BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001D19

Length=507
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010938988.1|  PREDICTED: 40S ribosomal protein S3a-like          232   5e-73   Elaeis guineensis
gb|EPS65103.1|  hypothetical protein M569_09676                         228   7e-73   Genlisea aurea
ref|XP_011026951.1|  PREDICTED: 40S ribosomal protein S3a-2             231   9e-73   Populus euphratica
ref|XP_011090682.1|  PREDICTED: 40S ribosomal protein S3a               230   2e-72   Sesamum indicum [beniseed]
ref|XP_011073454.1|  PREDICTED: 40S ribosomal protein S3a-like          230   3e-72   Sesamum indicum [beniseed]
ref|XP_010553762.1|  PREDICTED: 40S ribosomal protein S3a-1-like        229   4e-72   Tarenaya hassleriana [spider flower]
ref|XP_006379849.1|  hypothetical protein POPTR_0008s15610g             229   5e-72   Populus trichocarpa [western balsam poplar]
ref|XP_002312545.2|  ribosomal protein S3a                              229   5e-72   
gb|AFS65104.1|  40S ribosomal protein S3a-like protein                  229   6e-72   Elaeis guineensis
ref|XP_010942777.1|  PREDICTED: 40S ribosomal protein S3a               229   6e-72   Elaeis guineensis
sp|A7Q5X9.1|RS3A2_VITVI  RecName: Full=40S ribosomal protein S3a-2      228   7e-72   Vitis vinifera
ref|XP_010546607.1|  PREDICTED: 40S ribosomal protein S3a-1-like        229   9e-72   Tarenaya hassleriana [spider flower]
gb|KDP23643.1|  hypothetical protein JCGZ_23476                         229   1e-71   Jatropha curcas
ref|XP_010553319.1|  PREDICTED: 40S ribosomal protein S3a-1-like        228   1e-71   Tarenaya hassleriana [spider flower]
gb|EYU23687.1|  hypothetical protein MIMGU_mgv1a012196mg                228   1e-71   Erythranthe guttata [common monkey flower]
ref|XP_002277791.1|  PREDICTED: 40S ribosomal protein S3a-2-like        228   1e-71   Vitis vinifera
ref|XP_004247589.1|  PREDICTED: 40S ribosomal protein S3a               228   1e-71   Solanum lycopersicum
ref|NP_001275164.1|  40S ribosomal protein S3a-like protein             228   1e-71   Solanum tuberosum [potatoes]
ref|XP_008811659.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    228   2e-71   Phoenix dactylifera
ref|XP_010550935.1|  PREDICTED: 40S ribosomal protein S3a-2-like        228   2e-71   Tarenaya hassleriana [spider flower]
ref|XP_004985319.1|  PREDICTED: 40S ribosomal protein S3a-like is...    228   2e-71   Setaria italica
ref|XP_006649574.1|  PREDICTED: 40S ribosomal protein S3a-like          228   2e-71   Oryza brachyantha
ref|XP_006663973.1|  PREDICTED: 40S ribosomal protein S3a-like          228   3e-71   Oryza brachyantha
emb|CDO99096.1|  unnamed protein product                                228   3e-71   Coffea canephora [robusta coffee]
ref|XP_006663971.1|  PREDICTED: 40S ribosomal protein S3a-like          227   3e-71   Oryza brachyantha
ref|XP_010524908.1|  PREDICTED: 40S ribosomal protein S3a-2             227   3e-71   Tarenaya hassleriana [spider flower]
ref|XP_003610736.1|  40S ribosomal protein S3a-like protein             227   3e-71   Medicago truncatula
gb|EPS71864.1|  hypothetical protein M569_02887                         228   3e-71   Genlisea aurea
ref|XP_010034641.1|  PREDICTED: 40S ribosomal protein S3a               227   3e-71   Eucalyptus grandis [rose gum]
ref|XP_002517085.1|  40S ribosomal protein S3a, putative                227   3e-71   Ricinus communis
ref|XP_006663974.1|  PREDICTED: 40S ribosomal protein S3a-like          227   3e-71   Oryza brachyantha
ref|XP_007034836.1|  Ribosomal protein S3Ae isoform 2                   227   3e-71   
ref|XP_006284351.1|  hypothetical protein CARUB_v10005523mg             227   3e-71   Capsella rubella
gb|ABK24527.1|  unknown                                                 224   4e-71   Picea sitchensis
dbj|BAA05057.1|  cyc07                                                  226   4e-71   Catharanthus roseus [chatas]
ref|XP_004958212.1|  PREDICTED: 40S ribosomal protein S3a-like          227   4e-71   Setaria italica
sp|P49198.2|RS3A_HELAN  RecName: Full=40S ribosomal protein S3a         227   4e-71   Helianthus annuus
ref|XP_007034835.1|  Ribosomal protein S3Ae isoform 1                   227   4e-71   Theobroma cacao [chocolate]
ref|NP_001265990.1|  40S ribosomal protein S3a                          226   6e-71   Cicer arietinum [garbanzo]
ref|XP_004985318.1|  PREDICTED: 40S ribosomal protein S3a-like is...    228   6e-71   
ref|XP_011030646.1|  PREDICTED: 40S ribosomal protein S3a-2-like        226   6e-71   Populus euphratica
sp|P33444.4|RS3A_CATRO  RecName: Full=40S ribosomal protein S3a; ...    226   7e-71   Catharanthus roseus [chatas]
gb|KHN30486.1|  40S ribosomal protein S3a                               226   7e-71   Glycine soja [wild soybean]
gb|ACU17112.1|  unknown                                                 225   7e-71   Glycine max [soybeans]
ref|XP_002463138.1|  hypothetical protein SORBIDRAFT_02g038370          226   1e-70   Sorghum bicolor [broomcorn]
ref|NP_001046578.1|  Os02g0287000                                       226   1e-70   
gb|ABK56834.1|  RPS3                                                    226   1e-70   Cymbidium hybrid cultivar
ref|XP_008804511.1|  PREDICTED: 40S ribosomal protein S3a               226   1e-70   Phoenix dactylifera
dbj|BAA00860.1|  cyc07                                                  225   1e-70   Catharanthus roseus [chatas]
ref|XP_010256142.1|  PREDICTED: 40S ribosomal protein S3a-1-like        226   1e-70   Nelumbo nucifera [Indian lotus]
ref|NP_001241005.1|  uncharacterized protein LOC100805519               226   1e-70   Glycine max [soybeans]
gb|KHN02741.1|  40S ribosomal protein S3a                               226   1e-70   Glycine soja [wild soybean]
ref|XP_010259119.1|  PREDICTED: 40S ribosomal protein S3a-1             226   2e-70   Nelumbo nucifera [Indian lotus]
ref|XP_002314671.2|  ribosomal protein S3a                              225   2e-70   Populus trichocarpa [western balsam poplar]
ref|XP_003572000.1|  PREDICTED: 40S ribosomal protein S3a               225   2e-70   Brachypodium distachyon [annual false brome]
gb|ABK22319.1|  unknown                                                 224   2e-70   Picea sitchensis
ref|NP_001066631.1|  Os12g0406200                                       225   2e-70   
gb|KDP40219.1|  hypothetical protein JCGZ_02217                         225   2e-70   Jatropha curcas
gb|AFK33413.1|  unknown                                                 225   3e-70   Lotus japonicus
ref|XP_010675082.1|  PREDICTED: 40S ribosomal protein S3a               225   3e-70   Beta vulgaris subsp. vulgaris [field beet]
emb|CDO98656.1|  unnamed protein product                                224   3e-70   Coffea canephora [robusta coffee]
ref|XP_006408143.1|  hypothetical protein EUTSA_v10021341mg             224   3e-70   Eutrema salsugineum [saltwater cress]
gb|ACR37738.1|  unknown                                                 221   4e-70   Zea mays [maize]
dbj|BAJ93929.1|  predicted protein                                      224   4e-70   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010274385.1|  PREDICTED: 40S ribosomal protein S3a-like          224   4e-70   Nelumbo nucifera [Indian lotus]
gb|KJB34507.1|  hypothetical protein B456_006G069600                    224   4e-70   Gossypium raimondii
ref|XP_007030615.1|  Ribosomal protein S3Ae                             224   4e-70   
gb|KHG05975.1|  40S ribosomal S3a                                       224   4e-70   Gossypium arboreum [tree cotton]
ref|NP_001241430.1|  uncharacterized protein LOC100813273               224   4e-70   Glycine max [soybeans]
ref|XP_010272784.1|  PREDICTED: 40S ribosomal protein S3a-like          224   5e-70   Nelumbo nucifera [Indian lotus]
ref|XP_002463137.1|  hypothetical protein SORBIDRAFT_02g038365          224   5e-70   Sorghum bicolor [broomcorn]
gb|ACU18272.1|  unknown                                                 224   6e-70   Glycine max [soybeans]
ref|XP_002283142.1|  PREDICTED: 40S ribosomal protein S3a-1             224   6e-70   Vitis vinifera
ref|XP_010229024.1|  PREDICTED: 40S ribosomal protein S3a-like          224   6e-70   Brachypodium distachyon [annual false brome]
gb|AAC98779.1|  S-phase-specific ribosomal protein                      224   7e-70   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001239858.1|  uncharacterized protein LOC100808747               224   7e-70   Glycine max [soybeans]
ref|XP_009779517.1|  PREDICTED: 40S ribosomal protein S3a               224   7e-70   Nicotiana sylvestris
ref|NP_001152574.1|  40S ribosomal protein S3a                          224   7e-70   Zea mays [maize]
ref|XP_009628663.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    224   8e-70   Nicotiana tomentosiformis
gb|KJB28386.1|  hypothetical protein B456_005G045000                    223   8e-70   Gossypium raimondii
gb|EEE56753.1|  hypothetical protein OsJ_06287                          228   8e-70   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009775368.1|  PREDICTED: 40S ribosomal protein S3a-like          224   8e-70   Nicotiana sylvestris
ref|XP_002512232.1|  40S ribosomal protein S3a, putative                224   9e-70   Ricinus communis
ref|XP_009591686.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    223   9e-70   Nicotiana tomentosiformis
ref|XP_009618011.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    223   9e-70   Nicotiana tomentosiformis
ref|XP_004145387.1|  PREDICTED: 40S ribosomal protein S3a-like          223   9e-70   
gb|KFK37895.1|  hypothetical protein AALP_AA3G043200                    223   9e-70   Arabis alpina [alpine rockcress]
ref|NP_001141038.1|  hypothetical protein                               223   1e-69   Zea mays [maize]
ref|NP_001049289.1|  Os03g0200500                                       223   1e-69   
ref|XP_008449325.1|  PREDICTED: 40S ribosomal protein S3a-like          223   1e-69   Cucumis melo [Oriental melon]
ref|XP_006848758.1|  hypothetical protein AMTR_s00026p00042160          223   1e-69   Amborella trichopoda
ref|XP_003559021.1|  PREDICTED: 40S ribosomal protein S3a-like          223   1e-69   Brachypodium distachyon [annual false brome]
gb|KHG19560.1|  40S ribosomal S3a                                       223   1e-69   Gossypium arboreum [tree cotton]
ref|XP_008438626.1|  PREDICTED: 40S ribosomal protein S3a               223   1e-69   Cucumis melo [Oriental melon]
ref|XP_004134125.1|  PREDICTED: 40S ribosomal protein S3a-like          223   1e-69   Cucumis sativus [cucumbers]
emb|CDY17474.1|  BnaC03g65890D                                          223   1e-69   Brassica napus [oilseed rape]
gb|KJB28382.1|  hypothetical protein B456_005G045000                    223   1e-69   Gossypium raimondii
gb|AFW89330.1|  40S ribosomal protein S3a                               225   1e-69   
gb|AFW89335.1|  40S ribosomal protein S3a                               225   2e-69   
ref|NP_195193.1|  40S ribosomal protein S3a-2                           223   2e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007143300.1|  hypothetical protein PHAVU_007G060700g             223   2e-69   Phaseolus vulgaris [French bean]
tpg|DAA43947.1|  TPA: hypothetical protein ZEAMMB73_528269              220   2e-69   
ref|XP_002463139.1|  hypothetical protein SORBIDRAFT_02g038380          221   2e-69   
gb|KHG11221.1|  40S ribosomal S3a                                       223   2e-69   Gossypium arboreum [tree cotton]
ref|XP_007205738.1|  hypothetical protein PRUPE_ppa010179mg             223   2e-69   Prunus persica
ref|NP_001276152.1|  40S ribosomal protein S3a-like                     223   2e-69   
ref|XP_007157117.1|  hypothetical protein PHAVU_002G044200g             223   2e-69   Phaseolus vulgaris [French bean]
gb|KFK30101.1|  hypothetical protein AALP_AA7G217000                    223   2e-69   Arabis alpina [alpine rockcress]
ref|XP_008218237.1|  PREDICTED: 40S ribosomal protein S3a-2             223   2e-69   Prunus mume [ume]
gb|KJB72261.1|  hypothetical protein B456_011G167500                    223   2e-69   Gossypium raimondii
ref|XP_010090259.1|  40S ribosomal protein S3a                          223   3e-69   Morus notabilis
gb|KJB28385.1|  hypothetical protein B456_005G045000                    222   3e-69   Gossypium raimondii
gb|AAX55706.1|  cyc07                                                   221   3e-69   Vitis vinifera
ref|XP_004496691.1|  PREDICTED: 40S ribosomal protein S3a-like          222   3e-69   Cicer arietinum [garbanzo]
gb|AGT16352.1|  40S ribosomal protein S3a                               222   3e-69   Saccharum hybrid cultivar R570
gb|AFW89333.1|  hypothetical protein ZEAMMB73_166147                    224   4e-69   
ref|NP_001149096.1|  40S ribosomal protein S3a                          222   4e-69   Zea mays [maize]
gb|KCW60693.1|  hypothetical protein EUGRSUZ_H03423                     221   4e-69   Eucalyptus grandis [rose gum]
ref|XP_004235324.1|  PREDICTED: 40S ribosomal protein S3a               222   5e-69   Solanum lycopersicum
ref|XP_007137418.1|  hypothetical protein PHAVU_009G125400g             221   6e-69   Phaseolus vulgaris [French bean]
ref|NP_001275123.1|  cyc07-like protein                                 221   8e-69   Solanum tuberosum [potatoes]
ref|XP_004241461.1|  PREDICTED: 40S ribosomal protein S3a               221   8e-69   Solanum lycopersicum
ref|XP_010024230.1|  PREDICTED: 40S ribosomal protein S3a-like          221   9e-69   Eucalyptus grandis [rose gum]
ref|XP_010092425.1|  40S ribosomal protein S3a                          221   9e-69   
ref|XP_010419205.1|  PREDICTED: 40S ribosomal protein S3a-1-like        221   1e-68   Camelina sativa [gold-of-pleasure]
ref|XP_003638196.1|  40S ribosomal protein S3a                          220   1e-68   
ref|XP_010485869.1|  PREDICTED: 40S ribosomal protein S3a-1             221   1e-68   Camelina sativa [gold-of-pleasure]
gb|ACJ85751.1|  unknown                                                 220   1e-68   Medicago truncatula
ref|XP_008224264.1|  PREDICTED: 40S ribosomal protein S3a               220   1e-68   Prunus mume [ume]
ref|NP_187135.1|  40S ribosomal protein S3a-1                           220   2e-68   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001274913.1|  40S ribosomal protein S3a-like                     220   2e-68   Solanum tuberosum [potatoes]
emb|CDX76296.1|  BnaA08g11040D                                          220   2e-68   
ref|XP_009108713.1|  PREDICTED: 40S ribosomal protein S3a-2-like        220   2e-68   Brassica rapa
ref|XP_009124201.1|  PREDICTED: 40S ribosomal protein S3a-2             220   2e-68   Brassica rapa
ref|XP_009138316.1|  PREDICTED: 40S ribosomal protein S3a-2-like        219   3e-68   Brassica rapa
emb|CDX69078.1|  BnaC01g03750D                                          219   3e-68   
ref|XP_009110285.1|  PREDICTED: 40S ribosomal protein S3a-2             219   3e-68   Brassica rapa
emb|CDX75453.1|  BnaA01g02490D                                          219   3e-68   
ref|XP_006838990.1|  hypothetical protein AMTR_s00002p00271660          219   3e-68   
emb|CDY40680.1|  BnaC03g33960D                                          219   3e-68   Brassica napus [oilseed rape]
emb|CDY50760.1|  BnaAnng10670D                                          219   4e-68   Brassica napus [oilseed rape]
gb|ACG33267.1|  40S ribosomal protein S3a                               219   4e-68   Zea mays [maize]
gb|ABB55362.1|  cyc07-like                                              219   4e-68   Solanum tuberosum [potatoes]
ref|XP_009134791.1|  PREDICTED: 40S ribosomal protein S3a-2-like        219   4e-68   Brassica rapa
emb|CDX74165.1|  BnaA03g28820D                                          219   5e-68   
ref|XP_002882377.1|  40S ribosomal protein S3A                          219   5e-68   
ref|XP_006298355.1|  hypothetical protein CARUB_v10014425mg             219   5e-68   Capsella rubella
ref|XP_010432386.1|  PREDICTED: 40S ribosomal protein S3a-2-like        219   5e-68   Camelina sativa [gold-of-pleasure]
ref|XP_003526635.1|  PREDICTED: 40S ribosomal protein S3a-like          219   6e-68   Glycine max [soybeans]
ref|XP_002869131.1|  40S ribosomal protein S3A                          219   6e-68   Arabidopsis lyrata subsp. lyrata
gb|ACG34058.1|  40S ribosomal protein S3a                               219   6e-68   Zea mays [maize]
ref|XP_010463973.1|  PREDICTED: 40S ribosomal protein S3a-1-like        219   6e-68   Camelina sativa [gold-of-pleasure]
gb|ABB72808.1|  cyc07-like protein                                      219   7e-68   Solanum tuberosum [potatoes]
ref|XP_006412198.1|  hypothetical protein EUTSA_v10026006mg             219   8e-68   Eutrema salsugineum [saltwater cress]
sp|Q9MBB3.1|RS3A_DAUCA  RecName: Full=40S ribosomal protein S3a; ...    218   9e-68   Daucus carota [carrots]
ref|XP_009394355.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    218   9e-68   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACN40078.1|  unknown                                                 218   1e-67   Picea sitchensis
ref|XP_010437575.1|  PREDICTED: 40S ribosomal protein S3a-2             218   1e-67   Camelina sativa [gold-of-pleasure]
gb|KDO74488.1|  hypothetical protein CISIN_1g024879mg                   218   1e-67   Citrus sinensis [apfelsine]
gb|KJB38202.1|  hypothetical protein B456_006G241700                    218   2e-67   Gossypium raimondii
gb|KJB38201.1|  hypothetical protein B456_006G241700                    218   2e-67   Gossypium raimondii
ref|XP_006420004.1|  hypothetical protein CICLE_v10005663mg             218   2e-67   Citrus clementina [clementine]
ref|XP_011032434.1|  PREDICTED: 40S ribosomal protein S3a               218   2e-67   Populus euphratica
ref|XP_010447045.1|  PREDICTED: 40S ribosomal protein S3a-2-like        218   2e-67   Camelina sativa [gold-of-pleasure]
ref|NP_001288829.1|  40S ribosomal protein S3a                          218   2e-67   Brassica rapa
ref|XP_006382773.1|  40S ribosomal protein S3A                          218   2e-67   Populus trichocarpa [western balsam poplar]
gb|ABK93399.1|  unknown                                                 218   2e-67   Populus trichocarpa [western balsam poplar]
ref|XP_009406016.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    218   2e-67   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU41450.1|  hypothetical protein MIMGU_mgv1a002668mg                228   2e-67   Erythranthe guttata [common monkey flower]
emb|CDY21109.1|  BnaA01g33400D                                          217   2e-67   Brassica napus [oilseed rape]
ref|XP_004296667.1|  PREDICTED: 40S ribosomal protein S3a               217   2e-67   Fragaria vesca subsp. vesca
ref|XP_006382772.1|  hypothetical protein POPTR_0005s05280g             217   3e-67   
emb|CDY30019.1|  BnaC01g39890D                                          218   3e-67   Brassica napus [oilseed rape]
ref|XP_002987274.1|  hypothetical protein SELMODRAFT_271906             217   4e-67   Selaginella moellendorffii
ref|XP_009408135.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    217   4e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008391001.1|  PREDICTED: 40S ribosomal protein S3a-2-like        216   5e-67   Malus domestica [apple tree]
gb|KEH32959.1|  40S ribosomal protein S3a-1                             216   6e-67   Medicago truncatula
gb|KHN21710.1|  40S ribosomal protein S3a                               218   9e-67   Glycine soja [wild soybean]
ref|XP_009400022.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    216   1e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008390932.1|  PREDICTED: 40S ribosomal protein S3a-2-like        216   1e-66   Malus domestica [apple tree]
ref|XP_009335287.1|  PREDICTED: 40S ribosomal protein S3a-2-like        215   1e-66   Pyrus x bretschneideri [bai li]
gb|AAP80855.1|  cyc07                                                   214   1e-66   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004302028.1|  PREDICTED: 40S ribosomal protein S3a-2             214   4e-66   Fragaria vesca subsp. vesca
gb|KDO37446.1|  hypothetical protein CISIN_1g045491mg                   211   3e-65   Citrus sinensis [apfelsine]
ref|XP_001761018.1|  predicted protein                                  212   3e-65   
ref|XP_006428321.1|  hypothetical protein CICLE_v10012508mg             211   4e-65   Citrus clementina [clementine]
gb|KDO43437.1|  hypothetical protein CISIN_1g040060mg                   211   5e-65   Citrus sinensis [apfelsine]
ref|XP_007226551.1|  hypothetical protein PRUPE_ppa024854mg             221   7e-65   
gb|EEC69140.1|  hypothetical protein OsI_38068                          223   1e-64   Oryza sativa Indica Group [Indian rice]
gb|EEE53089.1|  hypothetical protein OsJ_35850                          222   1e-64   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002949135.1|  component of cytosolic 80S ribosome and 40S ...    210   1e-64   Volvox carteri f. nagariensis
ref|XP_001693710.1|  ribosomal protein S3a, component of cytosoli...    209   3e-64   Chlamydomonas reinhardtii
ref|XP_001767326.1|  predicted protein                                  209   5e-64   
ref|XP_001755439.1|  predicted protein                                  208   8e-64   
ref|XP_001774632.1|  predicted protein                                  208   1e-63   
ref|XP_001765908.1|  predicted protein                                  207   1e-63   
ref|XP_001765967.1|  predicted protein                                  207   2e-63   
emb|CBX25071.1|  40S ribosomal protein S3a                              206   6e-63   Polytomella sp. Pringsheim 198.80
ref|XP_001777314.1|  predicted protein                                  205   2e-62   
ref|XP_005650618.1|  ribosomal protein S3Ae                             202   2e-61   Coccomyxa subellipsoidea C-169
ref|XP_002465526.1|  hypothetical protein SORBIDRAFT_01g040570          200   1e-60   
ref|XP_002428136.1|  40S ribosomal protein S3A, putative                199   3e-60   Pediculus humanus corporis [human body lice]
emb|CBI34197.3|  unnamed protein product                                197   3e-60   Vitis vinifera
ref|XP_001422366.1|  Ribosomal protein S3a, component of cytosoli...    199   4e-60   Ostreococcus lucimarinus CCE9901
gb|EMT30223.1|  40S ribosomal protein S3a                               198   5e-60   
emb|CEG00819.1|  Ribosomal protein S3Ae                                 198   6e-60   Ostreococcus tauri
ref|XP_008671813.1|  PREDICTED: 40S ribosomal protein S3a-like          197   6e-60   Zea mays [maize]
gb|KFM56731.1|  40S ribosomal protein S3a                               195   1e-59   Stegodyphus mimosarum
gb|KDR16079.1|  40S ribosomal protein S3a                               197   3e-59   Zootermopsis nevadensis
gb|AGM32131.1|  40S ribosomal protein S3a                               197   3e-59   Coptotermes formosanus
sp|Q5G5C4.1|RS3A_PERAM  RecName: Full=40S ribosomal protein S3a         196   4e-59   Periplaneta americana
sp|Q6EV04.1|RS3A_BIPLU  RecName: Full=40S ribosomal protein S3a         196   4e-59   Biphyllus lunatus
gb|ABS44871.1|  ribosomal protein S3Ae                                  195   7e-59   Pteromalus puparum
ref|XP_001601315.1|  PREDICTED: 40S ribosomal protein S3a               196   8e-59   Nasonia vitripennis
emb|CCD22031.1|  40S ribosomal protein S3A                              192   8e-59   Cupiennius salei
gb|ACD61705.1|  ribosomal protein S3                                    196   9e-59   Chironomus riparius
gb|ABX75452.1|  40S ribosomal protein S3a                               194   1e-58   Lycosa singoriensis
ref|XP_011495909.1|  PREDICTED: 40S ribosomal protein S3a               194   3e-58   Ceratosolen solmsi marchali
dbj|BAN20332.1|  ribosomal protein S3A                                  194   4e-58   Riptortus pedestris
ref|XP_008555289.1|  PREDICTED: 40S ribosomal protein S3a               193   6e-58   Microplitis demolitor
emb|CAJ17219.1|  ribosomal protein S3Ae                                 193   1e-57   Timarcha balearica
ref|XP_011155135.1|  PREDICTED: 40S ribosomal protein S3a               192   1e-57   Harpegnathos saltator
ref|XP_968064.1|  PREDICTED: 40S ribosomal protein S3a                  192   1e-57   Tribolium castaneum [rust-red flour beetle]
ref|XP_011142878.1|  PREDICTED: 40S ribosomal protein S3a               192   1e-57   Harpegnathos saltator
ref|XP_011159168.1|  PREDICTED: 40S ribosomal protein S3a               192   2e-57   Solenopsis invicta [imported red fire ant]
ref|XP_011259689.1|  PREDICTED: 40S ribosomal protein S3a               192   2e-57   Camponotus floridanus
ref|XP_011060675.1|  PREDICTED: 40S ribosomal protein S3a               192   2e-57   Acromyrmex echinatior
ref|XP_011352079.1|  PREDICTED: 40S ribosomal protein S3a               192   2e-57   Ooceraea biroi
gb|AAV84249.1|  ribosomal protein S3                                    190   2e-57   Culicoides sonorensis
gb|AFW89329.1|  hypothetical protein ZEAMMB73_166147                    191   3e-57   
ref|XP_003704988.1|  PREDICTED: 40S ribosomal protein S3a-like          191   5e-57   Megachile rotundata
ref|XP_003399883.1|  PREDICTED: 40S ribosomal protein S3a-like          191   5e-57   Bombus terrestris [large earth bumblebee]
gb|ACD65096.1|  putative 40S ribosomal protein RPS3A                    188   6e-57   Novocrania anomala
sp|A6YPJ8.1|RS3A_TRIIF  RecName: Full=40S ribosomal protein S3a         191   7e-57   Triatoma infestans
gb|AAU06483.1|  ribosomal protein subunit 3                             191   8e-57   Culicoides sonorensis
ref|XP_008478156.1|  PREDICTED: 40S ribosomal protein S3a               189   9e-57   
gb|ABI52667.1|  40S ribosomal protein S3a                               190   1e-56   Argas monolakensis
ref|XP_007508881.1|  predicted protein                                  190   1e-56   Bathycoccus prasinos
gb|ACY71306.1|  ribosomal protein S3A                                   189   2e-56   Chrysomela tremula
ref|XP_011297729.1|  PREDICTED: 40S ribosomal protein S3a               189   2e-56   Fopius arisanus
gb|KDD76342.1|  ribosomal protein S3Ae                                  189   3e-56   Helicosporidium sp. ATCC 50920
gb|ABW23199.1|  ribosomal protein rps3a                                 189   4e-56   Eurythoe complanata
sp|Q4KTD9.1|RS3A_SUBDO  RecName: Full=40S ribosomal protein S3a         187   7e-56   Suberites domuncula
tpg|DAA34106.1|  TPA: 40S ribosomal protein S3a                         186   9e-56   Amblyomma variegatum
dbj|BAH12261.1|  unnamed protein product                                184   1e-55   Homo sapiens [man]
ref|XP_009024124.1|  hypothetical protein HELRODRAFT_185887             187   1e-55   Helobdella robusta
gb|EDL42086.1|  mCG2066                                                 184   2e-55   Mus musculus [mouse]
gb|AEE62515.1|  unknown                                                 187   2e-55   Dendroctonus ponderosae
dbj|BAC56507.1|  similar to ribosomal protein S3a                       183   2e-55   Bos taurus [bovine]
gb|KGL84225.1|  hypothetical protein N309_14824                         184   2e-55   Tinamus guttatus
ref|XP_011421723.1|  PREDICTED: 40S ribosomal protein S3a-like          186   2e-55   Crassostrea gigas
emb|CAB46830.1|  Ribosomal protein                                      184   2e-55   Canis lupus familiaris [dogs]
ref|XP_005954900.1|  PREDICTED: 40S ribosomal protein S3a-like          186   2e-55   Pantholops hodgsonii [Tibetan antelope]
ref|NP_001129593.1|  ribosomal protein S3A                              187   3e-55   Acyrthosiphon pisum
ref|XP_005149013.1|  PREDICTED: 40S ribosomal protein S3a isoform X4    184   4e-55   Melopsittacus undulatus
sp|Q4PM31.1|RS3A_IXOSC  RecName: Full=40S ribosomal protein S3a         186   4e-55   Ixodes scapularis [blacklegged tick]
ref|XP_007055759.1|  PREDICTED: 40S ribosomal protein S3a-A isofo...    184   4e-55   
ref|XP_005517609.1|  PREDICTED: 40S ribosomal protein S3a isoform X3    184   4e-55   
ref|XP_004088582.1|  PREDICTED: 40S ribosomal protein S3a               184   5e-55   Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_006735747.1|  PREDICTED: 40S ribosomal protein S3a-like is...    186   5e-55   Leptonychotes weddellii
gb|AAT76631.1|  ribosomal protein S3a                                   185   5e-55   Felis catus [cat]
ref|XP_009075160.1|  PREDICTED: 40S ribosomal protein S3a               185   5e-55   Acanthisitta chloris
gb|KFO84143.1|  40S ribosomal protein S3a                               185   5e-55   Buceros rhinoceros silvestris
gb|EAX04989.1|  ribosomal protein S3A, isoform CRA_b                    185   5e-55   Homo sapiens [man]
gb|EFB26537.1|  hypothetical protein PANDA_001716                       185   5e-55   Ailuropoda melanoleuca
emb|CAD91420.1|  ribosomal protein S3a                                  186   6e-55   Crassostrea gigas
ref|XP_010203978.1|  PREDICTED: 40S ribosomal protein S3a               185   6e-55   Colius striatus
gb|KFW97162.1|  40S ribosomal protein S3a                               185   6e-55   Phalacrocorax carbo [common cormorant]
ref|XP_009977023.1|  PREDICTED: 40S ribosomal protein S3a               185   6e-55   Tauraco erythrolophus
gb|EOB04964.1|  40S ribosomal protein S3a                               185   6e-55   Anas platyrhynchos [duck]
gb|KFM10230.1|  40S ribosomal protein S3a                               185   6e-55   Aptenodytes forsteri
ref|XP_005014766.1|  PREDICTED: 40S ribosomal protein S3a               185   6e-55   
gb|KFP00832.1|  40S ribosomal protein S3a                               185   6e-55   Calypte anna
ref|XP_008933878.1|  PREDICTED: 40S ribosomal protein S3a               185   6e-55   Merops nubicus
gb|KFP91786.1|  40S ribosomal protein S3a                               185   6e-55   Apaloderma vittatum
ref|XP_005415772.1|  PREDICTED: 40S ribosomal protein S3a               185   6e-55   
ref|XP_005330207.1|  PREDICTED: 40S ribosomal protein S3a-like          186   7e-55   
gb|KFR12636.1|  40S ribosomal protein S3a                               185   7e-55   Opisthocomus hoazin [hoatzin]
ref|XP_010016125.1|  PREDICTED: 40S ribosomal protein S3a               185   7e-55   Nestor notabilis
gb|EMC77645.1|  40S ribosomal protein S3a                               185   7e-55   
ref|XP_009281624.1|  PREDICTED: 40S ribosomal protein S3a               185   7e-55   
ref|XP_010311392.1|  PREDICTED: 40S ribosomal protein S3a               185   7e-55   
ref|XP_009969079.1|  PREDICTED: 40S ribosomal protein S3a               185   7e-55   
sp|Q56FG9.1|RS3A_LYSTE  RecName: Full=40S ribosomal protein S3a         186   7e-55   
ref|NP_001279332.1|  ribosomal protein S3A                              186   7e-55   
ref|XP_007902210.1|  PREDICTED: 40S ribosomal protein S3a               185   7e-55   
gb|EAW77577.1|  hCG33299, isoform CRA_a                                 185   7e-55   
ref|XP_008492080.1|  PREDICTED: 40S ribosomal protein S3a               185   7e-55   
dbj|BAE88391.1|  unnamed protein product                                185   7e-55   
ref|XP_003945196.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    185   7e-55   
gb|EAW77579.1|  hCG33299, isoform CRA_c                                 185   8e-55   
ref|XP_005436755.1|  PREDICTED: 40S ribosomal protein S3a               185   8e-55   
ref|XP_003923833.1|  PREDICTED: 40S ribosomal protein S3a               185   8e-55   
ref|XP_005967889.1|  PREDICTED: 40S ribosomal protein S3a-like          185   8e-55   
gb|AAH66926.1|  Ribosomal protein S3A                                   185   8e-55   
ref|XP_004088583.1|  PREDICTED: 40S ribosomal protein S3a               183   8e-55   
ref|XP_003221796.1|  PREDICTED: 40S ribosomal protein S3a               185   8e-55   
gb|EAX04994.1|  ribosomal protein S3A, isoform CRA_g                    185   8e-55   
ref|XP_008852472.1|  PREDICTED: 40S ribosomal protein S3a               185   8e-55   
ref|NP_000997.1|  40S ribosomal protein S3a isoform 1                   185   8e-55   
ref|XP_005955989.1|  PREDICTED: 40S ribosomal protein S3a-like is...    185   8e-55   
ref|XP_005149010.1|  PREDICTED: 40S ribosomal protein S3a isoform X1    185   8e-55   
ref|XP_007469965.1|  PREDICTED: 40S ribosomal protein S3a               185   8e-55   
ref|XP_003205487.1|  PREDICTED: 40S ribosomal protein S3a isoform X1    185   8e-55   
ref|XP_006779434.1|  PREDICTED: LOW QUALITY PROTEIN: ribosomal pr...    185   9e-55   
gb|AAA35682.1|  ribosmal protein small subunit                          185   9e-55   
sp|Q6DV02.3|RS3A_GECJA  RecName: Full=40S ribosomal protein S3a         185   9e-55   
gb|ERZ98268.1|  hypothetical protein GLOINDRAFT_339726                  185   9e-55   
ref|NP_058655.3|  40S ribosomal protein S3a                             185   9e-55   
dbj|BAF83764.1|  unnamed protein product                                185   9e-55   
dbj|BAE32029.1|  unnamed protein product                                185   9e-55   
sp|P61246.1|RS3A_FELCA  RecName: Full=40S ribosomal protein S3a         185   9e-55   
gb|EFX89527.1|  hypothetical protein DAPPUDRAFT_303071                  185   9e-55   
ref|XP_004655919.1|  PREDICTED: 40S ribosomal protein S3a               185   9e-55   
ref|XP_007635341.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    185   9e-55   
gb|ELW69964.1|  40S ribosomal protein S3a                               185   9e-55   
ref|XP_007437219.1|  PREDICTED: 40S ribosomal protein S3a-like          185   1e-54   
ref|XP_005954137.1|  PREDICTED: 40S ribosomal protein S3a-like is...    185   1e-54   
ref|XP_004323125.1|  PREDICTED: 40S ribosomal protein S3a-like          185   1e-54   
ref|XP_006884543.1|  PREDICTED: 40S ribosomal protein S3a-like          185   1e-54   
ref|XP_006985395.1|  PREDICTED: 40S ribosomal protein S3a-like          185   1e-54   
ref|NP_001075886.1|  ribosomal protein S3A                              185   1e-54   
ref|NP_001185510.1|  40S ribosomal protein S3a                          185   1e-54   
ref|XP_004017251.1|  PREDICTED: 40S ribosomal protein S3a               185   1e-54   
dbj|BAE87927.1|  unnamed protein product                                185   1e-54   
ref|XP_006040183.1|  PREDICTED: 40S ribosomal protein S3a-like          185   1e-54   
ref|XP_009873775.1|  PREDICTED: 40S ribosomal protein S3a               185   1e-54   
ref|XP_008047613.1|  PREDICTED: 40S ribosomal protein S3a               185   1e-54   
ref|XP_006262711.1|  PREDICTED: 40S ribosomal protein S3a               185   1e-54   
ref|XP_005045047.1|  PREDICTED: 40S ribosomal protein S3a               185   1e-54   
ref|XP_005307414.1|  PREDICTED: 40S ribosomal protein S3a               185   1e-54   
ref|XP_001366653.1|  PREDICTED: 40S ribosomal protein S3a               185   1e-54   
ref|XP_008931489.1|  PREDICTED: 40S ribosomal protein S3a               185   1e-54   
ref|NP_058849.1|  40S ribosomal protein S3a                             185   1e-54   
ref|XP_011421732.1|  PREDICTED: 40S ribosomal protein S3a-like          185   1e-54   
ref|XP_003797009.1|  PREDICTED: 40S ribosomal protein S3a-like is...    185   1e-54   
ref|XP_008633930.1|  PREDICTED: 40S ribosomal protein S3a               185   1e-54   
ref|XP_009896517.1|  PREDICTED: 40S ribosomal protein S3a               185   1e-54   
sp|O43999.3|RS3A_EIMTE  RecName: Full=40S ribosomal protein S3a; ...    185   1e-54   
sp|B0WN96.2|RS3A_CULQU  RecName: Full=40S ribosomal protein S3a         185   1e-54   
gb|ABZ04255.1|  ribosomal protein rps3a                                 184   1e-54   
ref|XP_004055608.1|  PREDICTED: 40S ribosomal protein S3a-like          185   1e-54   
ref|XP_001633847.1|  predicted protein                                  184   1e-54   
ref|XP_001514859.1|  PREDICTED: 40S ribosomal protein S3a               184   1e-54   
ref|XP_010223052.1|  PREDICTED: 40S ribosomal protein S3a               185   1e-54   
gb|ETE70827.1|  40S ribosomal protein S3a                               184   2e-54   
ref|XP_006174472.1|  PREDICTED: 40S ribosomal protein S3a               184   2e-54   
ref|XP_009099772.1|  PREDICTED: 40S ribosomal protein S3a               184   2e-54   
ref|XP_007528141.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    184   2e-54   
ref|XP_004411050.1|  PREDICTED: 40S ribosomal protein S3a-like          185   2e-54   
gb|ELK25366.1|  40S ribosomal protein S3a                               182   2e-54   
ref|XP_003797010.1|  PREDICTED: 40S ribosomal protein S3a-like is...    184   2e-54   
ref|XP_005710608.1|  40S ribosomal protein S3A                          184   2e-54   
ref|XP_009509149.1|  PREDICTED: 40S ribosomal protein S3a               184   2e-54   
ref|XP_007230303.1|  PREDICTED: 40S ribosomal protein S3a               184   2e-54   
ref|XP_004049753.1|  PREDICTED: 40S ribosomal protein S3a-like          181   2e-54   
ref|XP_009565584.1|  PREDICTED: 40S ribosomal protein S3a isoform X2    183   2e-54   
dbj|BAB22611.1|  unnamed protein product                                184   2e-54   
ref|NP_001104210.1|  40S ribosomal protein S3a-B                        184   2e-54   
ref|XP_005809444.1|  PREDICTED: 40S ribosomal protein S3a-like          184   2e-54   
ref|NP_001008075.1|  40S ribosomal protein S3a                          184   2e-54   
ref|XP_002505259.1|  predicted protein                                  184   2e-54   
ref|XP_006629554.1|  PREDICTED: 40S ribosomal protein S3a-like          184   2e-54   
gb|AFM88910.1|  40S ribosomal protein S3a                               184   3e-54   
ref|XP_003417586.1|  PREDICTED: 40S ribosomal protein S3a               184   3e-54   
gb|EAX04993.1|  ribosomal protein S3A, isoform CRA_f                    184   3e-54   
dbj|BAE30393.1|  unnamed protein product                                184   3e-54   
gb|EKC30815.1|  40S ribosomal protein S3a                               185   3e-54   
gb|AFM85626.1|  40S ribosomal protein S3a                               184   3e-54   
gb|ACD65136.1|  putative 40S ribosomal protein RPS3A                    181   3e-54   
ref|NP_001080325.1|  40S ribosomal protein S3a-A                        184   3e-54   
ref|XP_003972467.1|  PREDICTED: 40S ribosomal protein S3a-like is...    184   3e-54   
ref|XP_008314924.1|  PREDICTED: 40S ribosomal protein S3a               184   3e-54   
ref|NP_001098311.1|  40S ribosomal protein S3a                          184   3e-54   
ref|XP_002744350.1|  PREDICTED: 40S ribosomal protein S3a               184   4e-54   
ref|XP_005500910.1|  PREDICTED: 40S ribosomal protein S3a               184   4e-54   
ref|XP_009480002.1|  PREDICTED: 40S ribosomal protein S3a               184   4e-54   
gb|AFM88988.1|  ribosomal protein S3a                                   183   4e-54   
ref|NP_001291168.1|  ribosomal protein S3A                              183   4e-54   
ref|NP_001134789.1|  40S ribosomal protein S3a                          183   4e-54   
gb|AAT44427.1|  V-Fos transformation effector-like protein              183   4e-54   
ref|XP_002598366.1|  hypothetical protein BRAFLDRAFT_69722              183   4e-54   
gb|AGQ03805.1|  ribosomal protein S3A                                   183   5e-54   
ref|XP_009210953.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    183   5e-54   
gb|ADO29317.1|  40S ribosomal protein s3a                               183   5e-54   
ref|NP_956353.1|  40S ribosomal protein S3a                             183   5e-54   
gb|ABY28374.1|  ribosomal protein S3a                                   183   5e-54   
gb|AEP43788.1|  40S ribosomal protein S3a                               183   5e-54   
gb|AFM88390.1|  ribosomal protein S3a                                   183   5e-54   
ref|XP_001850180.1|  40S ribosomal protein S3a                          186   5e-54   
ref|XP_001651595.1|  AAEL005901-PA                                      182   5e-54   
ref|XP_010559325.1|  PREDICTED: 40S ribosomal protein S3a               185   5e-54   
gb|ELW50426.1|  40S ribosomal protein S3a                               185   5e-54   
gb|ACQ58827.1|  40S ribosomal protein S3a                               183   6e-54   
emb|CAJ17199.1|  ribosomal protein S3Ae                                 183   6e-54   
dbj|BAE27060.1|  unnamed protein product                                183   6e-54   
ref|XP_006879080.1|  PREDICTED: 40S ribosomal protein S3a-like          183   6e-54   
ref|XP_005996413.1|  PREDICTED: 40S ribosomal protein S3a               183   6e-54   
pdb|4KZX|B  Chain B, Rabbit 40s Ribosomal Subunit In Complex With...    183   6e-54   
ref|XP_003267670.1|  PREDICTED: 40S ribosomal protein S3a-like          183   6e-54   
ref|NP_001270826.1|  40S ribosomal protein S3a                          183   6e-54   
ref|XP_008285008.1|  PREDICTED: 40S ribosomal protein S3a               183   7e-54   
ref|XP_001501524.2|  PREDICTED: 40S ribosomal protein S3a               186   7e-54   
ref|XP_008588996.1|  PREDICTED: 40S ribosomal protein S3a-like          184   7e-54   
gb|AFM90263.1|  40S ribosomal protein S3a                               183   7e-54   
sp|A2Q0R8.1|RS3A_SOLSE  RecName: Full=40S ribosomal protein S3a         183   8e-54   
ref|XP_010410434.1|  PREDICTED: 40S ribosomal protein S3a               183   8e-54   
ref|XP_003449725.1|  PREDICTED: 40S ribosomal protein S3a-like          182   8e-54   
ref|XP_009328112.1|  PREDICTED: 40S ribosomal protein S3a               184   9e-54   
sp|Q98TX2.3|RS3A_OPHHA  RecName: Full=40S ribosomal protein S3a         182   9e-54   
ref|XP_010727857.1|  PREDICTED: 40S ribosomal protein S3a isoform X1    182   9e-54   
ref|XP_005149012.1|  PREDICTED: 40S ribosomal protein S3a isoform X3    182   1e-53   
ref|XP_005871471.1|  PREDICTED: 40S ribosomal protein S3a               185   1e-53   
gb|ELW51946.1|  40S ribosomal protein S3a                               181   1e-53   
sp|A5JSW9.1|RS3A_BOMMA  RecName: Full=40S ribosomal protein S3a         182   1e-53   
ref|XP_010773841.1|  PREDICTED: 40S ribosomal protein S3a               182   1e-53   
ref|XP_001651594.1|  AAEL005901-PB                                      182   1e-53   
ref|XP_003773191.1|  PREDICTED: 40S ribosomal protein S3a               186   2e-53   
sp|Q4T8S6.3|RS3A_TETNG  RecName: Full=40S ribosomal protein S3a         182   2e-53   
emb|CCQ18660.1|  40S ribosomal protein S3A                              181   2e-53   
dbj|BAQ21252.1|  hypothetical protein                                   179   2e-53   
sp|Q9XEG7.3|RS3A_TORRU  RecName: Full=40S ribosomal protein S3a         181   2e-53   
gb|AAK95185.1|  40S ribosomal protein S3a                               181   2e-53   
ref|XP_009040503.1|  hypothetical protein AURANDRAFT_38843              182   2e-53   
ref|XP_005542823.1|  PREDICTED: 40S ribosomal protein S3a-like          181   3e-53   
ref|NP_001131091.1|  40S ribosomal protein S3a                          181   3e-53   
gb|ACT21541.1|  s3a protein                                             181   3e-53   
ref|XP_003385841.1|  PREDICTED: 40S ribosomal protein S3a-like          181   3e-53   
gb|KIY97031.1|  small subunit ribosomal protein S3Ae                    179   4e-53   
ref|XP_005572524.1|  PREDICTED: 40S ribosomal protein S3a-like          181   4e-53   
gb|ACY95341.1|  ribosomal protein S3A                                   181   4e-53   
gb|ADI50268.1|  S3a protein                                             181   4e-53   
ref|XP_006902571.1|  PREDICTED: 40S ribosomal protein S3a-like          181   5e-53   
ref|XP_003473456.1|  PREDICTED: 40S ribosomal protein S3a-like          181   5e-53   
ref|XP_006821611.1|  PREDICTED: 40S ribosomal protein S3a-like          181   5e-53   
tpg|DAA12651.1|  TPA: ribosomal protein S3a-like                        181   5e-53   
ref|XP_001837102.1|  40S ribosomal protein S1                           180   6e-53   
ref|XP_003786993.1|  PREDICTED: 40S ribosomal protein S3a-like          180   6e-53   
ref|XP_005692628.1|  PREDICTED: 40S ribosomal protein S3a-like          180   6e-53   
ref|XP_001099771.1|  PREDICTED: 40S ribosomal protein S3a-like          180   6e-53   
gb|ELR56309.1|  hypothetical protein M91_13443                          177   7e-53   
ref|XP_005538843.1|  40S ribosomal protein S3A                          180   7e-53   
ref|XP_001774288.1|  predicted protein                                  180   7e-53   
ref|XP_006994622.1|  PREDICTED: 40S ribosomal protein S3a-like          180   8e-53   
ref|XP_004045861.1|  PREDICTED: 40S ribosomal protein S3a-like is...    180   8e-53   
dbj|BAM17666.1|  ribosomal protein S3A                                  180   8e-53   
gb|EJT50838.1|  40s ribosomal protein s3ae-a (s1-a)                     180   9e-53   
gb|ACV83781.1|  ribosomal protein S3A                                   180   9e-53   
gb|ADT80700.1|  ribosomal protein S3A                                   180   9e-53   
ref|XP_003060358.1|  predicted protein                                  180   9e-53   
gb|EHH54012.1|  hypothetical protein EGM_14744                          180   1e-52   
sp|Q95V35.1|RS3A_SPOFR  RecName: Full=40S ribosomal protein S3a         179   1e-52   
ref|XP_003740510.1|  PREDICTED: 40S ribosomal protein S3a-like          179   1e-52   
ref|XP_004420966.1|  PREDICTED: 40S ribosomal protein S3a isoform 1     180   1e-52   
gb|KDQ14611.1|  hypothetical protein BOTBODRAFT_65919                   179   1e-52   
ref|XP_005978767.1|  PREDICTED: 40S ribosomal protein S3a-like          179   2e-52   
ref|XP_006883035.1|  PREDICTED: 40S ribosomal protein S3a-like          179   2e-52   
ref|XP_009494472.1|  30S ribosomal protein S3Ae                         179   2e-52   
gb|EXX58553.1|  ribosomal 40S subunit protein S1A                       179   2e-52   
ref|NP_001037255.1|  40S ribosomal protein S3a                          179   2e-52   
ref|XP_003433155.1|  PREDICTED: 40S ribosomal protein S3a-like          179   2e-52   
gb|EHJ68722.1|  s3a protein                                             179   2e-52   
ref|XP_008071134.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    179   3e-52   
ref|XP_005771392.1|  hypothetical protein EMIHUDRAFT_316252             178   3e-52   
gb|KIM68608.1|  hypothetical protein SCLCIDRAFT_1208801                 178   3e-52   
ref|XP_007116397.1|  PREDICTED: 40S ribosomal protein S3a-like          178   3e-52   
gb|KIY51600.1|  ribosomal protein S3Ae                                  178   4e-52   
ref|XP_006872709.1|  PREDICTED: 40S ribosomal protein S3a-like          177   4e-52   
gb|AAK59927.1|AF379639_1  ribosomal protein S3a                         178   4e-52   
ref|XP_011395666.1|  40S ribosomal protein S3a                          178   5e-52   
gb|ACO12723.1|  40S ribosomal protein S3a                               178   5e-52   
ref|XP_004372235.1|  PREDICTED: 40S ribosomal protein S3a-like is...    177   5e-52   
ref|XP_003191240.1|  40s ribosomal protein s3ae-a (s1-a)                178   5e-52   
gb|KGB79628.1|  40S ribosomal protein S3ae-a                            177   6e-52   
ref|XP_002901276.1|  40S ribosomal protein S3a                          178   6e-52   
gb|EMD41078.1|  hypothetical protein CERSUDRAFT_80722                   177   6e-52   
gb|KIK30608.1|  hypothetical protein PISMIDRAFT_670675                  177   6e-52   
ref|XP_005641295.1|  PREDICTED: 40S ribosomal protein S3a-like          178   7e-52   
ref|XP_004412479.1|  PREDICTED: 40S ribosomal protein S3a-like          177   7e-52   
gb|ABE66401.1|  S phase protein                                         175   8e-52   
ref|XP_004372234.1|  PREDICTED: 40S ribosomal protein S3a-like is...    177   8e-52   
ref|XP_004844830.1|  PREDICTED: 40S ribosomal protein S3a-like          177   1e-51   
gb|KIK48635.1|  hypothetical protein CY34DRAFT_797777                   177   1e-51   
sp|A7L6A0.1|RS3A_ARTSF  RecName: Full=40S ribosomal protein S3a         177   1e-51   
gb|ABX44775.1|  putative 40S ribosomal protein RPS3A                    177   1e-51   
gb|KIM46265.1|  hypothetical protein M413DRAFT_441346                   177   1e-51   
ref|XP_568980.1|  40s ribosomal protein s3ae-a (s1-a)                   177   1e-51   
ref|XP_007843081.1|  40s ribosomal protein s3ae                         177   1e-51   
ref|XP_003038024.1|  40S ribosomal protein S1                           177   1e-51   
ref|XP_007102710.1|  PREDICTED: 40S ribosomal protein S3a-like          177   1e-51   
gb|KFB34832.1|  AGAP003532-PA-like protein                              177   1e-51   
ref|XP_004630040.1|  PREDICTED: 40S ribosomal protein S3a-like          175   1e-51   
gb|KHG19561.1|  40S ribosomal S3a                                       176   1e-51   
emb|CCM04869.1|  predicted protein                                      177   2e-51   
ref|XP_007315533.1|  hypothetical protein SERLADRAFT_382295             176   2e-51   
gb|EPS95373.1|  hypothetical protein FOMPIDRAFT_157719                  177   2e-51   
ref|XP_007382215.1|  S-phase-specific ribosomal protein cyc07           176   2e-51   
gb|ACY66591.1|  S3Ae ribosomal protein-like protein                     175   2e-51   
sp|B0CY45.2|RS3A_LACBS  RecName: Full=40S ribosomal protein S1          176   2e-51   
sp|Q764D2.1|RS3A_LENED  RecName: Full=40S ribosomal protein S1; A...    176   3e-51   



>ref|XP_010938988.1| PREDICTED: 40S ribosomal protein S3a-like [Elaeis guineensis]
Length=261

 Score =   232 bits (591),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVFS RNIGKTLV+RTQGTKIASEGLKHRVFE+SLADLQNDED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNIGKTLVSRTQGTKIASEGLKHRVFEISLADLQNDEDQAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQSLIEAHVDVKTTDNYTLRMFCIG
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQSLIEAHVDVKTTDNYTLRMFCIG  141



>gb|EPS65103.1| hypothetical protein M569_09676, partial [Genlisea aurea]
Length=165

 Score =   228 bits (581),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYD+KAPS+F+TRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED++FRKIRLR
Sbjct  30   DWYDVKAPSIFNTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDHSFRKIRLR  89

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG++VLTNFWGMDFTTDKLRSLV+KWQSLIEAHVDVKTTDNYTLRMFCI 
Sbjct  90   AEDVQGKSVLTNFWGMDFTTDKLRSLVRKWQSLIEAHVDVKTTDNYTLRMFCIA  143



>ref|XP_011026951.1| PREDICTED: 40S ribosomal protein S3a-2 [Populus euphratica]
Length=259

 Score =   231 bits (589),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 106/114 (93%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVFS +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDIKAPSVFSVKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIG
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIG  141



>ref|XP_011090682.1| PREDICTED: 40S ribosomal protein S3a [Sesamum indicum]
Length=260

 Score =   230 bits (587),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF+TRN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED+AFRKIRLR
Sbjct  28   DWYDIKAPSVFNTRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGDEDHAFRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQSLIEAHVDVKTTDNYTLRMFCI 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQSLIEAHVDVKTTDNYTLRMFCIA  141



>ref|XP_011073454.1| PREDICTED: 40S ribosomal protein S3a-like [Sesamum indicum]
Length=260

 Score =   230 bits (586),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF+TRN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED+AFRKIRLR
Sbjct  28   DWYDIKAPSVFNTRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGDEDHAFRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQSLIEAHVDVKTTDNYTLRMFCI 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQSLIEAHVDVKTTDNYTLRMFCIA  141



>ref|XP_010553762.1| PREDICTED: 40S ribosomal protein S3a-1-like [Tarenaya hassleriana]
Length=261

 Score =   229 bits (585),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVFS RN+GKTLV+RTQGTKIASEGLKHRVFE+SLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNVGKTLVSRTQGTKIASEGLKHRVFEISLADLQGDEDNAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTDNYTLR+FCI 
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDNYTLRLFCIA  141



>ref|XP_006379849.1| hypothetical protein POPTR_0008s15610g [Populus trichocarpa]
 gb|ABK95865.1| unknown [Populus trichocarpa]
 gb|ERP57646.1| hypothetical protein POPTR_0008s15610g [Populus trichocarpa]
Length=259

 Score =   229 bits (584),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVFS +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDIKAPSVFSVKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNFWGM+FT DKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIG
Sbjct  88   AEDVQGRNVLTNFWGMNFTNDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIG  141



>ref|XP_002312545.2| ribosomal protein S3a [Populus trichocarpa]
 gb|EEE89912.2| ribosomal protein S3a [Populus trichocarpa]
Length=262

 Score =   229 bits (584),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVFS +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDIKAPSVFSVKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNFWGM+FT DKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIG
Sbjct  88   AEDVQGRNVLTNFWGMNFTNDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIG  141



>gb|AFS65104.1| 40S ribosomal protein S3a-like protein [Elaeis guineensis]
Length=261

 Score =   229 bits (584),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF+ RNIGKTLV+RTQGTKIASEGLKHRVFE+SLADLQNDED A+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNIGKTLVSRTQGTKIASEGLKHRVFEISLADLQNDEDQAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIG
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIG  141



>ref|XP_010942777.1| PREDICTED: 40S ribosomal protein S3a [Elaeis guineensis]
Length=261

 Score =   229 bits (584),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF+ RNIGKTLV+RTQGTKIASEGLKHRVFE+SLADLQNDED A+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNIGKTLVSRTQGTKIASEGLKHRVFEISLADLQNDEDQAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIG
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIG  141



>sp|A7Q5X9.1|RS3A2_VITVI RecName: Full=40S ribosomal protein S3a-2 [Vitis vinifera]
Length=234

 Score =   228 bits (581),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPS+FS RN+GKTLV+RTQGTKIASEGLKHRVFE+SLADLQNDED+A+RKIRLR
Sbjct  28   DWYDIKAPSIFSVRNVGKTLVSRTQGTKIASEGLKHRVFEISLADLQNDEDHAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCI 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIA  141



>ref|XP_010546607.1| PREDICTED: 40S ribosomal protein S3a-1-like [Tarenaya hassleriana]
Length=262

 Score =   229 bits (583),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVFS RN+GKTLV+RTQGTKIASEGLKHRVFE+SLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNVGKTLVSRTQGTKIASEGLKHRVFEISLADLQGDEDNAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQ+LIEAH+DVKTTDNYTLR+FCI 
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQTLIEAHIDVKTTDNYTLRLFCIA  141



>gb|KDP23643.1| hypothetical protein JCGZ_23476 [Jatropha curcas]
Length=263

 Score =   229 bits (583),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF+ RN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDNAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLR+FCI 
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRLFCIA  141



>ref|XP_010553319.1| PREDICTED: 40S ribosomal protein S3a-1-like [Tarenaya hassleriana]
Length=261

 Score =   228 bits (582),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDIKAPSVFTVRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTDNYTLR+FCI 
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDNYTLRLFCIA  141



>gb|EYU23687.1| hypothetical protein MIMGU_mgv1a012196mg [Erythranthe guttata]
Length=259

 Score =   228 bits (582),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYD+KAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED+AFRKIRLR
Sbjct  28   DWYDVKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGDEDHAFRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLR+FCI 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRLFCIA  141



>ref|XP_002277791.1| PREDICTED: 40S ribosomal protein S3a-2-like [Vitis vinifera]
Length=261

 Score =   228 bits (582),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPS+FS RN+GKTLV+RTQGTKIASEGLKHRVFE+SLADLQNDED+A+RKIRLR
Sbjct  28   DWYDIKAPSIFSVRNVGKTLVSRTQGTKIASEGLKHRVFEISLADLQNDEDHAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCI 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIA  141



>ref|XP_004247589.1| PREDICTED: 40S ribosomal protein S3a [Solanum lycopersicum]
Length=260

 Score =   228 bits (582),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF  RN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED++FRKIRLR
Sbjct  28   DWYDIKAPSVFGVRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDHSFRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNF GMDFTTDKLRSLVKKWQSLIEAHVDVKTTD+YTLRMFCIG
Sbjct  88   AEDVQGRNVLTNFHGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDSYTLRMFCIG  141



>ref|NP_001275164.1| 40S ribosomal protein S3a-like protein [Solanum tuberosum]
 gb|ABB72801.1| 40S ribosomal protein S3a-like protein [Solanum tuberosum]
Length=260

 Score =   228 bits (581),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF  RN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED++FRKIRLR
Sbjct  28   DWYDIKAPSVFGVRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDHSFRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNF GMDFTTDKLRSLVKKWQSLIEAHVDVKTTD+YTLRMFCIG
Sbjct  88   AEDVQGRNVLTNFHGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDSYTLRMFCIG  141



>ref|XP_008811659.1| PREDICTED: LOW QUALITY PROTEIN: 40S ribosomal protein S3a-like 
[Phoenix dactylifera]
Length=261

 Score =   228 bits (581),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF+ RNIGKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIG
Sbjct  88   AEDVQGKNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIG  141



>ref|XP_010550935.1| PREDICTED: 40S ribosomal protein S3a-2-like [Tarenaya hassleriana]
Length=261

 Score =   228 bits (581),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYD+KAPSVFS RN+GKTLV+RTQGTKIASEGLKHRVFE+SLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDVKAPSVFSVRNVGKTLVSRTQGTKIASEGLKHRVFEISLADLQGDEDNAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLR+FCI 
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRLFCIA  141



>ref|XP_004985319.1| PREDICTED: 40S ribosomal protein S3a-like isoform X2 [Setaria 
italica]
Length=263

 Score =   228 bits (580),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVFS RNIGKTLV+RTQGTKIASEGLKHRVFEVSLADLQ+DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQSDEDQAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AED+QGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNY LR+FCIG
Sbjct  88   AEDIQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYMLRLFCIG  141



>ref|XP_006649574.1| PREDICTED: 40S ribosomal protein S3a-like [Oryza brachyantha]
Length=260

 Score =   228 bits (580),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF+ RNIGKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIG
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIG  141



>ref|XP_006663973.1| PREDICTED: 40S ribosomal protein S3a-like [Oryza brachyantha]
Length=261

 Score =   228 bits (580),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIG
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIG  141



>emb|CDO99096.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   228 bits (580),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVFS RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DE++AFRKIRLR
Sbjct  28   DWYDIKAPSVFSVRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEEHAFRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQSLIEAHVDVKTTDNY+LR+FCIG
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQSLIEAHVDVKTTDNYSLRLFCIG  141



>ref|XP_006663971.1| PREDICTED: 40S ribosomal protein S3a-like [Oryza brachyantha]
Length=261

 Score =   227 bits (579),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIG
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIG  141



>ref|XP_010524908.1| PREDICTED: 40S ribosomal protein S3a-2 [Tarenaya hassleriana]
 ref|XP_010524909.1| PREDICTED: 40S ribosomal protein S3a-2 [Tarenaya hassleriana]
Length=262

 Score =   227 bits (579),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVFS RN+GKTLV+RTQGTKIASEGLKHRVFE+SLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNVGKTLVSRTQGTKIASEGLKHRVFEISLADLQGDEDNAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIE+HVDVKTTDNYTLR+FCI 
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIESHVDVKTTDNYTLRLFCIA  141



>ref|XP_003610736.1| 40S ribosomal protein S3a-like protein [Medicago truncatula]
 gb|AES93694.1| 40S ribosomal protein S3a-1 [Medicago truncatula]
Length=261

 Score =   227 bits (579),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF  +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNAFRKIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAFRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+N+LTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIG
Sbjct  88   AEDVQGKNLLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIG  141



>gb|EPS71864.1| hypothetical protein M569_02887, partial [Genlisea aurea]
Length=266

 Score =   228 bits (580),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYD+KAPS+F+TRN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED++FRKIRLR
Sbjct  34   DWYDVKAPSIFNTRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDHSFRKIRLR  93

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG++VLTNFWGMDFTTDKLRSLV+KWQSLIEAHVDVKTTDNYTLR+FCI 
Sbjct  94   AEDVQGKSVLTNFWGMDFTTDKLRSLVRKWQSLIEAHVDVKTTDNYTLRLFCIA  147



>ref|XP_010034641.1| PREDICTED: 40S ribosomal protein S3a [Eucalyptus grandis]
Length=261

 Score =   227 bits (579),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVFS +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED+A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            +EDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIG
Sbjct  88   SEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIG  141



>ref|XP_002517085.1| 40S ribosomal protein S3a, putative [Ricinus communis]
 gb|EEF45248.1| 40S ribosomal protein S3a, putative [Ricinus communis]
Length=260

 Score =   227 bits (579),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF  +N+GKTLVTRTQGTKIASEGLKHRVFE+SLADLQ DED+A+RKIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVTRTQGTKIASEGLKHRVFEISLADLQGDEDHAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIG
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIG  141



>ref|XP_006663974.1| PREDICTED: 40S ribosomal protein S3a-like [Oryza brachyantha]
Length=261

 Score =   227 bits (579),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIG
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIG  141



>ref|XP_007034836.1| Ribosomal protein S3Ae isoform 2 [Theobroma cacao]
 gb|EOY05762.1| Ribosomal protein S3Ae isoform 2 [Theobroma cacao]
Length=246

 Score =   227 bits (578),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 106/115 (92%), Positives = 113/115 (98%), Gaps = 1/115 (1%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRL  341
            DWYDIKAPSVF+TRN+GKTLVTRTQGTKIASEGLKHRVFE+SLADLQ  DED+A+RKIRL
Sbjct  12   DWYDIKAPSVFTTRNVGKTLVTRTQGTKIASEGLKHRVFEISLADLQGGDEDHAYRKIRL  71

Query  342  RAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            RAEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIG
Sbjct  72   RAEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIG  126



>ref|XP_006284351.1| hypothetical protein CARUB_v10005523mg [Capsella rubella]
 gb|EOA17249.1| hypothetical protein CARUB_v10005523mg [Capsella rubella]
Length=262

 Score =   227 bits (579),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYD+KAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDEDNA+RKIRLR
Sbjct  28   DWYDVKAPSSFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDNAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQSLIEAHVDVKT+D YTLRMFCIG
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTSDGYTLRMFCIG  141



>gb|ABK24527.1| unknown [Picea sitchensis]
Length=165

 Score =   224 bits (570),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYD+KAPS F+TR +GKTLVTRTQGTKIASEGLKHRVFE+SLADLQNDED AFRKI+LR
Sbjct  28   DWYDVKAPSTFNTRTVGKTLVTRTQGTKIASEGLKHRVFELSLADLQNDEDQAFRKIKLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLRMFCIG
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRMFCIG  141



>dbj|BAA05057.1| cyc07 [Catharanthus roseus]
Length=245

 Score =   226 bits (577),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVFS RN+GKTLVTRTQGTKIASEGLKHRVFE+SLADLQ DED++FRKIRLR
Sbjct  28   DWYDIKAPSVFSVRNVGKTLVTRTQGTKIASEGLKHRVFEISLADLQGDEDHSFRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AED+QG+NVLTNFWGMDFTTDKLRSLV+KWQSLIEAHVDVKTTD+YTLRMFCIG
Sbjct  88   AEDIQGKNVLTNFWGMDFTTDKLRSLVRKWQSLIEAHVDVKTTDSYTLRMFCIG  141



>ref|XP_004958212.1| PREDICTED: 40S ribosomal protein S3a-like [Setaria italica]
Length=262

 Score =   227 bits (579),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVFS RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ+DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQSDEDQAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIG
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIG  141



>sp|P49198.2|RS3A_HELAN RecName: Full=40S ribosomal protein S3a [Helianthus annuus]
 gb|AAA80978.1| ribosomal protein S3a [Helianthus annuus]
Length=260

 Score =   227 bits (578),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPS+F TRN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED+++RKIRLR
Sbjct  28   DWYDIKAPSLFITRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDHSYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGMD TTDKLRSLVKKWQSLIEAHVDVKTTDN+TLRMFCIG
Sbjct  88   AEDVQGKNVLTNFWGMDVTTDKLRSLVKKWQSLIEAHVDVKTTDNFTLRMFCIG  141



>ref|XP_007034835.1| Ribosomal protein S3Ae isoform 1 [Theobroma cacao]
 gb|EOY05761.1| Ribosomal protein S3Ae isoform 1 [Theobroma cacao]
Length=262

 Score =   227 bits (578),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 106/115 (92%), Positives = 113/115 (98%), Gaps = 1/115 (1%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRL  341
            DWYDIKAPSVF+TRN+GKTLVTRTQGTKIASEGLKHRVFE+SLADLQ  DED+A+RKIRL
Sbjct  28   DWYDIKAPSVFTTRNVGKTLVTRTQGTKIASEGLKHRVFEISLADLQGGDEDHAYRKIRL  87

Query  342  RAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            RAEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIG
Sbjct  88   RAEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIG  142



>ref|NP_001265990.1| 40S ribosomal protein S3a [Cicer arietinum]
 sp|Q8GTE3.1|RS3A_CICAR RecName: Full=40S ribosomal protein S3a [Cicer arietinum]
 emb|CAD56219.1| ribosomal protein S3a [Cicer arietinum]
Length=261

 Score =   226 bits (577),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF  +N+GKTLV+RTQGTKIASEGLKHRVFE+SLADLQ DEDNAFRKIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVSRTQGTKIASEGLKHRVFEISLADLQGDEDNAFRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNF+GMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIG
Sbjct  88   AEDVQGKNVLTNFYGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIG  141



>ref|XP_004985318.1| PREDICTED: 40S ribosomal protein S3a-like isoform X1 [Setaria 
italica]
Length=290

 Score =   228 bits (580),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVFS RNIGKTLV+RTQGTKIASEGLKHRVFEVSLADLQ+DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQSDEDQAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AED+QGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNY LR+FCIG
Sbjct  88   AEDIQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYMLRLFCIG  141



>ref|XP_011030646.1| PREDICTED: 40S ribosomal protein S3a-2-like [Populus euphratica]
Length=259

 Score =   226 bits (577),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVFS +N+GKTLVTRTQGTKIASEGLKHRVFE+SLADLQ DED+A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVKNVGKTLVTRTQGTKIASEGLKHRVFEISLADLQGDEDHAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNFWGM+FT DKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIG
Sbjct  88   AEDVQGRNVLTNFWGMNFTNDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIG  141



>sp|P33444.4|RS3A_CATRO RecName: Full=40S ribosomal protein S3a; AltName: Full=CYC07 
protein [Catharanthus roseus]
Length=261

 Score =   226 bits (577),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVFS RN+GKTLVTRTQGTKIASEGL+HRVFE+SLADLQ DED++FRKIRLR
Sbjct  28   DWYDIKAPSVFSVRNVGKTLVTRTQGTKIASEGLEHRVFEISLADLQGDEDHSFRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AED+QG+NVLTNFWGMDFTTDKLRSLV+KWQSLIEAHVDVKTTD+YTLRMFCIG
Sbjct  88   AEDIQGKNVLTNFWGMDFTTDKLRSLVRKWQSLIEAHVDVKTTDSYTLRMFCIG  141



>gb|KHN30486.1| 40S ribosomal protein S3a, partial [Glycine soja]
Length=242

 Score =   226 bits (575),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF  +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED+AF+KIRLR
Sbjct  9    DWYDIKAPSVFQVKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHAFKKIRLR  68

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIG
Sbjct  69   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIG  122



>gb|ACU17112.1| unknown [Glycine max]
Length=227

 Score =   225 bits (574),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF  +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED+AF+KIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHAFKKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIG
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIG  141



>ref|XP_002463138.1| hypothetical protein SORBIDRAFT_02g038370 [Sorghum bicolor]
 gb|EER99659.1| hypothetical protein SORBIDRAFT_02g038370 [Sorghum bicolor]
Length=263

 Score =   226 bits (576),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVFS RNIGKTLV+RTQGTKIASEGLKHRVFEVSLADLQ+DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQSDEDQAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AED+QGRNVLTNFWGM FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIG
Sbjct  88   AEDIQGRNVLTNFWGMSFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIG  141



>ref|NP_001046578.1| Os02g0287000 [Oryza sativa Japonica Group]
 dbj|BAD21513.1| putative ribosomal protein S3a, cytosolic [Oryza sativa Japonica 
Group]
 dbj|BAD21711.1| putative ribosomal protein S3a, cytosolic [Oryza sativa Japonica 
Group]
 dbj|BAF08492.1| Os02g0287000 [Oryza sativa Japonica Group]
 gb|EAY85405.1| hypothetical protein OsI_06784 [Oryza sativa Indica Group]
Length=261

 Score =   226 bits (576),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAP+VFS RNIGKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RK+RLR
Sbjct  28   DWYDIKAPTVFSVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKVRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNFWGM FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIG
Sbjct  88   AEDVQGRNVLTNFWGMSFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIG  141



>gb|ABK56834.1| RPS3 [Cymbidium hybrid cultivar]
Length=261

 Score =   226 bits (576),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF+ RNIGKTLV+RTQGTKIASEGLKHRVFE+SLADLQNDED ++RKIRLR
Sbjct  28   DWYDIKAPSVFTVRNIGKTLVSRTQGTKIASEGLKHRVFEISLADLQNDEDQSYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAH+DVKTTDNYTLR+FCIG
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHIDVKTTDNYTLRLFCIG  141



>ref|XP_008804511.1| PREDICTED: 40S ribosomal protein S3a [Phoenix dactylifera]
Length=261

 Score =   226 bits (576),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF+ RNIGKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLRMFCIG
Sbjct  88   AEDVQGKNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRMFCIG  141



>dbj|BAA00860.1| cyc07 [Catharanthus roseus]
Length=245

 Score =   225 bits (574),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVFS RN+GKTLVTRTQGTKIASEGL+HRVFE+SLADLQ DED++FRKIRLR
Sbjct  28   DWYDIKAPSVFSVRNVGKTLVTRTQGTKIASEGLEHRVFEISLADLQGDEDHSFRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AED+QG+NVLTNFWGMDFTTDKLRSLV+KWQSLIEAHVDVKTTD+YTLRMFCIG
Sbjct  88   AEDIQGKNVLTNFWGMDFTTDKLRSLVRKWQSLIEAHVDVKTTDSYTLRMFCIG  141



>ref|XP_010256142.1| PREDICTED: 40S ribosomal protein S3a-1-like [Nelumbo nucifera]
Length=261

 Score =   226 bits (575),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPS+F+TRN+GKTLVTRTQGTKIASEGLKHRVFE+SLADLQ D+D ++RKIRLR
Sbjct  28   DWYDIKAPSIFTTRNVGKTLVTRTQGTKIASEGLKHRVFEISLADLQADDDQSYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIG
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIG  141



>ref|NP_001241005.1| uncharacterized protein LOC100805519 [Glycine max]
 gb|ACU23898.1| unknown [Glycine max]
Length=261

 Score =   226 bits (575),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF  +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED+AF+KIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHAFKKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIG
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIG  141



>gb|KHN02741.1| 40S ribosomal protein S3a [Glycine soja]
Length=261

 Score =   226 bits (575),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF  +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED+AF+KIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHAFKKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIG
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIG  141



>ref|XP_010259119.1| PREDICTED: 40S ribosomal protein S3a-1 [Nelumbo nucifera]
Length=261

 Score =   226 bits (575),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPS+F+TRN+GKTLVTRTQGTKIASEGLKHRVFE+SLADLQ D+D ++RKIRLR
Sbjct  28   DWYDIKAPSIFTTRNVGKTLVTRTQGTKIASEGLKHRVFEISLADLQADDDQSYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIG
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIG  141



>ref|XP_002314671.2| ribosomal protein S3a [Populus trichocarpa]
 gb|ABK93373.1| unknown [Populus trichocarpa]
 gb|ABK93864.1| unknown [Populus trichocarpa]
 gb|EEF00842.2| ribosomal protein S3a [Populus trichocarpa]
Length=260

 Score =   225 bits (574),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVFS +N+GKTLVTRTQGTKIASEGLKHRVFE+SLADLQ DED+A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVKNVGKTLVTRTQGTKIASEGLKHRVFEISLADLQGDEDHAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGM+FT DKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIG
Sbjct  88   AEDVQGKNVLTNFWGMNFTNDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIG  141



>ref|XP_003572000.1| PREDICTED: 40S ribosomal protein S3a [Brachypodium distachyon]
Length=265

 Score =   225 bits (574),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            +WYDIKAP +F+TRN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLR
Sbjct  28   EWYDIKAPLLFNTRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTDNY +RMFCIG
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMIRMFCIG  141



>gb|ABK22319.1| unknown [Picea sitchensis]
Length=245

 Score =   224 bits (572),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYD+KAPS F+TR +GKTLVTRTQGTKIASEGLKHRVFE+SLADLQNDED AFRKI+LR
Sbjct  12   DWYDVKAPSTFNTRTVGKTLVTRTQGTKIASEGLKHRVFELSLADLQNDEDQAFRKIKLR  71

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLRMFCIG
Sbjct  72   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRMFCIG  125



>ref|NP_001066631.1| Os12g0406200 [Oryza sativa Japonica Group]
 gb|ABG21991.1| 40S ribosomal protein S3a, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF29650.1| Os12g0406200 [Oryza sativa Japonica Group]
Length=260

 Score =   225 bits (573),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGM FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIG
Sbjct  88   AEDVQGKNVLTNFWGMSFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIG  141



>gb|KDP40219.1| hypothetical protein JCGZ_02217 [Jatropha curcas]
Length=262

 Score =   225 bits (573),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPS FS +N+GKTLV+RTQGTKIASEGLKHRVF++SLADLQ DED AFRKIRLR
Sbjct  28   DWYDIKAPSAFSVKNVGKTLVSRTQGTKIASEGLKHRVFDISLADLQGDEDYAFRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIG
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIG  141



>gb|AFK33413.1| unknown [Lotus japonicus]
Length=261

 Score =   225 bits (573),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPS+F  +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNAFRKIRLR
Sbjct  28   DWYDIKAPSLFQVKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAFRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCI 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIA  141



>ref|XP_010675082.1| PREDICTED: 40S ribosomal protein S3a [Beta vulgaris subsp. vulgaris]
Length=262

 Score =   225 bits (573),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPS+FS RN+GKTLVTRTQGTKIASEGLKHRVFE+SLADLQNDED  FRKIRLR
Sbjct  28   DWYDIKAPSIFSVRNVGKTLVTRTQGTKIASEGLKHRVFEISLADLQNDEDQFFRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNF+GMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDN+TLRMFCI 
Sbjct  88   AEDVQGRNVLTNFYGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNFTLRMFCIA  141



>emb|CDO98656.1| unnamed protein product [Coffea canephora]
Length=261

 Score =   224 bits (572),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF  RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED+AF+KIRLR
Sbjct  28   DWYDIKAPSVFEVRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQKDEDHAFKKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGM+FTTDK+RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIG
Sbjct  88   AEDVQGKNVLTNFWGMNFTTDKVRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIG  141



>ref|XP_006408143.1| hypothetical protein EUTSA_v10021341mg [Eutrema salsugineum]
 gb|ESQ49596.1| hypothetical protein EUTSA_v10021341mg [Eutrema salsugineum]
Length=262

 Score =   224 bits (572),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYD+KAPS+FS RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDEDNA+RKIRLR
Sbjct  28   DWYDVKAPSIFSQRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDNAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVL  FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD+YTLR+FCI 
Sbjct  88   AEDVQGRNVLCQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTLRLFCIA  141



>gb|ACR37738.1| unknown [Zea mays]
 gb|AFW89327.1| hypothetical protein ZEAMMB73_166147 [Zea mays]
Length=175

 Score =   221 bits (564),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVFS RNIGKTLV+RTQGT+IASEGLKHRVFEV LADLQ DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNIGKTLVSRTQGTRIASEGLKHRVFEVCLADLQGDEDQAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNFWGM+FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIG
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIG  141



>dbj|BAJ93929.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=262

 Score =   224 bits (572),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAP++F+TRNIGKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED AFRKIRLR
Sbjct  28   DWYDIKAPTLFNTRNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDQAFRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNY LR+FCIG
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYMLRLFCIG  141



>ref|XP_010274385.1| PREDICTED: 40S ribosomal protein S3a-like [Nelumbo nucifera]
Length=261

 Score =   224 bits (572),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIK PS+FS R IGKTLVTRTQGTKIASEGLKHRVFEV LADLQND+D ++RKIRLR
Sbjct  28   DWYDIKVPSIFSVRTIGKTLVTRTQGTKIASEGLKHRVFEVCLADLQNDDDQSYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIG
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIG  141



>gb|KJB34507.1| hypothetical protein B456_006G069600 [Gossypium raimondii]
Length=262

 Score =   224 bits (572),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 105/115 (91%), Positives = 113/115 (98%), Gaps = 1/115 (1%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRL  341
            DWYDIKAPSVF++RN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ  DED+AFRKIRL
Sbjct  28   DWYDIKAPSVFTSRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGGDEDHAFRKIRL  87

Query  342  RAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            RAEDVQG+NVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIG
Sbjct  88   RAEDVQGKNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIG  142



>ref|XP_007030615.1| Ribosomal protein S3Ae [Theobroma cacao]
 gb|EOY11117.1| Ribosomal protein S3Ae [Theobroma cacao]
Length=261

 Score =   224 bits (572),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF+ RNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFNERNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDQAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIE+HVDVKTTDNY+LR+FCI 
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIESHVDVKTTDNYSLRLFCIA  141



>gb|KHG05975.1| 40S ribosomal S3a [Gossypium arboreum]
 gb|KHG27725.1| 40S ribosomal S3a [Gossypium arboreum]
Length=262

 Score =   224 bits (572),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 105/115 (91%), Positives = 113/115 (98%), Gaps = 1/115 (1%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRL  341
            DWYDIKAPSVF+TRN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ  DED+A+RKIRL
Sbjct  28   DWYDIKAPSVFTTRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGGDEDHAYRKIRL  87

Query  342  RAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            RAEDVQG+NVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIG
Sbjct  88   RAEDVQGKNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIG  142



>ref|NP_001241430.1| uncharacterized protein LOC100813273 [Glycine max]
 gb|ACU21516.1| unknown [Glycine max]
 gb|KHN15736.1| 40S ribosomal protein S3a [Glycine soja]
Length=261

 Score =   224 bits (571),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPS+F  +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED+AF+KIRLR
Sbjct  28   DWYDIKAPSLFQVKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHAFKKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIG
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIG  141



>ref|XP_010272784.1| PREDICTED: 40S ribosomal protein S3a-like [Nelumbo nucifera]
Length=261

 Score =   224 bits (571),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF+ R +GKTLVTRTQGTKIASEGLKHRVFEV LADLQND+D ++RKIRLR
Sbjct  28   DWYDIKAPSVFNVRTVGKTLVTRTQGTKIASEGLKHRVFEVCLADLQNDDDQSYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIG
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIG  141



>ref|XP_002463137.1| hypothetical protein SORBIDRAFT_02g038365 [Sorghum bicolor]
 gb|EER99658.1| hypothetical protein SORBIDRAFT_02g038365 [Sorghum bicolor]
Length=263

 Score =   224 bits (571),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVFS R+IGKTLV+RTQGTKIASEGLKHRVFEVSLADLQ+DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRDIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQSDEDQAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AED+QGRNVLTNFWGM FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIG
Sbjct  88   AEDIQGRNVLTNFWGMSFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIG  141



>gb|ACU18272.1| unknown [Glycine max]
Length=261

 Score =   224 bits (571),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF  +N+GKTLV+RTQGTK ASEGLKHRVFEVSLADLQ DED+AF+KIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVSRTQGTKTASEGLKHRVFEVSLADLQGDEDHAFKKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIG
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIG  141



>ref|XP_002283142.1| PREDICTED: 40S ribosomal protein S3a-1 [Vitis vinifera]
 sp|A5B4K1.1|RS3A1_VITVI RecName: Full=40S ribosomal protein S3a-1 [Vitis vinifera]
 emb|CAN67522.1| hypothetical protein VITISV_020206 [Vitis vinifera]
 emb|CBI26295.3| unnamed protein product [Vitis vinifera]
Length=261

 Score =   224 bits (571),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF  RN+GKTLV+RTQGTKIASEGLKHRVFE+SLADLQ DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFEVRNVGKTLVSRTQGTKIASEGLKHRVFEISLADLQADEDQAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLR+FCI 
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRLFCIA  141



>ref|XP_010229024.1| PREDICTED: 40S ribosomal protein S3a-like [Brachypodium distachyon]
Length=264

 Score =   224 bits (571),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            +WYDIKAP +FSTRN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED AFRKIRLR
Sbjct  28   EWYDIKAPLLFSTRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQADEDQAFRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNY LRMFCIG
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYMLRMFCIG  141



>gb|AAC98779.1| S-phase-specific ribosomal protein [Oryza sativa Japonica Group]
Length=261

 Score =   224 bits (570),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAP+VFS RNIGKTLV+RTQGTKIASEGLKHRVFEVSLADL+NDED A+RK+RLR
Sbjct  28   DWYDIKAPTVFSVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLRNDEDQAYRKVRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNFWGM FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIG
Sbjct  88   AEDVQGRNVLTNFWGMSFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIG  141



>ref|NP_001239858.1| uncharacterized protein LOC100808747 [Glycine max]
 gb|ACU23875.1| unknown [Glycine max]
 gb|KHN35171.1| 40S ribosomal protein S3a [Glycine soja]
Length=261

 Score =   224 bits (570),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPS+F  +NIGKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED++F+KIRLR
Sbjct  28   DWYDIKAPSLFQVKNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHSFKKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIG
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIG  141



>ref|XP_009779517.1| PREDICTED: 40S ribosomal protein S3a [Nicotiana sylvestris]
 sp|Q285L8.1|RS3A_TOBAC RecName: Full=40S ribosomal protein S3a; AltName: Full=Protein 
cyc07 [Nicotiana tabacum]
 gb|ABA41527.1| cyc07 [Nicotiana tabacum]
Length=261

 Score =   224 bits (570),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF  +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED +FRKIRLR
Sbjct  28   DWYDIKAPSVFDIKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDQSFRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD+YTLRMFCI 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTLRMFCIA  141



>ref|NP_001152574.1| 40S ribosomal protein S3a [Zea mays]
 gb|ACG48293.1| 40S ribosomal protein S3a [Zea mays]
 gb|AFW89328.1| 40S ribosomal protein S3a [Zea mays]
Length=260

 Score =   224 bits (570),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVFS RNIGKTLV+RTQGT+IASEGLKHRVFEV LADLQ DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNIGKTLVSRTQGTRIASEGLKHRVFEVCLADLQGDEDQAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNFWGM+FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIG
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIG  141



>ref|XP_009628663.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122} 
[Nicotiana tomentosiformis]
 ref|XP_009763951.1| PREDICTED: 40S ribosomal protein S3a-like [Nicotiana sylvestris]
Length=261

 Score =   224 bits (570),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF  +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED AFRKIRLR
Sbjct  28   DWYDIKAPSVFDIKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDQAFRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLRMFCI 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRMFCIA  141



>gb|KJB28386.1| hypothetical protein B456_005G045000 [Gossypium raimondii]
Length=255

 Score =   223 bits (569),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 113/115 (98%), Gaps = 1/115 (1%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRL  341
            DWYDIKAPSVF++RN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ  DED+A+RKIRL
Sbjct  28   DWYDIKAPSVFTSRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGGDEDHAYRKIRL  87

Query  342  RAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            RAEDVQG+NVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIG
Sbjct  88   RAEDVQGKNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIG  142



>gb|EEE56753.1| hypothetical protein OsJ_06287 [Oryza sativa Japonica Group]
Length=399

 Score =   228 bits (581),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAP+VFS RNIGKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RK+RLR
Sbjct  28   DWYDIKAPTVFSVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKVRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNFWGM FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIG
Sbjct  88   AEDVQGRNVLTNFWGMSFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIG  141



>ref|XP_009775368.1| PREDICTED: 40S ribosomal protein S3a-like [Nicotiana sylvestris]
Length=261

 Score =   224 bits (570),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF  +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED AFRKIRLR
Sbjct  28   DWYDIKAPSVFDIKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDQAFRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLRMFCI 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRMFCIA  141



>ref|XP_002512232.1| 40S ribosomal protein S3a, putative [Ricinus communis]
 gb|EEF49684.1| 40S ribosomal protein S3a, putative [Ricinus communis]
Length=263

 Score =   224 bits (570),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF  RN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED+A+RKIRLR
Sbjct  28   DWYDIKAPSVFKVRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDHAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIE+HVDVKTTDNYTLR+FCI 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIESHVDVKTTDNYTLRLFCIA  141



>ref|XP_009591686.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122}-like 
[Nicotiana tomentosiformis]
Length=261

 Score =   223 bits (569),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF  +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED AFRKIRLR
Sbjct  28   DWYDIKAPSVFDIKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDQAFRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLRMFCI 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRMFCIA  141



>ref|XP_009618011.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122}-like 
[Nicotiana tomentosiformis]
Length=260

 Score =   223 bits (569),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF  +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED +FRKIRLR
Sbjct  28   DWYDIKAPSVFDIKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDQSFRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD+YTLRMFCI 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTLRMFCIA  141



>ref|XP_004145387.1| PREDICTED: 40S ribosomal protein S3a-like [Cucumis sativus]
 ref|XP_004153483.1| PREDICTED: 40S ribosomal protein S3a-like [Cucumis sativus]
 gb|KGN61672.1| hypothetical protein Csa_2G223140 [Cucumis sativus]
Length=260

 Score =   223 bits (569),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF+ +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DE++A+RKIRLR
Sbjct  28   DWYDIKAPSVFTVKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQEDEEHAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNFWGM+FTTDKLRSLV+KW +LIEAHVDVKTTDNYTLRMFCIG
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVRKWHTLIEAHVDVKTTDNYTLRMFCIG  141



>gb|KFK37895.1| hypothetical protein AALP_AA3G043200 [Arabis alpina]
Length=261

 Score =   223 bits (569),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYD+KAPS+F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDEDNA+RKIRLR
Sbjct  28   DWYDVKAPSIFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDNAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLT FWGMDFTTDKLRSLVKKWQ+LIE HVDVKTTD+YTLRMFCI 
Sbjct  88   AEDVQGKNVLTQFWGMDFTTDKLRSLVKKWQTLIECHVDVKTTDSYTLRMFCIA  141



>ref|NP_001141038.1| hypothetical protein [Zea mays]
 ref|XP_008660439.1| PREDICTED: 40S ribosomal protein S3a [Zea mays]
 gb|ACF79246.1| unknown [Zea mays]
 gb|ACF85254.1| unknown [Zea mays]
 gb|AFW89336.1| hypothetical protein ZEAMMB73_605321 [Zea mays]
Length=260

 Score =   223 bits (569),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVFS RNIGKTLV+RTQGT+IASEGLKHRVFEV LADLQ DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNIGKTLVSRTQGTRIASEGLKHRVFEVCLADLQGDEDQAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNFWGM+FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIG
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIG  141



>ref|NP_001049289.1| Os03g0200500 [Oryza sativa Japonica Group]
 sp|P49397.2|RS3A_ORYSJ RecName: Full=40S ribosomal protein S3a; AltName: Full=CYC07 
protein [Oryza sativa Japonica Group]
 pdb|3J60|B Chain B, Localization Of The Small Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 dbj|BAA05059.1| cyc07 [Oryza sativa]
 gb|ABF94491.1| 40S ribosomal protein S3a, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11203.1| Os03g0200500 [Oryza sativa Japonica Group]
 gb|EAY88924.1| hypothetical protein OsI_10409 [Oryza sativa Indica Group]
 gb|EAZ25948.1| hypothetical protein OsJ_09804 [Oryza sativa Japonica Group]
 dbj|BAG91340.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96538.1| unnamed protein product [Oryza sativa Japonica Group]
Length=262

 Score =   223 bits (569),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF+ RNIGKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGM FTTDKLRSLVKKWQ+LIEAHVDVKTTD Y LR+FCIG
Sbjct  88   AEDVQGKNVLTNFWGMSFTTDKLRSLVKKWQTLIEAHVDVKTTDGYMLRLFCIG  141



>ref|XP_008449325.1| PREDICTED: 40S ribosomal protein S3a-like [Cucumis melo]
Length=260

 Score =   223 bits (569),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF+ +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DE++A+RKIRLR
Sbjct  28   DWYDIKAPSVFTVKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQEDEEHAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNFWGM+FTTDKLRSLV+KW +LIEAHVDVKTTDNYTLRMFCIG
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVRKWHTLIEAHVDVKTTDNYTLRMFCIG  141



>ref|XP_006848758.1| hypothetical protein AMTR_s00026p00042160 [Amborella trichopoda]
 gb|ERN10339.1| hypothetical protein AMTR_s00026p00042160 [Amborella trichopoda]
Length=261

 Score =   223 bits (569),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPS+F+ R +GKTLVTRTQGTKIASEGLKHRVFE  LADLQNDED A++KIRLR
Sbjct  28   DWYDIKAPSIFNVRTVGKTLVTRTQGTKIASEGLKHRVFECCLADLQNDEDQAYKKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AED+QGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIG
Sbjct  88   AEDIQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIG  141



>ref|XP_003559021.1| PREDICTED: 40S ribosomal protein S3a-like [Brachypodium distachyon]
Length=265

 Score =   223 bits (569),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            +WYDIKAP +FSTRN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED A+RKIRLR
Sbjct  28   EWYDIKAPLIFSTRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQADEDQAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNY LRMFCIG
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYMLRMFCIG  141



>gb|KHG19560.1| 40S ribosomal S3a [Gossypium arboreum]
 gb|KJB28387.1| hypothetical protein B456_005G045000 [Gossypium raimondii]
Length=262

 Score =   223 bits (569),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 113/115 (98%), Gaps = 1/115 (1%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRL  341
            DWYDIKAPSVF++RN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ  DED+A+RKIRL
Sbjct  28   DWYDIKAPSVFTSRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGGDEDHAYRKIRL  87

Query  342  RAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            RAEDVQG+NVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIG
Sbjct  88   RAEDVQGKNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIG  142



>ref|XP_008438626.1| PREDICTED: 40S ribosomal protein S3a [Cucumis melo]
Length=261

 Score =   223 bits (569),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF+ +N+GKTLVTRTQGTKIASEGLKHRVFE+SLADLQ DE++A+RKIRLR
Sbjct  28   DWYDIKAPSVFTVKNVGKTLVTRTQGTKIASEGLKHRVFEISLADLQEDEEHAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNFWGM+FTTDKLRSLV+KW +LIEAHVDVKTTDNYTLRMFCIG
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVRKWHTLIEAHVDVKTTDNYTLRMFCIG  141



>ref|XP_004134125.1| PREDICTED: 40S ribosomal protein S3a-like [Cucumis sativus]
 ref|XP_004166384.1| PREDICTED: 40S ribosomal protein S3a-like [Cucumis sativus]
 gb|KGN56950.1| hypothetical protein Csa_3G146360 [Cucumis sativus]
Length=261

 Score =   223 bits (569),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF+ +N+GKTLVTRTQGTKIASEGLKHRVFE+SLADLQ DE++A+RKIRLR
Sbjct  28   DWYDIKAPSVFTVKNVGKTLVTRTQGTKIASEGLKHRVFEISLADLQEDEEHAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNFWGM+FTTDKLRSLV+KW +LIEAHVDVKTTDNYTLRMFCIG
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVRKWHTLIEAHVDVKTTDNYTLRMFCIG  141



>emb|CDY17474.1| BnaC03g65890D [Brassica napus]
Length=245

 Score =   223 bits (567),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ+DED+A+RKIRLR
Sbjct  28   DWYDIKAPSNFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQSDEDHAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD+YTLRMFCIG
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTLRMFCIG  141



>gb|KJB28382.1| hypothetical protein B456_005G045000 [Gossypium raimondii]
Length=248

 Score =   223 bits (567),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 113/115 (98%), Gaps = 1/115 (1%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRL  341
            DWYDIKAPSVF++RN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ  DED+A+RKIRL
Sbjct  28   DWYDIKAPSVFTSRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGGDEDHAYRKIRL  87

Query  342  RAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            RAEDVQG+NVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIG
Sbjct  88   RAEDVQGKNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIG  142



>gb|AFW89330.1| 40S ribosomal protein S3a [Zea mays]
 gb|AFW89331.1| 40S ribosomal protein S3a [Zea mays]
 gb|AFW89332.1| 40S ribosomal protein S3a [Zea mays]
Length=330

 Score =   225 bits (574),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVFS RNIGKTLV+RTQGT+IASEGLKHRVFEV LADLQ DED A+RKIRLR
Sbjct  98   DWYDIKAPSVFSVRNIGKTLVSRTQGTRIASEGLKHRVFEVCLADLQGDEDQAYRKIRLR  157

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNFWGM+FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIG
Sbjct  158  AEDVQGRNVLTNFWGMNFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIG  211



>gb|AFW89335.1| 40S ribosomal protein S3a [Zea mays]
Length=332

 Score =   225 bits (574),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVFS RNIGKTLV+RTQGT+IASEGLKHRVFEV LADLQ DED A+RKIRLR
Sbjct  100  DWYDIKAPSVFSVRNIGKTLVSRTQGTRIASEGLKHRVFEVCLADLQGDEDQAYRKIRLR  159

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNFWGM+FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIG
Sbjct  160  AEDVQGRNVLTNFWGMNFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIG  213



>ref|NP_195193.1| 40S ribosomal protein S3a-2 [Arabidopsis thaliana]
 sp|Q42262.3|RS3A2_ARATH RecName: Full=40S ribosomal protein S3a-2 [Arabidopsis thaliana]
 emb|CAA04689.1| Putative S-phase-specific ribosomal protein [Arabidopsis thaliana]
 emb|CAA18846.1| Putative S-phase-specific ribosomal protein [Arabidopsis thaliana]
 emb|CAB80184.1| Putative S-phase-specific ribosomal protein [Arabidopsis thaliana]
 gb|AAL32578.1| Putative S-phase-specific ribosomal protein [Arabidopsis thaliana]
 gb|AEE86408.1| 40S ribosomal protein S3a-2 [Arabidopsis thaliana]
Length=262

 Score =   223 bits (568),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYD+KAP  F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDEDNA+RKIRLR
Sbjct  28   DWYDVKAPGSFTNRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDNAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD YTLRMFCI 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDGYTLRMFCIA  141



>ref|XP_007143300.1| hypothetical protein PHAVU_007G060700g [Phaseolus vulgaris]
 gb|ESW15294.1| hypothetical protein PHAVU_007G060700g [Phaseolus vulgaris]
Length=261

 Score =   223 bits (568),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF  +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED++FRKIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHSFRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AED+QG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLRMFCIG
Sbjct  88   AEDIQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRMFCIG  141



>tpg|DAA43947.1| TPA: hypothetical protein ZEAMMB73_528269, partial [Zea mays]
Length=188

 Score =   220 bits (561),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVFS RNIGKTLV+RTQGT+IAS+GLKHRVFEV LADLQ DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNIGKTLVSRTQGTRIASDGLKHRVFEVCLADLQGDEDQAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNFWGM+FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIG
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIG  141



>ref|XP_002463139.1| hypothetical protein SORBIDRAFT_02g038380 [Sorghum bicolor]
 gb|EER99660.1| hypothetical protein SORBIDRAFT_02g038380 [Sorghum bicolor]
Length=218

 Score =   221 bits (564),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVFS RNIGKTLV+RTQGTKIASEGLKHRVFE SLADLQ+DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNIGKTLVSRTQGTKIASEGLKHRVFEASLADLQSDEDQAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNFWGM FTTDKLRSLVKKWQ+L EAHVDVKTTDNY LR+FCIG
Sbjct  88   AEDVQGRNVLTNFWGMSFTTDKLRSLVKKWQTLTEAHVDVKTTDNYMLRLFCIG  141



>gb|KHG11221.1| 40S ribosomal S3a [Gossypium arboreum]
Length=262

 Score =   223 bits (567),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 113/115 (98%), Gaps = 1/115 (1%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRL  341
            DWYDIKAPSVF++RN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ  DED+A+RKIRL
Sbjct  28   DWYDIKAPSVFTSRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGGDEDHAYRKIRL  87

Query  342  RAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            RAEDVQG+NVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIG
Sbjct  88   RAEDVQGKNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIG  142



>ref|XP_007205738.1| hypothetical protein PRUPE_ppa010179mg [Prunus persica]
 gb|EMJ06937.1| hypothetical protein PRUPE_ppa010179mg [Prunus persica]
Length=260

 Score =   223 bits (567),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPS+F+ R IGKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DE++A+RKIRLR
Sbjct  28   DWYDIKAPSLFTERQIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQKDEEHAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCI 
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIA  141



>ref|NP_001276152.1| 40S ribosomal protein S3a-like [Glycine max]
 gb|ACU22108.1| unknown [Glycine max]
Length=261

 Score =   223 bits (567),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF  +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ D D+AF+KIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDGDHAFKKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIG
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIG  141



>ref|XP_007157117.1| hypothetical protein PHAVU_002G044200g [Phaseolus vulgaris]
 gb|AGZ15363.1| 40S ribosomal protein S3a-like protein [Phaseolus vulgaris]
 gb|ESW29111.1| hypothetical protein PHAVU_002G044200g [Phaseolus vulgaris]
Length=261

 Score =   223 bits (567),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF  +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED++F+KIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHSFKKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLRMFCIG
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRMFCIG  141



>gb|KFK30101.1| hypothetical protein AALP_AA7G217000 [Arabis alpina]
Length=262

 Score =   223 bits (567),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADL  DEDNA+RKIRLR
Sbjct  28   DWYDIKAPSSFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLNGDEDNAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTDNYTLRMFCI 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDNYTLRMFCIA  141



>ref|XP_008218237.1| PREDICTED: 40S ribosomal protein S3a-2 [Prunus mume]
Length=260

 Score =   223 bits (567),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPS+F+ R IGKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DE++A+RKIRLR
Sbjct  28   DWYDIKAPSLFTERQIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQKDEEHAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCI 
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIA  141



>gb|KJB72261.1| hypothetical protein B456_011G167500 [Gossypium raimondii]
Length=262

 Score =   223 bits (567),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 113/115 (98%), Gaps = 1/115 (1%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRL  341
            DWYDIKAPSVF+TRN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ  DED+A+RKIRL
Sbjct  28   DWYDIKAPSVFTTRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGGDEDHAYRKIRL  87

Query  342  RAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            RAEDVQG+NVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLRMFCIG
Sbjct  88   RAEDVQGKNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRMFCIG  142



>ref|XP_010090259.1| 40S ribosomal protein S3a [Morus notabilis]
 gb|EXB39197.1| 40S ribosomal protein S3a [Morus notabilis]
Length=262

 Score =   223 bits (567),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPS+F+ R +GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED+A+RKIRLR
Sbjct  28   DWYDIKAPSLFNQRQVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDHAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCI 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIA  141



>gb|KJB28385.1| hypothetical protein B456_005G045000 [Gossypium raimondii]
Length=249

 Score =   222 bits (565),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 113/115 (98%), Gaps = 1/115 (1%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRL  341
            DWYDIKAPSVF++RN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ  DED+A+RKIRL
Sbjct  28   DWYDIKAPSVFTSRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGGDEDHAYRKIRL  87

Query  342  RAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            RAEDVQG+NVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIG
Sbjct  88   RAEDVQGKNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIG  142



>gb|AAX55706.1| cyc07 [Vitis vinifera]
Length=237

 Score =   221 bits (564),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPS+FS RN+GKTLV+RTQGTKIASEGLKHRV  +SLADLQNDED A+RKIRLR
Sbjct  6    DWYDIKAPSIFSVRNVGKTLVSRTQGTKIASEGLKHRVSGISLADLQNDEDRAYRKIRLR  65

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCI 
Sbjct  66   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIA  119



>ref|XP_004496691.1| PREDICTED: 40S ribosomal protein S3a-like [Cicer arietinum]
 ref|XP_004517272.1| PREDICTED: 40S ribosomal protein S3a-like [Cicer arietinum]
Length=261

 Score =   222 bits (566),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPS+F  +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DE++AF+KIRLR
Sbjct  28   DWYDIKAPSLFQVKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEEHAFKKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGM+FTTDKLRSLV+KWQSLIEAHVDVKTTDNYTLRMFCIG
Sbjct  88   AEDVQGKNVLTNFWGMNFTTDKLRSLVRKWQSLIEAHVDVKTTDNYTLRMFCIG  141



>gb|AGT16352.1| 40S ribosomal protein S3a [Saccharum hybrid cultivar R570]
Length=260

 Score =   222 bits (566),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVFS RNIGKTLV+RTQGT+IASEGLKHRVFEV LADLQ DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNIGKTLVSRTQGTRIASEGLKHRVFEVCLADLQGDEDQAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNFWGM FTTDKLRSLV+KWQ+LIEAHVDVKTTDNY LR+FCIG
Sbjct  88   AEDVQGRNVLTNFWGMSFTTDKLRSLVRKWQTLIEAHVDVKTTDNYMLRLFCIG  141



>gb|AFW89333.1| hypothetical protein ZEAMMB73_166147 [Zea mays]
Length=313

 Score =   224 bits (570),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVFS RNIGKTLV+RTQGT+IASEGLKHRVFEV LADLQ DED A+RKIRLR
Sbjct  98   DWYDIKAPSVFSVRNIGKTLVSRTQGTRIASEGLKHRVFEVCLADLQGDEDQAYRKIRLR  157

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNFWGM+FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIG
Sbjct  158  AEDVQGRNVLTNFWGMNFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIG  211



>ref|NP_001149096.1| 40S ribosomal protein S3a [Zea mays]
 gb|ACG34188.1| 40S ribosomal protein S3a [Zea mays]
 gb|ACN31605.1| unknown [Zea mays]
Length=260

 Score =   222 bits (565),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVFS RNIGKTLV+RTQGT+IAS+GLKHRVFEV LADLQ DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNIGKTLVSRTQGTRIASDGLKHRVFEVCLADLQGDEDQAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNFWGM+FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIG
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIG  141



>gb|KCW60693.1| hypothetical protein EUGRSUZ_H03423 [Eucalyptus grandis]
Length=237

 Score =   221 bits (563),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF+ +N+GKTLV+RTQGTKIASEGLKHRVFE SLADLQ DED+++RKIRLR
Sbjct  28   DWYDIKAPSVFTVKNVGKTLVSRTQGTKIASEGLKHRVFETSLADLQGDEDHSYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
             EDVQGRNVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIG
Sbjct  88   CEDVQGRNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIG  141



>ref|XP_004235324.1| PREDICTED: 40S ribosomal protein S3a [Solanum lycopersicum]
Length=261

 Score =   222 bits (565),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF  +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED AFRKIRLR
Sbjct  28   DWYDIKAPSVFEIKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDQAFRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNF GMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLRMFCI 
Sbjct  88   AEDVQGRNVLTNFHGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRMFCIA  141



>ref|XP_007137418.1| hypothetical protein PHAVU_009G125400g [Phaseolus vulgaris]
 gb|ESW09412.1| hypothetical protein PHAVU_009G125400g [Phaseolus vulgaris]
Length=261

 Score =   221 bits (564),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF  +N+GKTLVTRTQGTKIAS+GLKHRVFEVSLADLQ DED+AF+KIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVTRTQGTKIASDGLKHRVFEVSLADLQGDEDHAFKKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGMDFT DKLRSLV+KWQ+LIEAH DVKTTDNYTLRMFCIG
Sbjct  88   AEDVQGKNVLTNFWGMDFTNDKLRSLVRKWQTLIEAHADVKTTDNYTLRMFCIG  141



>ref|NP_001275123.1| cyc07-like protein [Solanum tuberosum]
 gb|ABB87133.1| 40S ribosomal protein S3a-like [Solanum tuberosum]
Length=261

 Score =   221 bits (563),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF  +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED AFRKIRLR
Sbjct  28   DWYDIKAPSVFEIKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDQAFRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNF GMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLRMFCI 
Sbjct  88   AEDVQGRNVLTNFHGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRMFCIA  141



>ref|XP_004241461.1| PREDICTED: 40S ribosomal protein S3a [Solanum lycopersicum]
Length=261

 Score =   221 bits (563),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF  +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED AFRKIRLR
Sbjct  28   DWYDIKAPSVFEIKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDQAFRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNF GMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLRMFCI 
Sbjct  88   AEDVQGRNVLTNFHGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRMFCIA  141



>ref|XP_010024230.1| PREDICTED: 40S ribosomal protein S3a-like [Eucalyptus grandis]
 gb|KCW60692.1| hypothetical protein EUGRSUZ_H03423 [Eucalyptus grandis]
Length=261

 Score =   221 bits (563),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF+ +N+GKTLV+RTQGTKIASEGLKHRVFE SLADLQ DED+++RKIRLR
Sbjct  28   DWYDIKAPSVFTVKNVGKTLVSRTQGTKIASEGLKHRVFETSLADLQGDEDHSYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
             EDVQGRNVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIG
Sbjct  88   CEDVQGRNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIG  141



>ref|XP_010092425.1| 40S ribosomal protein S3a [Morus notabilis]
 gb|EXB51143.1| 40S ribosomal protein S3a [Morus notabilis]
Length=267

 Score =   221 bits (563),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF+ RN+GKTLV+RTQGTKIASEGLKHRVFE+SLADLQ+DE++A+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNVGKTLVSRTQGTKIASEGLKHRVFEISLADLQDDEEHAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            +EDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDN+TLR+FCIG
Sbjct  88   SEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNFTLRLFCIG  141



>ref|XP_010419205.1| PREDICTED: 40S ribosomal protein S3a-1-like [Camelina sativa]
Length=262

 Score =   221 bits (563),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYD+KAPS+F++RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDVKAPSMFTSRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVL  FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD YTLR+FCI 
Sbjct  88   AEDVQGRNVLCQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDGYTLRLFCIA  141



>ref|XP_003638196.1| 40S ribosomal protein S3a [Medicago truncatula]
Length=244

 Score =   220 bits (561),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF  +N+GKTLV+RTQGTKIAS+GLKHRVFEVSLADLQ DE++AFRKIRLR
Sbjct  11   DWYDIKAPSVFQVKNVGKTLVSRTQGTKIASDGLKHRVFEVSLADLQGDEEHAFRKIRLR  70

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+N+LTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIG
Sbjct  71   AEDVQGKNLLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIG  124



>ref|XP_010485869.1| PREDICTED: 40S ribosomal protein S3a-1 [Camelina sativa]
Length=262

 Score =   221 bits (562),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYD+KAPS+F++RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDVKAPSMFTSRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVL  FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD YTLR+FCI 
Sbjct  88   AEDVQGRNVLCQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDGYTLRLFCIA  141



>gb|ACJ85751.1| unknown [Medicago truncatula]
 gb|AFK34441.1| unknown [Medicago truncatula]
 gb|KEH43817.1| 40S ribosomal protein S3a-1 [Medicago truncatula]
Length=261

 Score =   220 bits (561),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF  +N+GKTLV+RTQGTKIAS+GLKHRVFEVSLADLQ DE++AFRKIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVSRTQGTKIASDGLKHRVFEVSLADLQGDEEHAFRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+N+LTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIG
Sbjct  88   AEDVQGKNLLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIG  141



>ref|XP_008224264.1| PREDICTED: 40S ribosomal protein S3a [Prunus mume]
Length=260

 Score =   220 bits (561),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPS+F  +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DE++A+RK+RLR
Sbjct  28   DWYDIKAPSLFQNKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEEHAYRKMRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLR+FCIG
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRLFCIG  141



>ref|NP_187135.1| 40S ribosomal protein S3a-1 [Arabidopsis thaliana]
 sp|Q9CAV0.3|RS3A1_ARATH RecName: Full=40S ribosomal protein S3a-1 [Arabidopsis thaliana]
 gb|AAG51414.1|AC009465_14 putative 40S ribosomal protein S3A (S phase specific); 75194-73527 
[Arabidopsis thaliana]
 gb|AAL32874.1| putative 40S ribosomal protein S3A (S phase specific) [Arabidopsis 
thaliana]
 gb|AAM10147.1| putative 40S ribosomal protein S3A (S phase specific) [Arabidopsis 
thaliana]
 gb|AAM63004.1| putative 40S ribosomal protein S3A (S phase specific) [Arabidopsis 
thaliana]
 gb|AEE74143.1| 40S ribosomal protein S3a-1 [Arabidopsis thaliana]
Length=262

 Score =   220 bits (561),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYD+KAPS+F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDVKAPSIFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVL  FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD+YTLR+FCI 
Sbjct  88   AEDVQGRNVLCQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTLRLFCIA  141



>ref|NP_001274913.1| 40S ribosomal protein S3a-like [Solanum tuberosum]
 gb|ABB55367.1| cyc07-like [Solanum tuberosum]
 gb|ABB72794.1| cyc07-like protein [Solanum tuberosum]
Length=261

 Score =   220 bits (560),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF  +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFEIKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDQAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNF GMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLRMFCI 
Sbjct  88   AEDVQGRNVLTNFHGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRMFCIA  141



>emb|CDX76296.1| BnaA08g11040D [Brassica napus]
Length=261

 Score =   220 bits (560),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ+DED+++RKIRLR
Sbjct  28   DWYDIKAPSNFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQSDEDHSYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLT FWGM+FTTDKLRSLVKKWQ+LIEAHVDVKTTD+YTLRMFCIG
Sbjct  88   AEDVQGRNVLTQFWGMNFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTLRMFCIG  141



>ref|XP_009108713.1| PREDICTED: 40S ribosomal protein S3a-2-like [Brassica rapa]
Length=261

 Score =   220 bits (560),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ+DED+++RKIRLR
Sbjct  28   DWYDIKAPSNFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQSDEDHSYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLT FWGM+FTTDKLRSLVKKWQ+LIEAHVDVKTTD+YTLRMFCIG
Sbjct  88   AEDVQGRNVLTQFWGMNFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTLRMFCIG  141



>ref|XP_009124201.1| PREDICTED: 40S ribosomal protein S3a-2 [Brassica rapa]
Length=262

 Score =   220 bits (560),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED+A+RKIRLR
Sbjct  28   DWYDIKAPSNFNNRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIE+HVDVKTTDNYTLR+FCI 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIESHVDVKTTDNYTLRLFCIA  141



>ref|XP_009138316.1| PREDICTED: 40S ribosomal protein S3a-2-like [Brassica rapa]
 ref|XP_009138317.1| PREDICTED: 40S ribosomal protein S3a-2-like [Brassica rapa]
 emb|CDY45324.1| BnaA03g52970D [Brassica napus]
 emb|CDX72495.1| BnaC07g45170D [Brassica napus]
Length=261

 Score =   219 bits (559),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPS+F  RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED+++RKIRLR
Sbjct  28   DWYDIKAPSIFKQRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHSYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD+YTLR+FCI 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTLRLFCIA  141



>emb|CDX69078.1| BnaC01g03750D [Brassica napus]
Length=262

 Score =   219 bits (559),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPS F  RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED+++RKIRLR
Sbjct  28   DWYDIKAPSNFKQRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHSYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD+YTLR+FCIG
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTLRLFCIG  141



>ref|XP_009110285.1| PREDICTED: 40S ribosomal protein S3a-2 [Brassica rapa]
Length=262

 Score =   219 bits (559),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPS F  RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED+++RKIRLR
Sbjct  28   DWYDIKAPSNFKQRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHSYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD+YTLR+FCIG
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTLRLFCIG  141



>emb|CDX75453.1| BnaA01g02490D [Brassica napus]
Length=262

 Score =   219 bits (559),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPS F  RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED+++RKIRLR
Sbjct  28   DWYDIKAPSNFKQRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHSYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD+YTLR+FCIG
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTLRLFCIG  141



>ref|XP_006838990.1| hypothetical protein AMTR_s00002p00271660 [Amborella trichopoda]
 gb|ERN01559.1| hypothetical protein AMTR_s00002p00271660 [Amborella trichopoda]
Length=265

 Score =   219 bits (559),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPS+F+ R +GKTLVTRTQGTKIASEGLKHRVFE +LADLQ DED ++RKIRLR
Sbjct  33   DWYDIKAPSIFNVRTVGKTLVTRTQGTKIASEGLKHRVFECNLADLQADEDQSYRKIRLR  92

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AED+QGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLR+FCIG
Sbjct  93   AEDIQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRLFCIG  146



>emb|CDY40680.1| BnaC03g33960D [Brassica napus]
Length=262

 Score =   219 bits (559),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDIKAPSNFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIE+HVDVKTTDN+TLR+FCI 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIESHVDVKTTDNFTLRLFCIA  141



>emb|CDY50760.1| BnaAnng10670D [Brassica napus]
 emb|CDY41904.1| BnaC05g47000D [Brassica napus]
Length=262

 Score =   219 bits (559),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED+A+RKIRLR
Sbjct  28   DWYDIKAPSNFNNRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIE+HVDVKTTDNYTLR+FCI 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIESHVDVKTTDNYTLRLFCIA  141



>gb|ACG33267.1| 40S ribosomal protein S3a [Zea mays]
Length=260

 Score =   219 bits (559),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVFS RNIGKTLV+RTQGT+IAS+GLKHRVFEV LADLQ DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNIGKTLVSRTQGTRIASDGLKHRVFEVCLADLQGDEDQAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNFWGM+FTTDKLRSLVKKWQ+LIEAHVDVKTT NY LR+FCIG
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVKKWQTLIEAHVDVKTTXNYMLRLFCIG  141



>gb|ABB55362.1| cyc07-like [Solanum tuberosum]
 gb|ABB72815.1| cyc07-like protein [Solanum tuberosum]
Length=261

 Score =   219 bits (558),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF  +N+GKTLVTRTQGTKIAS+GLKHRVFEVSLADLQ DED AFRKIRLR
Sbjct  28   DWYDIKAPSVFEIKNVGKTLVTRTQGTKIASDGLKHRVFEVSLADLQKDEDQAFRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNF GMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLRMFCI 
Sbjct  88   AEDVQGRNVLTNFHGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRMFCIA  141



>ref|XP_009134791.1| PREDICTED: 40S ribosomal protein S3a-2-like [Brassica rapa]
Length=262

 Score =   219 bits (558),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDIKAPSNFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIE HVDVKTTDN+TLR+FCI 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIECHVDVKTTDNFTLRLFCIA  141



>emb|CDX74165.1| BnaA03g28820D [Brassica napus]
Length=262

 Score =   219 bits (558),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDIKAPSNFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIE HVDVKTTDN+TLR+FCI 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIECHVDVKTTDNFTLRLFCIA  141



>ref|XP_002882377.1| 40S ribosomal protein S3A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58636.1| 40S ribosomal protein S3A [Arabidopsis lyrata subsp. lyrata]
Length=262

 Score =   219 bits (558),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYD+KAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDVKAPSNFTKRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQVDEDNAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVL  FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTDNYTLR+FCI 
Sbjct  88   AEDVQGRNVLCQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDNYTLRLFCIA  141



>ref|XP_006298355.1| hypothetical protein CARUB_v10014425mg [Capsella rubella]
 gb|EOA31253.1| hypothetical protein CARUB_v10014425mg [Capsella rubella]
Length=261

 Score =   219 bits (558),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYD+KAPS+F+ +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDVKAPSIFTHKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVL  FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD+YTLR+FCI 
Sbjct  88   AEDVQGRNVLCQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTLRLFCIA  141



>ref|XP_010432386.1| PREDICTED: 40S ribosomal protein S3a-2-like [Camelina sativa]
Length=262

 Score =   219 bits (558),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYD+KAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDVKAPSSFTKRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD +TLR+FCI 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDGFTLRLFCIA  141



>ref|XP_003526635.1| PREDICTED: 40S ribosomal protein S3a-like [Glycine max]
Length=261

 Score =   219 bits (557),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF  +N+GKTLVTRTQGTK AS+GLKHRVFEVSLADLQ DED+AF+KIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVTRTQGTKTASDGLKHRVFEVSLADLQGDEDHAFKKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGM FTTDKLRSLV+KWQ+LIEAH DVKTTDNYTLRMFCIG
Sbjct  88   AEDVQGKNVLTNFWGMSFTTDKLRSLVRKWQTLIEAHADVKTTDNYTLRMFCIG  141



>ref|XP_002869131.1| 40S ribosomal protein S3A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45390.1| 40S ribosomal protein S3A [Arabidopsis lyrata subsp. lyrata]
Length=262

 Score =   219 bits (557),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYD+KAP+ F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDVKAPASFTNRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQVDEDNAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD YTLR+FCI 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDGYTLRLFCIA  141



>gb|ACG34058.1| 40S ribosomal protein S3a [Zea mays]
Length=260

 Score =   219 bits (557),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVFS RNIGKTLV+RTQGT+IAS+GLKHRVFEV LADLQ DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNIGKTLVSRTQGTRIASDGLKHRVFEVCLADLQGDEDQAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQ RNVLTNFWGM+FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIG
Sbjct  88   AEDVQDRNVLTNFWGMNFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIG  141



>ref|XP_010463973.1| PREDICTED: 40S ribosomal protein S3a-1-like [Camelina sativa]
Length=261

 Score =   219 bits (557),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYD+KAPS+F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDVKAPSLFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVL  FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD YTLR+FCI 
Sbjct  88   AEDVQGRNVLCQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDAYTLRLFCIA  141



>gb|ABB72808.1| cyc07-like protein [Solanum tuberosum]
Length=260

 Score =   219 bits (557),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF  +N+GKTLVTRTQGTKIAS+GLKHRVFEVSLADLQ DED AFRKIRLR
Sbjct  27   DWYDIKAPSVFEIKNVGKTLVTRTQGTKIASDGLKHRVFEVSLADLQKDEDQAFRKIRLR  86

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNF GMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLRMFCI 
Sbjct  87   AEDVQGRNVLTNFHGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRMFCIA  140



>ref|XP_006412198.1| hypothetical protein EUTSA_v10026006mg [Eutrema salsugineum]
 gb|ESQ53651.1| hypothetical protein EUTSA_v10026006mg [Eutrema salsugineum]
Length=262

 Score =   219 bits (557),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYD+KAP+ F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA RKIRLR
Sbjct  28   DWYDVKAPASFTVRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAHRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD+YTLR+FCI 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTLRLFCIA  141



>sp|Q9MBB3.1|RS3A_DAUCA RecName: Full=40S ribosomal protein S3a; AltName: Full=Protein 
cyc07 [Daucus carota]
 dbj|BAA89498.1| cyc07 [Daucus carota]
Length=261

 Score =   218 bits (556),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAP+VF  +N+GKTLV+RTQGTKIASEGLKHRVFEV LADLQ DED A+RKIRLR
Sbjct  28   DWYDIKAPNVFQNKNVGKTLVSRTQGTKIASEGLKHRVFEVCLADLQGDEDQAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNF+GMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLRMFCIG
Sbjct  88   AEDVQGKNVLTNFYGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRMFCIG  141



>ref|XP_009394355.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122} 
[Musa acuminata subsp. malaccensis]
Length=261

 Score =   218 bits (556),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAHRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGMD TTDK+R LV+KWQ+LIEAHVDVKTTDNYTLR+FC G
Sbjct  88   AEDVQGKNVLTNFWGMDLTTDKVRYLVRKWQTLIEAHVDVKTTDNYTLRLFCFG  141



>gb|ACN40078.1| unknown [Picea sitchensis]
Length=260

 Score =   218 bits (556),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 110/114 (96%), Gaps = 1/114 (1%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYD+KAPS F+TR +GKTLVTRTQGTKIASEGLKHRVFE+SLADLQN ED AFRKI+LR
Sbjct  28   DWYDVKAPSTFNTRTVGKTLVTRTQGTKIASEGLKHRVFELSLADLQN-EDQAFRKIKLR  86

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLRMFCIG
Sbjct  87   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRMFCIG  140



>ref|XP_010437575.1| PREDICTED: 40S ribosomal protein S3a-2 [Camelina sativa]
Length=262

 Score =   218 bits (556),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYD+KAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDVKAPSSFTNRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQVDEDNAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD +TLR+FCI 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDGFTLRLFCIA  141



>gb|KDO74488.1| hypothetical protein CISIN_1g024879mg [Citrus sinensis]
Length=245

 Score =   218 bits (554),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPS F  RN+GKTLVTRTQGTKIASEGLKHRVFEVSL DL N+E++A+RKIRLR
Sbjct  28   DWYDIKAPSCFRVRNVGKTLVTRTQGTKIASEGLKHRVFEVSLGDLHNEEEHAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KW +LIEA+VDVKTTDNYTLRMFCIG
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWHTLIEAYVDVKTTDNYTLRMFCIG  141



>gb|KJB38202.1| hypothetical protein B456_006G241700 [Gossypium raimondii]
Length=262

 Score =   218 bits (555),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/115 (88%), Positives = 112/115 (97%), Gaps = 1/115 (1%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRL  341
            DWYDIKAPSVF+TRN+GKTLV+RTQGTKIASEGLKHRVFEV LADLQ  DED+A+RKIRL
Sbjct  28   DWYDIKAPSVFTTRNVGKTLVSRTQGTKIASEGLKHRVFEVFLADLQGGDEDHAYRKIRL  87

Query  342  RAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            RAEDVQG+NVLTNFWGM+FTTD+LRSLV+KWQ+LIEAHVDVKTTDNYTLR+FCIG
Sbjct  88   RAEDVQGKNVLTNFWGMNFTTDRLRSLVRKWQTLIEAHVDVKTTDNYTLRLFCIG  142



>gb|KJB38201.1| hypothetical protein B456_006G241700 [Gossypium raimondii]
Length=258

 Score =   218 bits (554),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/115 (88%), Positives = 112/115 (97%), Gaps = 1/115 (1%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRL  341
            DWYDIKAPSVF+TRN+GKTLV+RTQGTKIASEGLKHRVFEV LADLQ  DED+A+RKIRL
Sbjct  28   DWYDIKAPSVFTTRNVGKTLVSRTQGTKIASEGLKHRVFEVFLADLQGGDEDHAYRKIRL  87

Query  342  RAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            RAEDVQG+NVLTNFWGM+FTTD+LRSLV+KWQ+LIEAHVDVKTTDNYTLR+FCIG
Sbjct  88   RAEDVQGKNVLTNFWGMNFTTDRLRSLVRKWQTLIEAHVDVKTTDNYTLRLFCIG  142



>ref|XP_006420004.1| hypothetical protein CICLE_v10005663mg [Citrus clementina]
 ref|XP_006489441.1| PREDICTED: 40S ribosomal protein S3a-like [Citrus sinensis]
 gb|ESR33244.1| hypothetical protein CICLE_v10005663mg [Citrus clementina]
 gb|KDO74487.1| hypothetical protein CISIN_1g024879mg [Citrus sinensis]
Length=261

 Score =   218 bits (554),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPS F  RN+GKTLVTRTQGTKIASEGLKHRVFEVSL DL N+E++A+RKIRLR
Sbjct  28   DWYDIKAPSCFRVRNVGKTLVTRTQGTKIASEGLKHRVFEVSLGDLHNEEEHAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KW +LIEA+VDVKTTDNYTLRMFCIG
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWHTLIEAYVDVKTTDNYTLRMFCIG  141



>ref|XP_011032434.1| PREDICTED: 40S ribosomal protein S3a [Populus euphratica]
Length=261

 Score =   218 bits (554),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWY +KAPS F+ ++IG+TLVTRTQGTKIASEGLKHRVFEVSLADLQNDED+AFRKIRLR
Sbjct  28   DWYVVKAPSGFTVKDIGRTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDHAFRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNFWGM FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCI 
Sbjct  88   AEDVQGRNVLTNFWGMSFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIA  141



>ref|XP_010447045.1| PREDICTED: 40S ribosomal protein S3a-2-like [Camelina sativa]
Length=262

 Score =   218 bits (554),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYD+KAPS+F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDVKAPSLFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD +T R+FCI 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDGFTFRLFCIA  141



>ref|NP_001288829.1| 40S ribosomal protein S3a [Brassica rapa]
 sp|P49396.2|RS3A_BRACM RecName: Full=40S ribosomal protein S3a; AltName: Full=S phase-specific 
protein BIS289 [Brassica rapa]
 gb|AAA33013.1| S-phase-specific protein [Brassica rapa]
 emb|CAA81030.1| unnamed protein product [Brassica rapa]
Length=262

 Score =   218 bits (554),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADL  DED A+RKIRLR
Sbjct  28   DWYDIKAPSSFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLNKDEDQAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIE+HVDVKTTDNYTLR+FCI 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIESHVDVKTTDNYTLRLFCIA  141



>ref|XP_006382773.1| 40S ribosomal protein S3A [Populus trichocarpa]
 gb|ERP60570.1| 40S ribosomal protein S3A [Populus trichocarpa]
Length=261

 Score =   218 bits (554),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWY +KAPS F+ ++IG+TLVTRTQGTKIASEGLKHRVFEVSLADLQNDED+AFRKIRLR
Sbjct  28   DWYVVKAPSGFTVKDIGRTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDHAFRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNFWGM FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCI 
Sbjct  88   AEDVQGRNVLTNFWGMSFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIA  141



>gb|ABK93399.1| unknown [Populus trichocarpa]
Length=261

 Score =   218 bits (554),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWY +KAPS F+ ++IG+TLVTRTQGTKIASEGLKHRVFEVSLADLQNDED+AFRKIRLR
Sbjct  28   DWYVVKAPSGFTVKDIGRTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDHAFRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNFWGM FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCI 
Sbjct  88   AEDVQGRNVLTNFWGMSFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIA  141



>ref|XP_009406016.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122}-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=260

 Score =   218 bits (554),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF+ RNIGKTLV+RTQGTKIASEGLKHRVFEV LADLQNDED A RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNIGKTLVSRTQGTKIASEGLKHRVFEVCLADLQNDEDQAHRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVL NFWGMD TTDK+R +V+KWQ+LIEAHVDVKTTDNYTLRMFCIG
Sbjct  88   AEDVQGKNVLANFWGMDLTTDKVRYVVRKWQTLIEAHVDVKTTDNYTLRMFCIG  141



>gb|EYU41450.1| hypothetical protein MIMGU_mgv1a002668mg [Erythranthe guttata]
Length=648

 Score =   228 bits (580),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/113 (92%), Positives = 113/113 (100%), Gaps = 0/113 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYD+KAPSVF+TRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQ+DED+AFRKIRLR
Sbjct  416  DWYDVKAPSVFNTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQSDEDHAFRKIRLR  475

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCI  503
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLR+FCI
Sbjct  476  AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRLFCI  528



>emb|CDY21109.1| BnaA01g33400D [Brassica napus]
Length=261

 Score =   217 bits (553),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADL  DED A+RKIRLR
Sbjct  28   DWYDIKAPSSFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLNKDEDQAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIE+HVDVKTTDNYTLR+FCI 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIESHVDVKTTDNYTLRLFCIA  141



>ref|XP_004296667.1| PREDICTED: 40S ribosomal protein S3a [Fragaria vesca subsp. vesca]
Length=259

 Score =   217 bits (553),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPS+F+ + +GKTLVTRTQGTKIASEGLKHRVFE SLADLQ DE++A+RK+RLR
Sbjct  28   DWYDIKAPSIFNIKQVGKTLVTRTQGTKIASEGLKHRVFETSLADLQGDEEHAYRKMRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGR VLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIG
Sbjct  88   AEDVQGRTVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIG  141



>ref|XP_006382772.1| hypothetical protein POPTR_0005s05280g [Populus trichocarpa]
 gb|ERP60569.1| hypothetical protein POPTR_0005s05280g [Populus trichocarpa]
Length=265

 Score =   217 bits (553),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWY +KAPS F+ ++IG+TLVTRTQGTKIASEGLKHRVFEVSLADLQNDED+AFRKIRLR
Sbjct  32   DWYVVKAPSGFTVKDIGRTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDHAFRKIRLR  91

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNFWGM FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCI 
Sbjct  92   AEDVQGRNVLTNFWGMSFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIA  145



>emb|CDY30019.1| BnaC01g39890D [Brassica napus]
Length=302

 Score =   218 bits (556),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADL  DED A+RKIRLR
Sbjct  69   DWYDIKAPSSFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLNKDEDQAYRKIRLR  128

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIE+HVDVKTTDNYTLR+FCI 
Sbjct  129  AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIESHVDVKTTDNYTLRLFCIA  182



>ref|XP_002987274.1| hypothetical protein SELMODRAFT_271906 [Selaginella moellendorffii]
 ref|XP_002987332.1| hypothetical protein SELMODRAFT_271907 [Selaginella moellendorffii]
 ref|XP_002989169.1| hypothetical protein SELMODRAFT_184408 [Selaginella moellendorffii]
 ref|XP_002989210.1| hypothetical protein SELMODRAFT_160008 [Selaginella moellendorffii]
 gb|EFJ09763.1| hypothetical protein SELMODRAFT_184408 [Selaginella moellendorffii]
 gb|EFJ09804.1| hypothetical protein SELMODRAFT_160008 [Selaginella moellendorffii]
 gb|EFJ11589.1| hypothetical protein SELMODRAFT_271906 [Selaginella moellendorffii]
 gb|EFJ11647.1| hypothetical protein SELMODRAFT_271907 [Selaginella moellendorffii]
Length=263

 Score =   217 bits (552),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYD+KA S F+ R IGKTLVTRTQGTKIAS+GLK RVFEVSLADLQNDED+AFRKI+LR
Sbjct  28   DWYDVKAMSTFNVRQIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQNDEDHAFRKIKLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQSLIEAHVDVKTTDNYTLR+FCIG
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQSLIEAHVDVKTTDNYTLRLFCIG  141



>ref|XP_009408135.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122}-like 
[Musa acuminata subsp. malaccensis]
Length=261

 Score =   217 bits (552),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF+ RNIGKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAHRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            +EDVQG+NVLTNFWGMD TTDKLR +V++WQ+LIEAHVDVKTTDNYTLR+FCI 
Sbjct  88   SEDVQGKNVLTNFWGMDLTTDKLRHIVRRWQTLIEAHVDVKTTDNYTLRLFCIA  141



>ref|XP_008391001.1| PREDICTED: 40S ribosomal protein S3a-2-like [Malus domestica]
 ref|XP_008360360.1| PREDICTED: 40S ribosomal protein S3a-2-like [Malus domestica]
 ref|XP_009371956.1| PREDICTED: 40S ribosomal protein S3a-2-like [Pyrus x bretschneideri]
Length=259

 Score =   216 bits (551),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAP +F+ +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DE++A+RK+RLR
Sbjct  28   DWYDIKAPKLFNHQNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEEHAYRKMRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+ VLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIG
Sbjct  88   AEDVQGKTVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIG  141



>gb|KEH32959.1| 40S ribosomal protein S3a-1 [Medicago truncatula]
Length=261

 Score =   216 bits (551),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF  +N+GKTLV+RTQGTKIA +GLKHRVFEVSL DLQ DE++AFRKIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVSRTQGTKIALDGLKHRVFEVSLVDLQGDEEHAFRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+N+LTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIG
Sbjct  88   AEDVQGKNLLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIG  141



>gb|KHN21710.1| 40S ribosomal protein S3a [Glycine soja]
Length=335

 Score =   218 bits (556),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF  +N+GKTLVTRTQGTK AS+GLKHRVFEVSLADLQ DED+AF+KIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVTRTQGTKTASDGLKHRVFEVSLADLQGDEDHAFKKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGM FTTDKLRSLV+KWQ+LIEAH DVKTTDNYTLRMFCIG
Sbjct  88   AEDVQGKNVLTNFWGMSFTTDKLRSLVRKWQTLIEAHADVKTTDNYTLRMFCIG  141



>ref|XP_009400022.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122}-like 
[Musa acuminata subsp. malaccensis]
Length=261

 Score =   216 bits (549),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF+ RNIGKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAHRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGMD TTDK+R +V+KW +LIEAHVDVKTTDNYTLRMFCI 
Sbjct  88   AEDVQGKNVLTNFWGMDLTTDKVRYIVRKWLTLIEAHVDVKTTDNYTLRMFCIA  141



>ref|XP_008390932.1| PREDICTED: 40S ribosomal protein S3a-2-like [Malus domestica]
Length=259

 Score =   216 bits (549),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAP +F+  N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DE++A+RK+RLR
Sbjct  28   DWYDIKAPKLFNNTNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEEHAYRKMRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+ VLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIG
Sbjct  88   AEDVQGKTVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIG  141



>ref|XP_009335287.1| PREDICTED: 40S ribosomal protein S3a-2-like [Pyrus x bretschneideri]
Length=259

 Score =   215 bits (548),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAP +F+  N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DE++A+RK+RLR
Sbjct  28   DWYDIKAPKLFNNTNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEEHAYRKMRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+ VLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIG
Sbjct  88   AEDVQGKTVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIG  141



>gb|AAP80855.1| cyc07 [Triticum aestivum]
Length=242

 Score =   214 bits (546),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +3

Query  168  WYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRA  347
            WYDIKAP +F++RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLRA
Sbjct  29   WYDIKAPLLFTSRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLRA  88

Query  348  EDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            EDVQG NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNY LRMF IG
Sbjct  89   EDVQGMNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYMLRMFAIG  141



>ref|XP_004302028.1| PREDICTED: 40S ribosomal protein S3a-2 [Fragaria vesca subsp. 
vesca]
Length=259

 Score =   214 bits (545),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYD+ APS+F+ R +G TLVTRTQGTKIASEGLKHRVFEVSLADLQ DED+A+RKIRLR
Sbjct  28   DWYDVTAPSLFNVRKVGVTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDHAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG++VLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLR+FCI 
Sbjct  88   AEDVQGKDVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRLFCIA  141



>gb|KDO37446.1| hypothetical protein CISIN_1g045491mg, partial [Citrus sinensis]
Length=241

 Score =   211 bits (537),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPS F  RN+GKTLVTRTQGTKIASEGLKHRVFEVSL DL N+E++A+RKIRLR
Sbjct  8    DWYDIKAPSCFRVRNVGKTLVTRTQGTKIASEGLKHRVFEVSLGDLLNEEEHAYRKIRLR  67

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGM+FTTDKLRSLV+KW +LIEA+VDVKTTDN+TLR+FCIG
Sbjct  68   AEDVQGKNVLTNFWGMNFTTDKLRSLVRKWHTLIEAYVDVKTTDNFTLRLFCIG  121



>ref|XP_001761018.1| predicted protein [Physcomitrella patens]
 gb|EDQ74085.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   212 bits (539),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAP+ F+ +N+GKTLVTRT GTKIAS+GLK RVFEVSLADLQNDED AFRKI+LR
Sbjct  28   DWYDIKAPNTFTQKNLGKTLVTRTAGTKIASDGLKGRVFEVSLADLQNDEDQAFRKIKLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGMD TTDKLRSLV+KWQSLIEAHVDVKTTDNY +RMFCI 
Sbjct  88   AEDVQGKNVLTNFWGMDLTTDKLRSLVRKWQSLIEAHVDVKTTDNYQIRMFCIA  141



>ref|XP_006428321.1| hypothetical protein CICLE_v10012508mg [Citrus clementina]
 ref|XP_006480359.1| PREDICTED: 40S ribosomal protein S3a-like [Citrus sinensis]
 gb|ESR41561.1| hypothetical protein CICLE_v10012508mg [Citrus clementina]
Length=261

 Score =   211 bits (538),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPS F  RN+GKTLVTRTQGTKIASEGLKHRVFEVSL DL N+E++A+RKIRLR
Sbjct  28   DWYDIKAPSCFRVRNVGKTLVTRTQGTKIASEGLKHRVFEVSLGDLLNEEEHAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGM+FTTDKLRSLV+KW +LIEA+VDVKTTDN+TLR+FCIG
Sbjct  88   AEDVQGKNVLTNFWGMNFTTDKLRSLVRKWHTLIEAYVDVKTTDNFTLRLFCIG  141



>gb|KDO43437.1| hypothetical protein CISIN_1g040060mg, partial [Citrus sinensis]
Length=241

 Score =   211 bits (536),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPS F  RN+GKTLVTRTQGTKIASEGLKHRVFEVSL DL N+E++A+RKIRLR
Sbjct  8    DWYDIKAPSCFRVRNVGKTLVTRTQGTKIASEGLKHRVFEVSLGDLLNEEEHAYRKIRLR  67

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGM FTTDKLRSLV+KW +LIEA+VDVKTTDN+TLR+FCIG
Sbjct  68   AEDVQGKNVLTNFWGMSFTTDKLRSLVRKWHTLIEAYVDVKTTDNFTLRLFCIG  121



>ref|XP_007226551.1| hypothetical protein PRUPE_ppa024854mg [Prunus persica]
 gb|EMJ27750.1| hypothetical protein PRUPE_ppa024854mg [Prunus persica]
Length=629

 Score =   221 bits (562),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPS+F  +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DE++A+RK+RLR
Sbjct  397  DWYDIKAPSLFQNKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEEHAYRKMRLR  456

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLR+FCIG
Sbjct  457  AEDVQGRNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRLFCIG  510



>gb|EEC69140.1| hypothetical protein OsI_38068 [Oryza sativa Indica Group]
Length=818

 Score =   223 bits (567),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGM FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIG
Sbjct  88   AEDVQGKNVLTNFWGMSFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIG  141



>gb|EEE53089.1| hypothetical protein OsJ_35850 [Oryza sativa Japonica Group]
Length=764

 Score =   222 bits (565),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPSVF+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGM FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIG
Sbjct  88   AEDVQGKNVLTNFWGMSFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIG  141



>ref|XP_002949135.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ49628.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
Length=257

 Score =   210 bits (535),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAP+VF+ RN+GKTLVTRTQGTKIASE LK RVFEVSLADLQ +ED+AFRK+RLR
Sbjct  28   DWYDIKAPTVFTVRNVGKTLVTRTQGTKIASEALKGRVFEVSLADLQKNEDDAFRKMRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
             EDVQGRN LTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD YTLR+FCI 
Sbjct  88   VEDVQGRNCLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDGYTLRVFCIS  141



>ref|XP_001693710.1| ribosomal protein S3a, component of cytosolic 80S ribosome and 
40S small subunit [Chlamydomonas reinhardtii]
 sp|A8HS48.1|RS3A_CHLRE RecName: Full=40S ribosomal protein S3a [Chlamydomonas reinhardtii]
 gb|EDP08964.1| ribosomal protein S3a [Chlamydomonas reinhardtii]
Length=259

 Score =   209 bits (532),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 96/113 (85%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAP++F+ RN+GKTLVTRTQGTKIASE LK RVFEVSLADLQ +ED+AFRK+RLR
Sbjct  28   DWYDIKAPTMFTVRNVGKTLVTRTQGTKIASEALKGRVFEVSLADLQKNEDDAFRKMRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCI  503
             EDVQGRN LTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD YTLR+FCI
Sbjct  88   VEDVQGRNCLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDGYTLRVFCI  140



>ref|XP_001767326.1| predicted protein [Physcomitrella patens]
 gb|EDQ67817.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   209 bits (531),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAP++F+ + +GKTLVTRT GTKIAS+GLK RVFEVSLADLQNDED AFRKI+LR
Sbjct  28   DWYDIKAPNIFTQKALGKTLVTRTAGTKIASDGLKGRVFEVSLADLQNDEDQAFRKIKLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGMD TTDKLRSLV+KWQSLIEAHVDVKTTDNY LR+FCI 
Sbjct  88   AEDVQGKNVLTNFWGMDLTTDKLRSLVRKWQSLIEAHVDVKTTDNYQLRIFCIA  141



>ref|XP_001755439.1| predicted protein [Physcomitrella patens]
 gb|EDQ79919.1| predicted protein [Physcomitrella patens]
Length=265

 Score =   208 bits (530),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAP+ F+ +++GKTLVTRT GTKIAS+GLK RVFEVSLADLQNDED AFRKI+LR
Sbjct  28   DWYDIKAPNTFTQKSLGKTLVTRTAGTKIASDGLKGRVFEVSLADLQNDEDQAFRKIKLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGMD TTDKLRSLV+KWQSLIEAHVDVKTTDNY LR+FCI 
Sbjct  88   AEDVQGKNVLTNFWGMDLTTDKLRSLVRKWQSLIEAHVDVKTTDNYQLRIFCIA  141



>ref|XP_001774632.1| predicted protein [Physcomitrella patens]
 gb|EDQ60566.1| predicted protein [Physcomitrella patens]
Length=264

 Score =   208 bits (529),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAP+ F+ +++GKTLVTRT GTKIAS+GLK RVFEVSLADLQNDED AFRKI+LR
Sbjct  28   DWYDIKAPNTFTQKSLGKTLVTRTAGTKIASDGLKGRVFEVSLADLQNDEDQAFRKIKLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGMD TTDKLRSLV+KWQSLIEAHVDVKTTDNY LR+FCI 
Sbjct  88   AEDVQGKNVLTNFWGMDLTTDKLRSLVRKWQSLIEAHVDVKTTDNYQLRIFCIA  141



>ref|XP_001765908.1| predicted protein [Physcomitrella patens]
 gb|EDQ69229.1| predicted protein [Physcomitrella patens]
Length=244

 Score =   207 bits (527),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAP+ F+ +++GKTLVTRT GTKIAS+GLK RVFEVSLADLQNDED AFRKI+LR
Sbjct  28   DWYDIKAPNTFTQKSLGKTLVTRTAGTKIASDGLKGRVFEVSLADLQNDEDQAFRKIKLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGMD TTDKLRSLV+KWQSLIE+HVDVKTTDNY LR+FCI 
Sbjct  88   AEDVQGKNVLTNFWGMDLTTDKLRSLVRKWQSLIESHVDVKTTDNYMLRIFCIA  141



>ref|XP_001765967.1| predicted protein [Physcomitrella patens]
 gb|EDQ69288.1| predicted protein [Physcomitrella patens]
Length=259

 Score =   207 bits (528),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAP+ F+ +++GKTLVTRT GTKIAS+GLK RVFEVSLADLQNDED AFRKI+LR
Sbjct  28   DWYDIKAPNTFTQKSLGKTLVTRTAGTKIASDGLKGRVFEVSLADLQNDEDQAFRKIKLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG+NVLTNFWGMD TTDKLRSLV+KWQSLIE+HVDVKTTDNY LR+FCI 
Sbjct  88   AEDVQGKNVLTNFWGMDLTTDKLRSLVRKWQSLIESHVDVKTTDNYMLRIFCIA  141



>emb|CBX25071.1| 40S ribosomal protein S3a [Polytomella sp. Pringsheim 198.80]
Length=262

 Score =   206 bits (524),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYD+KAP  FS RN+GKTLVTRTQGTKIASEGLK RVFEVSLADLQ +E++AF+KIRLR
Sbjct  28   DWYDLKAPGFFSVRNVGKTLVTRTQGTKIASEGLKGRVFEVSLADLQKNEEDAFKKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
             EDVQGRN LTNF+GMDFTTDKLR L++KWQSLIEAHVDVKTTD Y+LRMFCI 
Sbjct  88   VEDVQGRNCLTNFYGMDFTTDKLRFLIRKWQSLIEAHVDVKTTDGYSLRMFCIA  141



>ref|XP_001777314.1| predicted protein [Physcomitrella patens]
 gb|EDQ57844.1| predicted protein [Physcomitrella patens]
Length=269

 Score =   205 bits (521),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 106/120 (88%), Gaps = 6/120 (5%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTK------IASEGLKHRVFEVSLADLQNDEDNAF  326
            DWYDIKAP+ F+ +N+GKTLVTRT GTK      IAS+GLK RVFEVSLADLQNDED AF
Sbjct  28   DWYDIKAPNTFTQKNLGKTLVTRTAGTKAISSSDIASDGLKGRVFEVSLADLQNDEDQAF  87

Query  327  RKIRLRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            RKI+LRAEDVQG+NVLTNFWGMD TTDKLRSLV+KWQSLIEAHVDVKTTDNY +RMFCI 
Sbjct  88   RKIKLRAEDVQGKNVLTNFWGMDLTTDKLRSLVRKWQSLIEAHVDVKTTDNYMIRMFCIA  147



>ref|XP_005650618.1| ribosomal protein S3Ae [Coccomyxa subellipsoidea C-169]
 gb|EIE26074.1| ribosomal protein S3Ae [Coccomyxa subellipsoidea C-169]
Length=259

 Score =   202 bits (513),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYD+KAPS F++RN+GKTLVTRTQGTKIAS+GLK RVFEVSLADLQ +E +AFRKIRLR
Sbjct  28   DWYDVKAPSSFTSRNVGKTLVTRTQGTKIASDGLKGRVFEVSLADLQTNEADAFRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
             EDVQGRN LTNFWGMD+TTDKLRSLV+KWQ+LIEA VDVKTTD Y LRMF I 
Sbjct  88   VEDVQGRNCLTNFWGMDYTTDKLRSLVRKWQTLIEAQVDVKTTDGYLLRMFAIA  141



>ref|XP_002465526.1| hypothetical protein SORBIDRAFT_01g040570 [Sorghum bicolor]
 gb|EER92524.1| hypothetical protein SORBIDRAFT_01g040570 [Sorghum bicolor]
Length=254

 Score =   200 bits (508),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/121 (81%), Positives = 101/121 (83%), Gaps = 7/121 (6%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQG-------TKIASEGLKHRVFEVSLADLQNDEDNA  323
            DWYDIKAPSVFS RNIGKT V  T           IASEGLKHRVFEV LADLQ DED A
Sbjct  28   DWYDIKAPSVFSVRNIGKTSVQDTGCYSISNFIQNIASEGLKHRVFEVCLADLQGDEDQA  87

Query  324  FRKIRLRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCI  503
            +RKIRLRAEDVQGRNVLTNFWGM FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCI
Sbjct  88   YRKIRLRAEDVQGRNVLTNFWGMSFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCI  147

Query  504  G  506
            G
Sbjct  148  G  148



>ref|XP_002428136.1| 40S ribosomal protein S3A, putative [Pediculus humanus corporis]
 gb|EEB15398.1| 40S ribosomal protein S3A, putative [Pediculus humanus corporis]
Length=263

 Score =   199 bits (507),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 104/116 (90%), Gaps = 2/116 (2%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  338
            DWYD+KAPS+F+TR IGKTLV RTQGTKIASEGLK+RVFEVSLADLQND D   +FRK R
Sbjct  29   DWYDVKAPSMFATRQIGKTLVNRTQGTKIASEGLKNRVFEVSLADLQNDTDAERSFRKFR  88

Query  339  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            L AEDVQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEAHVDVKTTD Y LR+FCIG
Sbjct  89   LIAEDVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEAHVDVKTTDGYLLRVFCIG  144



>emb|CBI34197.3| unnamed protein product [Vitis vinifera]
Length=215

 Score =   197 bits (502),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPS+FS RN+GKTLV+RTQGTKIASEGLKHRVFE+SLADLQNDED+A+RKIRLR
Sbjct  28   DWYDIKAPSIFSVRNVGKTLVSRTQGTKIASEGLKHRVFEISLADLQNDEDHAYRKIRLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYT  485
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVD +  +  T
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDRQNQNKKT  134



>ref|XP_001422366.1| Ribosomal protein S3a, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
 sp|A4SAD2.1|RS3A_OSTLU RecName: Full=40S ribosomal protein S3a [Ostreococcus lucimarinus 
CCE9901]
 gb|ABP00683.1| Ribosomal protein S3a, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
Length=260

 Score =   199 bits (505),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPS+FS RNIGKTLV+RTQGTKIAS+GLK R+FE+SLADL NDED +FRK++L+
Sbjct  28   DWYDIKAPSMFSVRNIGKTLVSRTQGTKIASDGLKGRIFEISLADLNNDEDQSFRKMKLK  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
             EDVQG+NVLTNF GMDFTTDK+RSLV+KW SLIE  VDVKTTD YTLR+FCIG
Sbjct  88   CEDVQGKNVLTNFAGMDFTTDKIRSLVRKWFSLIECFVDVKTTDGYTLRVFCIG  141



>gb|EMT30223.1| 40S ribosomal protein S3a [Aegilops tauschii]
Length=257

 Score =   198 bits (504),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 94/113 (83%), Positives = 102/113 (90%), Gaps = 6/113 (5%)
 Frame = +3

Query  168  WYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRA  347
            WYDIKAP +F++RN+GKTLV+RTQ      EGLKHRVFEVSLADLQNDED A+RKIRLRA
Sbjct  29   WYDIKAPLLFTSRNVGKTLVSRTQ------EGLKHRVFEVSLADLQNDEDQAYRKIRLRA  82

Query  348  EDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            EDVQG NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNY LRMF IG
Sbjct  83   EDVQGMNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYMLRMFTIG  135



>emb|CEG00819.1| Ribosomal protein S3Ae [Ostreococcus tauri]
Length=258

 Score =   198 bits (504),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPS+FS RNIGKTLVTRTQGTKIAS+GLK R+FE+SLADL NDED +FRK++L+
Sbjct  28   DWYDIKAPSMFSVRNIGKTLVTRTQGTKIASDGLKGRIFEISLADLNNDEDQSFRKMKLK  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
             EDVQG+NVLTNF GMDFTTDK+RSLV+KW SLIE  VDVKTTD Y+LR+FCIG
Sbjct  88   CEDVQGKNVLTNFAGMDFTTDKIRSLVRKWFSLIECFVDVKTTDGYSLRVFCIG  141



>ref|XP_008671813.1| PREDICTED: 40S ribosomal protein S3a-like [Zea mays]
Length=238

 Score =   197 bits (502),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            D YDIKAP VFS RNIGKTLV+RTQGTKIASEGLKHRVFEVSL DL +DED  + KIRL 
Sbjct  28   DRYDIKAPPVFSVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLVDLHSDEDKTYMKIRLC  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQG NV+TNFWGM FTTDKL SLVKKWQ LIEAHV++KTTDNY LR+FCIG
Sbjct  88   AEDVQGGNVITNFWGMSFTTDKLHSLVKKWQRLIEAHVNIKTTDNYMLRLFCIG  141



>gb|KFM56731.1| 40S ribosomal protein S3a, partial [Stegodyphus mimosarum]
Length=187

 Score =   195 bits (495),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 103/114 (90%), Gaps = 1/114 (1%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYD+KAP++FS RN+GKTLV RTQGTKIASEGLK RVFE+SLADLQNDE  AFRK RL 
Sbjct  29   DWYDVKAPAMFSVRNVGKTLVNRTQGTKIASEGLKGRVFEISLADLQNDEI-AFRKFRLI  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AE+VQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA+VDVKTTD Y LRMFCIG
Sbjct  88   AEEVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEANVDVKTTDGYLLRMFCIG  141



>gb|KDR16079.1| 40S ribosomal protein S3a [Zootermopsis nevadensis]
Length=263

 Score =   197 bits (500),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 104/116 (90%), Gaps = 2/116 (2%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  338
            DWYD+KAPS+F+TR IGKTLV RTQGTKIASEGLK+RVFEVSLADLQND D   +FRK R
Sbjct  29   DWYDVKAPSMFATRQIGKTLVNRTQGTKIASEGLKYRVFEVSLADLQNDNDAERSFRKFR  88

Query  339  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            L AEDVQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA+VDVKTTD Y LR+FCIG
Sbjct  89   LIAEDVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEANVDVKTTDGYLLRVFCIG  144



>gb|AGM32131.1| 40S ribosomal protein S3a [Coptotermes formosanus]
Length=272

 Score =   197 bits (500),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 104/116 (90%), Gaps = 2/116 (2%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  338
            DWYD+KAPS+F+TR IGKTLV RTQGTKIASEGLK+RVFEVSLADLQND D   +FRK R
Sbjct  38   DWYDVKAPSMFATRQIGKTLVNRTQGTKIASEGLKYRVFEVSLADLQNDNDAERSFRKFR  97

Query  339  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            L AEDVQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA+VDVKTTD Y LR+FCIG
Sbjct  98   LIAEDVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEANVDVKTTDGYLLRVFCIG  153



>sp|Q5G5C4.1|RS3A_PERAM RecName: Full=40S ribosomal protein S3a [Periplaneta americana]
 gb|AAW57773.1| Parcxpwex01 [Periplaneta americana]
Length=263

 Score =   196 bits (499),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 104/116 (90%), Gaps = 2/116 (2%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  338
            DWYD+KAPS+F+TR IGKTLV RTQGTKIASEGLK+RVFEVSLADLQND D   +FRK R
Sbjct  29   DWYDVKAPSMFATRQIGKTLVNRTQGTKIASEGLKYRVFEVSLADLQNDNDAERSFRKFR  88

Query  339  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            L AEDVQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA+VDVKTTD Y LR+FCIG
Sbjct  89   LIAEDVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEANVDVKTTDGYLLRVFCIG  144



>sp|Q6EV04.1|RS3A_BIPLU RecName: Full=40S ribosomal protein S3a [Biphyllus lunatus]
 emb|CAH04315.1| S3Ae ribosomal protein [Biphyllus lunatus]
Length=267

 Score =   196 bits (499),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 101/116 (87%), Gaps = 2/116 (2%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  338
            DWYD+KAP +F+TR +GKTLV RTQGTKIASEGLKHRVFEVSLADLQND D   +FRK R
Sbjct  29   DWYDVKAPCMFATRQVGKTLVNRTQGTKIASEGLKHRVFEVSLADLQNDNDAERSFRKFR  88

Query  339  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            L AEDVQGRNVLTNF GMD TTDKLRS+VKKWQSLIEA  DVKTTD Y LR+FCIG
Sbjct  89   LIAEDVQGRNVLTNFHGMDLTTDKLRSMVKKWQSLIEASADVKTTDGYLLRVFCIG  144



>gb|ABS44871.1| ribosomal protein S3Ae [Pteromalus puparum]
Length=249

 Score =   195 bits (496),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 103/116 (89%), Gaps = 2/116 (2%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQ--NDEDNAFRKIR  338
            DWYD+KAPSVF+ R +GKTLV RTQGTKIASEGLKHRVFEVSLADLQ  ND + +FRK R
Sbjct  11   DWYDVKAPSVFTLRQVGKTLVNRTQGTKIASEGLKHRVFEVSLADLQSDNDAERSFRKFR  70

Query  339  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            L AEDVQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA VDVKTTD Y+LR+FCIG
Sbjct  71   LIAEDVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEAVVDVKTTDGYSLRVFCIG  126



>ref|XP_001601315.1| PREDICTED: 40S ribosomal protein S3a [Nasonia vitripennis]
Length=267

 Score =   196 bits (497),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 103/116 (89%), Gaps = 2/116 (2%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQ--NDEDNAFRKIR  338
            DWYD+KAPSVF+ R +GKTLV RTQGTKIASEGLKHRVFEVSLADLQ  ND + +FRK R
Sbjct  29   DWYDVKAPSVFTLRQVGKTLVNRTQGTKIASEGLKHRVFEVSLADLQSDNDAERSFRKFR  88

Query  339  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            L AEDVQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA VDVKTTD Y+LR+FCIG
Sbjct  89   LIAEDVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEAVVDVKTTDGYSLRVFCIG  144



>emb|CCD22031.1| 40S ribosomal protein S3A [Cupiennius salei]
Length=149

 Score =   192 bits (487),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 102/114 (89%), Gaps = 1/114 (1%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYD+KAP +FS RN+GKTLV RTQGTKIASEGLK RVFE+SLADLQNDE  AFRK RL 
Sbjct  29   DWYDVKAPVMFSVRNVGKTLVNRTQGTKIASEGLKGRVFEISLADLQNDEI-AFRKFRLI  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AE+VQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA+VDVKTTD Y LRMFCIG
Sbjct  88   AEEVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEANVDVKTTDGYLLRMFCIG  141



>gb|ACD61705.1| ribosomal protein S3 [Chironomus riparius]
Length=270

 Score =   196 bits (497),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 102/116 (88%), Gaps = 2/116 (2%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  338
            DWYDIKAPS+F+TR +GKTLV RTQGTKIASEGLK RVFEVSLADLQND D   +FRK +
Sbjct  29   DWYDIKAPSMFTTRQVGKTLVNRTQGTKIASEGLKGRVFEVSLADLQNDNDAERSFRKFK  88

Query  339  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            L AEDVQGRNVLTNF GMD TTDKLRS+VKKWQ+LIE HVDVKTTD Y LR+FCIG
Sbjct  89   LIAEDVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIECHVDVKTTDGYLLRVFCIG  144



>gb|ABX75452.1| 40S ribosomal protein S3a [Lycosa singoriensis]
Length=223

 Score =   194 bits (492),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 102/114 (89%), Gaps = 1/114 (1%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYD+KAP +FS RN+GKTLV RTQGTKIASEGLK RVFE+SLADLQNDE  AFRK RL 
Sbjct  29   DWYDVKAPVMFSVRNVGKTLVNRTQGTKIASEGLKGRVFEISLADLQNDE-IAFRKFRLI  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AE+VQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA+VDVKTTD Y LRMFCIG
Sbjct  88   AEEVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEANVDVKTTDGYLLRMFCIG  141



>ref|XP_011495909.1| PREDICTED: 40S ribosomal protein S3a [Ceratosolen solmsi marchali]
Length=267

 Score =   194 bits (493),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 103/116 (89%), Gaps = 2/116 (2%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  338
            DWYD+KAPSVF+ R++GKTLV RTQGTKIASEGLKHRVFEVSLADLQ+D D   +FRK R
Sbjct  29   DWYDVKAPSVFTVRHVGKTLVNRTQGTKIASEGLKHRVFEVSLADLQSDHDAERSFRKFR  88

Query  339  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            L AEDVQGR VLTNF GMD TTDKLRS+VKKWQ+LIEA VDVKTTD Y+LR+FCIG
Sbjct  89   LIAEDVQGRGVLTNFHGMDLTTDKLRSMVKKWQTLIEAVVDVKTTDGYSLRVFCIG  144



>dbj|BAN20332.1| ribosomal protein S3A [Riptortus pedestris]
Length=262

 Score =   194 bits (492),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 103/116 (89%), Gaps = 2/116 (2%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  338
            DWYD+KAPS+F+TR IGKTLV RTQGTKIASEGLK RVFEVSLADLQND D   +FRK R
Sbjct  29   DWYDVKAPSMFNTRQIGKTLVNRTQGTKIASEGLKGRVFEVSLADLQNDSDAERSFRKFR  88

Query  339  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            L AEDVQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA+VDV+TTD Y LR+FCIG
Sbjct  89   LIAEDVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEANVDVRTTDGYLLRVFCIG  144



>ref|XP_008555289.1| PREDICTED: 40S ribosomal protein S3a [Microplitis demolitor]
Length=266

 Score =   193 bits (491),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 104/116 (90%), Gaps = 2/116 (2%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  338
            DWYD+KAPS+F+TR +GKTLV RTQGTKIASEGLK RVFEVSLADLQND+D   +FRK R
Sbjct  29   DWYDVKAPSMFTTRQVGKTLVNRTQGTKIASEGLKLRVFEVSLADLQNDQDAERSFRKFR  88

Query  339  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            L AEDVQGR+VLTNF GMD TTDKLRS+VKKWQ+LIEA+VDVKTTD Y LR+FCIG
Sbjct  89   LIAEDVQGRSVLTNFHGMDLTTDKLRSMVKKWQTLIEANVDVKTTDGYLLRVFCIG  144



>emb|CAJ17219.1| ribosomal protein S3Ae [Timarcha balearica]
Length=268

 Score =   193 bits (490),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 102/116 (88%), Gaps = 2/116 (2%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  338
            DWYD+KAPS+F+TR +GKTLV RTQGTKIASEGLK+RVFEVSLADLQND D   +FRK R
Sbjct  29   DWYDVKAPSMFTTRQVGKTLVNRTQGTKIASEGLKYRVFEVSLADLQNDNDAERSFRKFR  88

Query  339  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            L AEDVQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA  DVKT+D Y LR+FCIG
Sbjct  89   LIAEDVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEASADVKTSDGYLLRVFCIG  144



>ref|XP_011155135.1| PREDICTED: 40S ribosomal protein S3a [Harpegnathos saltator]
 gb|EFN87627.1| 40S ribosomal protein S3a [Harpegnathos saltator]
Length=267

 Score =   192 bits (489),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 103/116 (89%), Gaps = 2/116 (2%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  338
            DWYD+KAPS+F+ R +GKTLV RTQGTKIASEGLK RVFEVSLADLQ+D+D   +FRK R
Sbjct  29   DWYDVKAPSMFANRQVGKTLVNRTQGTKIASEGLKFRVFEVSLADLQSDQDAERSFRKFR  88

Query  339  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            L AEDVQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA+VDVKTTD Y LR+FCIG
Sbjct  89   LIAEDVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEANVDVKTTDGYLLRVFCIG  144



>ref|XP_968064.1| PREDICTED: 40S ribosomal protein S3a [Tribolium castaneum]
 gb|EFA05373.1| hypothetical protein TcasGA2_TC015539 [Tribolium castaneum]
Length=267

 Score =   192 bits (489),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 101/116 (87%), Gaps = 2/116 (2%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  338
            DWYD+KAPS+F+TR +GKTLV RTQGTKIASEGLK RVFEVSLADLQND D   +FRK R
Sbjct  29   DWYDVKAPSMFATRQVGKTLVNRTQGTKIASEGLKGRVFEVSLADLQNDNDAERSFRKFR  88

Query  339  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            L AEDVQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA  DVKTTD Y LR+FCIG
Sbjct  89   LIAEDVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEASADVKTTDGYLLRVFCIG  144



>ref|XP_011142878.1| PREDICTED: 40S ribosomal protein S3a [Harpegnathos saltator]
 gb|EFN82270.1| 40S ribosomal protein S3a [Harpegnathos saltator]
Length=267

 Score =   192 bits (489),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 103/116 (89%), Gaps = 2/116 (2%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  338
            DWYD+KAPS+F+ R +GKTLV RTQGTKIASEGLK RVFEVSLADLQ+D+D   +FRK R
Sbjct  29   DWYDVKAPSMFANRQVGKTLVNRTQGTKIASEGLKFRVFEVSLADLQSDQDAERSFRKFR  88

Query  339  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            L AEDVQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA+VDVKTTD Y LR+FCIG
Sbjct  89   LIAEDVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEANVDVKTTDGYLLRVFCIG  144



>ref|XP_011159168.1| PREDICTED: 40S ribosomal protein S3a [Solenopsis invicta]
Length=267

 Score =   192 bits (488),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 103/116 (89%), Gaps = 2/116 (2%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  338
            DWYD+KAPS+F+ R +GKTLV RTQGTKIASEGLK RVFEVSLADLQ+D+D   +FRK R
Sbjct  29   DWYDVKAPSMFANRQVGKTLVNRTQGTKIASEGLKFRVFEVSLADLQSDQDAERSFRKFR  88

Query  339  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            L AEDVQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA+VDVKTTD Y LR+FCIG
Sbjct  89   LIAEDVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEANVDVKTTDGYLLRVFCIG  144



>ref|XP_011259689.1| PREDICTED: 40S ribosomal protein S3a [Camponotus floridanus]
 gb|EFN66139.1| 40S ribosomal protein S3a [Camponotus floridanus]
Length=267

 Score =   192 bits (488),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 103/116 (89%), Gaps = 2/116 (2%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  338
            DWYD+KAPS+F+ R +GKTLV RTQGTKIASEGLK RVFEVSLADLQ+D+D   +FRK R
Sbjct  29   DWYDVKAPSMFANRQVGKTLVNRTQGTKIASEGLKFRVFEVSLADLQSDQDAERSFRKFR  88

Query  339  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            L AEDVQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA+VDVKTTD Y LR+FCIG
Sbjct  89   LIAEDVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEANVDVKTTDGYLLRVFCIG  144



>ref|XP_011060675.1| PREDICTED: 40S ribosomal protein S3a [Acromyrmex echinatior]
 gb|EGI61728.1| 40S ribosomal protein S3a [Acromyrmex echinatior]
Length=267

 Score =   192 bits (487),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 103/116 (89%), Gaps = 2/116 (2%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  338
            DWYD+KAPS+F+ R +GKTLV RTQGTKIASEGLK RVFEVSLADLQ+D+D   +FRK R
Sbjct  29   DWYDVKAPSMFANRQVGKTLVNRTQGTKIASEGLKFRVFEVSLADLQSDQDAERSFRKFR  88

Query  339  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            L AEDVQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA+VDVKTTD Y LR+FCIG
Sbjct  89   LIAEDVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEANVDVKTTDGYLLRVFCIG  144



>ref|XP_011352079.1| PREDICTED: 40S ribosomal protein S3a [Cerapachys biroi]
 gb|EZA60712.1| 40S ribosomal protein S3a [Cerapachys biroi]
Length=267

 Score =   192 bits (487),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 103/116 (89%), Gaps = 2/116 (2%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  338
            DWYD+KAPS+F+ R +GKTLV RTQGTKIASEGLK RVFEVSLADLQ+D+D   +FRK R
Sbjct  29   DWYDVKAPSMFANRQVGKTLVNRTQGTKIASEGLKFRVFEVSLADLQSDQDAERSFRKFR  88

Query  339  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            L AEDVQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA+VDVKTTD Y LR+FCIG
Sbjct  89   LIAEDVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEANVDVKTTDGYLLRVFCIG  144



>gb|AAV84249.1| ribosomal protein S3 [Culicoides sonorensis]
Length=215

 Score =   190 bits (483),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 101/116 (87%), Gaps = 2/116 (2%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  338
            DWYD+KAPS+F+ R +GKTLV RTQGTKIASEGLK RVFEVSLADLQND D   +FRK +
Sbjct  27   DWYDVKAPSMFAIRQVGKTLVNRTQGTKIASEGLKGRVFEVSLADLQNDTDAERSFRKFK  86

Query  339  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            L AEDVQGR+VLTNF GMD TTDKLRS+VKKWQ+LIE HVDVKTTD Y LR+FCIG
Sbjct  87   LIAEDVQGRDVLTNFHGMDLTTDKLRSMVKKWQTLIECHVDVKTTDGYLLRVFCIG  142



>gb|AFW89329.1| hypothetical protein ZEAMMB73_166147 [Zea mays]
Length=231

 Score =   191 bits (484),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 88/98 (90%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = +3

Query  213  GKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGM  392
            GKTLV+RTQGT+IASEGLKHRVFEV LADLQ DED A+RKIRLRAEDVQGRNVLTNFWGM
Sbjct  15   GKTLVSRTQGTRIASEGLKHRVFEVCLADLQGDEDQAYRKIRLRAEDVQGRNVLTNFWGM  74

Query  393  DFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            +FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIG
Sbjct  75   NFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIG  112



>ref|XP_003704988.1| PREDICTED: 40S ribosomal protein S3a-like [Megachile rotundata]
Length=267

 Score =   191 bits (485),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 103/116 (89%), Gaps = 2/116 (2%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  338
            DWYD+KAPS+F+ R++GKTLV RTQGTKIASEGLK+RVFEVSLADLQND D   +FRK R
Sbjct  29   DWYDVKAPSMFTNRHVGKTLVNRTQGTKIASEGLKYRVFEVSLADLQNDGDAERSFRKFR  88

Query  339  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            L AEDVQ RNVLTNF GMD TTDKLRS+VKKWQ+LIEA+VDVKTTD Y LR+FCIG
Sbjct  89   LIAEDVQHRNVLTNFHGMDLTTDKLRSMVKKWQTLIEANVDVKTTDGYLLRVFCIG  144



>ref|XP_003399883.1| PREDICTED: 40S ribosomal protein S3a-like [Bombus terrestris]
 ref|XP_003493551.1| PREDICTED: 40S ribosomal protein S3a-like [Bombus impatiens]
 ref|XP_003695223.1| PREDICTED: 40S ribosomal protein S3a-like [Apis florea]
 ref|XP_006565264.1| PREDICTED: 40S ribosomal protein S3a [Apis mellifera]
 ref|XP_006615653.1| PREDICTED: 40S ribosomal protein S3a-like [Apis dorsata]
Length=267

 Score =   191 bits (485),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 103/116 (89%), Gaps = 2/116 (2%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  338
            DWYD+KAPS+F+ R++GKTLV RTQGTKIASEGLK+RVFEVSLADLQND D   +FRK R
Sbjct  29   DWYDVKAPSMFTNRHVGKTLVNRTQGTKIASEGLKYRVFEVSLADLQNDGDAERSFRKFR  88

Query  339  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            L AEDVQ RNVLTNF GMD TTDKLRS+VKKWQ+LIEA+VDVKTTD Y LR+FCIG
Sbjct  89   LIAEDVQHRNVLTNFHGMDLTTDKLRSMVKKWQTLIEANVDVKTTDGYLLRVFCIG  144



>gb|ACD65096.1| putative 40S ribosomal protein RPS3A [Novocrania anomala]
Length=185

 Score =   188 bits (478),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 102/114 (89%), Gaps = 1/114 (1%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYD+KAPS+F+ R IGKTLVTRTQGTKIAS+GLK RVFE +LADLQNDE  +FRK +L 
Sbjct  29   DWYDVKAPSMFAVRQIGKTLVTRTQGTKIASDGLKGRVFECALADLQNDEI-SFRKFKLM  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AEDVQGRNVLTNF GM+ TTDKLRS+VKKWQ+LIEA+VDVKTTD Y LR+FCIG
Sbjct  88   AEDVQGRNVLTNFHGMNLTTDKLRSMVKKWQTLIEANVDVKTTDGYLLRVFCIG  141



>sp|A6YPJ8.1|RS3A_TRIIF RecName: Full=40S ribosomal protein S3a [Triatoma infestans]
 gb|ABR27894.1| 40S ribosomal protein S3a [Triatoma infestans]
Length=262

 Score =   191 bits (484),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 102/116 (88%), Gaps = 2/116 (2%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  338
            DWYD+KAPS+F+TR IGKTLV RTQGTKIASEGLK RVFEVSLADLQND D   ++RK R
Sbjct  29   DWYDVKAPSMFTTRQIGKTLVNRTQGTKIASEGLKGRVFEVSLADLQNDTDAERSYRKFR  88

Query  339  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            L AEDVQ RNVLTNF GMD TTDKLRS+VKKWQ+LIEA+VDV+TTD Y LR+FCIG
Sbjct  89   LIAEDVQARNVLTNFHGMDLTTDKLRSMVKKWQTLIEANVDVRTTDGYLLRVFCIG  144



>gb|AAU06483.1| ribosomal protein subunit 3 [Culicoides sonorensis]
Length=265

 Score =   191 bits (484),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 101/116 (87%), Gaps = 2/116 (2%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  338
            DWYD+KAPS+F+ R +GKTLV RTQGTKIASEGLK RVFEVSLADLQND D   +FRK +
Sbjct  30   DWYDVKAPSMFAIRQVGKTLVNRTQGTKIASEGLKGRVFEVSLADLQNDTDAERSFRKFK  89

Query  339  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            L AEDVQGR+VLTNF GMD TTDKLRS+VKKWQ+LIE HVDVKTTD Y LR+FCIG
Sbjct  90   LIAEDVQGRDVLTNFHGMDLTTDKLRSMVKKWQTLIECHVDVKTTDGYLLRVFCIG  145



>ref|XP_008478156.1| PREDICTED: 40S ribosomal protein S3a [Diaphorina citri]
Length=208

 Score =   189 bits (479),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 103/117 (88%), Gaps = 3/117 (3%)
 Frame = +3

Query  165  DWYDIKAPS-VFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKI  335
            DWYD+KAPS +F+ + +GKTLV RTQGTKIASEGLKHRVFEVSLADLQ+D+D   +FRK 
Sbjct  29   DWYDVKAPSAMFTNKQVGKTLVNRTQGTKIASEGLKHRVFEVSLADLQSDQDAERSFRKF  88

Query  336  RLRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            RL AEDVQG NVLTNF GMD TTDKLRS+VKKWQ+LIEA+VDVKTTD Y LR+FCIG
Sbjct  89   RLIAEDVQGHNVLTNFHGMDLTTDKLRSMVKKWQTLIEANVDVKTTDGYLLRLFCIG  145



>gb|ABI52667.1| 40S ribosomal protein S3a [Argas monolakensis]
Length=255

 Score =   190 bits (482),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 99/114 (87%), Gaps = 1/114 (1%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYD+KAP ++S RNIGKT V RTQGTKIASEGLK RVFEVS ADLQN ED AFRK RL 
Sbjct  15   DWYDVKAPMMYSVRNIGKTFVNRTQGTKIASEGLKGRVFEVSQADLQNGED-AFRKFRLI  73

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AE+VQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA VDV+TTD Y LRMFCIG
Sbjct  74   AEEVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEATVDVRTTDGYLLRMFCIG  127



>ref|XP_007508881.1| predicted protein [Bathycoccus prasinos]
 emb|CCO19967.1| predicted protein [Bathycoccus prasinos]
Length=267

 Score =   190 bits (483),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPS+F+ RN+GKT  TRTQGTKIAS+GLK R+FE SLADL  DED AFRK+ L+
Sbjct  36   DWYDIKAPSMFTVRNVGKTPQTRTQGTKIASDGLKGRIFECSLADLNQDEDQAFRKMFLK  95

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
             EDVQG+NVLTNF+GMDFTTDK+RSLV+KW SLIE  VDVKTTD YT+R+FCIG
Sbjct  96   CEDVQGKNVLTNFYGMDFTTDKIRSLVRKWFSLIECFVDVKTTDGYTMRVFCIG  149



>gb|ACY71306.1| ribosomal protein S3A [Chrysomela tremula]
Length=269

 Score =   189 bits (481),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 101/116 (87%), Gaps = 2/116 (2%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  338
            DWYD+KAPS+F+TR +GKTLV RTQGT+IASEGLK RVFEVSLADLQND D   ++RK R
Sbjct  29   DWYDVKAPSMFATRQVGKTLVNRTQGTRIASEGLKSRVFEVSLADLQNDNDAERSYRKFR  88

Query  339  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            L AEDVQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA  DVKT+D Y LR+FCIG
Sbjct  89   LIAEDVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEASADVKTSDGYLLRVFCIG  144



>ref|XP_011297729.1| PREDICTED: 40S ribosomal protein S3a [Fopius arisanus]
Length=266

 Score =   189 bits (481),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 102/116 (88%), Gaps = 2/116 (2%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  338
            DWYD+KAPS+F+TR +GKTLV RTQGTKIASEGLK RVFEVSLADLQND D   +FRK R
Sbjct  29   DWYDVKAPSMFTTRQVGKTLVNRTQGTKIASEGLKGRVFEVSLADLQNDHDAERSFRKFR  88

Query  339  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            L AEDVQ R+VLTNF GMD TTDKLRS+VKKWQ+LIEA+VDVKTTD Y LR+FCIG
Sbjct  89   LIAEDVQHRSVLTNFHGMDLTTDKLRSMVKKWQTLIEANVDVKTTDGYLLRVFCIG  144



>gb|KDD76342.1| ribosomal protein S3Ae [Helicosporidium sp. ATCC 50920]
Length=259

 Score =   189 bits (479),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYDIKAPS+FS RN+GKTLVTRT GTKIAS+GLK R+  VSLADLQ++E +A+R I+LR
Sbjct  28   DWYDIKAPSMFSVRNVGKTLVTRTAGTKIASDGLKGRIINVSLADLQSNEADAYRNIKLR  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCI  503
             EDVQGRN LT+F GMD TTDKLRSLV+KWQ+LIEAHVDV+T D YTLRMFCI
Sbjct  88   IEDVQGRNCLTHFHGMDLTTDKLRSLVRKWQTLIEAHVDVRTADGYTLRMFCI  140



>gb|ABW23199.1| ribosomal protein rps3a [Eurythoe complanata]
Length=263

 Score =   189 bits (479),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 103/114 (90%), Gaps = 1/114 (1%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYD+KAPS+F+ R IGKTLVTRTQGTKIASEGLK RVFEVSLADLQNDE  AFRK +L 
Sbjct  29   DWYDVKAPSMFNIRQIGKTLVTRTQGTKIASEGLKGRVFEVSLADLQNDE-VAFRKFKLV  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AE+VQGRNVLTNF GM+ TTDKLRS+VKKWQ+LIEA+VDV+TTD + LR+FCIG
Sbjct  88   AEEVQGRNVLTNFHGMNLTTDKLRSMVKKWQTLIEANVDVRTTDAFLLRLFCIG  141



>sp|Q4KTD9.1|RS3A_SUBDO RecName: Full=40S ribosomal protein S3a [Suberites domuncula]
 gb|AAX48879.1| S3a [Suberites domuncula]
Length=252

 Score =   187 bits (476),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 102/114 (89%), Gaps = 1/114 (1%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYD+KAPS+F+ RNIGKTLVTRTQG K+AS+GLK RVFEVSLADLQNDE  +FRK RL 
Sbjct  28   DWYDVKAPSMFAVRNIGKTLVTRTQGKKLASDGLKGRVFEVSLADLQNDE-QSFRKFRLI  86

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            +ED+QG+NVLTNF GM  TTDKLR+LVKKWQ+LIEA+VDVKTTD Y LR+FCIG
Sbjct  87   SEDIQGKNVLTNFHGMTMTTDKLRALVKKWQTLIEANVDVKTTDGYLLRLFCIG  140



>tpg|DAA34106.1| TPA_exp: 40S ribosomal protein S3a [Amblyomma variegatum]
Length=214

 Score =   186 bits (472),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 99/114 (87%), Gaps = 1/114 (1%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYD+KAP++++ RNIGKT V RTQGTKIASEGLK RVFEVS ADL N ED AFRK RL 
Sbjct  29   DWYDVKAPTMYTVRNIGKTFVNRTQGTKIASEGLKGRVFEVSQADLTNGED-AFRKFRLI  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            AE+VQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA VDV+TTD Y LRMFCIG
Sbjct  88   AEEVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEATVDVRTTDGYLLRMFCIG  141



>dbj|BAH12261.1| unnamed protein product [Homo sapiens]
Length=175

 Score =   184 bits (468),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 100/114 (88%), Gaps = 1/114 (1%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYD+KAP++F+ RNIGKTLVTRTQGTKIAS+GLK RVFEVSLADLQNDE  AFRK +L 
Sbjct  16   DWYDVKAPAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQNDE-VAFRKFKLI  74

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
             EDVQG+N LTNF GMD T DK+ S+VKKWQ++IEAHVDVKTTD Y LR+FC+G
Sbjct  75   TEDVQGKNCLTNFHGMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLLRLFCVG  128



>ref|XP_009024124.1| hypothetical protein HELRODRAFT_185887 [Helobdella robusta]
 gb|ESN97662.1| hypothetical protein HELRODRAFT_185887 [Helobdella robusta]
Length=262

 Score =   187 bits (475),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 102/114 (89%), Gaps = 1/114 (1%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYD+KAPS+F+ RNIGKT+V+RT GTKIAS+GLK RVFEVSLADLQNDE   FRK +L 
Sbjct  29   DWYDVKAPSMFNNRNIGKTIVSRTVGTKIASDGLKGRVFEVSLADLQNDE-ITFRKFKLM  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            +E+VQGR+VLTNF GMD TTDKLRS+VKKWQ+LIEAHVDVKTTD Y LR+FCIG
Sbjct  88   SEEVQGRHVLTNFHGMDMTTDKLRSMVKKWQTLIEAHVDVKTTDGYLLRLFCIG  141



>gb|EDL42086.1| mCG2066 [Mus musculus]
Length=173

 Score =   184 bits (467),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 100/114 (88%), Gaps = 1/114 (1%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYD+KAP++F+ RNIGKTLVTRTQGTKIAS+GLK RVFEVSLADLQNDE  AFRK +L 
Sbjct  29   DWYDVKAPAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQNDE-VAFRKFKLI  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
             EDVQG+N LTNF GMD T DK+ S+VKKWQ++IEAHVDVKTTD Y LR+FC+G
Sbjct  88   TEDVQGKNCLTNFHGMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLLRLFCVG  141



>gb|AEE62515.1| unknown [Dendroctonus ponderosae]
 gb|ENN71611.1| hypothetical protein YQE_11710, partial [Dendroctonus ponderosae]
 gb|ERL90610.1| hypothetical protein D910_07957 [Dendroctonus ponderosae]
Length=267

 Score =   187 bits (475),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 100/116 (86%), Gaps = 2/116 (2%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  338
            +WYD+KAPS+F++R +GKTLV RTQGTKIASEGLK RVFEVSLADLQND D   +FRK R
Sbjct  29   EWYDVKAPSMFTSRQVGKTLVNRTQGTKIASEGLKGRVFEVSLADLQNDNDAERSFRKFR  88

Query  339  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
            L AEDVQGR VLTNF GMD TTDKLRS+VKKWQSLIEA  DVKT+D Y LR+FCIG
Sbjct  89   LIAEDVQGRYVLTNFHGMDLTTDKLRSMVKKWQSLIEASADVKTSDGYLLRVFCIG  144



>dbj|BAC56507.1| similar to ribosomal protein S3a [Bos taurus]
Length=159

 Score =   183 bits (465),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 100/114 (88%), Gaps = 1/114 (1%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYD+KAP++F+ RNIGKTLVTRTQGTKIAS+GLK RVFEVSLADLQNDE  AFRK +L 
Sbjct  29   DWYDVKAPAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQNDE-VAFRKFKLI  87

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
             EDVQG+N LTNF GMD T DK+ S+VKKWQ++IEAHVDVKTTD Y LR+FC+G
Sbjct  88   TEDVQGKNCLTNFHGMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLLRLFCVG  141



>gb|KGL84225.1| hypothetical protein N309_14824, partial [Tinamus guttatus]
Length=167

 Score =   184 bits (466),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 100/114 (88%), Gaps = 1/114 (1%)
 Frame = +3

Query  165  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  344
            DWYD+KAP++F+ RNIGKTLVTRTQGTKIAS+GLK RVFEVSLADLQNDE  AFRK +L 
Sbjct  8    DWYDVKAPAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQNDE-VAFRKFKLV  66

Query  345  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  506
             EDVQG+N LTNF GMD T DK+ S+VKKWQ++IEAH+DVKTTD Y LR+FC+G
Sbjct  67   TEDVQGKNCLTNFHGMDLTRDKMCSMVKKWQTMIEAHIDVKTTDGYLLRLFCVG  120



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559877061510