
Sbjct  123  NSETGALKTFITQQGIKSQHQTK  145



>ref|NP_988975.1| AP-2 complex subunit mu [Xenopus (Silurana) tropicalis]
 sp|Q6P856.1|AP2M1_XENTR RecName: Full=AP-2 complex subunit mu; AltName: Full=AP-2 mu 
chain; AltName: Full=Clathrin assembly protein complex 2 mu 
medium chain; AltName: Full=Clathrin coat assembly protein AP50; 
AltName: Full=Clathrin coat-associated protein AP50; AltName: 
Full=Mu2-adaptin; AltName: Full=Plasma membrane adaptor 
AP-2 50 kDa protein [Xenopus (Silurana) tropicalis]
 gb|AAH61374.1| adaptor protein complex AP-2, mu1 [Xenopus (Silurana) tropicalis]
Length=435

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 94/143 (66%), Gaps = 1/143 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ SN+
Sbjct  4    GLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+ +   +  +YF G   E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WLAAVTKQNVNAAMVFEFLYKMCDVMTAYF-GKISEENIKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRSPFSSK  575
            N     LK +ITQ+G++S   +K
Sbjct  123  NSETGALKTFITQQGIKSQHQTK  145



>ref|XP_007431580.1| PREDICTED: AP-2 complex subunit mu isoform X2 [Python bivittatus]
Length=439

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 94/143 (66%), Gaps = 1/143 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ SN+
Sbjct  4    GLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+ +   +  +YF G   E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WLAAVTKQNVNAAMVFEFLYKMCDVMTAYF-GKISEENIKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRSPFSSK  575
            N     LK +ITQ+G++S   +K
Sbjct  123  NSETGALKTFITQQGIKSQHQTK  145



>ref|XP_003224375.1| PREDICTED: AP-2 complex subunit mu [Anolis carolinensis]
 ref|XP_004176815.1| PREDICTED: AP-2 complex subunit mu [Taeniopygia guttata]
 ref|XP_005022499.1| PREDICTED: AP-2 complex subunit mu isoform X2 [Anas platyrhynchos]
 ref|XP_005051259.1| PREDICTED: AP-2 complex subunit mu isoform X7 [Ficedula albicollis]
 ref|XP_005142340.1| PREDICTED: AP-2 complex subunit mu isoform X1 [Melopsittacus 
undulatus]
 ref|XP_005235579.1| PREDICTED: AP-2 complex subunit mu isoform X2 [Falco peregrinus]
 ref|XP_005284084.1| PREDICTED: AP-2 complex subunit mu isoform X4 [Chrysemys picta 
bellii]
 ref|XP_005438518.1| PREDICTED: AP-2 complex subunit mu isoform X2 [Falco cherrug]
 ref|XP_005484922.1| PREDICTED: AP-2 complex subunit mu isoform X6 [Zonotrichia albicollis]
 ref|XP_005419034.1| PREDICTED: AP-2 complex subunit mu isoform X2 [Geospiza fortis]
 ref|XP_005506665.1| PREDICTED: AP-2 complex subunit mu isoform X1 [Columba livia]
 ref|XP_006017171.1| PREDICTED: AP-2 complex subunit mu isoform X1 [Alligator sinensis]
 ref|XP_006138515.1| PREDICTED: AP-2 complex subunit mu isoform X1 [Pelodiscus sinensis]
 ref|XP_006138516.1| PREDICTED: AP-2 complex subunit mu isoform X2 [Pelodiscus sinensis]
 ref|XP_007068679.1| PREDICTED: AP-2 complex subunit mu isoform X2 [Chelonia mydas]
 ref|XP_007431583.1| PREDICTED: AP-2 complex subunit mu isoform X5 [Python bivittatus]
 ref|XP_008642749.1| PREDICTED: AP-2 complex subunit mu isoform X2 [Corvus brachyrhynchos]
 ref|XP_008922734.1| PREDICTED: AP-2 complex subunit mu isoform X2 [Manacus vitellinus]
 ref|XP_009076326.1| PREDICTED: AP-2 complex subunit mu isoform X2 [Acanthisitta chloris]
 ref|XP_009087337.1| PREDICTED: AP-2 complex subunit mu isoform X2 [Serinus canaria]
 ref|XP_009489955.1| PREDICTED: AP-2 complex subunit mu isoform X2 [Pelecanus crispus]
 ref|XP_009466684.1| PREDICTED: AP-2 complex subunit mu isoform X2 [Nipponia nippon]
 ref|XP_009508678.1| PREDICTED: AP-2 complex subunit mu isoform X2 [Phalacrocorax 
carbo]
 ref|XP_009557546.1| PREDICTED: AP-2 complex subunit mu isoform X2 [Cuculus canorus]
 ref|XP_009577248.1| PREDICTED: AP-2 complex subunit mu isoform X2 [Fulmarus glacialis]
 ref|XP_009680483.1| PREDICTED: AP-2 complex subunit mu isoform X2 [Struthio camelus 
australis]
 ref|XP_009632682.1| PREDICTED: AP-2 complex subunit mu isoform X2 [Egretta garzetta]
 ref|XP_009819729.1| PREDICTED: AP-2 complex subunit mu isoform X2 [Gavia stellata]
 ref|XP_009698037.1| PREDICTED: AP-2 complex subunit mu isoform X2 [Cariama cristata]
 ref|XP_009863265.1| PREDICTED: AP-2 complex subunit mu isoform X2 [Apaloderma vittatum]
 ref|XP_009881624.1| PREDICTED: AP-2 complex subunit mu isoform X2 [Charadrius vociferus]
 ref|XP_009901830.1| PREDICTED: AP-2 complex subunit mu isoform X2 [Picoides pubescens]
 ref|XP_009929539.1| PREDICTED: AP-2 complex subunit mu isoform X2 [Opisthocomus hoazin]
 ref|XP_010022878.1| PREDICTED: AP-2 complex subunit mu isoform X2 [Nestor notabilis]
 ref|XP_009977785.1| PREDICTED: AP-2 complex subunit mu isoform X2 [Tauraco erythrolophus]
 ref|XP_009997830.1| PREDICTED: AP-2 complex subunit mu isoform X2 [Chaetura pelagica]
 ref|XP_010153563.1| PREDICTED: AP-2 complex subunit mu isoform X2 [Eurypyga helias]
 ref|XP_010170211.1| PREDICTED: AP-2 complex subunit mu isoform X2 [Caprimulgus carolinensis]
 ref|XP_010071797.1| PREDICTED: AP-2 complex subunit mu isoform X2 [Pterocles gutturalis]
 ref|XP_010187809.1| PREDICTED: AP-2 complex subunit mu isoform X2 [Mesitornis unicolor]
 ref|XP_010121887.1| PREDICTED: AP-2 complex subunit mu isoform X2 [Chlamydotis macqueenii]
 ref|XP_010224097.1| PREDICTED: AP-2 complex subunit mu isoform X3 [Tinamus guttatus]
 ref|XP_010281319.1| PREDICTED: AP-2 complex subunit mu isoform X2 [Phaethon lepturus]
 ref|XP_010300005.1| PREDICTED: AP-2 complex subunit mu isoform X2 [Balearica regulorum 
gibbericeps]
 ref|XP_010395573.1| PREDICTED: AP-2 complex subunit mu isoform X6 [Corvus cornix 
cornix]
Length=435

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 94/143 (66%), Gaps = 1/143 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ SN+
Sbjct  4    GLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+ +   +  +YF G   E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WLAAVTKQNVNAAMVFEFLYKMCDVMTAYF-GKISEENIKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRSPFSSK  575
            N     LK +ITQ+G++S   +K
Sbjct  123  NSETGALKTFITQQGIKSQHQTK  145



>dbj|BAA09762.2| KIAA0109 [Homo sapiens]
Length=438

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 94/143 (66%), Gaps = 1/143 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ SN+
Sbjct  7    GLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNI  66

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+ +   +  +YF G   E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  67   WLAAVTKQNVNAAMVFEFLYKMCDVMAAYF-GKISEENIKNNFVLIYELLDEILDFGYPQ  125

Query  507  NLSPEILKLYITQEGVRSPFSSK  575
            N     LK +ITQ+G++S   +K
Sbjct  126  NSETGALKTFITQQGIKSQHQTK  148



>emb|CAH93147.1| hypothetical protein [Pongo abelii]
Length=435

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 94/143 (66%), Gaps = 1/143 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ SN+
Sbjct  4    GLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+ +   +  +YF G   E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WLAAVTKQNVNAAMVFEFLYKMCDVMAAYF-GKISEENIKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRSPFSSK  575
            N     LK +ITQ+G++S   +K
Sbjct  123  NSETGALKTFITQQGIKSQHQTK  145



>ref|XP_005909584.1| PREDICTED: AP-2 complex subunit mu isoform X1 [Bos mutus]
Length=435

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 94/143 (66%), Gaps = 1/143 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ SN+
Sbjct  4    GLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+ +   +  +YF G   E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WLAAVTKQNVNAAMVFEFLYKMCDVMAAYF-GKISEENIKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRSPFSSK  575
            N     LK +ITQ+G++S   +K
Sbjct  123  NSETGALKTFITQQGIKSQHQTK  145



>ref|XP_006637891.1| PREDICTED: AP-2 complex subunit mu-like isoform X1 [Lepisosteus 
oculatus]
Length=435

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 94/143 (66%), Gaps = 1/143 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ SN+
Sbjct  4    GLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+ +   +  +YF G   E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WLAAVTKQNVNAAMVFEFLYKMCDVMTAYF-GKISEENIKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRSPFSSK  575
            N     LK +ITQ+G++S   +K
Sbjct  123  NSETGALKTFITQQGIKSQHQTK  145



>gb|KIK46523.1| hypothetical protein CY34DRAFT_401490 [Suillus luteus UH-Slu-Lm8-n1]
Length=220

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 94/140 (67%), Gaps = 2/140 (1%)
 Frame = +3

Query  144  SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISN  323
            SA +  N +G+VLI+RLYR D   ++ D FR  ++   ++ + P+  +G  SF ++R++N
Sbjct  3    SAFFIFNQKGEVLISRLYRTDFKRSIADVFRIQVVSNSDVRS-PIITLGSTSFFHVRVNN  61

Query  324  VYIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYP  503
            +Y+V V  TNAN A  F+F    +++ KSYFG   DE++++NNFVLIYEL+DEI D+GYP
Sbjct  62   LYVVCVTKTNANAALVFEFCYRFISIAKSYFGKV-DEESVKNNFVLIYELIDEISDYGYP  120

Query  504  QNLSPEILKLYITQEGVRSP  563
            QN   + LK YIT E V S 
Sbjct  121  QNSEIDTLKSYITTESVISS  140



>ref|XP_005051256.1| PREDICTED: AP-2 complex subunit mu isoform X4 [Ficedula albicollis]
 ref|XP_005484918.1| PREDICTED: AP-2 complex subunit mu isoform X2 [Zonotrichia albicollis]
 ref|XP_007068678.1| PREDICTED: AP-2 complex subunit mu isoform X1 [Chelonia mydas]
 ref|XP_010395569.1| PREDICTED: AP-2 complex subunit mu isoform X2 [Corvus cornix 
cornix]
Length=439

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 94/143 (66%), Gaps = 1/143 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ SN+
Sbjct  4    GLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+ +   +  +YF G   E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WLAAVTKQNVNAAMVFEFLYKMCDVMTAYF-GKISEENIKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRSPFSSK  575
            N     LK +ITQ+G++S   +K
Sbjct  123  NSETGALKTFITQQGIKSQHQTK  145



>ref|NP_033809.1| AP-2 complex subunit mu isoform 1 [Mus musculus]
 ref|NP_004059.2| AP-2 complex subunit mu isoform a [Homo sapiens]
 ref|NP_446289.1| AP-2 complex subunit mu [Rattus norvegicus]
 ref|NP_001029695.1| AP-2 complex subunit mu [Bos taurus]
 ref|NP_001274033.1| AP-2 complex subunit mu [Canis lupus familiaris]
 ref|NP_001274653.1| AP-2 complex subunit mu [Macaca fascicularis]
 ref|XP_002716532.1| PREDICTED: AP-2 complex subunit mu isoform X1 [Oryctolagus cuniculus]
 ref|XP_002758162.1| PREDICTED: AP-2 complex subunit mu isoform X1 [Callithrix jacchus]
 ref|XP_002915735.1| PREDICTED: AP-2 complex subunit mu isoform X1 [Ailuropoda melanoleuca]
 ref|XP_003256609.1| PREDICTED: AP-2 complex subunit mu isoform 1 [Nomascus leucogenys]
 ref|XP_003477103.1| PREDICTED: AP-2 complex subunit mu isoform 1 [Cavia porcellus]
 ref|XP_003802895.1| PREDICTED: AP-2 complex subunit mu isoform 1 [Otolemur garnettii]
 ref|XP_003806638.1| PREDICTED: AP-2 complex subunit mu isoform X1 [Pan paniscus]
 ref|XP_003894804.1| PREDICTED: AP-2 complex subunit mu isoform X1 [Papio anubis]
 ref|XP_003927012.1| PREDICTED: AP-2 complex subunit mu [Saimiri boliviensis boliviensis]
 ref|XP_003991910.1| PREDICTED: AP-2 complex subunit mu isoform X1 [Felis catus]
 ref|XP_004038148.1| PREDICTED: AP-2 complex subunit mu isoform 1 [Gorilla gorilla 
gorilla]
 ref|XP_004278464.1| PREDICTED: AP-2 complex subunit mu isoform 1 [Orcinus orca]
 ref|XP_004382344.1| PREDICTED: AP-2 complex subunit mu isoform 1 [Trichechus manatus 
latirostris]
 ref|XP_004406838.1| PREDICTED: AP-2 complex subunit mu isoform 1 [Odobenus rosmarus 
divergens]
 ref|XP_004424708.1| PREDICTED: AP-2 complex subunit mu isoform 1 [Ceratotherium simum 
simum]
 ref|XP_004577813.1| PREDICTED: AP-2 complex subunit mu isoform X1 [Ochotona princeps]
 ref|XP_004603117.1| PREDICTED: AP-2 complex subunit mu isoform X1 [Sorex araneus]
 ref|XP_004640769.1| PREDICTED: AP-2 complex subunit mu isoform X1 [Octodon degus]
 ref|XP_004713503.1| PREDICTED: AP-2 complex subunit mu isoform X1 [Echinops telfairi]
 ref|XP_004675084.1| PREDICTED: AP-2 complex subunit mu isoform X1 [Condylura cristata]
 ref|XP_004745177.1| PREDICTED: AP-2 complex subunit mu isoform X1 [Mustela putorius 
furo]
 ref|XP_004787625.1| PREDICTED: AP-2 complex subunit mu isoform X1 [Mustela putorius 
furo]
 ref|XP_004899783.1| PREDICTED: AP-2 complex subunit mu [Heterocephalus glaber]
 ref|XP_004834959.1| PREDICTED: AP-2 complex subunit mu [Heterocephalus glaber]
 ref|XP_005331115.1| PREDICTED: AP-2 complex subunit mu isoform X1 [Ictidomys tridecemlineatus]
 ref|XP_005383405.1| PREDICTED: AP-2 complex subunit mu isoform X2 [Chinchilla lanigera]
 ref|XP_005601903.1| PREDICTED: AP-2 complex subunit mu isoform X1 [Equus caballus]
 ref|XP_005675253.1| PREDICTED: AP-2 complex subunit mu isoform X1 [Capra hircus]
 ref|XP_005872189.1| PREDICTED: AP-2 complex subunit mu isoform X1 [Myotis brandtii]
 ref|XP_005981629.1| PREDICTED: AP-2 complex subunit mu isoform X2 [Pantholops hodgsonii]
 ref|XP_006084916.1| PREDICTED: AP-2 complex subunit mu isoform X1 [Myotis lucifugus]
 ref|XP_006183311.1| PREDICTED: AP-2 complex subunit mu isoform X1 [Camelus ferus]
 ref|XP_006201106.1| PREDICTED: AP-2 complex subunit mu isoform X1 [Vicugna pacos]
 ref|XP_006160817.1| PREDICTED: AP-2 complex subunit mu [Tupaia chinensis]
 ref|XP_006773685.1| PREDICTED: AP-2 complex subunit mu [Myotis davidii]
 ref|XP_006884131.1| PREDICTED: AP-2 complex subunit mu isoform X2 [Elephantulus edwardii]
 ref|XP_006869857.1| PREDICTED: AP-2 complex subunit mu isoform X1 [Chrysochloris 
asiatica]
 ref|XP_006925834.1| PREDICTED: AP-2 complex subunit mu isoform X1 [Pteropus alecto]
 ref|XP_007083693.1| PREDICTED: AP-2 complex subunit mu isoform X1 [Panthera tigris 
altaica]
 ref|XP_007117670.1| PREDICTED: AP-2 complex subunit mu isoform X1 [Physeter catodon]
 ref|XP_006056758.1| PREDICTED: AP-2 complex subunit mu isoform X1 [Bubalus bubalis]
 ref|XP_007195386.1| PREDICTED: AP-2 complex subunit mu isoform X2 [Balaenoptera acutorostrata 
scammoni]
 ref|XP_007469001.1| PREDICTED: AP-2 complex subunit mu isoform X1 [Lipotes vexillifer]
 ref|XP_007934114.1| PREDICTED: AP-2 complex subunit mu isoform X1 [Orycteropus afer 
afer]
 ref|XP_007970121.1| PREDICTED: AP-2 complex subunit mu isoform X1 [Chlorocebus sabaeus]
 ref|XP_008068888.1| PREDICTED: AP-2 complex subunit mu [Tarsius syrichta]
 ref|XP_008155736.1| PREDICTED: AP-2 complex subunit mu isoform X1 [Eptesicus fuscus]
 ref|XP_008264841.1| PREDICTED: AP-2 complex subunit mu isoform X1 [Oryctolagus cuniculus]
 ref|XP_008524200.1| PREDICTED: AP-2 complex subunit mu isoform X1 [Equus przewalskii]
 ref|XP_008575215.1| PREDICTED: AP-2 complex subunit mu isoform X1 [Galeopterus variegatus]
 ref|XP_008703475.1| PREDICTED: AP-2 complex subunit mu isoform X1 [Ursus maritimus]
 ref|XP_010364495.1| PREDICTED: AP-2 complex subunit mu isoform X1 [Rhinopithecus 
roxellana]
 ref|XP_010622572.1| PREDICTED: AP-2 complex subunit mu [Fukomys damarensis]
 ref|XP_010946168.1| PREDICTED: AP-2 complex subunit mu [Camelus bactrianus]
 ref|XP_010974504.1| PREDICTED: AP-2 complex subunit mu [Camelus dromedarius]
 ref|XP_011380776.1| PREDICTED: AP-2 complex subunit mu isoform X1 [Pteropus vampyrus]
 sp|P84092.1|AP2M1_RAT RecName: Full=AP-2 complex subunit mu; AltName: Full=AP-2 mu 
chain; AltName: Full=Adaptor protein complex AP-2 subunit mu; 
AltName: Full=Adaptor-related protein complex 2 subunit mu; 
AltName: Full=Clathrin assembly protein complex 2 mu medium 
chain; AltName: Full=Clathrin coat assembly protein AP50; 
AltName: Full=Clathrin coat-associated protein AP50; AltName: 
Full=Mu2-adaptin; AltName: Full=Plasma membrane adaptor AP-2 
50 kDa protein [Rattus norvegicus]
 sp|P84091.1|AP2M1_MOUSE RecName: Full=AP-2 complex subunit mu; AltName: Full=AP-2 mu 
chain; AltName: Full=Adaptor protein complex AP-2 subunit mu; 
AltName: Full=Adaptor-related protein complex 2 subunit mu; 
AltName: Full=Clathrin assembly protein complex 2 mu medium 
chain; AltName: Full=Clathrin coat assembly protein AP50; 
AltName: Full=Clathrin coat-associated protein AP50; AltName: 
Full=Mu2-adaptin; AltName: Full=Plasma membrane adaptor AP-2 
50 kDa protein [Mus musculus]
 sp|Q96CW1.2|AP2M1_HUMAN RecName: Full=AP-2 complex subunit mu; AltName: Full=AP-2 mu 
chain; AltName: Full=Adaptin-mu2; AltName: Full=Adaptor protein 
complex AP-2 subunit mu; AltName: Full=Adaptor-related protein 
complex 2 subunit mu; AltName: Full=Clathrin assembly 
protein complex 2 mu medium chain; AltName: Full=Clathrin coat 
assembly protein AP50; AltName: Full=Clathrin coat-associated 
protein AP50; AltName: Full=HA2 50 kDa subunit; AltName: 
Full=Plasma membrane adaptor AP-2 50 kDa protein [Homo sapiens]
 sp|Q4R706.1|AP2M1_MACFA RecName: Full=AP-2 complex subunit mu; AltName: Full=AP-2 mu 
chain; AltName: Full=Clathrin assembly protein complex 2 mu 
medium chain; AltName: Full=Clathrin coat assembly protein AP50; 
AltName: Full=Clathrin coat-associated protein AP50; AltName: 
Full=Mu2-adaptin; AltName: Full=Plasma membrane adaptor 
AP-2 50 kDa protein [Macaca fascicularis]
 sp|Q3ZC13.1|AP2M1_BOVIN RecName: Full=AP-2 complex subunit mu; AltName: Full=AP-2 mu 
chain; AltName: Full=Adaptor protein complex AP-2 subunit mu; 
AltName: Full=Adaptor-related protein complex 2 subunit mu; 
AltName: Full=Clathrin assembly protein complex 2 mu medium 
chain; AltName: Full=Clathrin coat assembly protein AP50; 
AltName: Full=Clathrin coat-associated protein AP50; AltName: 
Full=HA2 50 kDa subunit; AltName: Full=Mu2-adaptin; AltName: 
Full=Plasma membrane adaptor AP-2 50 kDa protein [Bos taurus]
 pdb|2BP5|M Chain M, Mu2 Adaptin Subunit (Ap50) Of Ap2 Adaptor (Second Domain), 
Complexed With Non-Canonical Internalization Peptide 
Vedyeqglsg
 pdb|2VGL|M Chain M, Ap2 Clathrin Adaptor Core
 pdb|2JKR|M Chain M, Ap2 Clathrin Adaptor Core With Dileucine Peptide Rm( 
Phosphos)qikrllse
 pdb|2JKR|U Chain U, Ap2 Clathrin Adaptor Core With Dileucine Peptide Rm( 
Phosphos)qikrllse
 pdb|2JKT|M Chain M, Ap2 Clathrin Adaptor Core With Cd4 Dileucine Peptide 
Rm( Phosphos)eikrllse  Q To E Mutant
 pdb|2JKT|U Chain U, Ap2 Clathrin Adaptor Core With Cd4 Dileucine Peptide 
Rm( Phosphos)eikrllse  Q To E Mutant
 gb|AAA72731.1| unnamed protein product [Rattus norvegicus]
 gb|AAC53158.1| clathrin-associated AP-2 complex AP50 subunit [Mus musculus]
 gb|AAC53583.1| clathrin-associated AP-2 complex AP50 subunit [Mus musculus]
 gb|AAH04996.1| Adaptor-related protein complex 2, mu 1 subunit [Homo sapiens]
 gb|AAH14030.1| Adaptor-related protein complex 2, mu 1 subunit [Homo sapiens]
 gb|AAP35972.1| adaptor-related protein complex 2, mu 1 subunit [Homo sapiens]
 gb|AAH56352.1| Adaptor protein complex AP-2, mu1 [Mus musculus]
 gb|AAH87724.1| Adaptor-related protein complex 2, mu 1 subunit [Rattus norvegicus]
 gb|AAH89342.1| Adaptor protein complex AP-2, mu1 [Mus musculus]
 gb|AAX32412.1| adaptor-related protein complex 2 mu 1 subunit [synthetic construct]
 gb|AAH94510.1| Adaptor protein complex AP-2, mu1 [Mus musculus]
 dbj|BAE01118.1| unnamed protein product [Macaca fascicularis]
 gb|AAI02984.1| Adaptor-related protein complex 2, mu 1 subunit [Bos taurus]
 dbj|BAE27229.1| unnamed protein product [Mus musculus]
 dbj|BAE24863.1| unnamed protein product [Mus musculus]
 gb|ABM83802.1| adaptor-related protein complex 2, mu 1 subunit [synthetic construct]
 gb|ABM86841.1| adaptor-related protein complex 2, mu 1 subunit [synthetic construct]
 dbj|BAG11136.1| AP-2 complex subunit mu-1 [synthetic construct]
 tpg|DAA33301.1| TPA: AP-2 complex subunit mu [Bos taurus]
 gb|AIC48515.1| AP2M1, partial [synthetic construct]
Length=435

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 94/143 (66%), Gaps = 1/143 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ SN+
Sbjct  4    GLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+ +   +  +YF G   E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WLAAVTKQNVNAAMVFEFLYKMCDVMAAYF-GKISEENIKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRSPFSSK  575
            N     LK +ITQ+G++S   +K
Sbjct  123  NSETGALKTFITQQGIKSQHQTK  145



>ref|NP_001080803.1| AP-2 complex subunit mu [Xenopus laevis]
 ref|NP_001085100.1| adaptor-related protein complex 2, mu 1 subunit [Xenopus laevis]
 sp|Q801Q8.1|AP2M1_XENLA RecName: Full=AP-2 complex subunit mu; AltName: Full=AP-2 mu 
chain; AltName: Full=Clathrin assembly protein complex 2 mu 
medium chain; AltName: Full=Clathrin coat assembly protein AP50; 
AltName: Full=Clathrin coat-associated protein AP50; AltName: 
Full=Mu2-adaptin; AltName: Full=Plasma membrane adaptor 
AP-2 50 kDa protein [Xenopus laevis]
 gb|AAH47969.1| Ap2m1 protein [Xenopus laevis]
 gb|AAH72057.1| MGC78929 protein [Xenopus laevis]
Length=435

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 94/143 (66%), Gaps = 1/143 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ SN+
Sbjct  4    GLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+ +   +  +YF G   E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WLAAVTKQNVNAAMVFEFLYKMCDVMTAYF-GKISEENIKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRSPFSSK  575
            N     LK +ITQ+G++S   +K
Sbjct  123  NSETGALKTFITQQGIKSQHQTK  145



>pdb|2XA7|M Chain M, Ap2 Clathrin Adaptor Core In Active Complex With Cargo 
Peptides
 pdb|4UQI|M Chain M, Ap2 Controls Clathrin Polymerization With A Membrane- 
Activated Switch
Length=446

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 94/143 (66%), Gaps = 1/143 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ SN+
Sbjct  4    GLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+ +   +  +YF G   E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WLAAVTKQNVNAAMVFEFLYKMCDVMAAYF-GKISEENIKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRSPFSSK  575
            N     LK +ITQ+G++S   +K
Sbjct  123  NSETGALKTFITQQGIKSQHQTK  145



>ref|XP_003412933.1| PREDICTED: AP-2 complex subunit mu [Loxodonta africana]
Length=435

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 94/143 (66%), Gaps = 1/143 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ SN+
Sbjct  4    GLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+ +   +  +YF G   E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WLAAVTKQNVNAAMVFEFLYKMCDVMAAYF-GKISEENIKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRSPFSSK  575
            N     LK +ITQ+G++S   +K
Sbjct  123  NSETGALKTFITQQGIKSQHQTK  145



>ref|NP_001267275.1| AP-2 complex subunit mu [Pan troglodytes]
 dbj|BAK62027.1| AP-2 complex subunit mu-1 [Pan troglodytes]
Length=435

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 94/143 (66%), Gaps = 1/143 (1%)
 Frame = +3

Query  147  AIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFLYMRISNV  326
             ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SF +++ SN+
Sbjct  4    GLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNI  63

Query  327  YIVIVVSTNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQ  506
            ++  V   N N A  F+F+ +   +  +YF G   E+ I+NNFVLIYELLDEI+DFGYPQ
Sbjct  64   WLAAVTKQNVNAAMVFEFLYKMCDVMAAYF-GKISEENIKNNFVLIYELLDEILDFGYPQ  122

Query  507  NLSPEILKLYITQEGVRSPFSSK  575
            N     LK +ITQ+G++S   +K
Sbjct  123  NSETGALKTFITQQGIKSQHQTK  145



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 710292972220