BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001D17

Length=455
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU32062.1|  hypothetical protein MIMGU_mgv1a003954mg              88.2    1e-19   Erythranthe guttata [common monkey flower]
ref|XP_009804054.1|  PREDICTED: probable methyltransferase PMT15      83.2    4e-17   Nicotiana sylvestris
ref|XP_009629797.1|  PREDICTED: probable methyltransferase PMT15      81.6    4e-16   Nicotiana tomentosiformis
ref|XP_006339462.1|  PREDICTED: probable methyltransferase PMT15-...  77.4    3e-15   Solanum tuberosum [potatoes]
emb|CDP08881.1|  unnamed protein product                              70.5    3e-14   Coffea canephora [robusta coffee]
ref|XP_011091674.1|  PREDICTED: probable methyltransferase PMT15      69.7    1e-13   Sesamum indicum [beniseed]
ref|XP_004229839.1|  PREDICTED: probable methyltransferase PMT15      68.6    4e-12   Solanum lycopersicum
ref|XP_008375906.1|  PREDICTED: probable methyltransferase PMT15      55.8    1e-09   
ref|XP_009343539.1|  PREDICTED: probable methyltransferase PMT15      54.3    4e-09   
ref|XP_003580353.1|  PREDICTED: probable methyltransferase PMT15      55.8    1e-08   Brachypodium distachyon [annual false brome]
ref|XP_009400717.1|  PREDICTED: probable methyltransferase PMT15      45.8    2e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008795397.1|  PREDICTED: probable methyltransferase PMT15      47.0    3e-07   Phoenix dactylifera
ref|XP_007220534.1|  hypothetical protein PRUPE_ppa002801mg           47.4    5e-07   Prunus persica
ref|XP_010419631.1|  PREDICTED: probable methyltransferase PMT15      52.8    6e-07   Camelina sativa [gold-of-pleasure]
ref|XP_008232735.1|  PREDICTED: probable methyltransferase PMT15      46.6    7e-07   Prunus mume [ume]
ref|XP_010053660.1|  PREDICTED: probable methyltransferase PMT15      50.4    9e-07   Eucalyptus grandis [rose gum]
ref|XP_006445150.1|  hypothetical protein CICLE_v10019272mg           57.0    1e-06   Citrus clementina [clementine]
gb|KDO86012.1|  hypothetical protein CISIN_1g006633mg                 57.0    1e-06   Citrus sinensis [apfelsine]
ref|NP_001053603.1|  Os04g0570800                                     53.1    1e-06   
gb|KDP28686.1|  hypothetical protein JCGZ_14457                       52.4    1e-06   Jatropha curcas
emb|CDP05238.1|  unnamed protein product                              47.0    2e-06   Coffea canephora [robusta coffee]
gb|KDO86014.1|  hypothetical protein CISIN_1g006633mg                 56.2    2e-06   Citrus sinensis [apfelsine]
gb|EYU19524.1|  hypothetical protein MIMGU_mgv1a002864mg              47.0    3e-06   Erythranthe guttata [common monkey flower]
ref|XP_011076214.1|  PREDICTED: probable methyltransferase PMT15      42.4    1e-05   Sesamum indicum [beniseed]
ref|XP_010456248.1|  PREDICTED: probable methyltransferase PMT15      48.1    2e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010427380.1|  PREDICTED: probable methyltransferase PMT15      48.1    2e-05   Camelina sativa [gold-of-pleasure]
ref|XP_009801989.1|  PREDICTED: probable methyltransferase PMT15 ...  45.1    3e-05   Nicotiana sylvestris
ref|XP_009801988.1|  PREDICTED: probable methyltransferase PMT15 ...  45.1    4e-05   Nicotiana sylvestris
ref|XP_008799521.1|  PREDICTED: probable methyltransferase PMT15      40.4    8e-05   Phoenix dactylifera
ref|XP_004306838.1|  PREDICTED: probable methyltransferase PMT15      42.4    9e-05   Fragaria vesca subsp. vesca
ref|XP_009626220.1|  PREDICTED: probable methyltransferase PMT15      43.1    1e-04   Nicotiana tomentosiformis
emb|CDY18904.1|  BnaC04g04460D                                        43.1    1e-04   Brassica napus [oilseed rape]
ref|XP_002880195.1|  dehydration-responsive family protein            40.0    1e-04   
ref|XP_002301329.1|  dehydration-responsive family protein            41.6    2e-04   Populus trichocarpa [western balsam poplar]
ref|XP_009349944.1|  PREDICTED: probable methyltransferase PMT15      45.8    2e-04   Pyrus x bretschneideri [bai li]
ref|XP_002875017.1|  dehydration-responsive family protein            45.1    2e-04   
tpg|DAA36414.1|  TPA: hypothetical protein ZEAMMB73_585119            46.2    2e-04   
ref|XP_008354467.1|  PREDICTED: probable methyltransferase PMT15      45.4    2e-04   
ref|XP_008668482.1|  PREDICTED: uncharacterized protein LOC100384...  46.2    2e-04   Zea mays [maize]
ref|XP_008438092.1|  PREDICTED: probable methyltransferase PMT15      41.6    3e-04   Cucumis melo [Oriental melon]
ref|XP_010933874.1|  PREDICTED: probable methyltransferase PMT15      38.5    3e-04   Elaeis guineensis
ref|XP_004133882.1|  PREDICTED: probable methyltransferase PMT15-...  41.2    3e-04   
ref|XP_004155808.1|  PREDICTED: probable methyltransferase PMT15-...  41.2    3e-04   
ref|NP_182099.1|  putative methyltransferase PMT16                    40.4    4e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009399379.1|  PREDICTED: probable methyltransferase PMT15      40.4    4e-04   
ref|XP_009384529.1|  PREDICTED: probable methyltransferase PMT15      37.4    5e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002320758.2|  hypothetical protein POPTR_0014s07180g           42.7    6e-04   
gb|EPS57356.1|  hypothetical protein M569_17462                       44.7    7e-04   Genlisea aurea
gb|KJB09867.1|  hypothetical protein B456_001G171500                  39.3    7e-04   Gossypium raimondii



>gb|EYU32062.1| hypothetical protein MIMGU_mgv1a003954mg [Erythranthe guttata]
Length=552

 Score = 88.2 bits (217),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 48/90 (53%), Positives = 63/90 (70%), Gaps = 6/90 (7%)
 Frame = +3

Query  99   MAISARLPQFLSARTKRTNLYYVAATTVLCSVFYLIGILQHGGFSGQQISTAALLPSVPC  278
            MAI   L  +LS RTK+TNLYY+A TTVLCS+FYLIGI QHGG +    ++A LLPS+PC
Sbjct  1    MAIWGSLTHYLSLRTKKTNLYYMAITTVLCSIFYLIGIWQHGGAA----TSATLLPSLPC  56

Query  279  --EPlnkdstdttnltssssAVSLDFAAHH  362
              + +     +   L +++SAV+LDF AHH
Sbjct  57   NTDDIKTTGPNPKTLPTNASAVTLDFTAHH  86


 Score = 34.7 bits (78),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 13/26 (50%), Positives = 17/26 (65%), Gaps = 0/26 (0%)
 Frame = +1

Query  376  FVAVAQAPPAKEFPPCKAELSEYTPC  453
             V ++ A  A +FPPC  + SEYTPC
Sbjct  91   LVTLSPAARAAQFPPCDPKFSEYTPC  116



>ref|XP_009804054.1| PREDICTED: probable methyltransferase PMT15 [Nicotiana sylvestris]
Length=636

 Score = 83.2 bits (204),  Expect(2) = 4e-17, Method: Composition-based stats.
 Identities = 39/88 (44%), Positives = 57/88 (65%), Gaps = 5/88 (6%)
 Frame = +3

Query  99   MAISARLPQFLSARTKRTNLYYVAATTVLCSVFYLIGILQHGGFSGQQISTAALLPSVPC  278
            MAI   L  +L++++K+ NLYYVAAT VLC  FY+IG+   GG +  Q+S+  LLP++PC
Sbjct  1    MAIWTNLSHYLTSKSKKANLYYVAATVVLCCTFYVIGLWPQGGVNTTQLSSTTLLPTLPC  60

Query  279  EPlnkdstdttnltssssAVSLDFAAHH  362
             P     +     ++  S++SLDF AHH
Sbjct  61   NP-----SIKNTNSNYGSSISLDFTAHH  83


 Score = 30.8 bits (68),  Expect(2) = 4e-17, Method: Composition-based stats.
 Identities = 14/25 (56%), Positives = 16/25 (64%), Gaps = 2/25 (8%)
 Frame = +1

Query  385  VAQAPPAK--EFPPCKAELSEYTPC  453
            V  +P A+   FP C  ELSEYTPC
Sbjct  89   VPLSPSARVNHFPSCNPELSEYTPC  113



>ref|XP_009629797.1| PREDICTED: probable methyltransferase PMT15 [Nicotiana tomentosiformis]
Length=636

 Score = 81.6 bits (200),  Expect(2) = 4e-16, Method: Composition-based stats.
 Identities = 38/88 (43%), Positives = 57/88 (65%), Gaps = 5/88 (6%)
 Frame = +3

Query  99   MAISARLPQFLSARTKRTNLYYVAATTVLCSVFYLIGILQHGGFSGQQISTAALLPSVPC  278
            MAI   L  +L++++K+ NLYYVAAT VLC  FY+IG+   GG +  Q+S+  LLP++PC
Sbjct  1    MAIWTNLSHYLTSKSKKANLYYVAATVVLCCTFYVIGLWPQGGVNTTQLSSTTLLPTLPC  60

Query  279  EPlnkdstdttnltssssAVSLDFAAHH  362
             P     +     ++  S++SL+F AHH
Sbjct  61   NP-----SIKNTNSNYGSSISLEFTAHH  83


 Score = 29.3 bits (64),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 15/26 (58%), Gaps = 0/26 (0%)
 Frame = +1

Query  376  FVAVAQAPPAKEFPPCKAELSEYTPC  453
             V ++ +     FP C  ELSEYTPC
Sbjct  88   LVPLSPSARVNHFPSCNPELSEYTPC  113



>ref|XP_006339462.1| PREDICTED: probable methyltransferase PMT15-like [Solanum tuberosum]
Length=636

 Score = 77.4 bits (189),  Expect(2) = 3e-15, Method: Composition-based stats.
 Identities = 43/90 (48%), Positives = 58/90 (64%), Gaps = 7/90 (8%)
 Frame = +3

Query  99   MAISARLPQFLSARTKRTNLYYVAATTVLCSVFYLIGILQHGG--FSGQQISTAALLPSV  272
            MAI A+L   L++  K+TNLYYVAAT VLC  FY+IG+   GG   S Q  STA++LP++
Sbjct  1    MAILAKLSHSLTSIIKKTNLYYVAATIVLCCTFYVIGLWPQGGDVTSRQLSSTASILPTL  60

Query  273  PCEPlnkdstdttnltssssAVSLDFAAHH  362
            PC P     +      +S S++S+DF AHH
Sbjct  61   PCNP-----SIKNTNPNSGSSISIDFTAHH  85


 Score = 30.8 bits (68),  Expect(2) = 3e-15, Method: Composition-based stats.
 Identities = 11/26 (42%), Positives = 15/26 (58%), Gaps = 0/26 (0%)
 Frame = +1

Query  376  FVAVAQAPPAKEFPPCKAELSEYTPC  453
             V ++ +     +P C  ELSEYTPC
Sbjct  90   LVPLSSSASVNHYPSCNPELSEYTPC  115



>emb|CDP08881.1| unnamed protein product [Coffea canephora]
Length=640

 Score = 70.5 bits (171),  Expect(2) = 3e-14, Method: Composition-based stats.
 Identities = 40/88 (45%), Positives = 52/88 (59%), Gaps = 4/88 (5%)
 Frame = +3

Query  99   MAISARLPQFLSARTKRTNLYYVAATTVLCSVFYLIGILQHGGFSGQQISTAALLPSVPC  278
            MA  A LP +L+ +TK+T+L+Y+A TTVLCS+ YLIGI QHGG      S  A L  +PC
Sbjct  1    MATWANLPYYLTLKTKKTSLFYMAVTTVLCSLSYLIGIWQHGGLKIAAKSPMATLLELPC  60

Query  279  EPlnkdstdttnltssssAVSLDFAAHH  362
                 +          SS+V+LDF A H
Sbjct  61   S----NLNKNFTTIGGSSSVTLDFTARH  84


 Score = 33.9 bits (76),  Expect(2) = 3e-14, Method: Composition-based stats.
 Identities = 12/26 (46%), Positives = 17/26 (65%), Gaps = 0/26 (0%)
 Frame = +1

Query  376  FVAVAQAPPAKEFPPCKAELSEYTPC  453
             V ++ +   ++ PPCK E SEYTPC
Sbjct  89   LVPLSSSARVEQIPPCKPEFSEYTPC  114



>ref|XP_011091674.1| PREDICTED: probable methyltransferase PMT15 [Sesamum indicum]
Length=645

 Score = 69.7 bits (169),  Expect(2) = 1e-13, Method: Composition-based stats.
 Identities = 35/55 (64%), Positives = 41/55 (75%), Gaps = 2/55 (4%)
 Frame = +3

Query  99   MAISARLPQFLSARTKRTNLYYVAATTVLCSVFYLIGILQHGGFSGQQISTAALL  263
            MA  A L  +LS RTK+TNLYY+A TTVLCS+FYLIGI QHGG  G   +T+A L
Sbjct  1    MAAWATLTHYLSLRTKKTNLYYMALTTVLCSIFYLIGIWQHGG--GATSTTSATL  53


 Score = 32.3 bits (72),  Expect(2) = 1e-13, Method: Composition-based stats.
 Identities = 12/26 (46%), Positives = 17/26 (65%), Gaps = 0/26 (0%)
 Frame = +1

Query  376  FVAVAQAPPAKEFPPCKAELSEYTPC  453
             V ++ +  A +FPPC  + SEYTPC
Sbjct  93   LVPLSPSARALQFPPCDRKFSEYTPC  118



>ref|XP_004229839.1| PREDICTED: probable methyltransferase PMT15 [Solanum lycopersicum]
Length=636

 Score = 68.6 bits (166),  Expect(2) = 4e-12, Method: Composition-based stats.
 Identities = 39/90 (43%), Positives = 53/90 (59%), Gaps = 7/90 (8%)
 Frame = +3

Query  99   MAISARLPQFLSARTKRTNLYYVAATTVLCSVFYLIGILQHGG--FSGQQISTAALLPSV  272
            M I A L   +++  K++NLYYVAAT VLC  FY+IG    GG   S Q  STA +LP++
Sbjct  1    MVILADLTHSITSIIKKSNLYYVAATIVLCCTFYVIGFWPQGGDVTSRQLSSTATILPTL  60

Query  273  PCEPlnkdstdttnltssssAVSLDFAAHH  362
            PC P     +      +S S++ +DF AHH
Sbjct  61   PCNP-----SIKNTNPNSRSSIPIDFTAHH  85


 Score = 28.9 bits (63),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (58%), Gaps = 0/26 (0%)
 Frame = +1

Query  376  FVAVAQAPPAKEFPPCKAELSEYTPC  453
             V ++ +     +P C  ELSEYTPC
Sbjct  90   LVPLSSSARVNHYPSCNLELSEYTPC  115



>ref|XP_008375906.1| PREDICTED: probable methyltransferase PMT15 [Malus domestica]
Length=632

 Score = 55.8 bits (133),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 30/80 (38%), Positives = 42/80 (53%), Gaps = 13/80 (16%)
 Frame = +3

Query  123  QFLSARTKRTNLYYVAATTVLCSVFYLIGILQHGGFSGQQISTAALLPSVPCEPlnkdst  302
            Q+LS + KR NLYY+    VLC++ YL+GI QH   SG  + TA++     C P      
Sbjct  8    QYLSLKPKRANLYYMTLAAVLCTLCYLVGIWQHS--SGGAVITASVSAVASCPP------  59

Query  303  dttnltssssAVSLDFAAHH  362
                  + +  + LDF AHH
Sbjct  60   -----ITINKTIHLDFKAHH  74


 Score = 32.7 bits (73),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 14/23 (61%), Positives = 15/23 (65%), Gaps = 4/23 (17%)
 Frame = +1

Query  397  PPA----KEFPPCKAELSEYTPC  453
            PPA       PPC A+LSEYTPC
Sbjct  82   PPAAARVDHLPPCNAKLSEYTPC  104



>ref|XP_009343539.1| PREDICTED: probable methyltransferase PMT15 [Pyrus x bretschneideri]
Length=632

 Score = 54.3 bits (129),  Expect(2) = 4e-09, Method: Composition-based stats.
 Identities = 29/80 (36%), Positives = 41/80 (51%), Gaps = 13/80 (16%)
 Frame = +3

Query  123  QFLSARTKRTNLYYVAATTVLCSVFYLIGILQHGGFSGQQISTAALLPSVPCEPlnkdst  302
            Q+ S + KR NLYY+    VLC++ YL+GI QH   SG  + TA++     C P      
Sbjct  8    QYFSLKPKRANLYYMTLAAVLCTLCYLVGIWQHS--SGGAVITASVSSVASCPP------  59

Query  303  dttnltssssAVSLDFAAHH  362
                  + +  + LDF AHH
Sbjct  60   -----ITINKTIHLDFKAHH  74


 Score = 32.7 bits (73),  Expect(2) = 4e-09, Method: Composition-based stats.
 Identities = 14/23 (61%), Positives = 15/23 (65%), Gaps = 4/23 (17%)
 Frame = +1

Query  397  PPA----KEFPPCKAELSEYTPC  453
            PPA       PPC A+LSEYTPC
Sbjct  82   PPAAARVDHLPPCNAKLSEYTPC  104



>ref|XP_003580353.1| PREDICTED: probable methyltransferase PMT15 [Brachypodium distachyon]
Length=643

 Score = 55.8 bits (133),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 34/85 (40%), Positives = 41/85 (48%), Gaps = 8/85 (9%)
 Frame = +3

Query  129  LSARTKRTNLYYVAATTVLCSVFYLIGILQHGGFSG-------QQISTAALLPSVPCEPl  287
            LS+  +R  L+ +AA  VLCSV YLIG+  HGGFS          +S A   PSVPC   
Sbjct  12   LSSVARRPTLHQLAAVAVLCSVSYLIGVWHHGGFSASPPGGTTSPVSVAITTPSVPC-VS  70

Query  288  nkdstdttnltssssAVSLDFAAHH  362
               +           A  LDF AHH
Sbjct  71   PNVTVLGGGGGGGRLAPPLDFRAHH  95


 Score = 29.6 bits (65),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 11/23 (48%), Positives = 14/23 (61%), Gaps = 0/23 (0%)
 Frame = +1

Query  385  VAQAPPAKEFPPCKAELSEYTPC  453
            V  AP  + +  C A+ SEYTPC
Sbjct  102  VESAPAKRTYEACPAQYSEYTPC  124



>ref|XP_009400717.1| PREDICTED: probable methyltransferase PMT15 [Musa acuminata subsp. 
malaccensis]
Length=631

 Score = 45.8 bits (107),  Expect(2) = 2e-07, Method: Composition-based stats.
 Identities = 26/73 (36%), Positives = 37/73 (51%), Gaps = 8/73 (11%)
 Frame = +3

Query  144  KRTNLYYVAATTVLCSVFYLIGILQHGGFSGQQISTAALLPSVPCEPlnkdstdttnlts  323
            KRTNL  +    +LCS  Y +GI QHG  SG    T+ ++ +V C+       +      
Sbjct  20   KRTNLLRLGVVAILCSASYYLGIWQHG--SGATSVTSTVVTAVSCD------RNPAASPI  71

Query  324  sssAVSLDFAAHH  362
            +  A +LDFA HH
Sbjct  72   TGRAAALDFAVHH  84


 Score = 35.4 bits (80),  Expect(2) = 2e-07, Method: Composition-based stats.
 Identities = 14/24 (58%), Positives = 16/24 (67%), Gaps = 0/24 (0%)
 Frame = +1

Query  382  AVAQAPPAKEFPPCKAELSEYTPC  453
            A A AP  +EFP C  + SEYTPC
Sbjct  89   AAAGAPSVREFPACDIKYSEYTPC  112



>ref|XP_008795397.1| PREDICTED: probable methyltransferase PMT15 [Phoenix dactylifera]
Length=629

 Score = 47.0 bits (110),  Expect(2) = 3e-07, Method: Composition-based stats.
 Identities = 29/74 (39%), Positives = 41/74 (55%), Gaps = 8/74 (11%)
 Frame = +3

Query  144  KRTNLYYVAATTVLCSVFYLIGILQHGGFSG-QQISTAALLPSVPCEPlnkdstdttnlt  320
            KR N   +AA  VLCS  YL+GI QHGG     + +++ +L +V C+          N  
Sbjct  20   KRVNFLSIAAIVVLCSASYLLGIWQHGGGGATSRAASSTILATVSCDD-------NNNSP  72

Query  321  ssssAVSLDFAAHH  362
            SS++  +LDFA HH
Sbjct  73   SSTAVTALDFANHH  86


 Score = 33.9 bits (76),  Expect(2) = 3e-07, Method: Composition-based stats.
 Identities = 12/20 (60%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = +1

Query  394  APPAKEFPPCKAELSEYTPC  453
            AP  ++FP C+A+ SEYTPC
Sbjct  95   APARRDFPACEAKYSEYTPC  114



>ref|XP_007220534.1| hypothetical protein PRUPE_ppa002801mg [Prunus persica]
 gb|EMJ21733.1| hypothetical protein PRUPE_ppa002801mg [Prunus persica]
Length=632

 Score = 47.4 bits (111),  Expect(2) = 5e-07, Method: Composition-based stats.
 Identities = 29/81 (36%), Positives = 40/81 (49%), Gaps = 14/81 (17%)
 Frame = +3

Query  123  QFLSARTKRTNLYYVAATTVLCSVFYLIGILQHGGFSGQQISTAALLPS-VPCEPlnkds  299
            Q  S + KR NLYY+    VLC++ YL+GI QH   +G    TA++  S   C P     
Sbjct  8    QHFSLKPKRANLYYMTLVAVLCTLCYLVGIWQHS--TGTTAITASISTSDSSCPP-----  60

Query  300  tdttnltssssAVSLDFAAHH  362
                     ++ + LDF AHH
Sbjct  61   ------IPRNTTIHLDFEAHH  75


 Score = 32.7 bits (73),  Expect(2) = 5e-07, Method: Composition-based stats.
 Identities = 14/23 (61%), Positives = 15/23 (65%), Gaps = 4/23 (17%)
 Frame = +1

Query  397  PPAK----EFPPCKAELSEYTPC  453
            PPA       PPC A+LSEYTPC
Sbjct  83   PPAAARVAHLPPCDAKLSEYTPC  105



>ref|XP_010419631.1| PREDICTED: probable methyltransferase PMT15 [Camelina sativa]
Length=630

 Score = 52.8 bits (125),  Expect(2) = 6e-07, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 37/59 (63%), Gaps = 7/59 (12%)
 Frame = +3

Query  114  RLPQFLSARTKRTNLYYVAATTVLCSVFYLIGILQHGGFSGQQISTAAL----LPSVPC  278
            R P  LS R ++TNLY+V    +LC+ FY IG+ QH   SG+ +S ++L    L SVPC
Sbjct  5    RWPSKLSLRARQTNLYHVILIAILCAAFYYIGVWQH---SGRGLSRSSLSNHDLTSVPC  60


 Score = 26.6 bits (57),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 11/24 (46%), Positives = 13/24 (54%), Gaps = 0/24 (0%)
 Frame = +1

Query  382  AVAQAPPAKEFPPCKAELSEYTPC  453
            + A A    +  PC  E SEYTPC
Sbjct  83   STATAERVTQISPCGVEFSEYTPC  106



>ref|XP_008232735.1| PREDICTED: probable methyltransferase PMT15 [Prunus mume]
Length=632

 Score = 46.6 bits (109),  Expect(2) = 7e-07, Method: Composition-based stats.
 Identities = 29/81 (36%), Positives = 40/81 (49%), Gaps = 14/81 (17%)
 Frame = +3

Query  123  QFLSARTKRTNLYYVAATTVLCSVFYLIGILQHGGFSGQQISTAALLPS-VPCEPlnkds  299
            Q  S + KR NLYY+    VLC++ YL+GI QH   +G    TA +  S   C P     
Sbjct  8    QHFSLKPKRANLYYMTLVAVLCTLCYLVGIWQHS--TGTTAITADISTSDSSCPP-----  60

Query  300  tdttnltssssAVSLDFAAHH  362
                   + ++ + LDF AHH
Sbjct  61   ------ITRNTTIHLDFEAHH  75


 Score = 32.7 bits (73),  Expect(2) = 7e-07, Method: Composition-based stats.
 Identities = 14/23 (61%), Positives = 15/23 (65%), Gaps = 4/23 (17%)
 Frame = +1

Query  397  PPA----KEFPPCKAELSEYTPC  453
            PPA       PPC A+LSEYTPC
Sbjct  83   PPAAARVSHLPPCDAKLSEYTPC  105



>ref|XP_010053660.1| PREDICTED: probable methyltransferase PMT15 [Eucalyptus grandis]
 gb|KCW78011.1| hypothetical protein EUGRSUZ_D02245 [Eucalyptus grandis]
Length=650

 Score = 50.4 bits (119),  Expect(2) = 9e-07, Method: Composition-based stats.
 Identities = 32/86 (37%), Positives = 45/86 (52%), Gaps = 7/86 (8%)
 Frame = +3

Query  123  QFLSARTKRTNLYYVAATTVLCSVFYLIGILQH-GGFSGQQISTAALLPSVPCE-----P  284
            Q     TK+ NLYY+   +VLC++FYL+G  QH GG     IS++      PC      P
Sbjct  12   QIFPFMTKKANLYYITTASVLCAIFYLLGNWQHSGGGVASAISSSG-FSRFPCTIANAIP  70

Query  285  lnkdstdttnltssssAVSLDFAAHH  362
             +      ++  +SS+ V LDF AHH
Sbjct  71   SSSPRNAASSAFASSANVVLDFEAHH  96


 Score = 28.5 bits (62),  Expect(2) = 9e-07, Method: Compositional matrix adjust.
 Identities = 10/15 (67%), Positives = 11/15 (73%), Gaps = 0/15 (0%)
 Frame = +1

Query  409  EFPPCKAELSEYTPC  453
             FPPC  + SEYTPC
Sbjct  113  HFPPCDPKFSEYTPC  127



>ref|XP_006445150.1| hypothetical protein CICLE_v10019272mg [Citrus clementina]
 ref|XP_006491016.1| PREDICTED: probable methyltransferase PMT15-like [Citrus sinensis]
 gb|ESR58390.1| hypothetical protein CICLE_v10019272mg [Citrus clementina]
 gb|KDO86013.1| hypothetical protein CISIN_1g006633mg [Citrus sinensis]
Length=636

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 33/92 (36%), Positives = 52/92 (57%), Gaps = 11/92 (12%)
 Frame = +3

Query  90   LAAMAISARLPQFLSARTKRTNLYYVAATTVLCSVFYLIGILQHG-GFSGQQISTAALLP  266
            +A  A S RL  +++ +TK  NLY +   T+LC++FYL G+ QH  G      S +++L 
Sbjct  1    MANTAGSTRL-SYITFKTKHANLYSITLVTILCTIFYLAGMWQHSPGAIRAATSPSSILT  59

Query  267  SVPCEPlnkdstdttnltssssAVSLDFAAHH  362
            SVPC          +    +S+ ++LDF+AHH
Sbjct  60   SVPCS---------STSAKASTNLNLDFSAHH  82



>gb|KDO86012.1| hypothetical protein CISIN_1g006633mg [Citrus sinensis]
Length=637

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 33/92 (36%), Positives = 52/92 (57%), Gaps = 11/92 (12%)
 Frame = +3

Query  90   LAAMAISARLPQFLSARTKRTNLYYVAATTVLCSVFYLIGILQHG-GFSGQQISTAALLP  266
            +A  A S RL  +++ +TK  NLY +   T+LC++FYL G+ QH  G      S +++L 
Sbjct  1    MANTAGSTRL-SYITFKTKHANLYSITLVTILCTIFYLAGMWQHSPGAIRAATSPSSILT  59

Query  267  SVPCEPlnkdstdttnltssssAVSLDFAAHH  362
            SVPC          +    +S+ ++LDF+AHH
Sbjct  60   SVPCS---------STSAKASTNLNLDFSAHH  82



>ref|NP_001053603.1| Os04g0570800 [Oryza sativa Japonica Group]
 emb|CAD41579.3| OSJNBa0088I22.11 [Oryza sativa Japonica Group]
 dbj|BAF15517.1| Os04g0570800 [Oryza sativa Japonica Group]
 gb|EAY95218.1| hypothetical protein OsI_17036 [Oryza sativa Indica Group]
 dbj|BAG91550.1| unnamed protein product [Oryza sativa Japonica Group]
Length=646

 Score = 53.1 bits (126),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 38/99 (38%), Positives = 48/99 (48%), Gaps = 10/99 (10%)
 Frame = +3

Query  87   GLAAMAISARLPQFLSARTKRTNLYYVAATTVLCSVFYLIGILQHGGFSGQQIS------  248
             + A A    +P   SA  +R +L+++AA  VLC+V YLIGI  HGGFS           
Sbjct  2    AVGATATKLHMP---SAGGRRPSLFHLAAVAVLCTVSYLIGIWHHGGFSASPAGGVASSV  58

Query  249  TAALLPSVPC-EPlnkdstdttnltssssAVSLDFAAHH  362
            + A   SV C  P             SSS+  LDFAAHH
Sbjct  59   SIATTASVSCVSPTPTLLGGGGGGGDSSSSAPLDFAAHH  97


 Score = 25.4 bits (54),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 10/23 (43%), Positives = 13/23 (57%), Gaps = 0/23 (0%)
 Frame = +1

Query  385  VAQAPPAKEFPPCKAELSEYTPC  453
            VA     + +  C A+ SEYTPC
Sbjct  104  VASGQVHRTYEACPAKYSEYTPC  126



>gb|KDP28686.1| hypothetical protein JCGZ_14457 [Jatropha curcas]
Length=628

 Score = 52.4 bits (124),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 32/88 (36%), Positives = 46/88 (52%), Gaps = 15/88 (17%)
 Frame = +3

Query  99   MAISARLPQFLSARTKRTNLYYVAATTVLCSVFYLIGILQHGGFSGQQISTAALLPSVPC  278
            MAIS +    +S +TK+ NLY +   T+LC+VFY IG  Q+   S    S AA +  +PC
Sbjct  1    MAISIQTSVLMS-KTKKANLYKITVITILCTVFYFIGFYQNSRGS-IPTSPAATIAILPC  58

Query  279  EPlnkdstdttnltssssAVSLDFAAHH  362
             P  ++              +LDF+AHH
Sbjct  59   SPPIRN-------------TTLDFSAHH  73


 Score = 26.2 bits (56),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 9/15 (60%), Positives = 10/15 (67%), Gaps = 0/15 (0%)
 Frame = +1

Query  409  EFPPCKAELSEYTPC  453
              PPC  + SEYTPC
Sbjct  87   HLPPCDPKYSEYTPC  101



>emb|CDP05238.1| unnamed protein product [Coffea canephora]
Length=655

 Score = 47.0 bits (110),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 45/74 (61%), Gaps = 1/74 (1%)
 Frame = +3

Query  144  KRTNLYYVAATTVLCSVFYLIGILQHGGFSGQQISTAALLPSVPCE-Plnkdstdttnlt  320
            KR NLY +   T+LCS+ YL G+ QHGG +    + + +  + PC  P N  ++  T  +
Sbjct  26   KRNNLYSLVLITILCSLSYLFGVWQHGGATTSFTTPSNVGSTPPCVLPENTTTSIATTAS  85

Query  321  ssssAVSLDFAAHH  362
             +S++ +LDF++HH
Sbjct  86   KTSNSKALDFSSHH  99


 Score = 31.2 bits (69),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 11/17 (65%), Positives = 13/17 (76%), Gaps = 0/17 (0%)
 Frame = +1

Query  403  AKEFPPCKAELSEYTPC  453
            AK +PPC  + SEYTPC
Sbjct  114  AKVYPPCDVKYSEYTPC  130



>gb|KDO86014.1| hypothetical protein CISIN_1g006633mg [Citrus sinensis]
Length=544

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 33/92 (36%), Positives = 52/92 (57%), Gaps = 11/92 (12%)
 Frame = +3

Query  90   LAAMAISARLPQFLSARTKRTNLYYVAATTVLCSVFYLIGILQHG-GFSGQQISTAALLP  266
            +A  A S RL  +++ +TK  NLY +   T+LC++FYL G+ QH  G      S +++L 
Sbjct  1    MANTAGSTRL-SYITFKTKHANLYSITLVTILCTIFYLAGMWQHSPGAIRAATSPSSILT  59

Query  267  SVPCEPlnkdstdttnltssssAVSLDFAAHH  362
            SVPC          +    +S+ ++LDF+AHH
Sbjct  60   SVPCS---------STSAKASTNLNLDFSAHH  82



>gb|EYU19524.1| hypothetical protein MIMGU_mgv1a002864mg [Erythranthe guttata]
Length=629

 Score = 47.0 bits (110),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 27/73 (37%), Positives = 41/73 (56%), Gaps = 14/73 (19%)
 Frame = +3

Query  144  KRTNLYYVAATTVLCSVFYLIGILQHGGFSGQQISTAALLPSVPCEPlnkdstdttnlts  323
            +++ LY +A  TVLCS+FYLIG+  HGG +    +T  L  ++PC             T+
Sbjct  27   RKSKLYSLAIVTVLCSLFYLIGVWHHGGGAA---TTTNLGTTLPC-----------FTTT  72

Query  324  sssAVSLDFAAHH  362
            +++   LDFA HH
Sbjct  73   NNTTKKLDFATHH  85


 Score = 30.4 bits (67),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 10/16 (63%), Positives = 12/16 (75%), Gaps = 0/16 (0%)
 Frame = +1

Query  406  KEFPPCKAELSEYTPC  453
            K +PPC  + SEYTPC
Sbjct  95   KPYPPCSGKYSEYTPC  110



>ref|XP_011076214.1| PREDICTED: probable methyltransferase PMT15 [Sesamum indicum]
Length=658

 Score = 42.4 bits (98),  Expect(2) = 1e-05, Method: Composition-based stats.
 Identities = 31/86 (36%), Positives = 47/86 (55%), Gaps = 10/86 (12%)
 Frame = +3

Query  120  PQFLSARTKRTNLYYVAATTVLCSVFYLIGILQHGGFSGQQISTAALLPSVPC-----EP  284
            P +L    K+  LY +A  T+LCS+ YL G  QHGG +     T+ L  ++PC       
Sbjct  21   PSYL----KKPKLYSLAIITILCSLSYLFGAWQHGGATSSS-PTSNLGATIPCFSTSQNN  75

Query  285  lnkdstdttnltssssAVSLDFAAHH  362
               ++   ++ +SSS+A  LDFA+HH
Sbjct  76   TITNTNTQSHSSSSSNAPKLDFASHH  101


 Score = 32.3 bits (72),  Expect(2) = 1e-05, Method: Composition-based stats.
 Identities = 11/20 (55%), Positives = 14/20 (70%), Gaps = 0/20 (0%)
 Frame = +1

Query  394  APPAKEFPPCKAELSEYTPC  453
            +P  K +PPC  + SEYTPC
Sbjct  112  SPAIKSYPPCDIKYSEYTPC  131



>ref|XP_010456248.1| PREDICTED: probable methyltransferase PMT15 [Camelina sativa]
Length=644

 Score = 48.1 bits (113),  Expect(2) = 2e-05, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 34/54 (63%), Gaps = 7/54 (13%)
 Frame = +3

Query  129  LSARTKRTNLYYVAATTVLCSVFYLIGILQHGGFSGQQISTAAL----LPSVPC  278
            LS R ++TNLY V    +LC+ FY IG+ QH   SG+ +S ++L    L SVPC
Sbjct  24   LSLRARQTNLYRVILIAILCAAFYYIGVWQH---SGRGLSRSSLSNHDLTSVPC  74


 Score = 26.6 bits (57),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 11/24 (46%), Positives = 13/24 (54%), Gaps = 0/24 (0%)
 Frame = +1

Query  382  AVAQAPPAKEFPPCKAELSEYTPC  453
            + A A    +  PC  E SEYTPC
Sbjct  97   STATAERVTQISPCGVEFSEYTPC  120



>ref|XP_010427380.1| PREDICTED: probable methyltransferase PMT15 [Camelina sativa]
Length=633

 Score = 48.1 bits (113),  Expect(2) = 2e-05, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 34/54 (63%), Gaps = 7/54 (13%)
 Frame = +3

Query  129  LSARTKRTNLYYVAATTVLCSVFYLIGILQHGGFSGQQISTAAL----LPSVPC  278
            LS R ++TNLY V    +LC+ FY IG+ QH   SG+ +S ++L    L SVPC
Sbjct  13   LSLRARQTNLYRVILIAILCAAFYYIGVWQH---SGRGLSRSSLSNHDLTSVPC  63


 Score = 26.2 bits (56),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 11/23 (48%), Positives = 12/23 (52%), Gaps = 0/23 (0%)
 Frame = +1

Query  385  VAQAPPAKEFPPCKAELSEYTPC  453
             A A    +  PC  E SEYTPC
Sbjct  87   TATAERVTQISPCGVEFSEYTPC  109



>ref|XP_009801989.1| PREDICTED: probable methyltransferase PMT15 isoform X2 [Nicotiana 
sylvestris]
Length=647

 Score = 45.1 bits (105),  Expect(2) = 3e-05, Method: Composition-based stats.
 Identities = 29/74 (39%), Positives = 42/74 (57%), Gaps = 4/74 (5%)
 Frame = +3

Query  144  KRTNLYYVAATTVLCSVFYLIGILQHGGFSGQQISTAALL-PSVPCEPlnkdstdttnlt  320
            KR NLY + A T LCS FY  G+ Q+ G S   I+T+ ++  ++PC P    ST++   +
Sbjct  28   KRPNLYSLVAVTFLCSAFYFTGLWQNRG-SNSVITTSNIVHTTIPCFPSKNTSTNSPTSS  86

Query  321  ssssAVSLDFAAHH  362
             S+    LDF  HH
Sbjct  87   KSTQ--KLDFTTHH  98


 Score = 29.3 bits (64),  Expect(2) = 3e-05, Method: Composition-based stats.
 Identities = 12/24 (50%), Positives = 14/24 (58%), Gaps = 0/24 (0%)
 Frame = +1

Query  382  AVAQAPPAKEFPPCKAELSEYTPC  453
            AV      K +PPC  + SEYTPC
Sbjct  105  AVTPDDSIKIYPPCDIKYSEYTPC  128



>ref|XP_009801988.1| PREDICTED: probable methyltransferase PMT15 isoform X1 [Nicotiana 
sylvestris]
Length=648

 Score = 45.1 bits (105),  Expect(2) = 4e-05, Method: Composition-based stats.
 Identities = 29/74 (39%), Positives = 42/74 (57%), Gaps = 4/74 (5%)
 Frame = +3

Query  144  KRTNLYYVAATTVLCSVFYLIGILQHGGFSGQQISTAALL-PSVPCEPlnkdstdttnlt  320
            KR NLY + A T LCS FY  G+ Q+ G S   I+T+ ++  ++PC P    ST++   +
Sbjct  28   KRPNLYSLVAVTFLCSAFYFTGLWQNRG-SNSVITTSNIVHTTIPCFPSKNTSTNSPTSS  86

Query  321  ssssAVSLDFAAHH  362
             S+    LDF  HH
Sbjct  87   KSTQ--KLDFTTHH  98


 Score = 28.5 bits (62),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 14/24 (58%), Gaps = 0/24 (0%)
 Frame = +1

Query  382  AVAQAPPAKEFPPCKAELSEYTPC  453
            AV      K +PPC  + SEYTPC
Sbjct  105  AVTPDDSIKIYPPCDIKYSEYTPC  128



>ref|XP_008799521.1| PREDICTED: probable methyltransferase PMT15 [Phoenix dactylifera]
Length=639

 Score = 40.4 bits (93),  Expect(2) = 8e-05, Method: Composition-based stats.
 Identities = 25/74 (34%), Positives = 40/74 (54%), Gaps = 8/74 (11%)
 Frame = +3

Query  144  KRTNLYYVAATTVLCSVFYLIGILQHGGFSGQQI-STAALLPSVPCEPlnkdstdttnlt  320
            K+ NL  +A   +LCS  YL+G+ QHGG     + S++ ++ +V C         + N  
Sbjct  20   KQLNLISIAVIALLCSASYLLGMWQHGGGGATSLASSSTIVATVSCN-------HSNNSP  72

Query  321  ssssAVSLDFAAHH  362
            SS++  +LDF  HH
Sbjct  73   SSTAVTTLDFDTHH  86


 Score = 32.0 bits (71),  Expect(2) = 8e-05, Method: Composition-based stats.
 Identities = 13/24 (54%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = +1

Query  382  AVAQAPPAKEFPPCKAELSEYTPC  453
            AV   P  + FP C A+ SEYTPC
Sbjct  92   AVDALPARRGFPACDAKYSEYTPC  115



>ref|XP_004306838.1| PREDICTED: probable methyltransferase PMT15 [Fragaria vesca subsp. 
vesca]
Length=627

 Score = 42.4 bits (98),  Expect(2) = 9e-05, Method: Composition-based stats.
 Identities = 28/78 (36%), Positives = 41/78 (53%), Gaps = 11/78 (14%)
 Frame = +3

Query  129  LSARTKRTNLYYVAATTVLCSVFYLIGILQHGGFSGQQISTAALLPSVPCEPlnkdstdt  308
             S + KRTNLY++  TTVLC++FYLIG+ QH   +    +T ++  ++ C          
Sbjct  4    FSLKPKRTNLYFLTLTTVLCTLFYLIGVWQHSAGTTSSAATTSVTSAISCP---------  54

Query  309  tnltssssAVSLDFAAHH  362
                  +    LDFAAHH
Sbjct  55   --HLLPNITTHLDFAAHH  70


 Score = 29.6 bits (65),  Expect(2) = 9e-05, Method: Composition-based stats.
 Identities = 10/13 (77%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = +1

Query  415  PPCKAELSEYTPC  453
            PPC A L+EYTPC
Sbjct  88   PPCDARLAEYTPC  100



>ref|XP_009626220.1| PREDICTED: probable methyltransferase PMT15 [Nicotiana tomentosiformis]
Length=650

 Score = 43.1 bits (100),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 29/74 (39%), Positives = 41/74 (55%), Gaps = 1/74 (1%)
 Frame = +3

Query  144  KRTNLYYVAATTVLCSVFYLIGILQHGGFSGQQISTAALLPSVPCEPlnkdstdttnlts  323
            KR NLY + A T LCS FY  G+ Q+ G S    ++  +  ++PC P    ST++   +S
Sbjct  28   KRPNLYSLVAITFLCSAFYFTGLWQNRGSSSVITTSNIVHTTIPCFPSKNTSTNSPTSSS  87

Query  324  sssAVS-LDFAAHH  362
            SS +   LDF  HH
Sbjct  88   SSKSTQKLDFTTHH  101


 Score = 28.9 bits (63),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 10/16 (63%), Positives = 12/16 (75%), Gaps = 0/16 (0%)
 Frame = +1

Query  406  KEFPPCKAELSEYTPC  453
            K +PPC  + SEYTPC
Sbjct  116  KIYPPCDIKYSEYTPC  131



>emb|CDY18904.1| BnaC04g04460D [Brassica napus]
Length=633

 Score = 43.1 bits (100),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 31/89 (35%), Positives = 45/89 (51%), Gaps = 16/89 (18%)
 Frame = +3

Query  99   MAISARLPQFLSARTKRTNLYYVAATTVLCSVFYLIGILQHGGFSGQ-QISTAALLPSVP  275
            M +S R+    S+R K++NLYYV    VLC   YL+G+ Q+   + +    T+   P  P
Sbjct  1    MNLSTRIS---SSRDKKSNLYYVTLVAVLCVGSYLLGVWQNSTVNPRAAFDTSTDAP--P  55

Query  276  CEPlnkdstdttnltssssAVSLDFAAHH  362
            CE            + ++SA  LDF AHH
Sbjct  56   CEK----------FSKTTSATDLDFNAHH  74


 Score = 28.5 bits (62),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 13/23 (57%), Positives = 14/23 (61%), Gaps = 4/23 (17%)
 Frame = +1

Query  397  PP----AKEFPPCKAELSEYTPC  453
            PP    A  FP C A LSE+TPC
Sbjct  80   PPSTVTAVSFPSCDAALSEHTPC  102



>ref|XP_002880195.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56454.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=631

 Score = 40.0 bits (92),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 39/80 (49%), Gaps = 16/80 (20%)
 Frame = +3

Query  129  LSARTKRTNLYYVAATTVLCSVFYLIGILQHGGFSGQQISTAALLPS--VPCEPlnkdst  302
            +S+RTK++NLYYV    +LC   YL+GI Q+   + +    AA   S   PCE   +  +
Sbjct  7    ISSRTKKSNLYYVTLVALLCIGSYLLGIWQNTAVNPR----AAFDDSDGTPCEQFTRPDS  62

Query  303  dttnltssssAVSLDFAAHH  362
                         LDF AHH
Sbjct  63   TK----------DLDFDAHH  72


 Score = 31.6 bits (70),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 14/27 (52%), Positives = 16/27 (59%), Gaps = 4/27 (15%)
 Frame = +1

Query  385  VAQAPPAKE----FPPCKAELSEYTPC  453
            +   PP  E    FP C AELSE+TPC
Sbjct  74   IQDPPPVTETAVNFPSCGAELSEHTPC  100



>ref|XP_002301329.1| dehydration-responsive family protein [Populus trichocarpa]
 gb|EEE80602.1| dehydration-responsive family protein [Populus trichocarpa]
Length=622

 Score = 41.6 bits (96),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 46/89 (52%), Gaps = 15/89 (17%)
 Frame = +3

Query  99   MAISARLPQFLSARTKRTNLYYVAATTVLCSVFYLIGILQHG-GFSGQQISTAALLPSVP  275
            MAI +  P +L+ + K+ NLY +  T +LC+VFYL G  Q+  G      ++++ + +  
Sbjct  1    MAILS--PSYLTFKAKKLNLYKITITIILCTVFYLAGFYQNSRGTISINTTSSSSITAFR  58

Query  276  CEPlnkdstdttnltssssAVSLDFAAHH  362
            C P            ++ S  +LDFAA H
Sbjct  59   CAP------------TNHSTTTLDFAARH  75


 Score = 29.6 bits (65),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 17/28 (61%), Gaps = 2/28 (7%)
 Frame = +1

Query  376  FVAVAQAPPAKE--FPPCKAELSEYTPC  453
            F    + P A+E  FPPC  + SEYTPC
Sbjct  76   FAQDPKPPVAREHHFPPCDPKYSEYTPC  103



>ref|XP_009349944.1| PREDICTED: probable methyltransferase PMT15 [Pyrus x bretschneideri]
Length=632

 Score = 45.8 bits (107),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 29/88 (33%), Positives = 47/88 (53%), Gaps = 14/88 (16%)
 Frame = +3

Query  99   MAISARLPQFLSARTKRTNLYYVAATTVLCSVFYLIGILQHGGFSGQQISTAALLPSVPC  278
            MAI   L Q+ S + KR NLY++    VLC++ YL+GI QH        ST+  + + P 
Sbjct  1    MAIQTPL-QYFSLKPKRANLYFMTVAAVLCTICYLVGIWQH--------STSRAVINTP-  50

Query  279  EPlnkdstdttnltssssAVSLDFAAHH  362
                  +  +    ++++ ++LDF AHH
Sbjct  51   ----VSAVASCPPITTNTTITLDFNAHH  74


 Score = 25.4 bits (54),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 9/14 (64%), Positives = 10/14 (71%), Gaps = 0/14 (0%)
 Frame = +1

Query  412  FPPCKAELSEYTPC  453
             P C A+ SEYTPC
Sbjct  91   LPACDAKHSEYTPC  104



>ref|XP_002875017.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51276.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=633

 Score = 45.1 bits (105),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 24/52 (46%), Positives = 29/52 (56%), Gaps = 3/52 (6%)
 Frame = +3

Query  129  LSARTKRTNLYYVAATTVLCSVFYLIGILQH--GGFSGQQISTAALLPSVPC  278
            LS R K TNLY V    +LC+  Y +G+ QH  GG S   +S    L SVPC
Sbjct  13   LSLRAKHTNLYRVILIAILCAASYFVGVWQHSGGGISRSSLSNHE-LTSVPC  63


 Score = 26.2 bits (56),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 11/23 (48%), Positives = 12/23 (52%), Gaps = 0/23 (0%)
 Frame = +1

Query  385  VAQAPPAKEFPPCKAELSEYTPC  453
             A A    + P C  E SEYTPC
Sbjct  87   TATAARVAQIPSCGVEFSEYTPC  109



>tpg|DAA36414.1| TPA: hypothetical protein ZEAMMB73_585119 [Zea mays]
Length=651

 Score = 46.2 bits (108),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 30/74 (41%), Positives = 41/74 (55%), Gaps = 10/74 (14%)
 Frame = +3

Query  156  LYYVAATTVLCSVFYLIGILQHGGFS-----GQQISTAALLPSVPCEPlnkdstdttnlt  320
            + ++AA  VLCS+ YL+GI  HGGFS     G   S+ ++  +V C      +   T  +
Sbjct  23   MLHLAAVAVLCSLSYLLGIWHHGGFSAGPAAGDSSSSVSIATAVSC-----ATPAPTTAS  77

Query  321  ssssAVSLDFAAHH  362
            SS  A  LDFAAHH
Sbjct  78   SSPPAGPLDFAAHH  91


 Score = 24.6 bits (52),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 8/16 (50%), Positives = 11/16 (69%), Gaps = 0/16 (0%)
 Frame = +1

Query  406  KEFPPCKAELSEYTPC  453
            + +  C A+ SEYTPC
Sbjct  105  RNYEACPAKYSEYTPC  120



>ref|XP_008354467.1| PREDICTED: probable methyltransferase PMT15, partial [Malus domestica]
Length=628

 Score = 45.4 bits (106),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 27/80 (34%), Positives = 42/80 (53%), Gaps = 13/80 (16%)
 Frame = +3

Query  123  QFLSARTKRTNLYYVAATTVLCSVFYLIGILQHGGFSGQQISTAALLPSVPCEPlnkdst  302
            Q+ S + KR NLYY+    VLC++ YL+GI QH        S AA+   V        + 
Sbjct  4    QYFSLKPKRANLYYMTVAAVLCTICYLVGIWQH------STSRAAIYTPV-------SAV  50

Query  303  dttnltssssAVSLDFAAHH  362
             +    ++++ ++LDF AHH
Sbjct  51   TSCPPITTNTTITLDFNAHH  70


 Score = 25.4 bits (54),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 9/14 (64%), Positives = 10/14 (71%), Gaps = 0/14 (0%)
 Frame = +1

Query  412  FPPCKAELSEYTPC  453
             P C A+ SEYTPC
Sbjct  87   LPACDAKHSEYTPC  100



>ref|XP_008668482.1| PREDICTED: uncharacterized protein LOC100384329 isoform X1 [Zea 
mays]
Length=638

 Score = 46.2 bits (108),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 30/74 (41%), Positives = 41/74 (55%), Gaps = 10/74 (14%)
 Frame = +3

Query  156  LYYVAATTVLCSVFYLIGILQHGGFS-----GQQISTAALLPSVPCEPlnkdstdttnlt  320
            + ++AA  VLCS+ YL+GI  HGGFS     G   S+ ++  +V C      +   T  +
Sbjct  23   MLHLAAVAVLCSLSYLLGIWHHGGFSAGPAAGDSSSSVSIATAVSC-----ATPAPTTAS  77

Query  321  ssssAVSLDFAAHH  362
            SS  A  LDFAAHH
Sbjct  78   SSPPAGPLDFAAHH  91


 Score = 24.6 bits (52),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 8/16 (50%), Positives = 11/16 (69%), Gaps = 0/16 (0%)
 Frame = +1

Query  406  KEFPPCKAELSEYTPC  453
            + +  C A+ SEYTPC
Sbjct  105  RNYEACPAKYSEYTPC  120



>ref|XP_008438092.1| PREDICTED: probable methyltransferase PMT15 [Cucumis melo]
Length=635

 Score = 41.6 bits (96),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 24/78 (31%), Positives = 40/78 (51%), Gaps = 6/78 (8%)
 Frame = +3

Query  129  LSARTKRTNLYYVAATTVLCSVFYLIGILQHGGFSGQQISTAALLPSVPCEPlnkdstdt  308
             S ++ R NLY +   T+LC+VFYL+G+ Q      Q +  + +            +  T
Sbjct  6    FSFKSGRLNLYKITLVTILCAVFYLVGVWQ------QSVGKSLIFAGGNYACTTSTAAAT  59

Query  309  tnltssssAVSLDFAAHH  362
               ++++S + LDFAAHH
Sbjct  60   FENSTATSVIDLDFAAHH  77


 Score = 29.3 bits (64),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 14/23 (61%), Gaps = 0/23 (0%)
 Frame = +1

Query  385  VAQAPPAKEFPPCKAELSEYTPC  453
            V Q      FPPC ++L EYTPC
Sbjct  84   VVQKARRPNFPPCDSKLYEYTPC  106



>ref|XP_010933874.1| PREDICTED: probable methyltransferase PMT15 [Elaeis guineensis]
Length=640

 Score = 38.5 bits (88),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 31/76 (41%), Positives = 43/76 (57%), Gaps = 10/76 (13%)
 Frame = +3

Query  144  KRTNLYYVAATTVLCSVFYLIGILQH---GGFSGQQISTAALLPSVPCEPlnkdstdttn  314
            KR N   +AA  VLCS  YL+GI QH   GG S  + +++ +L +V C          +N
Sbjct  20   KRINFLSIAAIAVLCSASYLLGIWQHGGGGGSSTSRAASSTILATVSCND-------NSN  72

Query  315  ltssssAVSLDFAAHH  362
              SS++  +LDFAAHH
Sbjct  73   SPSSTTVTTLDFAAHH  88


 Score = 32.0 bits (71),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 11/20 (55%), Positives = 14/20 (70%), Gaps = 0/20 (0%)
 Frame = +1

Query  394  APPAKEFPPCKAELSEYTPC  453
             P  ++FP C A+ SEYTPC
Sbjct  97   GPARRDFPACDAKYSEYTPC  116



>ref|XP_004133882.1| PREDICTED: probable methyltransferase PMT15-like [Cucumis sativus]
Length=640

 Score = 41.2 bits (95),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 6/78 (8%)
 Frame = +3

Query  129  LSARTKRTNLYYVAATTVLCSVFYLIGILQHGGFSGQQISTAALLPSVPCEPlnkdstdt  308
             S +  R NLY +    +LC+VFYL+G+ Q      Q I  + +               T
Sbjct  6    FSFKPGRLNLYTITLVAILCAVFYLVGVWQ------QSIGKSLIFAGGNYACTASTVAAT  59

Query  309  tnltssssAVSLDFAAHH  362
               +++++ + LDFAAHH
Sbjct  60   IENSTATTVIDLDFAAHH  77


 Score = 29.3 bits (64),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 14/23 (61%), Gaps = 0/23 (0%)
 Frame = +1

Query  385  VAQAPPAKEFPPCKAELSEYTPC  453
            V Q      FPPC ++L EYTPC
Sbjct  84   VVQKARRPNFPPCDSKLYEYTPC  106



>ref|XP_004155808.1| PREDICTED: probable methyltransferase PMT15-like [Cucumis sativus]
Length=635

 Score = 41.2 bits (95),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 6/78 (8%)
 Frame = +3

Query  129  LSARTKRTNLYYVAATTVLCSVFYLIGILQHGGFSGQQISTAALLPSVPCEPlnkdstdt  308
             S +  R NLY +    +LC+VFYL+G+ Q      Q I  + +               T
Sbjct  6    FSFKPGRLNLYTITLVAILCAVFYLVGVWQ------QSIGKSLIFAGGNYACTASTVAAT  59

Query  309  tnltssssAVSLDFAAHH  362
               +++++ + LDFAAHH
Sbjct  60   IENSTATTVIDLDFAAHH  77


 Score = 29.3 bits (64),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 14/23 (61%), Gaps = 0/23 (0%)
 Frame = +1

Query  385  VAQAPPAKEFPPCKAELSEYTPC  453
            V Q      FPPC ++L EYTPC
Sbjct  84   VVQKARRPNFPPCDSKLYEYTPC  106



>ref|NP_182099.1| putative methyltransferase PMT16 [Arabidopsis thaliana]
 sp|O80844.1|PMTG_ARATH RecName: Full=Probable methyltransferase PMT16 [Arabidopsis thaliana]
 gb|AAC28550.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC10597.1| putative methyltransferase PMT16 [Arabidopsis thaliana]
Length=631

 Score = 40.4 bits (93),  Expect(2) = 4e-04, Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 39/80 (49%), Gaps = 16/80 (20%)
 Frame = +3

Query  129  LSARTKRTNLYYVAATTVLCSVFYLIGILQHGGFSGQQISTAALLPS--VPCEPlnkdst  302
            +S+RTK+ NLYYV    +LC   YL+GI Q+   + +    AA   S   PCE   + ++
Sbjct  7    ISSRTKKANLYYVTLVALLCIASYLLGIWQNTAVNPR----AAFDDSDGTPCEGFTRPNS  62

Query  303  dttnltssssAVSLDFAAHH  362
                         LDF AHH
Sbjct  63   TK----------DLDFDAHH  72


 Score = 29.6 bits (65),  Expect(2) = 4e-04, Method: Composition-based stats.
 Identities = 13/27 (48%), Positives = 15/27 (56%), Gaps = 4/27 (15%)
 Frame = +1

Query  385  VAQAPPAKE----FPPCKAELSEYTPC  453
            +   PP  E    FP C A LSE+TPC
Sbjct  74   IQDPPPVTETAVSFPSCAAALSEHTPC  100



>ref|XP_009399379.1| PREDICTED: probable methyltransferase PMT15 [Musa acuminata subsp. 
malaccensis]
Length=644

 Score = 40.4 bits (93),  Expect(2) = 4e-04, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 38/73 (52%), Gaps = 8/73 (11%)
 Frame = +3

Query  144  KRTNLYYVAATTVLCSVFYLIGILQHGGFSGQQISTAALLPSVPCEPlnkdstdttnlts  323
            KRTNL  +    +LCS  Y +GI  HGG S    ST  +L +V C+       +    T+
Sbjct  20   KRTNLLQLGVVALLCSASYFLGICHHGGDSASFNST--VLSAVSCD------RNPPATTT  71

Query  324  sssAVSLDFAAHH  362
            +  A +LDFA HH
Sbjct  72   TVGAGTLDFAVHH  84


 Score = 29.6 bits (65),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 11/19 (58%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = +1

Query  397  PPAKEFPPCKAELSEYTPC  453
            P  +EFP C  + SEYTPC
Sbjct  94   PVVREFPACDVKYSEYTPC  112



>ref|XP_009384529.1| PREDICTED: probable methyltransferase PMT15 [Musa acuminata subsp. 
malaccensis]
Length=635

 Score = 37.4 bits (85),  Expect(2) = 5e-04, Method: Composition-based stats.
 Identities = 24/73 (33%), Positives = 32/73 (44%), Gaps = 12/73 (16%)
 Frame = +3

Query  144  KRTNLYYVAATTVLCSVFYLIGILQHGGFSGQQISTAALLPSVPCEPlnkdstdttnlts  323
            KR N   +    + CS  YL+GI QH       I  A +L ++ C+        T     
Sbjct  22   KRINFVPLVVVAMFCSASYLLGIWQH-------IGGATVLTAISCD-----RKATDASFV  69

Query  324  sssAVSLDFAAHH  362
               A +LDFAAHH
Sbjct  70   VGGAPTLDFAAHH  82


 Score = 32.3 bits (72),  Expect(2) = 5e-04, Method: Composition-based stats.
 Identities = 13/22 (59%), Positives = 15/22 (68%), Gaps = 0/22 (0%)
 Frame = +1

Query  388  AQAPPAKEFPPCKAELSEYTPC  453
            A  P A+EF  C A+ SEYTPC
Sbjct  89   AAIPAAREFTACDAKYSEYTPC  110



>ref|XP_002320758.2| hypothetical protein POPTR_0014s07180g [Populus trichocarpa]
 gb|EEE99073.2| hypothetical protein POPTR_0014s07180g [Populus trichocarpa]
Length=629

 Score = 42.7 bits (99),  Expect(2) = 6e-04, Method: Composition-based stats.
 Identities = 27/89 (30%), Positives = 43/89 (48%), Gaps = 15/89 (17%)
 Frame = +3

Query  99   MAISARLPQFLSARTKRTNLYYVAATTVLCSVFYLIGILQHGGFSGQQISTAALLPSV-P  275
            MAI +  P +L  + K+ NLY +  T + C++FYL+G  Q    +    +T++ +  V P
Sbjct  1    MAILS--PSYLPLKAKKLNLYKIILTIIPCTIFYLVGFYQSSRGNVPVSNTSSSINEVFP  58

Query  276  CEPlnkdstdttnltssssAVSLDFAAHH  362
            C P               +  +LDF AHH
Sbjct  59   CAP------------PDHNTTTLDFEAHH  75


 Score = 26.9 bits (58),  Expect(2) = 6e-04, Method: Composition-based stats.
 Identities = 12/27 (44%), Positives = 14/27 (52%), Gaps = 5/27 (19%)
 Frame = +1

Query  388  AQAPP-----AKEFPPCKAELSEYTPC  453
            A  PP     A   PPC  + SE+TPC
Sbjct  77   APDPPLRVARAHHLPPCDPKYSEHTPC  103



>gb|EPS57356.1| hypothetical protein M569_17462, partial [Genlisea aurea]
Length=222

 Score = 44.7 bits (104),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 35/70 (50%), Gaps = 12/70 (17%)
 Frame = +3

Query  153  NLYYVAATTVLCSVFYLIGILQHGGFSGQQISTAALLPSVPCEPlnkdstdttnltssss  332
            NLY+ A   VLC+VFYLIG  +     G  I++A + P++PC            L  S  
Sbjct  13   NLYFTAIAAVLCTVFYLIGNFR----GGATITSAGIRPTLPC--------SEDPLAESDQ  60

Query  333  AVSLDFAAHH  362
              S DF AHH
Sbjct  61   RSSFDFTAHH  70


 Score = 24.6 bits (52),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 9/15 (60%), Positives = 10/15 (67%), Gaps = 0/15 (0%)
 Frame = +1

Query  409  EFPPCKAELSEYTPC  453
            +FP C    SEYTPC
Sbjct  88   DFPRCDLRFSEYTPC  102



>gb|KJB09867.1| hypothetical protein B456_001G171500 [Gossypium raimondii]
Length=628

 Score = 39.3 bits (90),  Expect(2) = 7e-04, Method: Composition-based stats.
 Identities = 29/93 (31%), Positives = 36/93 (39%), Gaps = 21/93 (23%)
 Frame = +3

Query  99   MAISARLPQFLSARTKRTNLYYVAATTVLCSVFYLIGILQHG-----GFSGQQISTAALL  263
            MA +  L       +K +NLY +    +LC+ FYLIGI QH        S   +S    L
Sbjct  1    MAATRFLSHITIFNSKNSNLYSITILAILCTSFYLIGIWQHSLDPIPNSSSSPVS--GFL  58

Query  264  PSVPCEPlnkdstdttnltssssAVSLDFAAHH  362
             S PC               S     LDF  HH
Sbjct  59   SSSPC--------------YSLHTAQLDFMPHH  77


 Score = 30.0 bits (66),  Expect(2) = 7e-04, Method: Composition-based stats.
 Identities = 10/14 (71%), Positives = 10/14 (71%), Gaps = 0/14 (0%)
 Frame = +1

Query  412  FPPCKAELSEYTPC  453
            FPPC    SEYTPC
Sbjct  92   FPPCNISFSEYTPC  105



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 550993649940