BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001D12

Length=576
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP07249.1|  unnamed protein product                                223   2e-70   Coffea canephora [robusta coffee]
ref|XP_007046429.1|  Auxin:hydrogen symporter, putative isoform 1       230   4e-70   Theobroma cacao [chocolate]
gb|KJB17438.1|  hypothetical protein B456_003G000900                    228   3e-69   Gossypium raimondii
ref|XP_006435462.1|  hypothetical protein CICLE_v10001325mg             224   4e-69   
gb|KJB17441.1|  hypothetical protein B456_003G000900                    228   5e-69   Gossypium raimondii
ref|XP_006435465.1|  hypothetical protein CICLE_v10001325mg             224   5e-69   
emb|CDP01745.1|  unnamed protein product                                226   1e-68   Coffea canephora [robusta coffee]
gb|KDO85260.1|  hypothetical protein CISIN_1g015164mg                   221   7e-68   Citrus sinensis [apfelsine]
ref|XP_006435464.1|  hypothetical protein CICLE_v10001325mg             224   9e-68   Citrus clementina [clementine]
emb|CBI37491.3|  unnamed protein product                                222   2e-67   Vitis vinifera
ref|XP_002263531.1|  PREDICTED: uncharacterized transporter YBR28...    222   3e-67   Vitis vinifera
gb|ACU18030.1|  unknown                                                 218   4e-67   Glycine max [soybeans]
gb|KDO85259.1|  hypothetical protein CISIN_1g015164mg                   221   6e-67   Citrus sinensis [apfelsine]
ref|XP_010033614.1|  PREDICTED: uncharacterized transporter C5D6....    222   8e-67   Eucalyptus grandis [rose gum]
gb|EYU41206.1|  hypothetical protein MIMGU_mgv1a018588mg                219   8e-67   Erythranthe guttata [common monkey flower]
ref|XP_007156270.1|  hypothetical protein PHAVU_003G272300g             221   8e-67   Phaseolus vulgaris [French bean]
ref|XP_004509473.1|  PREDICTED: uncharacterized transporter YBR28...    221   1e-66   Cicer arietinum [garbanzo]
ref|XP_006473865.1|  PREDICTED: uncharacterized transporter YBR28...    221   1e-66   Citrus sinensis [apfelsine]
gb|KDO85258.1|  hypothetical protein CISIN_1g015164mg                   221   1e-66   Citrus sinensis [apfelsine]
gb|KHN41796.1|  Putative transporter                                    221   2e-66   Glycine soja [wild soybean]
ref|NP_001242102.1|  uncharacterized protein LOC100791609               221   2e-66   Glycine max [soybeans]
gb|KDP24916.1|  hypothetical protein JCGZ_24294                         221   2e-66   Jatropha curcas
ref|XP_006590301.1|  PREDICTED: uncharacterized protein LOC100791...    220   2e-66   
gb|KHN28298.1|  Putative transporter C5D6.04                            220   4e-66   Glycine soja [wild soybean]
ref|XP_003517114.1|  PREDICTED: uncharacterized protein LOC100785...    220   4e-66   Glycine max [soybeans]
ref|XP_008787017.1|  PREDICTED: uncharacterized transporter YBR28...    220   5e-66   Phoenix dactylifera
ref|XP_008373348.1|  PREDICTED: uncharacterized protein LOC103436679    211   1e-65   
ref|XP_003629048.1|  Transporter, putative                              218   2e-65   
gb|AET03524.2|  auxin efflux carrier family protein                     218   2e-65   Medicago truncatula
ref|XP_010266292.1|  PREDICTED: uncharacterized transporter YBR28...    216   1e-64   Nelumbo nucifera [Indian lotus]
ref|XP_008237902.1|  PREDICTED: uncharacterized transporter YBR28...    216   2e-64   Prunus mume [ume]
ref|XP_006342188.1|  PREDICTED: uncharacterized transporter YBR28...    215   2e-64   Solanum tuberosum [potatoes]
ref|XP_007018644.1|  Auxin efflux carrier family protein, putative      216   2e-64   
ref|XP_009592191.1|  PREDICTED: uncharacterized transporter YBR28...    216   2e-64   Nicotiana tomentosiformis
ref|XP_004238466.1|  PREDICTED: uncharacterized transporter YBR28...    215   2e-64   Solanum lycopersicum
gb|KDP24915.1|  hypothetical protein JCGZ_24293                         213   3e-64   Jatropha curcas
ref|XP_010270583.1|  PREDICTED: uncharacterized transporter YBR28...    214   3e-64   
ref|XP_007209188.1|  hypothetical protein PRUPE_ppa006413mg             215   3e-64   Prunus persica
ref|XP_008373350.1|  PREDICTED: uncharacterized transporter YBR28...    215   4e-64   
ref|XP_009798616.1|  PREDICTED: uncharacterized transporter YBR28...    215   4e-64   Nicotiana sylvestris
ref|XP_010270584.1|  PREDICTED: uncharacterized protein LOC104606...    213   6e-64   
ref|XP_010932122.1|  PREDICTED: uncharacterized transporter YBR28...    214   6e-64   Elaeis guineensis
ref|XP_003612433.1|  Auxin efflux carrier protein                       209   6e-64   
ref|XP_010270585.1|  PREDICTED: uncharacterized protein LOC104606...    213   7e-64   
ref|XP_009372647.1|  PREDICTED: uncharacterized transporter YBR28...    214   7e-64   Pyrus x bretschneideri [bai li]
ref|XP_003612432.1|  Auxin efflux carrier protein                       209   9e-64   
ref|XP_010270580.1|  PREDICTED: uncharacterized transporter C5D6....    214   1e-63   Nelumbo nucifera [Indian lotus]
ref|XP_008373331.1|  PREDICTED: uncharacterized transporter YBR28...    214   1e-63   
emb|CDP01744.1|  unnamed protein product                                213   1e-63   Coffea canephora [robusta coffee]
ref|XP_006599266.1|  PREDICTED: uncharacterized protein LOC100817...    213   1e-63   
ref|XP_008364468.1|  PREDICTED: uncharacterized transporter YBR28...    213   1e-63   
ref|XP_009390658.1|  PREDICTED: uncharacterized transporter YBR28...    213   2e-63   
gb|KEH27638.1|  auxin efflux carrier family protein                     209   3e-63   Medicago truncatula
ref|XP_007211270.1|  hypothetical protein PRUPE_ppa017924mg             212   4e-63   
ref|XP_011100009.1|  PREDICTED: uncharacterized protein LOC105178...    210   5e-63   
ref|XP_011465005.1|  PREDICTED: uncharacterized transporter YBR28...    211   5e-63   Fragaria vesca subsp. vesca
ref|XP_010033618.1|  PREDICTED: uncharacterized transporter C5D6....    212   5e-63   Eucalyptus grandis [rose gum]
ref|XP_009372645.1|  PREDICTED: uncharacterized transporter YBR28...    211   7e-63   Pyrus x bretschneideri [bai li]
gb|EPS71464.1|  hypothetical protein M569_03295                         206   7e-63   Genlisea aurea
gb|AES95391.2|  auxin efflux carrier family protein                     209   8e-63   Medicago truncatula
ref|XP_006465068.1|  PREDICTED: uncharacterized protein LOC102630978    204   2e-62   
gb|AES95390.2|  auxin efflux carrier family protein                     209   2e-62   Medicago truncatula
ref|XP_004300092.1|  PREDICTED: uncharacterized transporter YBR28...    210   2e-62   Fragaria vesca subsp. vesca
ref|XP_003534224.1|  PREDICTED: uncharacterized protein LOC100810...    209   3e-62   
ref|XP_011100000.1|  PREDICTED: uncharacterized transporter YBR28...    210   3e-62   Sesamum indicum [beniseed]
ref|XP_011099988.1|  PREDICTED: uncharacterized transporter YBR28...    209   4e-62   Sesamum indicum [beniseed]
ref|XP_002301894.1|  auxin efflux carrier family protein                209   5e-62   
ref|XP_003612431.1|  Auxin efflux carrier protein                       209   5e-62   
ref|XP_004253114.1|  PREDICTED: uncharacterized transporter C5D6....    209   5e-62   Solanum lycopersicum
gb|KCW56460.1|  hypothetical protein EUGRSUZ_I02196                     207   6e-62   Eucalyptus grandis [rose gum]
ref|XP_010029546.1|  PREDICTED: uncharacterized protein LOC104419...    208   8e-62   Eucalyptus grandis [rose gum]
ref|XP_011034783.1|  PREDICTED: uncharacterized transporter YBR28...    208   1e-61   Populus euphratica
ref|XP_010029545.1|  PREDICTED: uncharacterized transporter C5D6....    208   2e-61   Eucalyptus grandis [rose gum]
ref|XP_007158042.1|  hypothetical protein PHAVU_002G119300g             207   2e-61   Phaseolus vulgaris [French bean]
ref|XP_010094502.1|  Uncharacterized transporter                        207   3e-61   Morus notabilis
ref|XP_010029544.1|  PREDICTED: uncharacterized transporter C5D6....    208   3e-61   Eucalyptus grandis [rose gum]
ref|XP_008453020.1|  PREDICTED: uncharacterized transporter YBR28...    206   1e-60   Cucumis melo [Oriental melon]
emb|CBI37490.3|  unnamed protein product                                206   2e-60   Vitis vinifera
gb|ACJ85428.1|  unknown                                                 205   3e-60   Medicago truncatula
ref|XP_010649334.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    204   3e-60   
ref|XP_002528529.1|  auxin:hydrogen symporter, putative                 205   3e-60   Ricinus communis
ref|XP_006432166.1|  hypothetical protein CICLE_v10001450mg             203   5e-60   
ref|XP_010103231.1|  Uncharacterized transporter                        204   5e-60   Morus notabilis
ref|XP_002317634.2|  hypothetical protein POPTR_0011s14870g             203   5e-60   
gb|KDP36734.1|  hypothetical protein JCGZ_08025                         202   1e-59   Jatropha curcas
gb|KGN55542.1|  hypothetical protein Csa_4G664490                       202   2e-59   Cucumis sativus [cucumbers]
ref|XP_006370746.1|  hypothetical protein POPTR_0001s46050g             202   3e-59   
ref|XP_008237904.1|  PREDICTED: uncharacterized transporter YBR28...    201   1e-58   Prunus mume [ume]
ref|XP_002528528.1|  auxin:hydrogen symporter, putative                 201   1e-58   
ref|XP_011038092.1|  PREDICTED: uncharacterized transporter YBR28...    201   1e-58   Populus euphratica
ref|XP_010094503.1|  Uncharacterized transporter                        200   2e-58   
gb|KHN38844.1|  hypothetical protein glysoja_014836                     195   2e-58   Glycine soja [wild soybean]
gb|ABR18184.1|  unknown                                                 201   2e-58   Picea sitchensis
emb|CDP01746.1|  unnamed protein product                                199   3e-58   Coffea canephora [robusta coffee]
ref|XP_007209181.1|  hypothetical protein PRUPE_ppa006339mg             198   7e-58   Prunus persica
ref|XP_008805481.1|  PREDICTED: uncharacterized transporter YBR28...    197   9e-58   Phoenix dactylifera
ref|XP_010913879.1|  PREDICTED: uncharacterized transporter YBR28...    197   1e-57   
gb|KEH17833.1|  auxin efflux carrier family protein                     195   2e-57   Medicago truncatula
ref|XP_004515365.1|  PREDICTED: uncharacterized protein LOC101492...    195   2e-57   
ref|XP_010681118.1|  PREDICTED: uncharacterized protein LOC104896...    196   3e-57   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO70039.1|  hypothetical protein CISIN_1g014841mg                   192   3e-57   Citrus sinensis [apfelsine]
ref|XP_010681116.1|  PREDICTED: uncharacterized transporter C5D6....    197   3e-57   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006437711.1|  hypothetical protein CICLE_v10031658mg             191   4e-57   
gb|KHN30729.1|  hypothetical protein glysoja_034072                     189   4e-57   Glycine soja [wild soybean]
ref|XP_010649328.1|  PREDICTED: uncharacterized protein LOC100249...    196   4e-57   Vitis vinifera
ref|XP_008358580.1|  PREDICTED: uncharacterized protein LOC103422308    190   4e-57   
ref|XP_006370751.1|  hypothetical protein POPTR_0001s46060g             195   6e-57   
ref|XP_007134484.1|  hypothetical protein PHAVU_010G051100g             196   7e-57   Phaseolus vulgaris [French bean]
gb|KDO70038.1|  hypothetical protein CISIN_1g014841mg                   192   8e-57   Citrus sinensis [apfelsine]
ref|XP_007134485.1|  hypothetical protein PHAVU_010G051100g             195   8e-57   Phaseolus vulgaris [French bean]
ref|XP_011004410.1|  PREDICTED: uncharacterized transporter YBR28...    195   9e-57   Populus euphratica
gb|KEH17832.1|  auxin efflux carrier family protein                     195   9e-57   Medicago truncatula
ref|XP_006370750.1|  hypothetical protein POPTR_0001s46060g             195   1e-56   Populus trichocarpa [western balsam poplar]
ref|XP_011038091.1|  PREDICTED: uncharacterized transporter YBR28...    195   1e-56   Populus euphratica
ref|XP_011038089.1|  PREDICTED: uncharacterized transporter YBR28...    195   1e-56   Populus euphratica
ref|XP_006370747.1|  hypothetical protein POPTR_0001s46060g             195   1e-56   
ref|XP_004515364.1|  PREDICTED: uncharacterized protein LOC101492...    195   1e-56   Cicer arietinum [garbanzo]
gb|KDO70035.1|  hypothetical protein CISIN_1g014841mg                   192   1e-56   Citrus sinensis [apfelsine]
ref|XP_006437713.1|  hypothetical protein CICLE_v10031658mg             192   2e-56   
ref|XP_011030710.1|  PREDICTED: uncharacterized transporter YBR28...    194   2e-56   Populus euphratica
ref|XP_003520432.1|  PREDICTED: uncharacterized transporter YBR28...    195   2e-56   Glycine max [soybeans]
dbj|BAK04863.1|  predicted protein                                      194   3e-56   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHN44555.1|  Putative transporter C5D6.04                            194   3e-56   Glycine soja [wild soybean]
ref|XP_006849937.1|  hypothetical protein AMTR_s00022p00124760          191   3e-56   
gb|KEH27639.1|  auxin efflux carrier family protein                     194   4e-56   Medicago truncatula
ref|XP_011099968.1|  PREDICTED: uncharacterized transporter C5D6....    193   4e-56   Sesamum indicum [beniseed]
ref|XP_006416347.1|  hypothetical protein EUTSA_v10009415mg             193   6e-56   
gb|EMS57690.1|  hypothetical protein TRIUR3_00891                       192   1e-55   Triticum urartu
gb|KDO70033.1|  hypothetical protein CISIN_1g014841mg                   192   2e-55   Citrus sinensis [apfelsine]
ref|XP_006437709.1|  hypothetical protein CICLE_v10031658mg             192   2e-55   Citrus clementina [clementine]
ref|XP_007010159.1|  Auxin efflux carrier family protein                192   2e-55   
ref|XP_011027947.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    191   5e-55   Populus euphratica
gb|EMT00616.1|  Putative transporter                                    191   6e-55   
ref|XP_002890416.1|  auxin efflux carrier family protein                190   6e-55   
ref|XP_006304763.1|  hypothetical protein CARUB_v10012230mg             190   7e-55   
ref|XP_009149573.1|  PREDICTED: uncharacterized transporter YBR287W     189   1e-54   Brassica rapa
emb|CDY29492.1|  BnaA06g14780D                                          189   1e-54   Brassica napus [oilseed rape]
gb|KHG24872.1|  putative transporter C5D6.04                            190   1e-54   Gossypium arboreum [tree cotton]
gb|KDO70034.1|  hypothetical protein CISIN_1g014841mg                   190   2e-54   Citrus sinensis [apfelsine]
ref|XP_006589306.1|  PREDICTED: uncharacterized transporter YBR28...    189   2e-54   Glycine max [soybeans]
ref|XP_011027948.1|  PREDICTED: uncharacterized transporter C5D6....    189   2e-54   Populus euphratica
ref|XP_004300096.1|  PREDICTED: uncharacterized transporter YBR28...    189   3e-54   Fragaria vesca subsp. vesca
emb|CDY31514.1|  BnaC05g16230D                                          191   3e-54   Brassica napus [oilseed rape]
gb|KJB60446.1|  hypothetical protein B456_009G306100                    189   4e-54   Gossypium raimondii
ref|XP_010680488.1|  PREDICTED: uncharacterized transporter YBR28...    187   6e-54   Beta vulgaris subsp. vulgaris [field beet]
gb|EEC84799.1|  hypothetical protein OsI_31863                          188   8e-54   Oryza sativa Indica Group [Indian rice]
dbj|BAH57041.1|  AT1G76520                                              183   1e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004957210.1|  PREDICTED: uncharacterized protein LOC101771023    187   1e-53   Setaria italica
ref|XP_010679878.1|  PREDICTED: uncharacterized transporter YBR28...    187   1e-53   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010679877.1|  PREDICTED: uncharacterized transporter YBR28...    186   2e-53   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001175916.1|  Os09g0491740                                       186   2e-53   
ref|XP_010428716.1|  PREDICTED: uncharacterized transporter YBR28...    186   3e-53   Camelina sativa [gold-of-pleasure]
gb|EEE69960.1|  hypothetical protein OsJ_29847                          186   4e-53   Oryza sativa Japonica Group [Japonica rice]
ref|NP_683316.2|  auxin efflux carrier-like protein                     187   4e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004231634.1|  PREDICTED: uncharacterized protein LOC101264385    185   6e-53   Solanum lycopersicum
ref|XP_002462579.1|  hypothetical protein SORBIDRAFT_02g028510          185   6e-53   Sorghum bicolor [broomcorn]
gb|KCW76787.1|  hypothetical protein EUGRSUZ_D01141                     183   7e-53   Eucalyptus grandis [rose gum]
ref|XP_002462580.1|  hypothetical protein SORBIDRAFT_02g028520          185   7e-53   Sorghum bicolor [broomcorn]
ref|XP_002317029.1|  hypothetical protein POPTR_0011s14860g             184   8e-53   
ref|XP_006377867.1|  hypothetical protein POPTR_0011s14860g             185   8e-53   Populus trichocarpa [western balsam poplar]
ref|XP_002887644.1|  hypothetical protein ARALYDRAFT_895536             184   8e-53   Arabidopsis lyrata subsp. lyrata
ref|XP_009762862.1|  PREDICTED: uncharacterized protein LOC104214...    183   9e-53   Nicotiana sylvestris
gb|KDO71544.1|  hypothetical protein CISIN_1g013221mg                   181   1e-52   Citrus sinensis [apfelsine]
ref|XP_007010169.1|  Auxin efflux carrier family protein                185   1e-52   
ref|NP_565133.1|  auxin efflux carrier family protein                   184   2e-52   Arabidopsis thaliana [mouse-ear cress]
gb|AAM62517.1|  unknown                                                 183   2e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009106321.1|  PREDICTED: uncharacterized transporter YBR28...    183   3e-52   Brassica rapa
ref|XP_006350447.1|  PREDICTED: uncharacterized transporter YBR28...    183   3e-52   Solanum tuberosum [potatoes]
ref|XP_007010173.1|  Auxin efflux carrier family protein                184   3e-52   
ref|XP_003612404.1|  Transporter, putative                              184   3e-52   Medicago truncatula
emb|CDX87589.1|  BnaA07g32840D                                          183   3e-52   
emb|CDP01747.1|  unnamed protein product                                183   3e-52   Coffea canephora [robusta coffee]
ref|XP_009762861.1|  PREDICTED: uncharacterized protein LOC104214...    183   4e-52   Nicotiana sylvestris
ref|XP_010428718.1|  PREDICTED: uncharacterized transporter YBR28...    183   4e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010471808.1|  PREDICTED: uncharacterized transporter YBR28...    184   4e-52   Camelina sativa [gold-of-pleasure]
gb|AES95354.2|  auxin efflux carrier family protein                     176   5e-52   Medicago truncatula
gb|ABK92888.1|  unknown                                                 183   5e-52   Populus trichocarpa [western balsam poplar]
ref|XP_003578336.1|  PREDICTED: uncharacterized protein LOC100826810    183   5e-52   
ref|XP_010428717.1|  PREDICTED: uncharacterized transporter YBR28...    182   5e-52   Camelina sativa [gold-of-pleasure]
ref|XP_002264606.1|  PREDICTED: uncharacterized transporter C5D6....    183   5e-52   Vitis vinifera
ref|XP_010416572.1|  PREDICTED: uncharacterized transporter YBR28...    182   7e-52   Camelina sativa [gold-of-pleasure]
ref|XP_006584228.1|  PREDICTED: uncharacterized protein LOC100807965    184   7e-52   
ref|XP_009366044.1|  PREDICTED: uncharacterized transporter YBR28...    181   9e-52   
ref|XP_009600852.1|  PREDICTED: uncharacterized protein LOC104096...    181   9e-52   Nicotiana tomentosiformis
gb|KDO71541.1|  hypothetical protein CISIN_1g013221mg                   180   9e-52   Citrus sinensis [apfelsine]
ref|NP_001241160.1|  uncharacterized protein LOC100807081               181   1e-51   Glycine max [soybeans]
ref|XP_006425253.1|  hypothetical protein CICLE_v10025741mg             182   1e-51   
ref|XP_010052720.1|  PREDICTED: uncharacterized transporter YBR28...    182   1e-51   Eucalyptus grandis [rose gum]
ref|XP_006467106.1|  PREDICTED: uncharacterized transporter YBR28...    182   1e-51   Citrus sinensis [apfelsine]
ref|XP_006390184.1|  hypothetical protein EUTSA_v10018685mg             181   1e-51   Eutrema salsugineum [saltwater cress]
gb|KDO71543.1|  hypothetical protein CISIN_1g013221mg                   181   1e-51   Citrus sinensis [apfelsine]
dbj|BAH19704.1|  AT2G17500                                              176   2e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009600851.1|  PREDICTED: uncharacterized protein LOC104096...    181   4e-51   Nicotiana tomentosiformis
ref|XP_006661381.1|  PREDICTED: uncharacterized protein LOC102707339    181   4e-51   
gb|KEH27632.1|  auxin efflux carrier family protein                     177   5e-51   Medicago truncatula
gb|KDO71532.1|  hypothetical protein CISIN_1g013221mg                   181   5e-51   Citrus sinensis [apfelsine]
ref|XP_010471806.1|  PREDICTED: uncharacterized transporter YBR28...    180   5e-51   Camelina sativa [gold-of-pleasure]
gb|KDO71539.1|  hypothetical protein CISIN_1g013221mg                   180   5e-51   Citrus sinensis [apfelsine]
gb|KDO71534.1|  hypothetical protein CISIN_1g013221mg                   181   7e-51   Citrus sinensis [apfelsine]
gb|KDO71540.1|  hypothetical protein CISIN_1g013221mg                   180   8e-51   Citrus sinensis [apfelsine]
ref|XP_010681117.1|  PREDICTED: uncharacterized transporter C5D6....    179   9e-51   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY20402.1|  BnaC02g24140D                                          179   9e-51   Brassica napus [oilseed rape]
ref|XP_009128182.1|  PREDICTED: uncharacterized transporter YBR28...    179   9e-51   Brassica rapa
ref|XP_010467522.1|  PREDICTED: uncharacterized transporter YBR28...    179   9e-51   Camelina sativa [gold-of-pleasure]
emb|CDP01772.1|  unnamed protein product                                179   1e-50   Coffea canephora [robusta coffee]
ref|XP_007158024.1|  hypothetical protein PHAVU_002G117700g             179   1e-50   Phaseolus vulgaris [French bean]
ref|XP_009614500.1|  PREDICTED: uncharacterized protein LOC104107...    179   1e-50   Nicotiana tomentosiformis
ref|XP_004145562.1|  PREDICTED: uncharacterized protein LOC101208244    179   1e-50   
ref|XP_006409300.1|  hypothetical protein EUTSA_v10022717mg             179   1e-50   Eutrema salsugineum [saltwater cress]
ref|XP_007010166.1|  Auxin efflux carrier family protein                179   2e-50   
ref|XP_009104669.1|  PREDICTED: uncharacterized transporter YBR28...    179   2e-50   
ref|XP_003612396.1|  hypothetical protein MTR_5g024580                  172   2e-50   
ref|XP_010489377.1|  PREDICTED: uncharacterized transporter YBR28...    178   2e-50   Camelina sativa [gold-of-pleasure]
ref|XP_003537691.1|  PREDICTED: uncharacterized transporter YBR28...    179   2e-50   Glycine max [soybeans]
gb|AFW58767.1|  hypothetical protein ZEAMMB73_122963                    179   2e-50   
tpg|DAA62056.1|  TPA: hypothetical protein ZEAMMB73_195263              179   3e-50   
gb|KEH27633.1|  auxin efflux carrier family protein                     177   4e-50   Medicago truncatula
gb|KJB60463.1|  hypothetical protein B456_009G306300                    175   4e-50   Gossypium raimondii
ref|XP_002526514.1|  auxin:hydrogen symporter, putative                 179   4e-50   
ref|XP_008663364.1|  PREDICTED: uncharacterized protein LOC103641814    178   4e-50   
ref|XP_003517128.1|  PREDICTED: uncharacterized transporter YBR28...    178   4e-50   
emb|CDY24342.1|  BnaA07g02670D                                          177   4e-50   Brassica napus [oilseed rape]
ref|XP_008652869.1|  PREDICTED: uncharacterized protein LOC103632939    178   5e-50   
ref|XP_009121108.1|  PREDICTED: uncharacterized transporter YBR287W     177   5e-50   Brassica rapa
ref|XP_010514952.1|  PREDICTED: uncharacterized transporter YBR28...    177   6e-50   Camelina sativa [gold-of-pleasure]
ref|XP_006485670.1|  PREDICTED: uncharacterized transporter YBR28...    178   6e-50   Citrus sinensis [apfelsine]
ref|XP_006451737.1|  hypothetical protein CICLE_v10010809mg             178   6e-50   Citrus clementina [clementine]
ref|XP_002884062.1|  auxin efflux carrier family protein                177   6e-50   
gb|KEH17831.1|  auxin efflux carrier family protein                     177   8e-50   Medicago truncatula
ref|XP_003612402.1|  Transporter, putative                              177   8e-50   Medicago truncatula
gb|AAM60930.1|  unknown                                                 176   2e-49   Arabidopsis thaliana [mouse-ear cress]
ref|NP_565417.1|  auxin efflux carrier family protein                   176   2e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010550503.1|  PREDICTED: uncharacterized transporter YBR28...    176   2e-49   Tarenaya hassleriana [spider flower]
ref|XP_009779996.1|  PREDICTED: uncharacterized protein LOC104229115    176   2e-49   Nicotiana sylvestris
emb|CDY26812.1|  BnaC09g09390D                                          176   3e-49   Brassica napus [oilseed rape]
ref|XP_006299821.1|  hypothetical protein CARUB_v10016022mg             176   3e-49   Capsella rubella
gb|KDO71531.1|  hypothetical protein CISIN_1g013221mg                   176   3e-49   Citrus sinensis [apfelsine]
gb|ABR16386.1|  unknown                                                 176   3e-49   Picea sitchensis
ref|XP_009112433.1|  PREDICTED: uncharacterized transporter YBR28...    175   3e-49   Brassica rapa
gb|KHG24871.1|  Transporter protein                                     176   3e-49   Gossypium arboreum [tree cotton]
ref|XP_009112263.1|  PREDICTED: uncharacterized transporter YBR287W     175   3e-49   Brassica rapa
emb|CDY18579.1|  BnaA09g08160D                                          175   3e-49   Brassica napus [oilseed rape]
emb|CDX81425.1|  BnaC09g08360D                                          175   4e-49   
gb|KJB10399.1|  hypothetical protein B456_001G199900                    173   4e-49   Gossypium raimondii
ref|XP_007046465.1|  Auxin efflux carrier family protein isoform 1      176   4e-49   
ref|XP_007046466.1|  Auxin efflux carrier family protein isoform 2      176   4e-49   
ref|NP_177779.1|  auxin efflux carrier family protein                   175   4e-49   
ref|XP_004232583.1|  PREDICTED: uncharacterized transporter C5D6....    175   5e-49   Solanum lycopersicum
gb|KJB60464.1|  hypothetical protein B456_009G306300                    175   5e-49   Gossypium raimondii
ref|XP_010270517.1|  PREDICTED: uncharacterized protein LOC104606827    175   6e-49   Nelumbo nucifera [Indian lotus]
ref|XP_011022138.1|  PREDICTED: uncharacterized transporter YBR28...    175   6e-49   Populus euphratica
ref|XP_006282359.1|  hypothetical protein CARUB_v10028656mg             174   6e-49   Capsella rubella
ref|XP_010466350.1|  PREDICTED: uncharacterized transporter YBR28...    174   8e-49   Camelina sativa [gold-of-pleasure]
emb|CDY57767.1|  BnaC02g45080D                                          174   9e-49   Brassica napus [oilseed rape]
emb|CDY55102.1|  BnaA02g34870D                                          174   9e-49   Brassica napus [oilseed rape]
ref|XP_006393787.1|  hypothetical protein EUTSA_v10005581mg             174   1e-48   Eutrema salsugineum [saltwater cress]
ref|XP_004234500.1|  PREDICTED: uncharacterized transporter YBR28...    174   1e-48   Solanum lycopersicum
ref|XP_006343315.1|  PREDICTED: uncharacterized transporter YBR28...    174   1e-48   Solanum tuberosum [potatoes]
ref|XP_007134486.1|  hypothetical protein PHAVU_010G051200g             173   1e-48   Phaseolus vulgaris [French bean]
gb|KHG04809.1|  Transporter protein                                     174   1e-48   Gossypium arboreum [tree cotton]
ref|XP_002462581.1|  hypothetical protein SORBIDRAFT_02g028530          173   1e-48   
ref|XP_010550502.1|  PREDICTED: uncharacterized transporter YBR28...    174   2e-48   Tarenaya hassleriana [spider flower]
ref|XP_006855674.1|  hypothetical protein AMTR_s00044p00126910          174   2e-48   Amborella trichopoda
gb|KFK28259.1|  hypothetical protein AALP_AA8G493500                    173   2e-48   Arabis alpina [alpine rockcress]
ref|NP_201399.1|  auxin efflux carrier family protein                   173   2e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002521739.1|  auxin:hydrogen symporter, putative                 173   2e-48   
ref|XP_002866780.1|  predicted protein                                  173   3e-48   Arabidopsis lyrata subsp. lyrata
gb|KHG29772.1|  SPAC5D6.04: Uncharacterized transporter C5D6.04         173   3e-48   Gossypium arboreum [tree cotton]
gb|KJB10400.1|  hypothetical protein B456_001G199900                    173   4e-48   Gossypium raimondii
gb|KJB60426.1|  hypothetical protein B456_009G306200                    172   4e-48   Gossypium raimondii
gb|KHG29771.1|  SPAC5D6.04: Uncharacterized transporter C5D6.04         172   5e-48   Gossypium arboreum [tree cotton]
dbj|BAK01989.1|  predicted protein                                      172   5e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010548200.1|  PREDICTED: uncharacterized transporter YBR28...    172   6e-48   Tarenaya hassleriana [spider flower]
gb|KHN01043.1|  Putative transporter C5D6.04                            172   6e-48   Glycine soja [wild soybean]
ref|XP_010103240.1|  putative transporter                               172   7e-48   
ref|XP_002528527.1|  auxin:hydrogen symporter, putative                 171   7e-48   
ref|XP_010530989.1|  PREDICTED: uncharacterized transporter YBR287W     172   8e-48   
ref|XP_002306421.2|  auxin efflux carrier family protein                172   1e-47   
ref|XP_010029570.1|  PREDICTED: uncharacterized protein LOC104419566    172   1e-47   Eucalyptus grandis [rose gum]
ref|XP_011030712.1|  PREDICTED: uncharacterized transporter YBR28...    171   1e-47   
ref|XP_011004415.1|  PREDICTED: uncharacterized transporter YBR28...    171   1e-47   
ref|XP_010680628.1|  PREDICTED: uncharacterized transporter YBR28...    171   1e-47   
ref|XP_003555504.2|  PREDICTED: uncharacterized transporter YBR28...    172   1e-47   
ref|XP_010918345.1|  PREDICTED: uncharacterized protein LOC105042...    171   1e-47   
ref|XP_009759349.1|  PREDICTED: uncharacterized transporter C5D6....    171   2e-47   
ref|XP_009759350.1|  PREDICTED: uncharacterized transporter C5D6....    171   2e-47   
gb|EMT16972.1|  Putative transporter                                    171   2e-47   
ref|XP_009607642.1|  PREDICTED: uncharacterized transporter C5D6.04     171   3e-47   
gb|KJB17459.1|  hypothetical protein B456_003G001200                    170   3e-47   
ref|XP_006388075.1|  hypothetical protein POPTR_0365s00230g             171   3e-47   
ref|XP_004512284.1|  PREDICTED: uncharacterized transporter YBR28...    171   3e-47   
gb|KHG10464.1|  Transporter protein                                     170   4e-47   
gb|KGN55596.1|  hypothetical protein Csa_3G000690                       170   4e-47   
ref|XP_004159743.1|  PREDICTED: uncharacterized transporter YBR28...    170   5e-47   
ref|XP_008448449.1|  PREDICTED: uncharacterized transporter YBR28...    170   5e-47   
ref|XP_008804451.1|  PREDICTED: uncharacterized transporter YBR28...    170   6e-47   
ref|XP_009772486.1|  PREDICTED: uncharacterized transporter YBR28...    169   6e-47   
ref|XP_009600925.1|  PREDICTED: uncharacterized transporter C5D6....    169   7e-47   
gb|KDP43785.1|  hypothetical protein JCGZ_22412                         169   7e-47   
ref|XP_007144117.1|  hypothetical protein PHAVU_007G130200g             169   1e-46   
ref|XP_010317676.1|  PREDICTED: uncharacterized protein LOC101262895    167   2e-46   
ref|XP_010270520.1|  PREDICTED: uncharacterized protein LOC104606828    167   3e-46   
ref|XP_009418347.1|  PREDICTED: uncharacterized transporter YBR28...    168   4e-46   
ref|XP_009386671.1|  PREDICTED: uncharacterized transporter YBR28...    167   5e-46   
ref|XP_006588038.1|  PREDICTED: uncharacterized protein LOC100788582    166   5e-46   
gb|AAD30600.1|AC007369_10  Hypothetical protein                         166   5e-46   
ref|XP_007010162.1|  Auxin efflux carrier family protein isoform 5      165   6e-46   
ref|XP_007010163.1|  Auxin efflux carrier family protein isoform 6      166   7e-46   
ref|XP_009420837.1|  PREDICTED: uncharacterized protein LOC104000492    167   8e-46   
ref|NP_001063887.1|  Os09g0554300                                       167   9e-46   
ref|XP_007010160.1|  Auxin efflux carrier family protein isoform 1      166   1e-45   
gb|AET03577.2|  auxin efflux carrier family protein                     166   1e-45   
ref|XP_004146180.1|  PREDICTED: uncharacterized transporter YBR28...    167   1e-45   
ref|XP_003578612.1|  PREDICTED: uncharacterized protein LOC100833440    166   2e-45   
ref|XP_007134489.1|  hypothetical protein PHAVU_010G051500g             166   2e-45   
ref|XP_003629101.1|  Transporter, putative                              166   2e-45   
gb|EMS54288.1|  Uncharacterized transporter C5D6.04                     166   3e-45   
ref|XP_011099928.1|  PREDICTED: uncharacterized transporter YBR28...    165   3e-45   
ref|XP_007010161.1|  Auxin efflux carrier family protein isoform 2      166   4e-45   
ref|XP_011096970.1|  PREDICTED: uncharacterized transporter C5D6....    164   4e-45   
ref|XP_011096969.1|  PREDICTED: uncharacterized transporter C5D6....    165   4e-45   
gb|EYU30838.1|  hypothetical protein MIMGU_mgv1a007822mg                164   5e-45   
ref|XP_002276744.2|  PREDICTED: uncharacterized transporter YBR287W     164   6e-45   
ref|XP_009369785.1|  PREDICTED: uncharacterized transporter YBR28...    164   6e-45   
ref|XP_009592390.1|  PREDICTED: uncharacterized transporter YBR28...    163   1e-44   
ref|XP_004957592.1|  PREDICTED: uncharacterized transporter YBR28...    164   1e-44   
ref|XP_003533405.1|  PREDICTED: uncharacterized transporter YBR28...    163   1e-44   
gb|EPS57973.1|  hypothetical protein M569_16844                         164   1e-44   
ref|XP_006660956.1|  PREDICTED: uncharacterized transporter YBR28...    164   2e-44   
ref|XP_008448455.1|  PREDICTED: uncharacterized transporter C5D6....    164   2e-44   
ref|XP_004146179.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    163   3e-44   
ref|XP_010935349.1|  PREDICTED: uncharacterized transporter YBR28...    163   3e-44   
ref|XP_009401008.1|  PREDICTED: uncharacterized transporter YBR28...    162   5e-44   
ref|XP_008393334.1|  PREDICTED: uncharacterized transporter YBR28...    161   7e-44   
ref|XP_007202341.1|  hypothetical protein PRUPE_ppa008223mg             160   8e-44   
ref|XP_007156259.1|  hypothetical protein PHAVU_003G271200g             161   1e-43   
ref|XP_008448450.1|  PREDICTED: uncharacterized transporter YBR28...    160   1e-43   
ref|XP_011465006.1|  PREDICTED: uncharacterized transporter YBR28...    159   2e-43   
ref|XP_003573172.1|  PREDICTED: uncharacterized transporter YBR28...    161   2e-43   
ref|XP_010266240.1|  PREDICTED: uncharacterized transporter YBR287W     160   3e-43   
ref|XP_008448451.1|  PREDICTED: uncharacterized transporter YBR28...    159   3e-43   
ref|XP_008242098.1|  PREDICTED: uncharacterized transporter YBR287W     160   3e-43   
ref|XP_004146216.1|  PREDICTED: uncharacterized transporter YBR28...    159   3e-43   
ref|XP_004159761.1|  PREDICTED: uncharacterized transporter YBR28...    159   3e-43   
ref|XP_004509460.1|  PREDICTED: uncharacterized transporter YBR28...    160   3e-43   
gb|KJB78710.1|  hypothetical protein B456_013G014100                    158   9e-43   
ref|XP_009130575.1|  PREDICTED: uncharacterized transporter YBR28...    158   1e-42   
gb|KCW56462.1|  hypothetical protein EUGRSUZ_I02197                     155   2e-42   
ref|XP_009420836.1|  PREDICTED: uncharacterized transporter YBR28...    157   3e-42   
ref|XP_010649330.1|  PREDICTED: uncharacterized protein LOC100249...    157   3e-42   
ref|XP_010649326.1|  PREDICTED: uncharacterized protein LOC100249...    157   6e-42   
ref|XP_011461477.1|  PREDICTED: uncharacterized transporter YBR28...    156   1e-41   
ref|XP_004287713.1|  PREDICTED: uncharacterized transporter YBR28...    155   1e-41   
ref|XP_004515379.1|  PREDICTED: uncharacterized protein LOC101498835    155   2e-41   
gb|KJB78711.1|  hypothetical protein B456_013G014100                    155   2e-41   
ref|XP_003562144.1|  PREDICTED: uncharacterized protein LOC100832109    154   3e-41   
ref|XP_010029548.1|  PREDICTED: uncharacterized transporter YBR28...    154   3e-41   
ref|XP_006343325.1|  PREDICTED: uncharacterized transporter YBR28...    153   7e-41   
ref|XP_011018693.1|  PREDICTED: uncharacterized protein LOC105121661    154   4e-40   
ref|NP_001147841.1|  auxin Efflux Carrier family protein                152   4e-40   
gb|AFK32350.1|  putative auxin efflux carrier-like protein PINX         152   5e-40   
ref|XP_006485673.1|  PREDICTED: uncharacterized transporter YBR28...    150   9e-40   
gb|EEE70196.1|  hypothetical protein OsJ_30282                          150   9e-40   
ref|XP_006660957.1|  PREDICTED: uncharacterized transporter YBR28...    150   9e-40   
gb|EEC85032.1|  hypothetical protein OsI_32336                          150   1e-39   
gb|KJB73487.1|  hypothetical protein B456_011G234700                    150   1e-39   
ref|NP_001063888.2|  Os09g0555100                                       150   1e-39   
ref|XP_007010168.1|  Auxin efflux carrier family protein, putative      150   1e-39   
ref|XP_003570731.1|  PREDICTED: uncharacterized transporter YBR28...    147   2e-38   
ref|XP_010649335.1|  PREDICTED: uncharacterized transporter C5D6....    146   2e-38   
emb|CBI37493.3|  unnamed protein product                                146   2e-38   
emb|CAN63214.1|  hypothetical protein VITISV_002064                     146   4e-38   
ref|NP_001280772.1|  uncharacterized transporter YBR287W-like           146   4e-38   
ref|XP_009359620.1|  PREDICTED: uncharacterized transporter YBR287W     143   6e-37   
gb|KHG02404.1|  hypothetical protein F383_24041                         139   4e-36   
ref|XP_002981829.1|  hypothetical protein SELMODRAFT_115659             140   4e-36   
ref|XP_002468584.1|  hypothetical protein SORBIDRAFT_01g048490          139   5e-36   
gb|KGN55594.1|  hypothetical protein Csa_3G000180                       140   5e-36   
ref|XP_002982798.1|  hypothetical protein SELMODRAFT_117190             140   9e-36   
ref|XP_008786678.1|  PREDICTED: uncharacterized protein LOC103704...    139   1e-35   
ref|XP_008786672.1|  PREDICTED: uncharacterized transporter YBR28...    139   2e-35   
ref|XP_008786677.1|  PREDICTED: uncharacterized transporter YBR28...    139   3e-35   
emb|CAN62432.1|  hypothetical protein VITISV_012649                     139   3e-35   
dbj|BAJ86794.1|  predicted protein                                      138   4e-35   
gb|AES95349.2|  auxin efflux carrier family protein                     137   4e-35   
ref|XP_003612391.1|  hypothetical protein MTR_5g024520                  137   5e-35   
ref|XP_003612434.1|  Auxin efflux carrier protein                       136   7e-35   
gb|KHN33198.1|  hypothetical protein glysoja_043233                     134   3e-34   
ref|XP_001766817.1|  predicted protein                                  134   9e-34   
ref|XP_006599263.1|  PREDICTED: uncharacterized protein LOC100804...    134   1e-33   
ref|XP_003548795.1|  PREDICTED: uncharacterized protein LOC100804...    134   1e-33   
ref|XP_006435466.1|  hypothetical protein CICLE_v10001325mg             129   2e-33   
ref|XP_009592449.1|  PREDICTED: uncharacterized transporter YBR28...    132   3e-33   
ref|XP_009798619.1|  PREDICTED: uncharacterized transporter YBR28...    131   5e-33   
ref|XP_007010164.1|  Auxin efflux carrier family protein, putative      130   7e-33   
ref|XP_006435463.1|  hypothetical protein CICLE_v10001325mg             129   2e-32   
ref|XP_009614501.1|  PREDICTED: uncharacterized protein LOC104107...    130   2e-32   
dbj|BAJ99434.1|  predicted protein                                      130   3e-32   
emb|CBI37488.3|  unnamed protein product                                123   8e-32   
ref|XP_004512294.1|  PREDICTED: uncharacterized protein LOC101507...    128   9e-32   
ref|XP_010029547.1|  PREDICTED: uncharacterized transporter YBR28...    128   1e-31   
ref|XP_006599270.1|  PREDICTED: uncharacterized protein LOC100817...    127   1e-31   
emb|CDY57768.1|  BnaC02g45090D                                          121   3e-31   
ref|XP_004172586.1|  PREDICTED: uncharacterized LOC101208244            126   5e-31   
ref|XP_006382981.1|  hypothetical protein POPTR_0005s10230g             125   9e-31   
ref|XP_006302565.1|  hypothetical protein CARUB_v10020672mg             124   1e-30   
emb|CDX85953.1|  BnaC06g21810D                                          124   2e-30   
ref|XP_010649331.1|  PREDICTED: uncharacterized protein LOC100249...    124   2e-30   
ref|XP_006587541.1|  PREDICTED: uncharacterized protein LOC100810...    122   9e-30   
ref|XP_010913880.1|  PREDICTED: uncharacterized transporter YBR28...    122   1e-29   
ref|XP_011465007.1|  PREDICTED: uncharacterized transporter YBR28...    120   3e-29   
ref|XP_004512295.1|  PREDICTED: uncharacterized protein LOC101507...    120   4e-29   
emb|CBI37380.3|  unnamed protein product                                116   1e-28   
gb|KHN29468.1|  Putative transporter C5D6.04                            118   8e-28   
ref|XP_003533648.1|  PREDICTED: uncharacterized transporter YBR28...    117   9e-28   
gb|KDO70040.1|  hypothetical protein CISIN_1g014841mg                   117   9e-28   
ref|XP_006437710.1|  hypothetical protein CICLE_v10031658mg             117   9e-28   
ref|XP_002967465.1|  hypothetical protein SELMODRAFT_87119              117   1e-27   
ref|XP_002960250.1|  hypothetical protein SELMODRAFT_73552              117   1e-27   
ref|XP_011038093.1|  PREDICTED: uncharacterized transporter YBR28...    116   1e-27   
ref|XP_006390183.1|  hypothetical protein EUTSA_v10018685mg             114   5e-27   
ref|XP_009804398.1|  PREDICTED: uncharacterized protein LOC104249625    110   1e-26   
dbj|BAG92093.1|  unnamed protein product                                114   2e-26   
gb|EPS68823.1|  auxin efflux carrier component, auxin transport p...    114   2e-26   
ref|XP_001785659.1|  predicted protein                                  114   2e-26   
gb|KHG08318.1|  putative transporter C5D6.04                            112   5e-26   
ref|XP_001784737.1|  predicted protein                                  112   6e-26   
ref|XP_009772093.1|  PREDICTED: uncharacterized protein LOC104222551    112   6e-26   
ref|XP_009589511.1|  PREDICTED: uncharacterized protein LOC104086873    112   6e-26   
ref|XP_010922814.1|  PREDICTED: uncharacterized protein LOC105046029    112   7e-26   
tpg|DAA57098.1|  TPA: hypothetical protein ZEAMMB73_854946              111   1e-25   
gb|KJB71500.1|  hypothetical protein B456_011G126000                    111   2e-25   
ref|XP_011006245.1|  PREDICTED: uncharacterized protein LOC105112293    110   2e-25   
ref|XP_008244422.1|  PREDICTED: uncharacterized transporter YBR287W     110   2e-25   
ref|XP_002323690.1|  hypothetical protein POPTR_0016s14840g             110   2e-25   
gb|KJB60449.1|  hypothetical protein B456_009G306100                    110   3e-25   
ref|XP_007207474.1|  hypothetical protein PRUPE_ppa006242mg             110   3e-25   
ref|XP_010543136.1|  PREDICTED: uncharacterized protein LOC104816...    110   3e-25   
gb|KJB27611.1|  hypothetical protein B456_005G002100                    110   4e-25   
ref|XP_008674893.1|  PREDICTED: uncharacterized transporter YBR287W     110   4e-25   
ref|XP_010550500.1|  PREDICTED: uncharacterized transporter YBR28...    110   5e-25   
ref|XP_009337818.1|  PREDICTED: uncharacterized protein LOC103930244    109   7e-25   
ref|XP_010278930.1|  PREDICTED: uncharacterized protein LOC104612960    109   7e-25   
ref|XP_009370868.1|  PREDICTED: uncharacterized protein LOC103960175    109   1e-24   
ref|XP_011466389.1|  PREDICTED: uncharacterized protein LOC101296115    109   1e-24   
ref|XP_002531815.1|  auxin:hydrogen symporter, putative                 109   1e-24   
ref|XP_008370296.1|  PREDICTED: uncharacterized transporter YBR28...    108   2e-24   
ref|NP_001044627.1|  Os01g0818000                                       108   2e-24   
emb|CDY01222.1|  BnaC05g25100D                                          108   3e-24   
dbj|BAD73344.1|  auxin efflux carrier family protein-like               108   3e-24   
gb|EEE55582.1|  hypothetical protein OsJ_03876                          108   3e-24   
emb|CDY70057.1|  BnaA05g35770D                                          108   3e-24   
ref|XP_009144903.1|  PREDICTED: uncharacterized protein LOC103868570    107   3e-24   
ref|XP_009391659.1|  PREDICTED: uncharacterized protein LOC103977...    107   3e-24   
gb|KGN54477.1|  hypothetical protein Csa_4G337340                       107   3e-24   
gb|EAY76281.1|  hypothetical protein OsI_04215                          108   3e-24   
ref|XP_002870888.1|  auxin efflux carrier family protein                107   3e-24   
ref|XP_009391660.1|  PREDICTED: uncharacterized protein LOC103977...    107   4e-24   
ref|XP_004142666.1|  PREDICTED: uncharacterized transporter YBR28...    107   4e-24   
gb|KFK24696.1|  hypothetical protein AALP_AA8G013000                    107   4e-24   
ref|XP_006398552.1|  hypothetical protein EUTSA_v10013614mg             107   4e-24   
ref|NP_195819.1|  auxin efflux carrier family protein                   107   4e-24   
ref|XP_006300110.1|  hypothetical protein CARUB_v10016338mg             107   5e-24   
ref|XP_010496816.1|  PREDICTED: uncharacterized protein LOC104773846    107   5e-24   
ref|XP_006442997.1|  hypothetical protein CICLE_v10024499mg             102   5e-24   
ref|XP_003564484.1|  PREDICTED: uncharacterized protein LOC100836625    107   5e-24   
ref|XP_002267734.1|  PREDICTED: uncharacterized protein LOC100246780    107   6e-24   
ref|XP_005651741.1|  auxin efflux carrier                               107   6e-24   
gb|KDO46281.1|  hypothetical protein CISIN_1g048488mg                   102   6e-24   
ref|XP_010113048.1|  Uncharacterized transporter                        106   7e-24   
gb|AIC32551.1|  PH                                                      106   1e-23   
ref|XP_010327698.1|  PREDICTED: uncharacterized protein LOC101257...    104   2e-23   
ref|XP_006644905.1|  PREDICTED: uncharacterized transporter YBR28...    105   3e-23   
emb|CDY03621.1|  BnaC03g68800D                                          105   3e-23   
emb|CDY58937.1|  BnaAnng15560D                                          105   3e-23   
ref|XP_009107207.1|  PREDICTED: uncharacterized protein LOC103832859    105   3e-23   
gb|AFK47877.1|  unknown                                                 104   4e-23   
gb|KJB60466.1|  hypothetical protein B456_009G306300                    104   4e-23   
emb|CDM84752.1|  unnamed protein product                                104   5e-23   
ref|XP_010550501.1|  PREDICTED: uncharacterized transporter YBR28...    104   5e-23   
gb|KDO71535.1|  hypothetical protein CISIN_1g013221mg                   103   5e-23   
ref|XP_004249020.1|  PREDICTED: uncharacterized protein LOC101257...    104   5e-23   
ref|XP_003623663.1|  Auxin efflux carrier component auxin transpo...    103   9e-23   
ref|XP_002985541.1|  hypothetical protein SELMODRAFT_269010             103   1e-22   
gb|EMS45676.1|  Uncharacterized transporter C5D6.04                     103   1e-22   
ref|XP_010543135.1|  PREDICTED: uncharacterized protein LOC104816...    103   1e-22   
gb|EMT23880.1|  Putative transporter                                    103   1e-22   
dbj|BAJ88273.1|  predicted protein                                      103   1e-22   
ref|XP_002987028.1|  hypothetical protein SELMODRAFT_235164             102   2e-22   
ref|XP_010066648.1|  PREDICTED: uncharacterized transporter YBR287W     103   2e-22   
ref|XP_010693630.1|  PREDICTED: uncharacterized protein LOC104906556    102   4e-22   
ref|NP_001148375.1|  LOC100281987                                       102   4e-22   
ref|XP_010918350.1|  PREDICTED: uncharacterized protein LOC105042...    101   5e-22   
ref|XP_010683424.1|  PREDICTED: uncharacterized protein LOC104898109    101   7e-22   
emb|CAN71532.1|  hypothetical protein VITISV_018180                     103   7e-22   
ref|XP_004953056.1|  PREDICTED: uncharacterized protein LOC101773408    101   8e-22   
ref|XP_004492601.1|  PREDICTED: uncharacterized transporter YBR28...    100   9e-22   
ref|NP_001242551.1|  uncharacterized protein LOC100819622               100   9e-22   
ref|XP_008463302.1|  PREDICTED: uncharacterized transporter YBR28...    100   9e-22   
ref|XP_006362331.1|  PREDICTED: uncharacterized transporter YBR28...    100   9e-22   



>emb|CDP07249.1| unnamed protein product [Coffea canephora]
Length=172

 Score =   223 bits (569),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MG L L   AS+PVLKVL+++ALGS LA D  +ILGE+AR HLN++VF+VFNPA+V SNL
Sbjct  1    MGLLDLFSAASIPVLKVLLVTALGSYLALDRVNILGEDARKHLNSIVFYVFNPAIVSSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+++T DS++ LWFMPFNIL+TF++GS LGW++ ++TRAP+HL GL++G  AAGN+GN+ 
Sbjct  61   AKTITYDSMVKLWFMPFNILITFLVGSVLGWLVIQMTRAPRHLHGLVIGCCAAGNLGNML  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPA+C EKGSPFGA DVCH+YGM YASLSMA+
Sbjct  121  LIIIPAVCKEKGSPFGAPDVCHSYGMAYASLSMAV  155



>ref|XP_007046429.1| Auxin:hydrogen symporter, putative isoform 1 [Theobroma cacao]
 gb|EOX90586.1| Auxin:hydrogen symporter, putative isoform 1 [Theobroma cacao]
Length=419

 Score =   230 bits (587),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M FL L  VASMPVLKVL+++ALGS LA D   ++GE+AR  LNN+VF+VFNPA+V SNL
Sbjct  1    MRFLDLFVVASMPVLKVLLLTALGSFLALDRIDVMGEDARKQLNNVVFYVFNPAVVSSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+++T +S++LLWFMPFNIL TFI+GSA+GW+L K+T+APQHL+GLIL   AAGNMG+LP
Sbjct  61   AKTITFESIVLLWFMPFNILNTFIIGSAMGWVLVKITKAPQHLRGLILSCCAAGNMGHLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +I++PAIC EKGSPFG  D+CH YGM YASLSMAI
Sbjct  121  LIVVPAICTEKGSPFGTPDICHKYGMAYASLSMAI  155



>gb|KJB17438.1| hypothetical protein B456_003G000900 [Gossypium raimondii]
 gb|KJB17439.1| hypothetical protein B456_003G000900 [Gossypium raimondii]
 gb|KJB17440.1| hypothetical protein B456_003G000900 [Gossypium raimondii]
Length=424

 Score =   228 bits (581),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L  VASMP++KVLM++ALGS LA D   ++GE+AR  LNN+VFFVFNPALV S+L
Sbjct  1    MRILDLFVVASMPIMKVLMLTALGSFLALDRIDVMGESARKQLNNVVFFVFNPALVSSSL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A++VT +S++LLWFMPFNILLTFI+G+A+GW+L K+T+APQH++GLIL   AAGN+G+LP
Sbjct  61   AKTVTFESIVLLWFMPFNILLTFIIGTAMGWLLVKITKAPQHIRGLILSCCAAGNVGHLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +I++PAIC EKGSPFGA D+CHTYG  YASLSMAI
Sbjct  121  LIVVPAICREKGSPFGAPDICHTYGTAYASLSMAI  155



>ref|XP_006435462.1| hypothetical protein CICLE_v10001325mg [Citrus clementina]
 gb|ESR48702.1| hypothetical protein CICLE_v10001325mg [Citrus clementina]
Length=302

 Score =   224 bits (571),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MG L L   +S+PVLKVL+I+ALGS LA DH +ILGE+AR H+NN+VF+VFNPALV SNL
Sbjct  1    MGALDLFIASSIPVLKVLLITALGSYLALDHVNILGEDARKHINNLVFYVFNPALVASNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++T +S+L LWFMPFN+L+TF++GS LGWI+ + TR P HL+GLI+G  AAGN+GN+P
Sbjct  61   ANTITYESMLKLWFMPFNVLITFLVGSILGWIVVQFTRPPSHLRGLIVGCCAAGNLGNMP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPA+C EKGSPFG+ D C TYG+ YASLSMA+
Sbjct  121  LIIIPAVCKEKGSPFGSPDTCQTYGLAYASLSMAV  155



>gb|KJB17441.1| hypothetical protein B456_003G000900 [Gossypium raimondii]
 gb|KJB17442.1| hypothetical protein B456_003G000900 [Gossypium raimondii]
Length=439

 Score =   228 bits (581),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L  VASMP++KVLM++ALGS LA D   ++GE+AR  LNN+VFFVFNPALV S+L
Sbjct  1    MRILDLFVVASMPIMKVLMLTALGSFLALDRIDVMGESARKQLNNVVFFVFNPALVSSSL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A++VT +S++LLWFMPFNILLTFI+G+A+GW+L K+T+APQH++GLIL   AAGN+G+LP
Sbjct  61   AKTVTFESIVLLWFMPFNILLTFIIGTAMGWLLVKITKAPQHIRGLILSCCAAGNVGHLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +I++PAIC EKGSPFGA D+CHTYG  YASLSMAI
Sbjct  121  LIVVPAICREKGSPFGAPDICHTYGTAYASLSMAI  155



>ref|XP_006435465.1| hypothetical protein CICLE_v10001325mg [Citrus clementina]
 gb|ESR48705.1| hypothetical protein CICLE_v10001325mg [Citrus clementina]
Length=310

 Score =   224 bits (571),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MG L L   +S+PVLKVL+I+ALGS LA DH +ILGE+AR H+NN+VF+VFNPALV SNL
Sbjct  1    MGALDLFIASSIPVLKVLLITALGSYLALDHVNILGEDARKHINNLVFYVFNPALVASNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++T +S+L LWFMPFN+L+TF++GS LGWI+ + TR P HL+GLI+G  AAGN+GN+P
Sbjct  61   ANTITYESMLKLWFMPFNVLITFLVGSILGWIVVQFTRPPSHLRGLIVGCCAAGNLGNMP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPA+C EKGSPFG+ D C TYG+ YASLSMA+
Sbjct  121  LIIIPAVCKEKGSPFGSPDTCQTYGLAYASLSMAV  155



>emb|CDP01745.1| unnamed protein product [Coffea canephora]
Length=415

 Score =   226 bits (577),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MG L L  VAS+PV+KVL+I  LGS LA DH  ILGE+AR  +NN+VFFVFNPALV SNL
Sbjct  1    MGLLDLFMVASVPVMKVLLICGLGSFLALDHIDILGESARKQINNVVFFVFNPALVSSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+++TL++++ LWFMP NILLTFILG   GW+L K+T+APQHLKGL++GS AAGN+GNLP
Sbjct  61   AQTITLENIVSLWFMPVNILLTFILGLFFGWVLGKITKAPQHLKGLVIGSCAAGNLGNLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +I++PAIC EKGSPFGA D CH YGM Y SLSMAI
Sbjct  121  LILVPAICREKGSPFGAPDSCHMYGMAYVSLSMAI  155



>gb|KDO85260.1| hypothetical protein CISIN_1g015164mg [Citrus sinensis]
Length=302

 Score =   221 bits (563),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MG L L   +S+PVLKVL+I+ALGS LA DH +ILGE+AR H+NN+VF+VFNPALV SNL
Sbjct  1    MGALDLFIASSIPVLKVLLITALGSYLALDHVNILGEDARKHINNLVFYVFNPALVASNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++T +S+L LWFMPFN+L+TF++GS LGWI+ + TR P H +GLI+G  AAGN+GN+P
Sbjct  61   ANTITYESMLKLWFMPFNVLITFLVGSILGWIVVQFTRPPSHFRGLIVGCCAAGNLGNMP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPA+C EKGSPFG+ D C TYG+ Y SLSMA+
Sbjct  121  LIIIPAVCKEKGSPFGSPDTCQTYGLAYVSLSMAV  155



>ref|XP_006435464.1| hypothetical protein CICLE_v10001325mg [Citrus clementina]
 gb|ESR48704.1| hypothetical protein CICLE_v10001325mg [Citrus clementina]
Length=412

 Score =   224 bits (571),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MG L L   +S+PVLKVL+I+ALGS LA DH +ILGE+AR H+NN+VF+VFNPALV SNL
Sbjct  1    MGALDLFIASSIPVLKVLLITALGSYLALDHVNILGEDARKHINNLVFYVFNPALVASNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++T +S+L LWFMPFN+L+TF++GS LGWI+ + TR P HL+GLI+G  AAGN+GN+P
Sbjct  61   ANTITYESMLKLWFMPFNVLITFLVGSILGWIVVQFTRPPSHLRGLIVGCCAAGNLGNMP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPA+C EKGSPFG+ D C TYG+ YASLSMA+
Sbjct  121  LIIIPAVCKEKGSPFGSPDTCQTYGLAYASLSMAV  155



>emb|CBI37491.3| unnamed protein product [Vitis vinifera]
Length=391

 Score =   222 bits (566),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MG L L  VASMPV++VL+++ALGS LA D   ILG+  R  LN +VFFVFNPALV+SNL
Sbjct  1    MGLLDLFFVASMPVIRVLLLTALGSFLALDRIDILGDVVRKQLNTVVFFVFNPALVYSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++TLD ++LLWFMP NIL   I+GSALG +L K TRAPQHLKGLILGS AAGNMGN+P
Sbjct  61   ANTITLDRMVLLWFMPLNILTVCIIGSALGLLLVKTTRAPQHLKGLILGSCAAGNMGNMP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPA+C EKGSPFGA DVCHT+ M YASLSMAI
Sbjct  121  LIIIPAVCREKGSPFGAPDVCHTFAMAYASLSMAI  155



>ref|XP_002263531.1| PREDICTED: uncharacterized transporter YBR287W-like [Vitis vinifera]
Length=390

 Score =   222 bits (566),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MG L L  VASMPV++VL+++ALGS LA D   ILG+  R  LN +VFFVFNPALV+SNL
Sbjct  1    MGLLDLFFVASMPVIRVLLLTALGSFLALDRIDILGDVVRKQLNTVVFFVFNPALVYSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++TLD ++LLWFMP NIL   I+GSALG +L K TRAPQHLKGLILGS AAGNMGN+P
Sbjct  61   ANTITLDRMVLLWFMPLNILTVCIIGSALGLLLVKTTRAPQHLKGLILGSCAAGNMGNMP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPA+C EKGSPFGA DVCHT+ M YASLSMAI
Sbjct  121  LIIIPAVCREKGSPFGAPDVCHTFAMAYASLSMAI  155



>gb|ACU18030.1| unknown [Glycine max]
Length=274

 Score =   218 bits (555),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MG + L  +ASMPV+KVL+I+A+G LLA D+ ++LG++AR+ +N++V +VFNPALV  NL
Sbjct  1    MGLVELFGMASMPVIKVLLITAVGLLLALDNVNLLGKDARIQVNHLVHYVFNPALVGGNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++T ++V+LLWFMP NILLTFI+GSALGWIL KLTRAP+HL+GLI+G  +AGN+GNLP
Sbjct  61   ADTITFENVVLLWFMPVNILLTFIIGSALGWILIKLTRAPKHLEGLIMGVCSAGNLGNLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPAIC +KGSPFG ++VC+ YGM YASLSMA+
Sbjct  121  IIIIPAICKDKGSPFGDSNVCYQYGMAYASLSMAV  155



>gb|KDO85259.1| hypothetical protein CISIN_1g015164mg [Citrus sinensis]
Length=381

 Score =   221 bits (563),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MG L L   +S+PVLKVL+I+ALGS LA DH +ILGE+AR H+NN+VF+VFNPALV SNL
Sbjct  1    MGALDLFIASSIPVLKVLLITALGSYLALDHVNILGEDARKHINNLVFYVFNPALVASNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++T +S+L LWFMPFN+L+TF++GS LGWI+ + TR P H +GLI+G  AAGN+GN+P
Sbjct  61   ANTITYESMLKLWFMPFNVLITFLVGSILGWIVVQFTRPPSHFRGLIVGCCAAGNLGNMP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPA+C EKGSPFG+ D C TYG+ Y SLSMA+
Sbjct  121  LIIIPAVCKEKGSPFGSPDTCQTYGLAYVSLSMAV  155



>ref|XP_010033614.1| PREDICTED: uncharacterized transporter C5D6.04-like [Eucalyptus 
grandis]
 ref|XP_010033615.1| PREDICTED: uncharacterized transporter C5D6.04-like [Eucalyptus 
grandis]
 ref|XP_010033616.1| PREDICTED: uncharacterized transporter C5D6.04-like [Eucalyptus 
grandis]
 ref|XP_010033617.1| PREDICTED: uncharacterized transporter C5D6.04-like [Eucalyptus 
grandis]
 gb|KCW53315.1| hypothetical protein EUGRSUZ_J02568 [Eucalyptus grandis]
Length=418

 Score =   222 bits (565),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M FL L  VASMPVLKVL+++ALG  LA +   I+GE+ R  +N + FFVFNPALV SNL
Sbjct  1    MAFLDLFLVASMPVLKVLLVTALGLYLALESVDIMGESTRRQMNRVAFFVFNPALVGSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            AR+VT ++++ LWFMP NIL+TFI+GSALGWIL K+TRAPQH+KGLILG  A+GN+GNLP
Sbjct  61   ARTVTSENIVQLWFMPINILITFIIGSALGWILVKVTRAPQHVKGLILGCCASGNLGNLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPA+C E+GSPFG  DVC+ YGM YAS+SMAI
Sbjct  121  LIIIPAVCKEQGSPFGEPDVCYKYGMAYASISMAI  155



>gb|EYU41206.1| hypothetical protein MIMGU_mgv1a018588mg [Erythranthe guttata]
Length=341

 Score =   219 bits (559),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MG + L   +++PVLKVL+++ LGS LA DH  ILG++AR HLNN+ FFVF+PALV+SNL
Sbjct  1    MGLVDLFIASTIPVLKVLLVTGLGSYLAFDHVGILGDDARKHLNNITFFVFSPALVYSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+++T DS+  LWFMP NIL+TFI+GS LGW++ ++TRAP HL+GLI+G  AAGN+GNL 
Sbjct  61   AKTITYDSMAKLWFMPLNILITFIVGSVLGWVVIQITRAPSHLRGLIIGCCAAGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPA+C EKGSPFG  DVC TYGM YASLSMAI
Sbjct  121  LIIIPAVCKEKGSPFGDPDVCQTYGMSYASLSMAI  155



>ref|XP_007156270.1| hypothetical protein PHAVU_003G272300g [Phaseolus vulgaris]
 gb|ESW28264.1| hypothetical protein PHAVU_003G272300g [Phaseolus vulgaris]
Length=414

 Score =   221 bits (564),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGFL LL VAS PV+KVL+I+A+G  LA D   IL E+AR  +N +VF+VFNP+LV +NL
Sbjct  1    MGFLQLLSVASFPVIKVLLITAVGLFLALDDISILAEDARKKVNQLVFYVFNPSLVGTNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+++TL+SV+ LWFMPFNIL+TF+LGSALGWIL K+TR P+ L+GLILG  +AGN+GNLP
Sbjct  61   AKTITLESVVQLWFMPFNILITFVLGSALGWILIKITRPPKQLEGLILGCCSAGNLGNLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPA+C + GSPFG +DVC+ YGM YASLSMAI
Sbjct  121  IIIIPAMCTQSGSPFGDSDVCYEYGMAYASLSMAI  155



>ref|XP_004509473.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Cicer arietinum]
 ref|XP_004509474.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X2 
[Cicer arietinum]
Length=392

 Score =   221 bits (562),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGF+ LL VAS+PV+KVL+I+ALG  LA D   +LG +AR  +NN+VF+VFNP+LV SNL
Sbjct  1    MGFIELLYVASLPVIKVLLITALGLFLAIDQVDVLGADARKRMNNLVFYVFNPSLVGSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++T ++VL LWFMP NIL TFILGSAL WI+ K+TR P+HL+GLILG  +AGN+GNLP
Sbjct  61   AETLTSENVLTLWFMPVNILSTFILGSALAWIVIKITRPPKHLQGLILGCCSAGNLGNLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPAIC EKGSPFG  D+CH YGM Y SLSMAI
Sbjct  121  IIIIPAICKEKGSPFGDPDLCHKYGMAYVSLSMAI  155



>ref|XP_006473865.1| PREDICTED: uncharacterized transporter YBR287W-like [Citrus sinensis]
Length=412

 Score =   221 bits (563),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MG L L   +S+PVLKVL+I+ALGS LA DH +ILGE+AR H+NN+VF+VFNPALV SNL
Sbjct  1    MGALDLFIASSIPVLKVLLITALGSYLALDHVNILGEDARKHINNLVFYVFNPALVASNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++T +S+L LWFMPFN+L+TF++GS LGWI+ + TR P H +GLI+G  AAGN+GN+P
Sbjct  61   ANTITYESMLKLWFMPFNVLITFLVGSILGWIVVQFTRPPSHFRGLIVGCCAAGNLGNMP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPA+C EKGSPFG+ D C TYG+ Y SLSMA+
Sbjct  121  LIIIPAVCKEKGSPFGSPDTCQTYGLAYVSLSMAV  155



>gb|KDO85258.1| hypothetical protein CISIN_1g015164mg [Citrus sinensis]
Length=412

 Score =   221 bits (563),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MG L L   +S+PVLKVL+I+ALGS LA DH +ILGE+AR H+NN+VF+VFNPALV SNL
Sbjct  1    MGALDLFIASSIPVLKVLLITALGSYLALDHVNILGEDARKHINNLVFYVFNPALVASNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++T +S+L LWFMPFN+L+TF++GS LGWI+ + TR P H +GLI+G  AAGN+GN+P
Sbjct  61   ANTITYESMLKLWFMPFNVLITFLVGSILGWIVVQFTRPPSHFRGLIVGCCAAGNLGNMP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPA+C EKGSPFG+ D C TYG+ Y SLSMA+
Sbjct  121  LIIIPAVCKEKGSPFGSPDTCQTYGLAYVSLSMAV  155



>gb|KHN41796.1| Putative transporter [Glycine soja]
Length=416

 Score =   221 bits (562),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MG + L  VASMPV+KVL+I+A+G LLA D+ ++LG++AR+ +N++V +VFNPALV  NL
Sbjct  1    MGLVELFGVASMPVIKVLIITAVGLLLALDNVNLLGKDARIQVNHLVHYVFNPALVGGNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++T ++V+LLWFMP NILLTFI+GSALGWIL KLTRAP+HL+GLILG  +AGN+GNLP
Sbjct  61   ADTITFENVVLLWFMPVNILLTFIIGSALGWILIKLTRAPKHLEGLILGVCSAGNLGNLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPAIC +KGSPFG ++VC+ YGM YASLSMA+
Sbjct  121  IIIIPAICKDKGSPFGDSNVCYQYGMAYASLSMAV  155



>ref|NP_001242102.1| uncharacterized protein LOC100791609 [Glycine max]
 gb|ACU17889.1| unknown [Glycine max]
Length=415

 Score =   221 bits (562),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MG + L  VASMPV+KVL+I+A+G LLA D+ ++LG++AR+ +N++V +VFNPALV  NL
Sbjct  1    MGLVELFGVASMPVIKVLIITAIGLLLALDNVNLLGKDARIQVNHLVHYVFNPALVGGNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++T ++V+LLWFMP NILLTFI+GSALGWIL KLTRAP+HL+GLILG  +AGN+GNLP
Sbjct  61   ADTITFENVVLLWFMPVNILLTFIIGSALGWILIKLTRAPKHLEGLILGVCSAGNLGNLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPAIC +KGSPFG ++VC+ YGM YASLSMA+
Sbjct  121  IIIIPAICKDKGSPFGDSNVCYQYGMAYASLSMAV  155



>gb|KDP24916.1| hypothetical protein JCGZ_24294 [Jatropha curcas]
Length=447

 Score =   221 bits (564),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 132/157 (84%), Gaps = 0/157 (0%)
 Frame = +3

Query  105  FGMGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFS  284
            F M  L+L  +ASMPVLKVL+I+ALGS LA ++ ++LGE AR  +N++VF+VFNPAL+ S
Sbjct  24   FIMQLLNLFVIASMPVLKVLLITALGSFLALEYVNVLGEEARKQINSVVFYVFNPALIGS  83

Query  285  NLARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGN  464
            NLA+++T +S+ LLWFMP NIL+TFI+GS LGW+L K+T  PQHL+GLILG  AAGN+GN
Sbjct  84   NLAKTITFESISLLWFMPVNILVTFIIGSILGWLLIKVTATPQHLRGLILGCCAAGNLGN  143

Query  465  LPVIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            LP+III AIC EKGSPFGA DVC+TYG+ YASLSMAI
Sbjct  144  LPLIIIAAICKEKGSPFGAPDVCYTYGIAYASLSMAI  180



>ref|XP_006590301.1| PREDICTED: uncharacterized protein LOC100791609 isoform X1 [Glycine 
max]
 ref|XP_006590302.1| PREDICTED: uncharacterized protein LOC100791609 isoform X2 [Glycine 
max]
Length=415

 Score =   220 bits (561),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MG + L  VASMPV+KVL+I+A+G LLA D+ ++LG++AR+ +N++V +VFNPALV  NL
Sbjct  1    MGLVELFGVASMPVIKVLIITAVGLLLALDNVNLLGKDARIQVNHLVHYVFNPALVGGNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++T ++V+LLWFMP NILLTFI+GSALGWIL KLTRAP+HL+GLILG  +AGN+GNLP
Sbjct  61   ADTITFENVVLLWFMPVNILLTFIIGSALGWILIKLTRAPKHLEGLILGVCSAGNLGNLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPAIC +KGSPFG ++VC+ YGM YASLSMA+
Sbjct  121  IIIIPAICKDKGSPFGDSNVCYQYGMAYASLSMAV  155



>gb|KHN28298.1| Putative transporter C5D6.04 [Glycine soja]
Length=416

 Score =   220 bits (560),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MG + L  VASMPV+KVL+I+A+G LLA D+ ++LG++AR+ +N++V +VFNPALV  NL
Sbjct  1    MGLVELFGVASMPVIKVLLITAVGLLLALDNVNLLGKDARIQVNHLVHYVFNPALVGGNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++T ++V+LLWFMP NILLTFI+GSALGWIL KLTRAP+HL+GLI+G  +AGN+GNLP
Sbjct  61   ADTITFENVVLLWFMPVNILLTFIIGSALGWILIKLTRAPKHLEGLIMGVCSAGNLGNLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPAIC +KGSPFG ++VC+ YGM YASLSMA+
Sbjct  121  IIIIPAICKDKGSPFGDSNVCYQYGMAYASLSMAV  155



>ref|XP_003517114.1| PREDICTED: uncharacterized protein LOC100785182 isoformX1 [Glycine 
max]
 ref|XP_006573505.1| PREDICTED: uncharacterized protein LOC100785182 isoform X2 [Glycine 
max]
 ref|XP_006573506.1| PREDICTED: uncharacterized protein LOC100785182 isoform X3 [Glycine 
max]
Length=415

 Score =   220 bits (560),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MG + L  VASMPV+KVL+I+A+G LLA D+ ++LG++AR+ +N++V +VFNPALV  NL
Sbjct  1    MGLVELFGVASMPVIKVLLITAVGLLLALDNVNLLGKDARIQVNHLVHYVFNPALVGGNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++T ++V+LLWFMP NILLTFI+GSALGWIL KLTRAP+HL+GLI+G  +AGN+GNLP
Sbjct  61   ADTITFENVVLLWFMPVNILLTFIIGSALGWILIKLTRAPKHLEGLIMGVCSAGNLGNLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPAIC +KGSPFG ++VC+ YGM YASLSMA+
Sbjct  121  IIIIPAICKDKGSPFGDSNVCYQYGMAYASLSMAV  155



>ref|XP_008787017.1| PREDICTED: uncharacterized transporter YBR287W-like [Phoenix 
dactylifera]
 ref|XP_008787018.1| PREDICTED: uncharacterized transporter YBR287W-like [Phoenix 
dactylifera]
Length=421

 Score =   220 bits (560),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGFL L   A++PV+ VL+++ +GS LA+ +  IL E+AR HLNN+VFFVFNPALV +NL
Sbjct  1    MGFLELFITATVPVMNVLLVTGVGSFLATSNVGILSEDARKHLNNVVFFVFNPALVSTNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            AR++T++S++LLWFMP NILLTFI+GS  GW++ ++TRAP +L+GLILG  AAGN+GN+ 
Sbjct  61   ARTITMESMVLLWFMPINILLTFIVGSLFGWLVIQITRAPTNLRGLILGCCAAGNLGNML  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PAIC EKGSPFGA+DVCHTYG+ YASLSMAI
Sbjct  121  LIIVPAICKEKGSPFGASDVCHTYGLAYASLSMAI  155



>ref|XP_008373348.1| PREDICTED: uncharacterized protein LOC103436679 [Malus domestica]
 ref|XP_008373349.1| PREDICTED: uncharacterized protein LOC103436679 [Malus domestica]
Length=182

 Score =   211 bits (538),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L   AS+PVLKVL+I+ALGS LA D   ILGE  R +LN +VF+VF+PALV SNL
Sbjct  1    MELLQLFVTASIPVLKVLLITALGSYLALDRVDILGEVTRKNLNTVVFYVFSPALVGSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+++T +S++ +WFMP NIL+TFI+GS LGWIL +LTR P HL+GL+LG  AAGN+GNL 
Sbjct  61   AKTITYESMVKMWFMPVNILITFIIGSVLGWILIQLTRPPAHLRGLVLGCCAAGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PA+C EKGSPFGA DVCHTY M YASLSMA+
Sbjct  121  LIIVPAVCKEKGSPFGAPDVCHTYAMAYASLSMAV  155



>ref|XP_003629048.1| Transporter, putative [Medicago truncatula]
Length=403

 Score =   218 bits (555),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGF+ LL VAS+PV+KVL+ISALG  LA D   +LG +AR  +NN+VF+VFNP+LV SNL
Sbjct  1    MGFMQLLYVASLPVMKVLLISALGLFLAIDQVDVLGADARKRVNNLVFYVFNPSLVGSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++T D+VL LWFMP N+L TFILGSAL WI+ K+TR P+HL+GLILG  +AGN+GNLP
Sbjct  61   AETLTSDNVLTLWFMPVNVLATFILGSALAWIVIKITRPPKHLEGLILGCCSAGNLGNLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPAIC EKGSPFG   +CH YGM Y SLSMAI
Sbjct  121  IIIIPAICKEKGSPFGDPVLCHKYGMAYVSLSMAI  155



>gb|AET03524.2| auxin efflux carrier family protein [Medicago truncatula]
Length=404

 Score =   218 bits (555),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGF+ LL VAS+PV+KVL+ISALG  LA D   +LG +AR  +NN+VF+VFNP+LV SNL
Sbjct  1    MGFMQLLYVASLPVMKVLLISALGLFLAIDQVDVLGADARKRVNNLVFYVFNPSLVGSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++T D+VL LWFMP N+L TFILGSAL WI+ K+TR P+HL+GLILG  +AGN+GNLP
Sbjct  61   AETLTSDNVLTLWFMPVNVLATFILGSALAWIVIKITRPPKHLEGLILGCCSAGNLGNLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPAIC EKGSPFG   +CH YGM Y SLSMAI
Sbjct  121  IIIIPAICKEKGSPFGDPVLCHKYGMAYVSLSMAI  155



>ref|XP_010266292.1| PREDICTED: uncharacterized transporter YBR287W-like [Nelumbo 
nucifera]
 ref|XP_010266293.1| PREDICTED: uncharacterized transporter YBR287W-like [Nelumbo 
nucifera]
 ref|XP_010266294.1| PREDICTED: uncharacterized transporter YBR287W-like [Nelumbo 
nucifera]
 ref|XP_010266295.1| PREDICTED: uncharacterized transporter YBR287W-like [Nelumbo 
nucifera]
 ref|XP_010266296.1| PREDICTED: uncharacterized transporter YBR287W-like [Nelumbo 
nucifera]
 ref|XP_010266297.1| PREDICTED: uncharacterized transporter YBR287W-like [Nelumbo 
nucifera]
Length=418

 Score =   216 bits (550),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L  VA++PVLKVL+++ +GS LA D   ILGE+AR HLN +VFFVFNPALV  NL
Sbjct  1    MELLDLFVVATIPVLKVLIVTGVGSFLAIDRIDILGEDARKHLNRVVFFVFNPALVAINL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            AR++T +S+++LWFMPFNILLTFI+GSALGW++ ++T+AP +L+GLILG  +AGN+GN+ 
Sbjct  61   ARTITFESMVMLWFMPFNILLTFIIGSALGWMVIQITKAPSNLRGLILGCCSAGNLGNML  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPA+C EKGSPFGA DVC+ YGM Y+SLSMAI
Sbjct  121  LIIIPAVCREKGSPFGANDVCYKYGMAYSSLSMAI  155



>ref|XP_008237902.1| PREDICTED: uncharacterized transporter YBR287W-like [Prunus mume]
 ref|XP_008237903.1| PREDICTED: uncharacterized transporter YBR287W-like [Prunus mume]
Length=413

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L   AS+PVLKVL+I+ALGS LA D  +ILGE+ R HLN +VF+V NPALV SNL
Sbjct  1    MEVLQLFITASIPVLKVLLITALGSYLALDSVNILGEDTRKHLNTVVFYVLNPALVSSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            AR++T +S++ LWFMP NIL+TFI+GS LGWIL  LTR P HL+GL+LG  AAGN+GNL 
Sbjct  61   ARTITYESIVKLWFMPVNILITFIVGSILGWILLLLTRPPAHLRGLVLGCCAAGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PA+C EKGSPFGA DVC TYG+ YASLSMAI
Sbjct  121  LIIVPAVCKEKGSPFGAPDVCRTYGLAYASLSMAI  155



>ref|XP_006342188.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Solanum tuberosum]
 ref|XP_006342189.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X2 
[Solanum tuberosum]
Length=407

 Score =   215 bits (548),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MG L L   ASMPVLKVL+I+ALG +LA D   +LG++AR HLNN+VFFV NPALV SNL
Sbjct  1    MGLLDLFITASMPVLKVLLITALGLILALDRIDLLGQDARKHLNNIVFFVLNPALVSSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+++T +S+  LWFMPFNIL TFI+GS LGW + ++TR PQHL+GL++G  AAGN+GN+ 
Sbjct  61   AKTITYESLKKLWFMPFNILFTFIVGSILGWAVLQITRPPQHLRGLVVGCCAAGNLGNML  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPA+C EKGSPFG   VCHTYGM YASLSMA+
Sbjct  121  LIIIPAVCKEKGSPFGDPGVCHTYGMSYASLSMAV  155



>ref|XP_007018644.1| Auxin efflux carrier family protein, putative [Theobroma cacao]
 gb|EOY15869.1| Auxin efflux carrier family protein, putative [Theobroma cacao]
Length=436

 Score =   216 bits (550),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L   A++PVLKVL+I+ALG  LA DH +ILGE+ R H+NN+VF+VFNPALV SNL
Sbjct  19   MVLLDLFIAATIPVLKVLLITALGLYLALDHVNILGEDTRKHMNNVVFYVFNPALVASNL  78

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++T +S++ LWFMPFN+LLTF++GS LGWI+ + TR P HL+GLILG  AAGNMGN+ 
Sbjct  79   AETITYESMVKLWFMPFNVLLTFVIGSILGWIVIQFTRPPSHLRGLILGCCAAGNMGNML  138

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPA+C EKGSPFG+ +VCH+YGM Y SLSMAI
Sbjct  139  LIIIPAVCKEKGSPFGSPEVCHSYGMGYVSLSMAI  173



>ref|XP_009592191.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Nicotiana tomentosiformis]
 ref|XP_009592265.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Nicotiana tomentosiformis]
 ref|XP_009592327.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Nicotiana tomentosiformis]
Length=418

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MG L L   ASMPVLKVL+I+ALG +LA D   +LGE+AR HLNN+VFFVFNPALV SNL
Sbjct  1    MGLLDLFIAASMPVLKVLLITALGLVLALDRIDLLGEDARKHLNNIVFFVFNPALVSSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+++T +S+  LWFMP NIL TFI+GS LGW + ++TR PQHL+GL++G  AAGN+GN+ 
Sbjct  61   AKTITSESMKKLWFMPLNILFTFIIGSILGWAVIQITRPPQHLRGLVVGCCAAGNLGNML  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPA+C EKGSPFG   VCHTYGM YASLSMA+
Sbjct  121  LIIIPAVCKEKGSPFGDPGVCHTYGMGYASLSMAV  155



>ref|XP_004238466.1| PREDICTED: uncharacterized transporter YBR287W-like [Solanum 
lycopersicum]
 ref|XP_010320486.1| PREDICTED: uncharacterized transporter YBR287W-like [Solanum 
lycopersicum]
 ref|XP_010320487.1| PREDICTED: uncharacterized transporter YBR287W-like [Solanum 
lycopersicum]
Length=407

 Score =   215 bits (547),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MG L L   ASMPVLKVL+I+ALG +LA D   +LG++AR HLNN+VFFV NPALV SNL
Sbjct  1    MGLLDLFITASMPVLKVLLITALGLILALDRIDLLGQDARKHLNNIVFFVLNPALVSSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A++VT +S+  LWFMPFNIL TF+ GS LGW + ++TR PQHL+GL++G  AAGN+GN+ 
Sbjct  61   AKTVTYESLKKLWFMPFNILFTFVAGSILGWAVLQVTRPPQHLRGLVVGCCAAGNLGNML  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPA+C EKGSPFG   VCHTYGM YASLSMA+
Sbjct  121  LIIIPAVCKEKGSPFGDPGVCHTYGMSYASLSMAV  155



>gb|KDP24915.1| hypothetical protein JCGZ_24293 [Jatropha curcas]
Length=334

 Score =   213 bits (541),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MG L L   A MPVLKVL+I+ALGS LA+D   +LG +AR HLNN+VFF+FNPALV SNL
Sbjct  1    MGLLDLFTAALMPVLKVLLITALGSFLATDRLGVLGVDARKHLNNVVFFIFNPALVGSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A  +TL S+  LWFMPFNIL+TFI+GS LGW+L + TRAP  L+GL+LG  +AGN+GN+P
Sbjct  61   ATYITLKSMETLWFMPFNILITFIVGSILGWLLIRSTRAPHDLRGLVLGCCSAGNLGNMP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPA+C E+GSPFG  DVC+ +G+ YASLSMAI
Sbjct  121  LIIIPAVCKERGSPFGDVDVCYKHGLAYASLSMAI  155



>ref|XP_010270583.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X2 
[Nelumbo nucifera]
Length=385

 Score =   214 bits (545),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MG L L   ASMPVLKVL+++ +GSLLA D   ILGE+AR HLN +V+FVF PALV S L
Sbjct  1    MGLLDLFITASMPVLKVLLVTLIGSLLALDQIDILGEDARKHLNQIVYFVFTPALVGSYL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+++TL+ + +LWFMP NIL+T+I+GS LGWI+ ++TR P HLKGLILG  +AGNMGN+ 
Sbjct  61   AKTITLERMAMLWFMPVNILITYIIGSILGWIVIRITRPPSHLKGLILGCCSAGNMGNMF  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +I IPA+C EKG+PFGA ++CHTYG+ YASLSMAI
Sbjct  121  IIFIPAVCKEKGNPFGAHEICHTYGLAYASLSMAI  155



>ref|XP_007209188.1| hypothetical protein PRUPE_ppa006413mg [Prunus persica]
 gb|EMJ10387.1| hypothetical protein PRUPE_ppa006413mg [Prunus persica]
Length=413

 Score =   215 bits (547),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L   AS+PVLKVL+I+ALGS LA D  +ILGE++R HLN +VF+V NPALV SNL
Sbjct  1    MEVLQLFITASIPVLKVLLITALGSYLALDSVNILGEDSRKHLNTVVFYVLNPALVSSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            AR++T +S++ LWFMP NIL+TFI+GS LGWIL  LTR P HL+GL+LG  AAGN+GNL 
Sbjct  61   ARTITYESMVKLWFMPVNILITFIVGSILGWILLLLTRPPAHLRGLVLGCCAAGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PA+C EKGSPFGA DVC TYG+ YASLSMAI
Sbjct  121  LIIVPAVCKEKGSPFGAPDVCRTYGLAYASLSMAI  155



>ref|XP_008373350.1| PREDICTED: uncharacterized transporter YBR287W-like [Malus domestica]
 ref|XP_008373351.1| PREDICTED: uncharacterized transporter YBR287W-like [Malus domestica]
Length=414

 Score =   215 bits (547),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 123/155 (79%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L   AS+PVLKVL+I+ALGS LA D   ILGE  R ++N +VF+VFNPALV SNL
Sbjct  1    MELLQLFVTASIPVLKVLLITALGSYLALDRVDILGEVTRKNVNTVVFYVFNPALVGSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            AR++T  S+  LWFMP NIL+TFI+GS LGWIL +LTR P HL+GL+LG  AAGN+GNL 
Sbjct  61   ARTITYQSMAKLWFMPVNILITFIIGSVLGWILIQLTRPPAHLRGLVLGCCAAGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PA+C EKGSPFGA DVCHTY M YASLSMAI
Sbjct  121  LIIVPAVCKEKGSPFGAPDVCHTYAMAYASLSMAI  155



>ref|XP_009798616.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Nicotiana sylvestris]
 ref|XP_009798617.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Nicotiana sylvestris]
 ref|XP_009798618.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Nicotiana sylvestris]
Length=418

 Score =   215 bits (547),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MG L L   ASMPVLKVL+I+ALG +LA D   +LGE+AR HLNN+VFFVFNPALV SNL
Sbjct  1    MGLLDLFIAASMPVLKVLLITALGLVLALDRIDLLGEDARKHLNNIVFFVFNPALVSSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+++T +S+  LWFMP NIL TFI+GS LGW + ++TR PQHL+GL++G  AAGN+GN+ 
Sbjct  61   AKTITSESMKKLWFMPINILFTFIIGSILGWAVIQITRPPQHLRGLVVGCCAAGNLGNML  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPA+C EKGSPFG   +CHTYGM YASLSMA+
Sbjct  121  LIIIPAVCKEKGSPFGDPGICHTYGMGYASLSMAV  155



>ref|XP_010270584.1| PREDICTED: uncharacterized protein LOC104606871 isoform X3 [Nelumbo 
nucifera]
Length=380

 Score =   213 bits (543),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MG L L   ASMPVLKVL+++ +GSLLA D   ILGE+AR HLN +V+FVF PALV S L
Sbjct  1    MGLLDLFITASMPVLKVLLVTLIGSLLALDQIDILGEDARKHLNQIVYFVFTPALVGSYL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+++TL+ + +LWFMP NIL+T+I+GS LGWI+ ++TR P HLKGLILG  +AGNMGN+ 
Sbjct  61   AKTITLERMAMLWFMPVNILITYIIGSILGWIVIRITRPPSHLKGLILGCCSAGNMGNMF  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +I IPA+C EKG+PFGA ++CHTYG+ YASLSMAI
Sbjct  121  IIFIPAVCKEKGNPFGAHEICHTYGLAYASLSMAI  155



>ref|XP_010932122.1| PREDICTED: uncharacterized transporter YBR287W-like [Elaeis guineensis]
Length=418

 Score =   214 bits (545),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGFL L   A++PV+ VL+++A+GS LA+ +  IL E AR HLNN+VFFVFNPALV +NL
Sbjct  1    MGFLELFITATVPVMNVLLVTAVGSFLATSYVGILSEAARKHLNNVVFFVFNPALVSTNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+++T++S++LLWFMP NILLTFI+GS  GW++ ++TRAP +L+GLILG  AAGN+GN+ 
Sbjct  61   AQTITMESMVLLWFMPINILLTFIIGSLFGWLVIQITRAPTNLRGLILGCCAAGNLGNML  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PAIC EKGSPFGA  VCHTYG+ YASLSMAI
Sbjct  121  LIIVPAICKEKGSPFGAPVVCHTYGLAYASLSMAI  155



>ref|XP_003612433.1| Auxin efflux carrier protein [Medicago truncatula]
 gb|KEH27641.1| auxin efflux carrier family protein [Medicago truncatula]
Length=264

 Score =   209 bits (533),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGFL L  VAS PV+KVL+++ +G LLA D+ ++LG++AR   N++V +VFNP L+  NL
Sbjct  1    MGFLELFSVASFPVIKVLLVTGIGLLLALDNINLLGKDARNQTNHLVHYVFNPGLIGGNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+++TLD+V+ LWFMP NIL+TF+LGSALGWI+ KLT+ P+H++GLI+G  +AGN+GNLP
Sbjct  61   AQTITLDNVVSLWFMPVNILVTFLLGSALGWIIIKLTKPPRHIEGLIVGVCSAGNLGNLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPAIC +KGSPFG  DVC+ +GM YASLSMAI
Sbjct  121  IIIIPAICKDKGSPFGDPDVCYQFGMAYASLSMAI  155



>ref|XP_010270585.1| PREDICTED: uncharacterized protein LOC104606871 isoform X4 [Nelumbo 
nucifera]
Length=369

 Score =   213 bits (542),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MG L L   ASMPVLKVL+++ +GSLLA D   ILGE+AR HLN +V+FVF PALV S L
Sbjct  1    MGLLDLFITASMPVLKVLLVTLIGSLLALDQIDILGEDARKHLNQIVYFVFTPALVGSYL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+++TL+ + +LWFMP NIL+T+I+GS LGWI+ ++TR P HLKGLILG  +AGNMGN+ 
Sbjct  61   AKTITLERMAMLWFMPVNILITYIIGSILGWIVIRITRPPSHLKGLILGCCSAGNMGNMF  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +I IPA+C EKG+PFGA ++CHTYG+ YASLSMAI
Sbjct  121  IIFIPAVCKEKGNPFGAHEICHTYGLAYASLSMAI  155



>ref|XP_009372647.1| PREDICTED: uncharacterized transporter YBR287W-like [Pyrus x 
bretschneideri]
 ref|XP_009372648.1| PREDICTED: uncharacterized transporter YBR287W-like [Pyrus x 
bretschneideri]
Length=414

 Score =   214 bits (545),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L   AS+PVLKVL+I+ALGS LA D   ILGE  R +LN +VF+VF+PALV SNL
Sbjct  1    MELLQLFVTASIPVLKVLLITALGSYLALDRVDILGEVTRKNLNTVVFYVFSPALVGSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+++T +S++ +WFMP NIL+TFI+GS LGWIL +LTR P HL+GL+LG  AAGN+GNL 
Sbjct  61   AKTITYESMVKMWFMPVNILITFIIGSVLGWILIQLTRPPAHLRGLVLGCCAAGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PA+C EKGSPFGA DVCHTY M YASLSMAI
Sbjct  121  LIIVPAVCKEKGSPFGAPDVCHTYAMAYASLSMAI  155



>ref|XP_003612432.1| Auxin efflux carrier protein [Medicago truncatula]
 gb|KEH27640.1| auxin efflux carrier family protein [Medicago truncatula]
Length=275

 Score =   209 bits (533),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGFL L  VAS PV+KVL+++ +G LLA D+ ++LG++AR   N++V +VFNP L+  NL
Sbjct  1    MGFLELFSVASFPVIKVLLVTGIGLLLALDNINLLGKDARNQTNHLVHYVFNPGLIGGNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+++TLD+V+ LWFMP NIL+TF+LGSALGWI+ KLT+ P+H++GLI+G  +AGN+GNLP
Sbjct  61   AQTITLDNVVSLWFMPVNILVTFLLGSALGWIIIKLTKPPRHIEGLIVGVCSAGNLGNLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPAIC +KGSPFG  DVC+ +GM YASLSMAI
Sbjct  121  IIIIPAICKDKGSPFGDPDVCYQFGMAYASLSMAI  155



>ref|XP_010270580.1| PREDICTED: uncharacterized transporter C5D6.04-like isoform X1 
[Nelumbo nucifera]
 ref|XP_010270581.1| PREDICTED: uncharacterized transporter C5D6.04-like isoform X1 
[Nelumbo nucifera]
Length=416

 Score =   214 bits (544),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MG L L   ASMPVLKVL+++ +GSLLA D   ILGE+AR HLN +V+FVF PALV S L
Sbjct  1    MGLLDLFITASMPVLKVLLVTLIGSLLALDQIDILGEDARKHLNQIVYFVFTPALVGSYL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+++TL+ + +LWFMP NIL+T+I+GS LGWI+ ++TR P HLKGLILG  +AGNMGN+ 
Sbjct  61   AKTITLERMAMLWFMPVNILITYIIGSILGWIVIRITRPPSHLKGLILGCCSAGNMGNMF  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +I IPA+C EKG+PFGA ++CHTYG+ YASLSMAI
Sbjct  121  IIFIPAVCKEKGNPFGAHEICHTYGLAYASLSMAI  155



>ref|XP_008373331.1| PREDICTED: uncharacterized transporter YBR287W-like [Malus domestica]
Length=414

 Score =   214 bits (544),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L   AS+PVLKVL+I+ALGS LA D   ILGE  R +LN +VF+VF+PALV SNL
Sbjct  1    MELLQLFVTASIPVLKVLLITALGSYLALDRVDILGEVTRKNLNTVVFYVFSPALVGSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+++T +S++ +WFMP NIL+TFI+GS LGWIL +LTR P HL+GL+LG  AAGN+GNL 
Sbjct  61   AKTITYESMVKMWFMPVNILITFIIGSVLGWILIQLTRPPAHLRGLVLGCCAAGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PA+C EKGSPFGA DVCHTY M YASLSMAI
Sbjct  121  LIIVPAVCKEKGSPFGAPDVCHTYAMAYASLSMAI  155



>emb|CDP01744.1| unnamed protein product [Coffea canephora]
Length=413

 Score =   213 bits (543),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MG L L  VAS+PV+KVL+I ALGS LA DH  ILG++AR  LNNMVFFVFNPALV SNL
Sbjct  1    MGLLDLSLVASIPVVKVLLICALGSFLALDHIDILGDSARKELNNMVFFVFNPALVSSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+++T ++++ LWFMP NILLT+I+GS LGW + K+T++PQHLKGL++G  AAGN+G+LP
Sbjct  61   AQTITSENIISLWFMPLNILLTYIVGSFLGWEINKITKSPQHLKGLVMGLCAAGNLGSLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
             +++PAIC EKGSPFGA + CH Y M Y SLSMAI
Sbjct  121  FVLVPAICREKGSPFGAPESCHKYAMAYVSLSMAI  155



>ref|XP_006599266.1| PREDICTED: uncharacterized protein LOC100817605 isoform X1 [Glycine 
max]
 ref|XP_006599267.1| PREDICTED: uncharacterized protein LOC100817605 isoform X2 [Glycine 
max]
 ref|XP_006599268.1| PREDICTED: uncharacterized protein LOC100817605 isoform X3 [Glycine 
max]
 ref|XP_006599269.1| PREDICTED: uncharacterized protein LOC100817605 isoform X4 [Glycine 
max]
 gb|KHN39763.1| Putative transporter C5D6.04 [Glycine soja]
Length=414

 Score =   213 bits (543),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/155 (63%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGF+ LL VAS PV+KVL+++A+G  LA D   ILGE++R  +N +VF+VFNP+LV SNL
Sbjct  1    MGFIQLLSVASFPVIKVLLVTAIGLFLALDDISILGEDSRKKVNQLVFYVFNPSLVGSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+++T +S++ LWFMP NIL TFILGSALGWIL K+TR P+H++GLILG  +AGN+GNL 
Sbjct  61   AKTITFESIVQLWFMPLNILCTFILGSALGWILIKMTRPPKHMEGLILGCCSAGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            ++IIPAIC E G+PFG +DVC+ YGM YA+LSMAI
Sbjct  121  IVIIPAICKESGNPFGDSDVCYQYGMAYAALSMAI  155



>ref|XP_008364468.1| PREDICTED: uncharacterized transporter YBR287W-like [Malus domestica]
Length=414

 Score =   213 bits (542),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L   AS+PVLKVL+I+ALGS LA D   ILGE  R +LN +VF+VF+PALV SNL
Sbjct  1    MELLQLFVTASIPVLKVLLITALGSYLALDRVDILGEVTRKNLNTVVFYVFSPALVGSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+++T +S++ +WFMP NIL+TFI+GS LGWIL +LTR P HL+GL+LG  AAGN+GNL 
Sbjct  61   AKTITYESMVKMWFMPVNILITFIIGSVLGWILIQLTRPPAHLRGLVLGCCAAGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PA+C EKGSPFGA DVCHTY M YASLSMAI
Sbjct  121  LIIVPAVCKEKGSPFGAPDVCHTYAMAYASLSMAI  155



>ref|XP_009390658.1| PREDICTED: uncharacterized transporter YBR287W-like [Musa acuminata 
subsp. malaccensis]
Length=421

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/155 (63%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MG L L   AS+PVLKVL+++ +GS LA+    IL   AR HLNN+VF+VFNPALV +NL
Sbjct  1    MGLLKLFVTASVPVLKVLLVTGVGSFLATGQVGILCHEARKHLNNVVFYVFNPALVSTNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            +R++T++S++LLWFMP NILLTFI+G A GW++ ++T AP HLKGL+LG  AAGN+GN+ 
Sbjct  61   SRTITMESLVLLWFMPINILLTFIIGFAFGWVVIQITNAPSHLKGLVLGCCAAGNLGNML  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PAIC E+GSPFGA+DVC TYG+ YASLSMAI
Sbjct  121  LIIVPAICKERGSPFGASDVCTTYGLAYASLSMAI  155



>gb|KEH27638.1| auxin efflux carrier family protein [Medicago truncatula]
Length=319

 Score =   209 bits (533),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGFL L  VAS PV+KVL+++ +G LLA D+ ++LG++AR   N++V +VFNP L+  NL
Sbjct  1    MGFLELFSVASFPVIKVLLVTGIGLLLALDNINLLGKDARNQTNHLVHYVFNPGLIGGNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+++TLD+V+ LWFMP NIL+TF+LGSALGWI+ KLT+ P+H++GLI+G  +AGN+GNLP
Sbjct  61   AQTITLDNVVSLWFMPVNILVTFLLGSALGWIIIKLTKPPRHIEGLIVGVCSAGNLGNLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPAIC +KGSPFG  DVC+ +GM YASLSMAI
Sbjct  121  IIIIPAICKDKGSPFGDPDVCYQFGMAYASLSMAI  155



>ref|XP_007211270.1| hypothetical protein PRUPE_ppa017924mg [Prunus persica]
 gb|EMJ12469.1| hypothetical protein PRUPE_ppa017924mg [Prunus persica]
Length=423

 Score =   212 bits (540),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L   AS+PVLKVL+I+ALGS LA D  +ILGE+ R HLN +VF+V +PALV SNL
Sbjct  1    MEVLQLFITASIPVLKVLLITALGSYLALDSVNILGEDTRKHLNTVVFYVLSPALVSSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            AR++T +S++ LWFMP NIL+TFI+GS LGWIL  LTR P HL+GL+LG  AAGN+GNL 
Sbjct  61   ARTITYESMVKLWFMPVNILITFIVGSILGWILLLLTRPPAHLRGLVLGCCAAGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PA+C EKGSPFGA DVC TYG+ YASLSMAI
Sbjct  121  LIIVPAVCKEKGSPFGAPDVCRTYGLAYASLSMAI  155



>ref|XP_011100009.1| PREDICTED: uncharacterized protein LOC105178246 isoform X3 [Sesamum 
indicum]
Length=349

 Score =   210 bits (534),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 97/155 (63%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L + +S+PVLKVL+++ LGS LA D   ILG++AR HLNN+VFFVF+PALV SNL
Sbjct  1    MSLLDLFRASSIPVLKVLLVTGLGSYLARDRIDILGDDARKHLNNIVFFVFSPALVSSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+++T DS++ LWFMP NILLTFI+G+ LGW + ++TR P HL+GL++G  AAGN+GNL 
Sbjct  61   AKTITYDSMVKLWFMPINILLTFIIGTILGWGVIQITRTPFHLRGLVIGCCAAGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPA+C E+ SPFG ADVC+ +GM YASLSMAI
Sbjct  121  LIIIPAVCKERASPFGNADVCYEHGMAYASLSMAI  155



>ref|XP_011465005.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Fragaria vesca subsp. vesca]
Length=381

 Score =   211 bits (536),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L   AS+PVLK L+I+ALGS LA++  +ILGE+ R HLN++ FFVFNPALV S+L
Sbjct  3    MKLLQLFITASIPVLKTLLITALGSYLATERVNILGEDTRKHLNSVAFFVFNPALVGSSL  62

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++T DS++ LWFMP NILLTF++GS  GWIL  LTR P HL+GLI+G  AAGN+GNL 
Sbjct  63   AETITYDSMIKLWFMPVNILLTFVVGSIFGWILNLLTRTPPHLRGLIMGFCAAGNLGNLL  122

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPA+C EKGSPFGAADVC+T GM YASLSMAI
Sbjct  123  LIIIPAVCKEKGSPFGAADVCYTSGMAYASLSMAI  157



>ref|XP_010033618.1| PREDICTED: uncharacterized transporter C5D6.04-like [Eucalyptus 
grandis]
 gb|KCW53316.1| hypothetical protein EUGRSUZ_J02569 [Eucalyptus grandis]
Length=418

 Score =   212 bits (539),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGFL LL +ASMPVLK L+++ALG  LA +   ++GE+AR  LN + +FVF+PALV S L
Sbjct  1    MGFLDLLMIASMPVLKTLLVTALGLYLALESVDVMGESARKQLNRVGYFVFSPALVGSTL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            AR+VT +++  LWFMP NIL+TFI+GSALGWIL K TRAP H+KGLILG  AAGN+G+LP
Sbjct  61   ARTVTSENIAQLWFMPVNILITFIIGSALGWILVKFTRAPHHVKGLILGCCAAGNLGHLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPA+C E+GSPFG  DVC  YGM YAS++MA+
Sbjct  121  LIIIPALCKEQGSPFGVPDVCQKYGMAYASITMAV  155



>ref|XP_009372645.1| PREDICTED: uncharacterized transporter YBR287W-like [Pyrus x 
bretschneideri]
 ref|XP_009372646.1| PREDICTED: uncharacterized transporter YBR287W-like [Pyrus x 
bretschneideri]
Length=414

 Score =   211 bits (538),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 122/154 (79%), Gaps = 0/154 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L   AS+PVLKVL+I+ALGS LA D   +LGE  R ++N +VF+VFNPALV SNL
Sbjct  1    MELLQLFVTASIPVLKVLLITALGSYLALDRVDVLGEVTRKNVNTVVFYVFNPALVGSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            AR++T  S++ LWFMP NIL+TFI+GS LGWIL +LTR P  L+GL+LG  AAGN+GNL 
Sbjct  61   ARTITYQSMVKLWFMPVNILITFIIGSVLGWILLQLTRPPARLRGLVLGCCAAGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMA  572
            +II+PA+C EKGSPFGA DVCHTY M YASLSMA
Sbjct  121  LIIVPAVCKEKGSPFGAPDVCHTYAMAYASLSMA  154



>gb|EPS71464.1| hypothetical protein M569_03295, partial [Genlisea aurea]
Length=225

 Score =   206 bits (523),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MG + L   +S+PVLK+L+++ALGS LA DH +ILG++AR H NN+ FFVF+PALV+SNL
Sbjct  1    MGLMDLFITSSIPVLKLLLLTALGSYLALDHVNILGDDARKHWNNVTFFVFSPALVYSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            AR+VT DS++ LWFMPFNIL TFI+GS  GW++  +TRAP HL+GL++GS AAGN+GNL 
Sbjct  61   ARTVTYDSMVKLWFMPFNILCTFIIGSIFGWMIIHVTRAPPHLRGLVIGSCAAGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            VIIIPA+C E+GSPFG  +VCHT GM YASLSMAI
Sbjct  121  VIIIPAVCKERGSPFGNPEVCHTLGMAYASLSMAI  155



>gb|AES95391.2| auxin efflux carrier family protein [Medicago truncatula]
Length=329

 Score =   209 bits (531),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGFL L  VAS PV+KVL+++ +G LLA D+ ++LG++AR   N++V +VFNP L+  NL
Sbjct  1    MGFLELFSVASFPVIKVLLVTGIGLLLALDNINLLGKDARNQTNHLVHYVFNPGLIGGNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+++TLD+V+ LWFMP NIL+TF+LGSALGWI+ KLT+ P+H++GLI+G  +AGN+GNLP
Sbjct  61   AQTITLDNVVSLWFMPVNILVTFLLGSALGWIIIKLTKPPRHIEGLIVGVCSAGNLGNLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPAIC +KGSPFG  DVC+ +GM YASLSMAI
Sbjct  121  IIIIPAICKDKGSPFGDPDVCYQFGMAYASLSMAI  155



>ref|XP_006465068.1| PREDICTED: uncharacterized protein LOC102630978 [Citrus sinensis]
Length=218

 Score =   204 bits (520),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 124/154 (81%), Gaps = 0/154 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M    L  VASMPVLK L+++ LGS LA D   ++GENAR  LN++VFFVF+PA+V SNL
Sbjct  1    MQISDLFFVASMPVLKTLLLTTLGSFLALDRVGVMGENARKQLNSVVFFVFSPAIVGSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+++TL+S++L+WFMP NIL TFI+GS L WIL K+TRAP+HLKGL+LG  AAGN+GNLP
Sbjct  61   AKTITLESIVLMWFMPINILCTFIIGSVLAWILIKVTRAPRHLKGLVLGCCAAGNLGNLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMA  572
            +IIIPAIC EK SPFG  ++CH YGM Y SLSMA
Sbjct  121  LIIIPAICREKNSPFGDPEICHKYGMTYVSLSMA  154



>gb|AES95390.2| auxin efflux carrier family protein [Medicago truncatula]
Length=379

 Score =   209 bits (533),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGFL L  VAS PV+KVL+++ +G LLA D+ ++LG++AR   N++V +VFNP L+  NL
Sbjct  1    MGFLELFSVASFPVIKVLLVTGIGLLLALDNINLLGKDARNQTNHLVHYVFNPGLIGGNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+++TLD+V+ LWFMP NIL+TF+LGSALGWI+ KLT+ P+H++GLI+G  +AGN+GNLP
Sbjct  61   AQTITLDNVVSLWFMPVNILVTFLLGSALGWIIIKLTKPPRHIEGLIVGVCSAGNLGNLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPAIC +KGSPFG  DVC+ +GM YASLSMAI
Sbjct  121  IIIIPAICKDKGSPFGDPDVCYQFGMAYASLSMAI  155



>ref|XP_004300092.1| PREDICTED: uncharacterized transporter YBR287W-like [Fragaria 
vesca subsp. vesca]
Length=413

 Score =   210 bits (535),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 124/154 (81%), Gaps = 0/154 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L   AS+PVLKVL I+ALGS LA +  +ILGE  R +LN +VF+VF+PALV +NL
Sbjct  1    MAVLQLFITASIPVLKVLFITALGSYLALERINILGEETRKNLNTVVFYVFSPALVGTNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+++T DS++ LWFMP NIL+TF++GS LGWIL +L R P HL+GLILG  AAGN+GNL 
Sbjct  61   AQTITYDSMIKLWFMPVNILVTFLVGSLLGWILIQLARPPPHLRGLILGCCAAGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMA  572
            +IIIPA+C EKGSPFGA DVCHTYGM YASLSMA
Sbjct  121  LIIIPAVCKEKGSPFGAPDVCHTYGMAYASLSMA  154



>ref|XP_003534224.1| PREDICTED: uncharacterized protein LOC100810166 isoform X1 [Glycine 
max]
Length=414

 Score =   209 bits (533),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGF+ L  VAS PV+KVL+I+ALG  LA D+  ILGE+AR  +N +VF+VFNP+LV SNL
Sbjct  1    MGFIKLFSVASFPVIKVLLITALGLFLALDNISILGEDARKKVNQLVFYVFNPSLVGSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+++T +SV+ LWFMP NIL TFILGSALGWIL K+TR P+ ++GLILG  +AGN+GNLP
Sbjct  61   AKTITFESVVKLWFMPVNILGTFILGSALGWILIKMTRPPKRMEGLILGCCSAGNLGNLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +III AIC ++GSPFG  D+C+ YGM YA+LSMAI
Sbjct  121  MIIIAAICKQEGSPFGEPDLCNQYGMAYAALSMAI  155



>ref|XP_011100000.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X2 
[Sesamum indicum]
Length=416

 Score =   210 bits (534),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 97/155 (63%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L + +S+PVLKVL+++ LGS LA D   ILG++AR HLNN+VFFVF+PALV SNL
Sbjct  1    MSLLDLFRASSIPVLKVLLVTGLGSYLARDRIDILGDDARKHLNNIVFFVFSPALVSSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+++T DS++ LWFMP NILLTFI+G+ LGW + ++TR P HL+GL++G  AAGN+GNL 
Sbjct  61   AKTITYDSMVKLWFMPINILLTFIIGTILGWGVIQITRTPFHLRGLVIGCCAAGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPA+C E+ SPFG ADVC+ +GM YASLSMAI
Sbjct  121  LIIIPAVCKERASPFGNADVCYEHGMAYASLSMAI  155



>ref|XP_011099988.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Sesamum indicum]
Length=417

 Score =   209 bits (533),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 97/155 (63%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L + +S+PVLKVL+++ LGS LA D   ILG++AR HLNN+VFFVF+PALV SNL
Sbjct  1    MSLLDLFRASSIPVLKVLLVTGLGSYLARDRIDILGDDARKHLNNIVFFVFSPALVSSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+++T DS++ LWFMP NILLTFI+G+ LGW + ++TR P HL+GL++G  AAGN+GNL 
Sbjct  61   AKTITYDSMVKLWFMPINILLTFIIGTILGWGVIQITRTPFHLRGLVIGCCAAGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPA+C E+ SPFG ADVC+ +GM YASLSMAI
Sbjct  121  LIIIPAVCKERASPFGNADVCYEHGMAYASLSMAI  155



>ref|XP_002301894.1| auxin efflux carrier family protein [Populus trichocarpa]
 gb|EEE81167.1| auxin efflux carrier family protein [Populus trichocarpa]
Length=407

 Score =   209 bits (532),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 97/155 (63%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MG L LL  +S+PVLKVL+I+A+GS LA DH  +LGE+AR H+NN+VF+VFNPALV SNL
Sbjct  1    MGLLDLLIASSIPVLKVLLITAIGSYLALDHVDVLGEDARKHVNNVVFYVFNPALVSSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++T DS+  +WFMPFNIL+TF++ S LGW + + TR P HL GLI+G  AAGN+GN+ 
Sbjct  61   AETITYDSMKKMWFMPFNILITFVISSLLGWFVVQFTRPPSHLHGLIVGCCAAGNLGNMF  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +I+IPAIC EKGSPFG+ D+C T+G+ Y SLSMAI
Sbjct  121  LIMIPAICKEKGSPFGSPDICETFGLGYVSLSMAI  155



>ref|XP_003612431.1| Auxin efflux carrier protein [Medicago truncatula]
 gb|AES95389.1| auxin efflux carrier family protein [Medicago truncatula]
Length=417

 Score =   209 bits (532),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGFL L  VAS PV+KVL+++ +G LLA D+ ++LG++AR   N++V +VFNP L+  NL
Sbjct  1    MGFLELFSVASFPVIKVLLVTGIGLLLALDNINLLGKDARNQTNHLVHYVFNPGLIGGNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+++TLD+V+ LWFMP NIL+TF+LGSALGWI+ KLT+ P+H++GLI+G  +AGN+GNLP
Sbjct  61   AQTITLDNVVSLWFMPVNILVTFLLGSALGWIIIKLTKPPRHIEGLIVGVCSAGNLGNLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPAIC +KGSPFG  DVC+ +GM YASLSMAI
Sbjct  121  IIIIPAICKDKGSPFGDPDVCYQFGMAYASLSMAI  155



>ref|XP_004253114.1| PREDICTED: uncharacterized transporter C5D6.04-like [Solanum 
lycopersicum]
 ref|XP_010314834.1| PREDICTED: uncharacterized transporter C5D6.04-like [Solanum 
lycopersicum]
Length=419

 Score =   209 bits (532),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MG L LL  ASMPV+++L+I+ALG +LA D   ILGE+AR HLNN+VF++ NP+L+ SNL
Sbjct  1    MGLLDLLVAASMPVIQILLITALGLVLALDRFAILGEDARKHLNNIVFYICNPSLISSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            ++++T +S+  LWFMP NI +TFI+GS L WI+ ++TR P+HL+GL++G  AAGNMGN+ 
Sbjct  61   SKTITYESMKRLWFMPLNIFVTFIVGSILAWIVNQITRPPKHLRGLVIGCCAAGNMGNML  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PA+C EKGSPFGA D+CHTYGM YASLSMA+
Sbjct  121  LIIVPAVCKEKGSPFGAPDICHTYGMGYASLSMAV  155



>gb|KCW56460.1| hypothetical protein EUGRSUZ_I02196 [Eucalyptus grandis]
Length=353

 Score =   207 bits (527),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 124/155 (80%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L  VA MPVLKVL+I+ALGSLLA     ILGE AR HLNN+VFFVF+PALVFS L
Sbjct  1    MALLDLFVVALMPVLKVLLITALGSLLAIARVDILGEEARKHLNNIVFFVFSPALVFSCL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+S+T  S+  LWFMP NILLTFI+GSALGW+L + +RAP HL+GL+LG  AAGN GN+ 
Sbjct  61   AKSITYKSMASLWFMPCNILLTFIVGSALGWLLIRFSRAPDHLRGLVLGCCAAGNQGNML  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPA+C EKGSPFG  + C+T+GM +ASLS+AI
Sbjct  121  LIIIPAVCREKGSPFGDPESCNTHGMTFASLSLAI  155



>ref|XP_010029546.1| PREDICTED: uncharacterized protein LOC104419550 isoform X3 [Eucalyptus 
grandis]
Length=392

 Score =   208 bits (529),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 124/155 (80%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L  VA MPVLKVL+I+ALGSLLA     ILGE AR HLNN+VFFVF+PALVFS L
Sbjct  1    MALLDLFVVALMPVLKVLLITALGSLLAIARVDILGEEARKHLNNIVFFVFSPALVFSCL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+S+T  S+  LWFMP NILLTFI+GSALGW+L + +RAP HL+GL+LG  AAGN GN+ 
Sbjct  61   AKSITYKSMASLWFMPCNILLTFIVGSALGWLLIRFSRAPDHLRGLVLGCCAAGNQGNML  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPA+C EKGSPFG  + C+T+GM +ASLS+AI
Sbjct  121  LIIIPAVCREKGSPFGDPESCNTHGMTFASLSLAI  155



>ref|XP_011034783.1| PREDICTED: uncharacterized transporter YBR287W-like [Populus 
euphratica]
Length=407

 Score =   208 bits (529),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 97/155 (63%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L LL  +S+PVLKVL+I+A+GS LA DH  +LGE+AR H+NN+VF+VFNPALV SNL
Sbjct  1    MALLDLLIASSIPVLKVLLITAIGSYLALDHVDVLGEDARKHVNNVVFYVFNPALVSSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++T DS+  +WFMPFNIL+TF++GS LGW + + TR P HL GLI+G  AAGN+GN+ 
Sbjct  61   AETITYDSMKKMWFMPFNILITFVIGSLLGWFVVQFTRPPSHLHGLIVGCCAAGNLGNMF  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +I+IPAIC EKGSPFG+ D+C T+G+ Y SLSMAI
Sbjct  121  LIMIPAICKEKGSPFGSPDMCETFGLGYVSLSMAI  155



>ref|XP_010029545.1| PREDICTED: uncharacterized transporter C5D6.04-like isoform X2 
[Eucalyptus grandis]
Length=415

 Score =   208 bits (529),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 124/155 (80%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L  VA MPVLKVL+I+ALGSLLA     ILGE AR HLNN+VFFVF+PALVFS L
Sbjct  1    MALLDLFVVALMPVLKVLLITALGSLLAIARVDILGEEARKHLNNIVFFVFSPALVFSCL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+S+T  S+  LWFMP NILLTFI+GSALGW+L + +RAP HL+GL+LG  AAGN GN+ 
Sbjct  61   AKSITYKSMASLWFMPCNILLTFIVGSALGWLLIRFSRAPDHLRGLVLGCCAAGNQGNML  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPA+C EKGSPFG  + C+T+GM +ASLS+AI
Sbjct  121  LIIIPAVCREKGSPFGDPESCNTHGMTFASLSLAI  155



>ref|XP_007158042.1| hypothetical protein PHAVU_002G119300g [Phaseolus vulgaris]
 ref|XP_007158043.1| hypothetical protein PHAVU_002G119300g [Phaseolus vulgaris]
 gb|ESW30036.1| hypothetical protein PHAVU_002G119300g [Phaseolus vulgaris]
 gb|ESW30037.1| hypothetical protein PHAVU_002G119300g [Phaseolus vulgaris]
Length=412

 Score =   207 bits (528),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/155 (63%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  + LL VASMPV+KVL+I+A+G +LA  + ++LG++AR+ +NN+V +V  PALV  NL
Sbjct  1    MALMELLWVASMPVIKVLLITAVGLVLALGNINLLGKDARIQVNNLVHYVLYPALVGGNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++T ++V+ LWFMP NILLTFI+GSALGWIL KLTRAP+HL+GLI+G  +AGN+GNLP
Sbjct  61   ADTITSENVVSLWFMPVNILLTFIIGSALGWILVKLTRAPKHLEGLIVGVCSAGNLGNLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPAIC +KGSPFG ++VC+ YGM YASLSMA+
Sbjct  121  IIIIPAICKDKGSPFGDSNVCYQYGMAYASLSMAV  155



>ref|XP_010094502.1| Uncharacterized transporter [Morus notabilis]
 gb|EXB56256.1| Uncharacterized transporter [Morus notabilis]
Length=420

 Score =   207 bits (527),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 123/155 (79%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L LL  AS+PVLKVL+I+ALGS LA D   I  E+A  HLN +VF+VFNPALV SNL
Sbjct  1    MEILGLLVTASIPVLKVLLITALGSYLALDRVGIFPEDAIKHLNTIVFYVFNPALVASNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++T  S++ LWFMP NIL+TFI+GS LGWI+ + TR PQHL GLILG SAAGN+GN+ 
Sbjct  61   ASTITYQSMIKLWFMPVNILITFIVGSILGWIVIQFTRPPQHLHGLILGCSAAGNLGNML  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            ++IIPA+C E+GSPFG  DVC+TYGM Y+SLSMAI
Sbjct  121  LVIIPALCKERGSPFGDPDVCYTYGMAYSSLSMAI  155



>ref|XP_010029544.1| PREDICTED: uncharacterized transporter C5D6.04-like isoform X1 
[Eucalyptus grandis]
Length=445

 Score =   208 bits (529),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 124/155 (80%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L  VA MPVLKVL+I+ALGSLLA     ILGE AR HLNN+VFFVF+PALVFS L
Sbjct  1    MALLDLFVVALMPVLKVLLITALGSLLAIARVDILGEEARKHLNNIVFFVFSPALVFSCL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+S+T  S+  LWFMP NILLTFI+GSALGW+L + +RAP HL+GL+LG  AAGN GN+ 
Sbjct  61   AKSITYKSMASLWFMPCNILLTFIVGSALGWLLIRFSRAPDHLRGLVLGCCAAGNQGNML  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPA+C EKGSPFG  + C+T+GM +ASLS+AI
Sbjct  121  LIIIPAVCREKGSPFGDPESCNTHGMTFASLSLAI  155



>ref|XP_008453020.1| PREDICTED: uncharacterized transporter YBR287W-like [Cucumis 
melo]
Length=421

 Score =   206 bits (524),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M FLSLL +AS+PVLKVL+I+ LGS LA  +  ILG+ AR HLN +VF+VFNPALV SNL
Sbjct  3    MKFLSLLILASIPVLKVLLITGLGSFLALPYIDILGQEARKHLNGVVFYVFNPALVASNL  62

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++T ++++ +WFMPFNIL+TFI+GS  GWI+ + T+ P HL+GLILG S+AGN+GN+ 
Sbjct  63   AETITYNNMVKMWFMPFNILITFIVGSLFGWIVIQWTKPPPHLRGLILGCSSAGNLGNIL  122

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPA+C EKGSPFG +D C TYGM Y SLSMAI
Sbjct  123  LIIIPAVCKEKGSPFGDSDNCTTYGMAYVSLSMAI  157



>emb|CBI37490.3| unnamed protein product [Vitis vinifera]
Length=459

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 117/158 (74%), Gaps = 3/158 (2%)
 Frame = +3

Query  102  RFGMGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVF  281
            RF MG L L  VASMPV+KVL+++A+GS +A D   I GEN R  LN +VFFV       
Sbjct  41   RFQMGLLDLFFVASMPVIKVLLVTAVGSFIALDRFDIFGENVRKQLNTIVFFV---XXXX  97

Query  282  SNLARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMG  461
                         L+WFMPFNIL+TF++GSALGW+L KLTRAPQHL+GL+LG  AAGN+G
Sbjct  98   XXXXXXXXGGGGGLMWFMPFNILITFVIGSALGWLLVKLTRAPQHLRGLVLGCCAAGNLG  157

Query  462  NLPVIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            NLP+II+PA+C EKGSPFGA DVCHTYGM YASLSMAI
Sbjct  158  NLPLIIVPAVCREKGSPFGAPDVCHTYGMAYASLSMAI  195



>gb|ACJ85428.1| unknown [Medicago truncatula]
 gb|AFK36849.1| unknown [Medicago truncatula]
 gb|AFK46985.1| unknown [Medicago truncatula]
Length=417

 Score =   205 bits (521),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGFL L  VAS PV+KVL+++ +G LLA D+ ++LG++AR   N++V +VFNP L+  NL
Sbjct  1    MGFLELFSVASFPVIKVLLVTGIGLLLALDNINLLGKDARSQTNHLVHYVFNPGLIGGNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+++TLD+V+ LWFMP NIL+TF+LGSALGWI+ KLT+ P+H++GLI+G  +AGN+GNLP
Sbjct  61   AQTITLDNVVSLWFMPVNILVTFLLGSALGWIIIKLTKPPRHIEGLIVGVCSAGNLGNLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPAI  +KGSPFG  DVC+ +GM YASLSMAI
Sbjct  121  IIIIPAIRKDKGSPFGDPDVCYQFGMAYASLSMAI  155



>ref|XP_010649334.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized transporter YBR287W-like 
[Vitis vinifera]
Length=410

 Score =   204 bits (520),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 102/159 (64%), Positives = 122/159 (77%), Gaps = 4/159 (3%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNM-VFFVFNPAL---V  278
            MG L L  VASMPV+KVL+++A+GS +A D   I GEN R  LN +  FF   P L   V
Sbjct  1    MGLLDLFFVASMPVIKVLLVTAVGSFIALDRFDIFGENVRKQLNTVSCFFFLPPCLXFQV  60

Query  279  FSNLARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNM  458
            F  L   + L+ V+ LWFMPFNIL+TF++GSALGW+L KLTRAPQHL+GL+LG  AAGN+
Sbjct  61   FCALIXFLLLNFVVRLWFMPFNILITFVIGSALGWLLVKLTRAPQHLRGLVLGCCAAGNL  120

Query  459  GNLPVIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            GNLP+II+PA+C EKGSPFGA DVCHTYGM YASLSMAI
Sbjct  121  GNLPLIIVPAVCREKGSPFGAPDVCHTYGMAYASLSMAI  159



>ref|XP_002528529.1| auxin:hydrogen symporter, putative [Ricinus communis]
 gb|EEF33841.1| auxin:hydrogen symporter, putative [Ricinus communis]
Length=447

 Score =   205 bits (522),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 97/155 (63%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MG L +   + +PV+KVL+I+A+GS LA D+  ILG +AR HLNN+VFFVFNPALV SN+
Sbjct  1    MGLLDIFIASVIPVVKVLLITAVGSFLAIDYVDILGVDARKHLNNIVFFVFNPALVGSNI  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+ +TL S+ +LWFMP NIL+TFI+GS LGW+L K T+AP  L GL+LG  +AGN+GNLP
Sbjct  61   AKYITLRSMGVLWFMPLNILITFIIGSMLGWLLIKSTKAPHELWGLVLGCCSAGNLGNLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIP +C E+GSPFG  DVC+T+G+ YASLSMAI
Sbjct  121  MIIIPTVCKERGSPFGDVDVCYTHGLAYASLSMAI  155



>ref|XP_006432166.1| hypothetical protein CICLE_v10001450mg [Citrus clementina]
 gb|ESR45406.1| hypothetical protein CICLE_v10001450mg [Citrus clementina]
Length=389

 Score =   203 bits (517),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 124/154 (81%), Gaps = 0/154 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M    L  VASMPVLK L+++ LGS LA D   ++GENAR  LN++VFFVF+PA+V SNL
Sbjct  1    MQISDLFFVASMPVLKTLLLTTLGSFLALDRVGVMGENARKQLNSVVFFVFSPAIVGSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+++TL+S++L+WFMP NIL TFI+GS L WIL K+TRAP+HLKGL+LG  AAGN+GNLP
Sbjct  61   AKTITLESIVLMWFMPINILCTFIIGSVLAWILIKVTRAPRHLKGLVLGCCAAGNLGNLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMA  572
            +IIIPAIC EK SPFG  ++CH YGM Y SLSMA
Sbjct  121  LIIIPAICREKNSPFGDPEICHKYGMTYVSLSMA  154



>ref|XP_010103231.1| Uncharacterized transporter [Morus notabilis]
 gb|EXB95102.1| Uncharacterized transporter [Morus notabilis]
Length=417

 Score =   204 bits (519),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 126/154 (82%), Gaps = 0/154 (0%)
 Frame = +3

Query  114  GFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNLA  293
            G + L  VAS+PVLK+L+++ALGS LA   + ILG+NAR  LN++VFFVFNPA V SNLA
Sbjct  4    GLIDLFLVASIPVLKLLILTALGSFLAFTASDILGDNARKRLNSLVFFVFNPAFVSSNLA  63

Query  294  RSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLPV  473
            +++TL+ ++ LWFMP NI+ TF++GS LGW++ K+T+ PQHLKGL+LG  +AGN+GNLP+
Sbjct  64   KTITLERIISLWFMPVNIMSTFVIGSGLGWLVVKITKPPQHLKGLVLGCCSAGNLGNLPI  123

Query  474  IIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II A+C E+GSPFGA  +CH+ GM YASLSMAI
Sbjct  124  VIILAVCRERGSPFGAPHLCHSSGMTYASLSMAI  157



>ref|XP_002317634.2| hypothetical protein POPTR_0011s14870g [Populus trichocarpa]
 gb|EEE98246.2| hypothetical protein POPTR_0011s14870g [Populus trichocarpa]
Length=390

 Score =   203 bits (517),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MG   L  VA MPV+KVL+I+A+G  LA++   ILG +AR HLN++VF+V NPALV SNL
Sbjct  1    MGLWQLFVVALMPVVKVLLITAVGVFLATERMDILGTDARKHLNSLVFYVLNPALVGSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+ +TL S+++LWFMP NIL+TFI GSALGW+L K+T+AP HL+GLILG  AAGN+GN+P
Sbjct  61   AKFITLKSIVMLWFMPLNILITFIAGSALGWLLIKITKAPIHLRGLILGCCAAGNLGNMP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPA C EKG+PFG A +C  +G+ YA+LS+AI
Sbjct  121  LIIIPAACEEKGNPFGDASICKMHGLAYATLSLAI  155



>gb|KDP36734.1| hypothetical protein JCGZ_08025 [Jatropha curcas]
Length=402

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 122/155 (79%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L   +S+PVLKVLMI+ LG+ LA D   IL  +AR H+NN+VF+VF+PALV + L
Sbjct  1    MALLDLFIASSIPVLKVLMITGLGTFLALDRVDILKGDARKHVNNVVFYVFSPALVGTKL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++T +S++ +WFMP NIL+TFI+GS LGWIL +LTR P HL+GLI+G  AAGN+GN+ 
Sbjct  61   AETITYESIVKMWFMPLNILITFIIGSMLGWILVQLTRPPSHLRGLIVGCCAAGNLGNML  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +I+IPAIC EKGSPFGA DVC +YG+ Y SLSMAI
Sbjct  121  LIMIPAICKEKGSPFGAPDVCQSYGLAYVSLSMAI  155



>gb|KGN55542.1| hypothetical protein Csa_4G664490 [Cucumis sativus]
Length=421

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/155 (63%), Positives = 123/155 (79%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M FLSLL +AS+PVLKVL+I+ LGS LA     ILG+ AR HLN +VF+VFNPALV SNL
Sbjct  3    MKFLSLLILASIPVLKVLLITGLGSFLALPSIDILGQEARKHLNGVVFYVFNPALVSSNL  62

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++T  +++ +WFMPFNIL+TFI+GS  GWI+ + T+ P HL+GLILG  +AGN+GN+ 
Sbjct  63   AETITYSNMVKMWFMPFNILITFIVGSLFGWIVIQWTKPPPHLRGLILGCCSAGNLGNIL  122

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PA+C EKGSPFG +D C TYGM Y SLSMAI
Sbjct  123  LIIVPAVCQEKGSPFGDSDKCTTYGMAYVSLSMAI  157



>ref|XP_006370746.1| hypothetical protein POPTR_0001s46050g [Populus trichocarpa]
 gb|ERP67315.1| hypothetical protein POPTR_0001s46050g [Populus trichocarpa]
Length=428

 Score =   202 bits (515),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/155 (63%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L LL +AS+P+LKVL+++ALGSLLA D+ H+LGE+ R  LN +VF VF+PALV S+L
Sbjct  1    MRLLDLLYIASVPILKVLILTALGSLLALDNIHVLGESTRKELNRVVFLVFSPALVVSSL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+++T ++++ LWFMP NIL  FI+GSALGWIL K+TR  + LKGLILG  AAGN G+L 
Sbjct  61   AKTITYENIVTLWFMPVNILCAFIVGSALGWILIKITRPAKQLKGLILGCCAAGNNGSLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
             IIIPA+C+EKGSPFG+ DVC TYGM Y SLS+A+
Sbjct  121  FIIIPAVCSEKGSPFGSPDVCSTYGMAYVSLSLAV  155



>ref|XP_008237904.1| PREDICTED: uncharacterized transporter YBR287W-like [Prunus mume]
Length=416

 Score =   201 bits (510),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 122/155 (79%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L   A +PVLK+L I+ LGS LA D  +ILGE+AR HLN +VF+VF+PALV SNL
Sbjct  1    MELLQLFITALIPVLKILFITVLGSYLALDRVNILGEDARKHLNTVVFYVFSPALVSSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            AR++T  S++ LWFMP NIL+TFI+GS LGWIL +LTR P +L+G+++G  A GN+G + 
Sbjct  61   ARTITPKSIVKLWFMPVNILITFIVGSILGWILLQLTRPPAYLRGIVVGCCAGGNLGFML  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PA+C EKGSPFGA DVCHT+ + YASLSMAI
Sbjct  121  LIIVPAVCKEKGSPFGAPDVCHTFALAYASLSMAI  155



>ref|XP_002528528.1| auxin:hydrogen symporter, putative [Ricinus communis]
 gb|EEF33840.1| auxin:hydrogen symporter, putative [Ricinus communis]
Length=417

 Score =   201 bits (510),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 122/159 (77%), Gaps = 4/159 (3%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L  +ASMPVLKVL+I+ALGS LA D+ +ILGE AR  +N +VF+VFNPALV  NL
Sbjct  1    MRLLDLFAIASMPVLKVLLITALGSFLAFDNVNILGEEARKQINRVVFYVFNPALVGGNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKG----LILGSSAAGNM  458
            A+++T +S+LLLWFMP NIL+TFI+GSALGWIL K+T  P+HL      + +     GNM
Sbjct  61   AKTITFESILLLWFMPVNILITFIIGSALGWILIKITAPPKHLXAVLQVVDVVVVVTGNM  120

Query  459  GNLPVIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            GNL +II+PA+C EKGSPFG  DVCH YG+ YASLSMAI
Sbjct  121  GNLVLIIVPAMCREKGSPFGPPDVCHAYGISYASLSMAI  159



>ref|XP_011038092.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Populus euphratica]
Length=420

 Score =   201 bits (510),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 124/155 (80%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L LL +AS+P+LKVL+++ALGSLLA D+ H+LGE+ R  LN +VF VF+PALV S+L
Sbjct  1    MRLLDLLYIASVPILKVLILTALGSLLALDNIHVLGESTRKELNRVVFLVFSPALVVSSL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+++T ++++ LWFMP NIL  FI+GS LGWIL K+TR  + LKGLILG  AAGN G+L 
Sbjct  61   AKTITYENIVTLWFMPVNILCAFIVGSELGWILIKITRPAKQLKGLILGCCAAGNNGSLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
             IIIPA+C+EKGSPFG+ DVC TYGM Y SLS+A+
Sbjct  121  FIIIPAVCSEKGSPFGSPDVCSTYGMAYVSLSLAV  155



>ref|XP_010094503.1| Uncharacterized transporter [Morus notabilis]
 gb|EXB56257.1| Uncharacterized transporter [Morus notabilis]
Length=411

 Score =   200 bits (508),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 119/155 (77%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L   AS+PVLKVL+I+ LGS LA D   I  E+AR HLN +VF+VFNPALV SNL
Sbjct  1    MKILGLFVTASIPVLKVLLITTLGSYLALDRVGIFPEDARKHLNTVVFYVFNPALVGSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++T  S++ LWFMP NIL+ +I+GS LGWI+ ++TR  QHL+GLILG SAAGN G + 
Sbjct  61   ANTITYQSMITLWFMPVNILIAYIVGSILGWIVIQITRPSQHLRGLILGCSAAGNFGTIL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIP +C E+GSPFG  DVC+TYGM Y+SLSMAI
Sbjct  121  LIIIPTLCKERGSPFGDPDVCYTYGMAYSSLSMAI  155



>gb|KHN38844.1| hypothetical protein glysoja_014836 [Glycine soja]
Length=248

 Score =   195 bits (495),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 127/183 (69%), Gaps = 28/183 (15%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLN----------------  242
            MGF+ L  VAS PV+KVL+I+ALG  LA D+  ILGE+AR  +N                
Sbjct  1    MGFIKLFSVASFPVIKVLLITALGLFLALDNISILGEDARKKVNQVTIPENLFSFVLFFS  60

Query  243  ------------NMVFFVFNPALVFSNLARSVTLDSVLLLWFMPFNILLTFILGSALGWI  386
                         +VF+VFNP+LV SNLA+++T +SV+ LWFMP NIL TFILGSALGWI
Sbjct  61   LCSLMERVLFLEQLVFYVFNPSLVGSNLAKTITFESVVKLWFMPVNILGTFILGSALGWI  120

Query  387  LFKLTRAPQHLKGLILGSSAAGNMGNLPVIIIPAICNEKGSPFGAADVCHTYGMVYASLS  566
            L K+TR P+ ++GLILG  +AGN+GNLP+III AIC ++GSPFG  D+C+ YG+ YA+LS
Sbjct  121  LIKMTRPPKRMEGLILGCCSAGNLGNLPMIIIAAICKQEGSPFGEPDLCNQYGLAYAALS  180

Query  567  MAI  575
            MAI
Sbjct  181  MAI  183



>gb|ABR18184.1| unknown [Picea sitchensis]
Length=455

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/192 (52%), Positives = 141/192 (73%), Gaps = 7/192 (4%)
 Frame = +3

Query  6    YWFLSPLLFQINS--LICSKILITKKIFTLERRERFGMGFLSLLKVASMPVLKVLMISAL  179
            YW    L+F+  S  +I  + L  K++    +++R  M FL+LL+VASMPVL++L+IS L
Sbjct  7    YW--PCLIFEKESDFMIVGQALNIKRV---SKKDRSIMAFLALLEVASMPVLRILLISGL  61

Query  180  GSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNLARSVTLDSVLLLWFMPFNILLTF  359
            G+ LA+ +  +L  + R H+N +VF VF PAL+F++L++SVTLD+++  W+MP N+LLTF
Sbjct  62   GAFLATSYVDVLTADVRKHVNKVVFIVFTPALMFASLSKSVTLDNIVSWWYMPVNLLLTF  121

Query  360  ILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLPVIIIPAICNEKGSPFGAADVCHT  539
            ++G   GWI+ K+TR P+HL GL++G+ AAGN+GNL +IIIPAIC +K SPFG A VC  
Sbjct  122  LIGGFCGWIVVKITRTPRHLSGLVIGNCAAGNVGNLLLIIIPAICEQKASPFGDAGVCMD  181

Query  540  YGMVYASLSMAI  575
            YGM YAS SMAI
Sbjct  182  YGMAYASFSMAI  193



>emb|CDP01746.1| unnamed protein product [Coffea canephora]
Length=411

 Score =   199 bits (507),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/155 (63%), Positives = 119/155 (77%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGFL+L  VA MPVLK L+++A+G  LA +   ILG  AR HLNN+VFFVF PALV SNL
Sbjct  1    MGFLALFIVALMPVLKTLIVTAVGLFLALEKVDILGATARHHLNNLVFFVFTPALVSSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++T+ S++ LWFMP NILLTF++GSALGW+L K+ R PQHL GL++G  AAGN+GNL 
Sbjct  61   AETITMSSLIKLWFMPVNILLTFLIGSALGWVLVKVLRTPQHLHGLVIGCCAAGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPA+C E  SPFG +  C T G  YASLSMAI
Sbjct  121  LIIIPAVCEENDSPFGDSSTCSTNGEAYASLSMAI  155



>ref|XP_007209181.1| hypothetical protein PRUPE_ppa006339mg [Prunus persica]
 gb|EMJ10380.1| hypothetical protein PRUPE_ppa006339mg [Prunus persica]
Length=416

 Score =   198 bits (504),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 120/155 (77%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L   A +P LK+L  + LGS LA D  +ILGE+AR HLN +VF+VF+PALV SNL
Sbjct  1    MELLQLFITALIPALKILFTTLLGSYLALDRVNILGEDARKHLNTVVFYVFSPALVSSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            AR++T  S++ LWFMP NIL+TFI+GS LGWIL +LTR P +L+G+++G  A GN+G + 
Sbjct  61   ARTITDKSIVQLWFMPVNILITFIVGSILGWILLQLTRPPAYLRGIVVGCCAGGNLGFML  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PA+C EKGSPFGA DVCHTY + YASLSMAI
Sbjct  121  LIIVPAVCKEKGSPFGAPDVCHTYALAYASLSMAI  155



>ref|XP_008805481.1| PREDICTED: uncharacterized transporter YBR287W-like [Phoenix 
dactylifera]
Length=399

 Score =   197 bits (502),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MG  +L   AS+PVL VL+++ +GS+ A+    ILG++A  HLNN+VFFVFNPALV +NL
Sbjct  1    MGLFNLFITASVPVLNVLLLTGVGSITATRRIGILGKDATKHLNNVVFFVFNPALVATNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            ++++TL+S++LLWFMP N+LL F++GSALGW++ ++T AP HL+G+IL S +AGN+GNL 
Sbjct  61   SQTITLESMVLLWFMPVNLLLNFVIGSALGWVVIQITNAPTHLRGVILASCSAGNVGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +I++PA+C EKG+P G+ DVC TYG+ YASLSMAI
Sbjct  121  LILVPAMCKEKGTPLGSPDVCGTYGLAYASLSMAI  155



>ref|XP_010913879.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Elaeis guineensis]
Length=396

 Score =   197 bits (501),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MG L+L   AS+PVL VL+++ +GS+ A+    ILG++A  HLNN+VFFVFNPALV +NL
Sbjct  1    MGLLNLFVTASIPVLNVLLLTGVGSICATRRIGILGKDATKHLNNVVFFVFNPALVATNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            ++++T++S++LLWFMP N+LL F+LGSALGW++ ++T AP HL+G+IL   +AGN+GNL 
Sbjct  61   SQTITMESMVLLWFMPVNLLLNFVLGSALGWVVIQITNAPTHLRGVILACCSAGNVGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +I++PA+C EKG+P G+ DVC TYG+ YASLSMAI
Sbjct  121  LILVPAMCKEKGTPLGSHDVCGTYGLAYASLSMAI  155



>gb|KEH17833.1| auxin efflux carrier family protein [Medicago truncatula]
Length=340

 Score =   195 bits (496),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/156 (61%), Positives = 120/156 (77%), Gaps = 1/156 (1%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILG-ENARMHLNNMVFFVFNPALVFSN  287
            M FL L  VA MPVLKVL+I+ LG+ LA D   IL  E AR +LN +VFFVF PALV  +
Sbjct  1    MEFLKLFIVALMPVLKVLLITVLGTFLALDRFDILSRETARKNLNTIVFFVFAPALVCGS  60

Query  288  LARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNL  467
            LA +VT  S++ LWFMP N+LLTFI+G+ALGW++ KL R P HL+GL+LG  AAGN+GNL
Sbjct  61   LAETVTSKSIVTLWFMPLNVLLTFIIGAALGWLVVKLMRVPHHLQGLVLGCCAAGNLGNL  120

Query  468  PVIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            P+II+PA+C + G+PFG AD+CH  G+ YASLSMA+
Sbjct  121  PLIIVPAVCKQTGNPFGDADICHRNGLAYASLSMAV  156



>ref|XP_004515365.1| PREDICTED: uncharacterized protein LOC101492524 isoform X2 [Cicer 
arietinum]
Length=332

 Score =   195 bits (495),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 120/155 (77%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M F  L  VA MPVLKVL+I+ALG+ L+ D   IL E A  +LN +VFFVF+PALV S+L
Sbjct  1    MEFWKLFVVALMPVLKVLLITALGTFLSLDRFDILKETASKNLNTIVFFVFSPALVCSSL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++T  S++ LWFMP N+LLTFI+G+ALGW+L KL + P HL+GL LG  AAGN+GNLP
Sbjct  61   AETITSRSIITLWFMPLNVLLTFIIGAALGWLLVKLIKVPYHLQGLALGCCAAGNLGNLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PA+C +KG+PFG  D+CH  G+ YASLSMAI
Sbjct  121  LIIVPAVCKQKGNPFGDLDICHRNGLAYASLSMAI  155



>ref|XP_010681118.1| PREDICTED: uncharacterized protein LOC104896113 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=374

 Score =   196 bits (498),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 122/153 (80%), Gaps = 0/153 (0%)
 Frame = +3

Query  117  FLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNLAR  296
            + +LL VASMPVLKVL+I+ALG  LA +   ILGE    HLN +VFFVF PALV SNLA+
Sbjct  4    WFNLLFVASMPVLKVLLITALGLFLALNRIDILGEAVTNHLNKVVFFVFGPALVGSNLAK  63

Query  297  SVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLPVI  476
            +VT +S L LWFM   IL+TF++GS +GW+L K+T+AP+H+KGLIL S +AGN+GNLP+I
Sbjct  64   TVTFESFLTLWFMLVKILITFLIGSTMGWVLAKVTKAPKHIKGLILASCSAGNLGNLPII  123

Query  477  IIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            I+PAIC EKGS FGA ++C  YG+ YASLSMAI
Sbjct  124  ILPAICKEKGSRFGAPNICERYGLAYASLSMAI  156



>gb|KDO70039.1| hypothetical protein CISIN_1g014841mg [Citrus sinensis]
Length=240

 Score =   192 bits (487),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L +VA MP+LKVL+++ALG +LA D   +LG +    LNN+VF+VFNPAL+ SNL
Sbjct  1    MEILDLFEVALMPILKVLLVTALGLVLAIDRIDLLGHSVTHSLNNLVFYVFNPALIGSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++T  S++ LWFMP NILL+F++GSAL WIL K+TR P HL+GL++G  +AGNMGNL 
Sbjct  61   AETITYQSLISLWFMPVNILLSFLIGSALAWILIKITRTPPHLQGLVIGCCSAGNMGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PA+C E  SPFG   VC +YG  YASLSMA+
Sbjct  121  LIIVPAVCEESNSPFGDTSVCSSYGKAYASLSMAV  155



>ref|XP_010681116.1| PREDICTED: uncharacterized transporter C5D6.04-like isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=406

 Score =   197 bits (500),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 122/153 (80%), Gaps = 0/153 (0%)
 Frame = +3

Query  117  FLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNLAR  296
            + +LL VASMPVLKVL+I+ALG  LA +   ILGE    HLN +VFFVF PALV SNLA+
Sbjct  4    WFNLLFVASMPVLKVLLITALGLFLALNRIDILGEAVTNHLNKVVFFVFGPALVGSNLAK  63

Query  297  SVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLPVI  476
            +VT +S L LWFM   IL+TF++GS +GW+L K+T+AP+H+KGLIL S +AGN+GNLP+I
Sbjct  64   TVTFESFLTLWFMLVKILITFLIGSTMGWVLAKVTKAPKHIKGLILASCSAGNLGNLPII  123

Query  477  IIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            I+PAIC EKGS FGA ++C  YG+ YASLSMAI
Sbjct  124  ILPAICKEKGSRFGAPNICERYGLAYASLSMAI  156



>ref|XP_006437711.1| hypothetical protein CICLE_v10031658mg [Citrus clementina]
 gb|ESR50951.1| hypothetical protein CICLE_v10031658mg [Citrus clementina]
Length=240

 Score =   191 bits (486),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L +VA MP+LKVL+++ALG +LA D   +LG +    LNN+VF+VFNPAL+ SNL
Sbjct  1    MEILDLFEVALMPILKVLLVTALGLVLAIDRIDLLGHSVTHSLNNLVFYVFNPALIGSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++T  S++ LWFMP NILL+F++GSAL WIL K+TR P HL+GL++G  +AGNMGNL 
Sbjct  61   AETITYQSLISLWFMPVNILLSFLIGSALAWILIKITRTPPHLQGLVIGCCSAGNMGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PA+C E  SPFG   VC +YG  YASLSMA+
Sbjct  121  LIIVPAVCEESNSPFGDTSVCSSYGKAYASLSMAV  155



>gb|KHN30729.1| hypothetical protein glysoja_034072 [Glycine soja]
Length=162

 Score =   189 bits (479),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 117/155 (75%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M    L   A MPVLKVL+I+A+G+ LA    +IL E+AR HLN +V+FVF PALV S L
Sbjct  1    MELWKLFVTALMPVLKVLLITAVGTFLALHRFNILRESARKHLNTIVYFVFTPALVCSIL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A++ T  S++ +WFMP NILLTFI+G+ LGW+  K+T+AP  ++GL+LG  AAGN+GNLP
Sbjct  61   AKTTTFKSLVAVWFMPLNILLTFIIGTTLGWLFMKITKAPPDMQGLVLGCCAAGNLGNLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PA+C E  SPFGA DVC+  GM YASLSMA+
Sbjct  121  LIIVPAVCKESSSPFGAVDVCNKKGMAYASLSMAV  155



>ref|XP_010649328.1| PREDICTED: uncharacterized protein LOC100249991 isoform X2 [Vitis 
vinifera]
 ref|XP_010649329.1| PREDICTED: uncharacterized protein LOC100249991 isoform X2 [Vitis 
vinifera]
 emb|CBI37492.3| unnamed protein product [Vitis vinifera]
Length=418

 Score =   196 bits (499),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 125/155 (81%), Gaps = 1/155 (1%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGFLSL  VA +P+LKVL+++ +G L+A +   +LG NAR +LN +VF+VFNPALV SNL
Sbjct  1    MGFLSLFVVALVPILKVLLVTGVGLLIALERIDLLGANARRNLNAIVFYVFNPALVSSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+++T  S++ +WFMP NILLTF++GSALGW+L K+TR PQHL+GL+LG  +AGN+GNL 
Sbjct  61   AKTITFSSLVTMWFMPVNILLTFVIGSALGWVLIKITRTPQHLQGLVLGCCSAGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPAIC E+ +PFG +D C T G  YASLS+AI
Sbjct  121  LIIIPAICEEEDNPFGDSD-CSTNGEAYASLSLAI  154



>ref|XP_008358580.1| PREDICTED: uncharacterized protein LOC103422308 [Malus domestica]
Length=206

 Score =   190 bits (483),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M    L   A +PVLKVL I+ALGS LA D  +ILGE  R +LN +VF+VF PALV SN+
Sbjct  1    MELKQLFVTALIPVLKVLSITALGSYLALDRVNILGEVTRKNLNTVVFYVFGPALVSSNV  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+++T  S++ +WFMP NIL+TFI+GS LG +L +LTR P HL+GL+LG  AAGN+G + 
Sbjct  61   AQTITYQSMVKMWFMPVNILITFIIGSILGCLLIQLTRPPAHLRGLVLGCCAAGNLGMML  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PA+C EKGSPFGA DVCH Y M YASLSMA+
Sbjct  121  LIIVPAVCKEKGSPFGAPDVCHMYAMGYASLSMAV  155



>ref|XP_006370751.1| hypothetical protein POPTR_0001s46060g [Populus trichocarpa]
 gb|ERP67320.1| hypothetical protein POPTR_0001s46060g [Populus trichocarpa]
Length=376

 Score =   195 bits (495),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 120/155 (77%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGFL L  VA +PVLKVL+I+ +G  LA D   +LG  AR +LNN++F+VF+PALV S L
Sbjct  1    MGFLDLFVVAMVPVLKVLLITLVGLFLALDRIDLLGSTARPYLNNLIFYVFSPALVSSQL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++TL S+  LWFMP NILLTFI+GS L WIL K+TR P HL+GL++G  +AGN+GNL 
Sbjct  61   AGTITLQSLASLWFMPVNILLTFIIGSVLAWILIKITRTPPHLQGLVIGCCSAGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PA+CNE  SPFG + VC +YGM YASLSMA+
Sbjct  121  LIIVPAVCNESNSPFGDSTVCSSYGMAYASLSMAV  155



>ref|XP_007134484.1| hypothetical protein PHAVU_010G051100g [Phaseolus vulgaris]
 gb|ESW06478.1| hypothetical protein PHAVU_010G051100g [Phaseolus vulgaris]
Length=425

 Score =   196 bits (498),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 124/155 (80%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M F  L  VA MPVLKVL+I+ALG++LA +  HILGEN R +LN +V+FVF+PALV S+L
Sbjct  1    MEFWKLFVVALMPVLKVLLITALGTILAINRFHILGENTRKNLNTLVYFVFSPALVCSSL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++TL SV++LWFMP NILLTF++GS LG++L KLT+ P HL+GL+LG  A+GN+GNLP
Sbjct  61   AETITLRSVVILWFMPVNILLTFVIGSLLGFLLVKLTKVPHHLQGLVLGCCASGNLGNLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PA+C + G+PFG  +VC    + YASLSMA+
Sbjct  121  IIIVPALCKQSGNPFGDVNVCSKNALAYASLSMAL  155



>gb|KDO70038.1| hypothetical protein CISIN_1g014841mg [Citrus sinensis]
Length=292

 Score =   192 bits (488),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L +VA MP+LKVL+++ALG +LA D   +LG +    LNN+VF+VFNPAL+ SNL
Sbjct  1    MEILDLFEVALMPILKVLLVTALGLVLAIDRIDLLGHSVTHSLNNLVFYVFNPALIGSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++T  S++ LWFMP NILL+F++GSAL WIL K+TR P HL+GL++G  +AGNMGNL 
Sbjct  61   AETITYQSLISLWFMPVNILLSFLIGSALAWILIKITRTPPHLQGLVIGCCSAGNMGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PA+C E  SPFG   VC +YG  YASLSMA+
Sbjct  121  LIIVPAVCEESNSPFGDTSVCSSYGKAYASLSMAV  155



>ref|XP_007134485.1| hypothetical protein PHAVU_010G051100g [Phaseolus vulgaris]
 gb|ESW06479.1| hypothetical protein PHAVU_010G051100g [Phaseolus vulgaris]
Length=394

 Score =   195 bits (496),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 124/155 (80%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M F  L  VA MPVLKVL+I+ALG++LA +  HILGEN R +LN +V+FVF+PALV S+L
Sbjct  1    MEFWKLFVVALMPVLKVLLITALGTILAINRFHILGENTRKNLNTLVYFVFSPALVCSSL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++TL SV++LWFMP NILLTF++GS LG++L KLT+ P HL+GL+LG  A+GN+GNLP
Sbjct  61   AETITLRSVVILWFMPVNILLTFVIGSLLGFLLVKLTKVPHHLQGLVLGCCASGNLGNLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PA+C + G+PFG  +VC    + YASLSMA+
Sbjct  121  IIIVPALCKQSGNPFGDVNVCSKNALAYASLSMAL  155



>ref|XP_011004410.1| PREDICTED: uncharacterized transporter YBR287W-like [Populus 
euphratica]
 ref|XP_011004411.1| PREDICTED: uncharacterized transporter YBR287W-like [Populus 
euphratica]
 ref|XP_011004412.1| PREDICTED: uncharacterized transporter YBR287W-like [Populus 
euphratica]
 ref|XP_011004413.1| PREDICTED: uncharacterized transporter YBR287W-like [Populus 
euphratica]
 ref|XP_011004414.1| PREDICTED: uncharacterized transporter YBR287W-like [Populus 
euphratica]
Length=411

 Score =   195 bits (496),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 122/155 (79%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MG   L  V+ MPV+KVL+++ LG  LA++   ILG +AR HLN++V++V NPALV SNL
Sbjct  1    MGLWQLFVVSLMPVVKVLLMTTLGVFLATERMDILGTDARKHLNSLVYYVLNPALVGSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+ +TL S+++LWFMP NI +TFI GSALGW+L K+T+AP HL+GLI+G  AAGN+GN+P
Sbjct  61   AKFITLKSIVMLWFMPLNIFITFIAGSALGWLLIKITKAPNHLRGLIVGCCAAGNLGNMP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPA C EK +PFG A +C  +G+ YA+LS+AI
Sbjct  121  LIIIPAACEEKDNPFGDASICKMHGLAYATLSLAI  155



>gb|KEH17832.1| auxin efflux carrier family protein [Medicago truncatula]
Length=410

 Score =   195 bits (496),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 120/156 (77%), Gaps = 1/156 (1%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILG-ENARMHLNNMVFFVFNPALVFSN  287
            M FL L  VA MPVLKVL+I+ LG+ LA D   IL  E AR +LN +VFFVF PALV  +
Sbjct  1    MEFLKLFIVALMPVLKVLLITVLGTFLALDRFDILSRETARKNLNTIVFFVFAPALVCGS  60

Query  288  LARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNL  467
            LA +VT  S++ LWFMP N+LLTFI+G+ALGW++ KL R P HL+GL+LG  AAGN+GNL
Sbjct  61   LAETVTSKSIVTLWFMPLNVLLTFIIGAALGWLVVKLMRVPHHLQGLVLGCCAAGNLGNL  120

Query  468  PVIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            P+II+PA+C + G+PFG AD+CH  G+ YASLSMAI
Sbjct  121  PLIIVPAVCKQTGNPFGDADICHRNGLAYASLSMAI  156



>ref|XP_006370750.1| hypothetical protein POPTR_0001s46060g [Populus trichocarpa]
 gb|ERP67319.1| hypothetical protein POPTR_0001s46060g [Populus trichocarpa]
Length=406

 Score =   195 bits (496),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 120/155 (77%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGFL L  VA +PVLKVL+I+ +G  LA D   +LG  AR +LNN++F+VF+PALV S L
Sbjct  1    MGFLDLFVVAMVPVLKVLLITLVGLFLALDRIDLLGSTARPYLNNLIFYVFSPALVSSQL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++TL S+  LWFMP NILLTFI+GS L WIL K+TR P HL+GL++G  +AGN+GNL 
Sbjct  61   AGTITLQSLASLWFMPVNILLTFIIGSVLAWILIKITRTPPHLQGLVIGCCSAGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PA+CNE  SPFG + VC +YGM YASLSMA+
Sbjct  121  LIIVPAVCNESNSPFGDSTVCSSYGMAYASLSMAV  155



>ref|XP_011038091.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X2 
[Populus euphratica]
Length=405

 Score =   195 bits (495),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 120/155 (77%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGFL L  VA +PVLKVL+I+ +G  LA D   +LG  AR +LNN++F+VF+PALV S L
Sbjct  1    MGFLDLFVVAMVPVLKVLLITLVGLFLALDRIDLLGSTARPYLNNLIFYVFSPALVSSQL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++TL S+  LWFMP NILLTFI+GS L WIL K+TR P HL+GL++G  +AGN+GNL 
Sbjct  61   AGTITLQSLASLWFMPVNILLTFIVGSVLAWILIKITRTPPHLQGLVIGCCSAGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PA+CNE  SPFG + VC +YGM YASLSMA+
Sbjct  121  LIIVPAVCNESNSPFGDSTVCSSYGMAYASLSMAV  155



>ref|XP_011038089.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Populus euphratica]
 ref|XP_011038090.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Populus euphratica]
Length=406

 Score =   195 bits (495),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 120/155 (77%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGFL L  VA +PVLKVL+I+ +G  LA D   +LG  AR +LNN++F+VF+PALV S L
Sbjct  1    MGFLDLFVVAMVPVLKVLLITLVGLFLALDRIDLLGSTARPYLNNLIFYVFSPALVSSQL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++TL S+  LWFMP NILLTFI+GS L WIL K+TR P HL+GL++G  +AGN+GNL 
Sbjct  61   AGTITLQSLASLWFMPVNILLTFIVGSVLAWILIKITRTPPHLQGLVIGCCSAGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PA+CNE  SPFG + VC +YGM YASLSMA+
Sbjct  121  LIIVPAVCNESNSPFGDSTVCSSYGMAYASLSMAV  155



>ref|XP_006370747.1| hypothetical protein POPTR_0001s46060g [Populus trichocarpa]
 ref|XP_006370748.1| hypothetical protein POPTR_0001s46060g [Populus trichocarpa]
 ref|XP_006370749.1| hypothetical protein POPTR_0001s46060g [Populus trichocarpa]
 gb|ERP67316.1| hypothetical protein POPTR_0001s46060g [Populus trichocarpa]
 gb|ERP67317.1| hypothetical protein POPTR_0001s46060g [Populus trichocarpa]
 gb|ERP67318.1| hypothetical protein POPTR_0001s46060g [Populus trichocarpa]
Length=405

 Score =   195 bits (495),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 120/155 (77%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGFL L  VA +PVLKVL+I+ +G  LA D   +LG  AR +LNN++F+VF+PALV S L
Sbjct  1    MGFLDLFVVAMVPVLKVLLITLVGLFLALDRIDLLGSTARPYLNNLIFYVFSPALVSSQL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++TL S+  LWFMP NILLTFI+GS L WIL K+TR P HL+GL++G  +AGN+GNL 
Sbjct  61   AGTITLQSLASLWFMPVNILLTFIIGSVLAWILIKITRTPPHLQGLVIGCCSAGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PA+CNE  SPFG + VC +YGM YASLSMA+
Sbjct  121  LIIVPAVCNESNSPFGDSTVCSSYGMAYASLSMAV  155



>ref|XP_004515364.1| PREDICTED: uncharacterized protein LOC101492524 isoform X1 [Cicer 
arietinum]
Length=419

 Score =   195 bits (496),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 120/155 (77%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M F  L  VA MPVLKVL+I+ALG+ L+ D   IL E A  +LN +VFFVF+PALV S+L
Sbjct  1    MEFWKLFVVALMPVLKVLLITALGTFLSLDRFDILKETASKNLNTIVFFVFSPALVCSSL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++T  S++ LWFMP N+LLTFI+G+ALGW+L KL + P HL+GL LG  AAGN+GNLP
Sbjct  61   AETITSRSIITLWFMPLNVLLTFIIGAALGWLLVKLIKVPYHLQGLALGCCAAGNLGNLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PA+C +KG+PFG  D+CH  G+ YASLSMAI
Sbjct  121  LIIVPAVCKQKGNPFGDLDICHRNGLAYASLSMAI  155



>gb|KDO70035.1| hypothetical protein CISIN_1g014841mg [Citrus sinensis]
 gb|KDO70036.1| hypothetical protein CISIN_1g014841mg [Citrus sinensis]
 gb|KDO70037.1| hypothetical protein CISIN_1g014841mg [Citrus sinensis]
Length=297

 Score =   192 bits (487),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L +VA MP+LKVL+++ALG +LA D   +LG +    LNN+VF+VFNPAL+ SNL
Sbjct  1    MEILDLFEVALMPILKVLLVTALGLVLAIDRIDLLGHSVTHSLNNLVFYVFNPALIGSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++T  S++ LWFMP NILL+F++GSAL WIL K+TR P HL+GL++G  +AGNMGNL 
Sbjct  61   AETITYQSLISLWFMPVNILLSFLIGSALAWILIKITRTPPHLQGLVIGCCSAGNMGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PA+C E  SPFG   VC +YG  YASLSMA+
Sbjct  121  LIIVPAVCEESNSPFGDTSVCSSYGKAYASLSMAV  155



>ref|XP_006437713.1| hypothetical protein CICLE_v10031658mg [Citrus clementina]
 gb|ESR50953.1| hypothetical protein CICLE_v10031658mg [Citrus clementina]
Length=297

 Score =   192 bits (487),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L +VA MP+LKVL+++ALG +LA D   +LG +    LNN+VF+VFNPAL+ SNL
Sbjct  1    MEILDLFEVALMPILKVLLVTALGLVLAIDRIDLLGHSVTHSLNNLVFYVFNPALIGSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++T  S++ LWFMP NILL+F++GSAL WIL K+TR P HL+GL++G  +AGNMGNL 
Sbjct  61   AETITYQSLISLWFMPVNILLSFLIGSALAWILIKITRTPPHLQGLVIGCCSAGNMGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PA+C E  SPFG   VC +YG  YASLSMA+
Sbjct  121  LIIVPAVCEESNSPFGDTSVCSSYGKAYASLSMAV  155



>ref|XP_011030710.1| PREDICTED: uncharacterized transporter YBR287W-like [Populus 
euphratica]
 ref|XP_011030711.1| PREDICTED: uncharacterized transporter YBR287W-like [Populus 
euphratica]
Length=411

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 121/155 (78%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MG   L  V+ MPV+KVL+++ LG  LA++   ILG +AR HLN++V++V NPALV SNL
Sbjct  1    MGLWQLFVVSLMPVVKVLLMTTLGVFLATERMDILGTDARKHLNSLVYYVLNPALVGSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+ +TL S+ +LWFMP NI +TFI GSALGW+L K+T+AP HL+GLI+G  AAGN+GN+P
Sbjct  61   AKFITLKSIAMLWFMPLNIFITFIAGSALGWLLIKITKAPNHLRGLIVGCCAAGNLGNMP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPA C EK +PFG A +C  +G+ YA+LS+AI
Sbjct  121  LIIIPAACEEKDNPFGDASICKMHGLAYATLSLAI  155



>ref|XP_003520432.1| PREDICTED: uncharacterized transporter YBR287W-like [Glycine 
max]
Length=424

 Score =   195 bits (495),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 124/155 (80%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M F  L  VA +PVLKVL+I+A+G++LA +  +ILGE AR +LN MVF+VF+P LV S+L
Sbjct  1    MDFWKLFIVALLPVLKVLLITAVGTILAINRLNILGETARKNLNTMVFYVFSPTLVCSSL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++TL++VL+LWFMP NILLTF++GS LG ++ KLTR P HL+GL+LG  AAGN+GNLP
Sbjct  61   AETITLENVLILWFMPVNILLTFVIGSVLGLLVVKLTRVPHHLQGLVLGCCAAGNLGNLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +I++PA+C + GSPFG  +VC+   + YASLSMA+
Sbjct  121  IILVPAVCKQSGSPFGDVNVCYKNALAYASLSMAL  155



>dbj|BAK04863.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=411

 Score =   194 bits (493),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 120/155 (77%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MG L L   A MPVL +L+++ +GS LA+D A ILG+ AR HLN +VF+VFNP+L+ + L
Sbjct  1    MGLLELFVTACMPVLNMLLVTGVGSFLATDSAGILGKEARKHLNYVVFYVFNPSLISTYL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+++T++S+  LWFMP N+L TF  G   GWI+ K+TRAP  L+GLILG  +AGN+GN+ 
Sbjct  61   AKTITMESLAKLWFMPVNVLFTFTFGLIFGWIVIKVTRAPLKLRGLILGCCSAGNLGNIF  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPA+C EKGSPFGA DVC TYG+ Y+SLS+AI
Sbjct  121  LIIIPALCKEKGSPFGAPDVCQTYGLAYSSLSLAI  155



>gb|KHN44555.1| Putative transporter C5D6.04 [Glycine soja]
Length=424

 Score =   194 bits (494),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 124/155 (80%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M F  L  VA +PVLKVL+I+A+G++LA +  +ILGE AR +LN MVF+VF+P LV S+L
Sbjct  1    MDFWKLFIVALLPVLKVLLITAVGTILAINRFNILGETARKNLNTMVFYVFSPTLVCSSL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++TL++VL+LWFMP NILLTF++GS LG ++ KLTR P HL+GL+LG  AAGN+GNLP
Sbjct  61   AETITLENVLILWFMPVNILLTFVIGSVLGLLVVKLTRVPHHLQGLVLGCCAAGNLGNLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +I++PA+C + GSPFG  +VC+   + YASLSMA+
Sbjct  121  IILVPAVCKQSGSPFGDVNVCYKNALAYASLSMAL  155



>ref|XP_006849937.1| hypothetical protein AMTR_s00022p00124760 [Amborella trichopoda]
 gb|ERN11518.1| hypothetical protein AMTR_s00022p00124760 [Amborella trichopoda]
Length=285

 Score =   191 bits (484),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 119/147 (81%), Gaps = 0/147 (0%)
 Frame = +3

Query  135  VASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNLARSVTLDS  314
            VA+ PV+KVL+I+ALGS LA     ILG  A+ HLN +VFFVF PALV+S L++++T +S
Sbjct  9    VAAKPVVKVLIITALGSFLALGRVDILGPEAKEHLNRVVFFVFTPALVYSKLSKTITWNS  68

Query  315  VLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLPVIIIPAIC  494
            ++LLWFMP NILLTFI+GSALG +L K+T+ P HL+GLI+ + +AGN+GNL +II+PA+C
Sbjct  69   LMLLWFMPINILLTFIVGSALGCVLIKITKPPPHLRGLIISTCSAGNLGNLLLIIVPALC  128

Query  495  NEKGSPFGAADVCHTYGMVYASLSMAI  575
             E+GSPFG AD C +YG  YA+LSMAI
Sbjct  129  QEQGSPFGDADTCDSYGNAYAALSMAI  155



>gb|KEH27639.1| auxin efflux carrier family protein [Medicago truncatula]
Length=444

 Score =   194 bits (494),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 129/182 (71%), Gaps = 27/182 (15%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGFL L  VAS PV+KVL+++ +G LLA D+ ++LG++AR   N++V +VFNP L+  NL
Sbjct  1    MGFLELFSVASFPVIKVLLVTGIGLLLALDNINLLGKDARNQTNHLVHYVFNPGLIGGNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAA-------  449
            A+++TLD+V+ LWFMP NIL+TF+LGSALGWI+ KLT+ P+H++GLI+G  +A       
Sbjct  61   AQTITLDNVVSLWFMPVNILVTFLLGSALGWIIIKLTKPPRHIEGLIVGVCSAGRYISSL  120

Query  450  --------------------GNMGNLPVIIIPAICNEKGSPFGAADVCHTYGMVYASLSM  569
                                GN+GNLP+IIIPAIC +KGSPFG  DVC+ +GM YASLSM
Sbjct  121  HKKNMSMNIEPGSMSLLKVSGNLGNLPIIIIPAICKDKGSPFGDPDVCYQFGMAYASLSM  180

Query  570  AI  575
            AI
Sbjct  181  AI  182



>ref|XP_011099968.1| PREDICTED: uncharacterized transporter C5D6.04-like [Sesamum 
indicum]
 ref|XP_011099976.1| PREDICTED: uncharacterized transporter C5D6.04-like [Sesamum 
indicum]
Length=393

 Score =   193 bits (491),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 121/155 (78%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M FL L   +S+PVLKVL+++ LGS LA D   ILG++AR HLNN++FFVFNPALV SNL
Sbjct  1    MAFLDLFITSSIPVLKVLLVTGLGSYLALDRIGILGDDARKHLNNIIFFVFNPALVSSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+ +T +S++ +WFMPFNIL+TF++GS LG ++ ++T+AP HL+GL++G  AAGN+GNL 
Sbjct  61   AKEITYESMVKMWFMPFNILITFVIGSILGLVIVRITKAPPHLQGLVIGCCAAGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
             IIIP    E+ S FG ADVCH  GM YASLS+AI
Sbjct  121  FIIIPTARKERTSTFGDADVCHENGMAYASLSLAI  155



>ref|XP_006416347.1| hypothetical protein EUTSA_v10009415mg, partial [Eutrema salsugineum]
 gb|ESQ34700.1| hypothetical protein EUTSA_v10009415mg, partial [Eutrema salsugineum]
Length=401

 Score =   193 bits (490),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 123/155 (79%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L   +S+PV+K+L+I+A+G  LA D  +IL ++AR HLNN+VF+VF+P+LV S+L
Sbjct  19   MKLLDLFITSSIPVVKILVITAIGFYLALDRVNILNQDARKHLNNIVFYVFSPSLVGSSL  78

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            + ++T +S++ +WFMP N+LLTFI+GS LGWI+ K+T+ P HL G+I+G  AAGN+GN+P
Sbjct  79   SETITYESMVKMWFMPINVLLTFIIGSFLGWIVIKITKPPSHLHGIIVGCCAAGNLGNMP  138

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPAICNEKGSPFG  + C  YG+ Y +LSMA+
Sbjct  139  LIIIPAICNEKGSPFGDPETCEKYGLGYIALSMAV  173



>gb|EMS57690.1| hypothetical protein TRIUR3_00891 [Triticum urartu]
Length=384

 Score =   192 bits (488),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 119/155 (77%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MG L L   A MPVL +L+++ +GS LA+D A ILG+ AR HLN +VF+VFNPAL+ + L
Sbjct  1    MGLLELFITACMPVLNMLLVTGVGSFLATDSAGILGKEARKHLNYVVFYVFNPALIATYL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+++T++S+  LWFMP N+  TFI G  LGWI+ K+T AP  L+GLILG  +AGN+GN+ 
Sbjct  61   AKTITMESLAKLWFMPVNVFFTFIFGLILGWIVIKVTGAPLKLRGLILGCCSAGNLGNIF  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPA+C EKGSPFG  DVC TYG+ Y+SLS+AI
Sbjct  121  LIIIPALCKEKGSPFGTPDVCQTYGLAYSSLSLAI  155



>gb|KDO70033.1| hypothetical protein CISIN_1g014841mg [Citrus sinensis]
Length=417

 Score =   192 bits (488),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L +VA MP+LKVL+++ALG +LA D   +LG +    LNN+VF+VFNPAL+ SNL
Sbjct  1    MEILDLFEVALMPILKVLLVTALGLVLAIDRIDLLGHSVTHSLNNLVFYVFNPALIGSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++T  S++ LWFMP NILL+F++GSAL WIL K+TR P HL+GL++G  +AGNMGNL 
Sbjct  61   AETITYQSLISLWFMPVNILLSFLIGSALAWILIKITRTPPHLQGLVIGCCSAGNMGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PA+C E  SPFG   VC +YG  YASLSMA+
Sbjct  121  LIIVPAVCEESNSPFGDTSVCSSYGKAYASLSMAV  155



>ref|XP_006437709.1| hypothetical protein CICLE_v10031658mg [Citrus clementina]
 ref|XP_006484431.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Citrus sinensis]
 gb|ESR50949.1| hypothetical protein CICLE_v10031658mg [Citrus clementina]
Length=417

 Score =   192 bits (488),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L +VA MP+LKVL+++ALG +LA D   +LG +    LNN+VF+VFNPAL+ SNL
Sbjct  1    MEILDLFEVALMPILKVLLVTALGLVLAIDRIDLLGHSVTHSLNNLVFYVFNPALIGSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++T  S++ LWFMP NILL+F++GSAL WIL K+TR P HL+GL++G  +AGNMGNL 
Sbjct  61   AETITYQSLISLWFMPVNILLSFLIGSALAWILIKITRTPPHLQGLVIGCCSAGNMGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PA+C E  SPFG   VC +YG  YASLSMA+
Sbjct  121  LIIVPAVCEESNSPFGDTSVCSSYGKAYASLSMAV  155



>ref|XP_007010159.1| Auxin efflux carrier family protein [Theobroma cacao]
 gb|EOY18969.1| Auxin efflux carrier family protein [Theobroma cacao]
Length=407

 Score =   192 bits (487),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 121/155 (78%), Gaps = 2/155 (1%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGFL L  VA MPVLKVL+++ +G  LA+D  ++LG  AR +LN +VF++F P+LV SNL
Sbjct  1    MGFLDLFVVAVMPVLKVLLVTGVGLFLATDGINLLGPEARNYLNKIVFYLFGPSLVVSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A +VTL+S++ +WFMP NI LTFI+GSALGWIL K+T+ P+HL+G+++G  +AGN+GNL 
Sbjct  61   AETVTLESLVTMWFMPVNIFLTFIIGSALGWILIKITKTPEHLRGMVIGCCSAGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PA+C E  +PFG  D C TY   YASLSMA+
Sbjct  121  LIIVPAVCTESNTPFG--DSCSTYAEAYASLSMAV  153



>ref|XP_011027947.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized transporter C5D6.04-like 
[Populus euphratica]
Length=420

 Score =   191 bits (485),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 122/155 (79%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M    L  VA MPVLKVL+++A+G  LA +   ILG  AR HLNN+VF+V +PALV S+L
Sbjct  1    MDIWKLFFVALMPVLKVLLLTAVGVFLAIERVGILGAEARNHLNNLVFYVLSPALVGSSL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+ VTL S+L LWFMP N+L+TFI+GS LGW+L K+T AP+ ++G+ILGS AAGN+G +P
Sbjct  61   AKFVTLRSLLELWFMPLNVLMTFIIGSVLGWLLVKITNAPKRMRGMILGSCAAGNLGAIP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +I+IPA+C EKGSPFG ++ C+T G+ YASLSMAI
Sbjct  121  LILIPAVCKEKGSPFGDSNACNTRGLAYASLSMAI  155



>gb|EMT00616.1| Putative transporter [Aegilops tauschii]
Length=411

 Score =   191 bits (484),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MG L L   A MPVL +L+++ +GS LA+D   ILG+ AR HLN +VF+VFNPAL+ + L
Sbjct  1    MGLLELFITACMPVLNMLLVTGVGSFLATDSVGILGKEARKHLNYVVFYVFNPALIATYL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+++T++S+  LWFMP N+  TFI G   GWI+ K+T AP  L+GLILG  +AGN+GN+ 
Sbjct  61   AKTITMESMARLWFMPVNVFFTFIFGLIFGWIVIKVTGAPLKLRGLILGCCSAGNLGNIF  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPA+C EKGSPFGA DVC TYG+ Y+SLS+AI
Sbjct  121  LIIIPALCKEKGSPFGAPDVCQTYGLAYSSLSLAI  155



>ref|XP_002890416.1| auxin efflux carrier family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66675.1| auxin efflux carrier family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=386

 Score =   190 bits (482),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 121/155 (78%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L   +S+PV K+L+I+ +G  LA D  +IL ++AR  LNN+VF+VF+P+LV S+L
Sbjct  3    MRLLDLFITSSIPVAKILLITGIGFYLALDQVNILNQDARKQLNNIVFYVFSPSLVASSL  62

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            + ++T +S++ +WFMP N+LLTFI+GS LGWI+ K+T+ P HL+G+I+G  AAGN+GN+P
Sbjct  63   SETITYESMVKMWFMPLNVLLTFIIGSFLGWIVIKITKPPSHLRGIIVGCCAAGNLGNMP  122

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPAICNEKGSPFG  + C  YG+ Y +LSMAI
Sbjct  123  LIIIPAICNEKGSPFGDPESCEKYGLGYIALSMAI  157



>ref|XP_006304763.1| hypothetical protein CARUB_v10012230mg [Capsella rubella]
 gb|EOA37661.1| hypothetical protein CARUB_v10012230mg [Capsella rubella]
Length=384

 Score =   190 bits (482),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 122/155 (79%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L   +S+PV K+LMI+ +G  LA D  +IL ++AR  LNN+VF+VF+P+LV S+L
Sbjct  1    MRLLDLFITSSIPVAKILMITGIGFYLAMDRVNILNQDARKQLNNIVFYVFSPSLVASSL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++T +S++ +WFMP N+LLTFI+GS LGW++ K+T+ P HL+G+I+G  AAGN+GN+P
Sbjct  61   AATITYESMVKMWFMPINVLLTFIIGSFLGWVVIKITKPPPHLRGIIVGCCAAGNLGNMP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPAICNEKGSPFG ++ C  +G+ Y +LSMAI
Sbjct  121  LIIIPAICNEKGSPFGDSESCQKFGLGYVALSMAI  155



>ref|XP_009149573.1| PREDICTED: uncharacterized transporter YBR287W [Brassica rapa]
Length=383

 Score =   189 bits (481),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 121/155 (78%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L   +S+PV K+L+I+ +G  LA D  +IL ++AR  LNN+VF+VF+P+LV S+L
Sbjct  1    MKLLDLFITSSIPVGKILVITGIGFYLALDRVNILNQDARKQLNNIVFYVFSPSLVASSL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++T +S++ +WFMP N++LTFI+GS LGW++ K+T+ P HL+G+I+G  AAGN+GN+P
Sbjct  61   AETITYESLVKMWFMPLNVVLTFIIGSFLGWLVIKITKPPSHLRGIIVGCCAAGNLGNMP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPAICNEKGSPFG  + C  YG+ Y +LSMAI
Sbjct  121  LIIIPAICNEKGSPFGDPETCEKYGLGYVALSMAI  155



>emb|CDY29492.1| BnaA06g14780D [Brassica napus]
Length=383

 Score =   189 bits (480),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 121/155 (78%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L   +S+PV K+L+I+ +G  LA D  +IL ++AR  LNN+VF+VF+P+LV S+L
Sbjct  1    MKLLDLFITSSIPVGKILVITGIGFYLALDRVNILNQDARKQLNNIVFYVFSPSLVASSL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++T +S++ +WFMP N++LTFI+GS LGW++ K+T+ P HL+G+I+G  AAGN+GN+P
Sbjct  61   AETITYESLVKMWFMPLNVVLTFIIGSFLGWLVIKVTKPPSHLRGIIVGCCAAGNLGNMP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPAICNEKGSPFG  + C  YG+ Y +LSMAI
Sbjct  121  LIIIPAICNEKGSPFGDPETCEKYGLGYVALSMAI  155



>gb|KHG24872.1| putative transporter C5D6.04 [Gossypium arboreum]
Length=417

 Score =   190 bits (482),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 120/154 (78%), Gaps = 0/154 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGFL LL VA +PV+KVL I+ +G  LA D  ++LG +AR HLN +VF+VF PALV +NL
Sbjct  1    MGFLDLLLVALIPVIKVLFITGVGLFLALDRVNLLGPDARNHLNKIVFYVFGPALVATNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+++T +S++ LWFMP NILLTF++GSAL W+L K+TR P+HL+G+++G  +AGN+GNLP
Sbjct  61   AQTITYESLVTLWFMPVNILLTFMIGSALAWLLIKITRTPKHLQGMVIGCCSAGNLGNLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMA  572
            +II+P++C E  +PFG +  C +    YASLSMA
Sbjct  121  LIIVPSVCEESNNPFGESSTCFSNAQAYASLSMA  154



>gb|KDO70034.1| hypothetical protein CISIN_1g014841mg [Citrus sinensis]
Length=416

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 116/153 (76%), Gaps = 0/153 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L +VA MP+LKVL+++ALG +LA D   +LG +    LNN+VF+VFNPAL+ SNL
Sbjct  1    MEILDLFEVALMPILKVLLVTALGLVLAIDRIDLLGHSVTHSLNNLVFYVFNPALIGSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++T  S++ LWFMP NILL+F++GSAL WIL K+TR P HL+GL++G  +AGNMGNL 
Sbjct  61   AETITYQSLISLWFMPVNILLSFLIGSALAWILIKITRTPPHLQGLVIGCCSAGNMGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSM  569
            +II+PA+C E  SPFG   VC +YG  YASLSM
Sbjct  121  LIIVPAVCEESNSPFGDTSVCSSYGKAYASLSM  153



>ref|XP_006589306.1| PREDICTED: uncharacterized transporter YBR287W-like [Glycine 
max]
Length=400

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 117/155 (75%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M    L   A MPVLKVL+I+A+G+ LA    +IL E+AR HLN +V+FVF PALV S L
Sbjct  1    MELWKLFVTALMPVLKVLLITAVGTFLALHRFNILRESARKHLNTIVYFVFTPALVCSIL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A++ T  S++ +WFMP NILLTFI+G+ LGW+  K+T+AP  ++GL+LG  AAGN+GNLP
Sbjct  61   AKTTTFKSLVAVWFMPLNILLTFIIGTTLGWLFMKITKAPPDMQGLVLGCCAAGNLGNLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PA+C E  SPFGA DVC+  GM YASLSMA+
Sbjct  121  LIIVPAVCKESSSPFGAVDVCNKKGMAYASLSMAV  155



>ref|XP_011027948.1| PREDICTED: uncharacterized transporter C5D6.04-like [Populus 
euphratica]
Length=420

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 121/155 (78%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M    L  VA MPVLKVL+++A+G  LA +   ILG +AR HLNN+VF+V  PALV S+L
Sbjct  1    MDIWKLFFVALMPVLKVLLLTAVGVFLAIERVGILGADARNHLNNLVFYVLGPALVGSSL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+ VTL S+L LWFMP N+L+TFI+GS LGW+L K+T AP+ ++G+ILG  AAGN+G +P
Sbjct  61   AKFVTLKSLLELWFMPLNVLMTFIIGSVLGWLLVKITNAPKRMRGMILGFCAAGNLGAIP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +I+IPA+C EKGSPFG ++ C+T G+ YASLSMAI
Sbjct  121  LILIPAVCKEKGSPFGDSNACNTRGLAYASLSMAI  155



>ref|XP_004300096.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Fragaria vesca subsp. vesca]
Length=406

 Score =   189 bits (479),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 116/155 (75%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M   +L   AS+PVL+  +I+ALGS LA D  ++LG ++R HLN ++F+V  PAL+ +NL
Sbjct  1    MNLWTLFVTASIPVLESFLITALGSYLALDRVNLLGPDSRNHLNTILFYVCTPALIGANL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++T +S++ LWFMP NI LTF++GS  GWIL KLTR P HL+GL+LG  AAGN+GNL 
Sbjct  61   AETITYESLVKLWFMPVNIFLTFMVGSIFGWILMKLTRTPPHLRGLVLGCCAAGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPA+C E GSPFG AD C T G  YASLSMAI
Sbjct  121  LIIIPAVCEESGSPFGDADTCDTTGTTYASLSMAI  155



>emb|CDY31514.1| BnaC05g16230D [Brassica napus]
Length=478

 Score =   191 bits (484),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 128/171 (75%), Gaps = 4/171 (2%)
 Frame = +3

Query  63   LITKKIFTLERRERFGMGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLN  242
            L+  K+ + E R    M  L L   +S+PV K+L+I+ +G  LA D  +IL ++AR  LN
Sbjct  84   LVISKLSSDETR----MKLLDLFITSSIPVGKILVITGIGFYLALDRVNILNQDARKQLN  139

Query  243  NMVFFVFNPALVFSNLARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLK  422
            N+VF+VF+P+LV S+LA ++T +S++ +WFMP N++LTFI+GS LGW++ K+T+ P HL+
Sbjct  140  NIVFYVFSPSLVASSLAETITYESLVKMWFMPLNVVLTFIIGSFLGWLVIKITKPPYHLR  199

Query  423  GLILGSSAAGNMGNLPVIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            G+I+G  AAGN+GN+P+IIIPAICNEKGSPFG  + C  YG+ Y +LSMAI
Sbjct  200  GIIVGCCAAGNLGNMPLIIIPAICNEKGSPFGDPETCEKYGLGYVALSMAI  250



>gb|KJB60446.1| hypothetical protein B456_009G306100 [Gossypium raimondii]
 gb|KJB60447.1| hypothetical protein B456_009G306100 [Gossypium raimondii]
 gb|KJB60448.1| hypothetical protein B456_009G306100 [Gossypium raimondii]
Length=417

 Score =   189 bits (479),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 119/154 (77%), Gaps = 0/154 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGFL LL VA +PV+KVL I+ +G  LA D  ++LG +AR HLN +VF+VF PALV +NL
Sbjct  1    MGFLDLLLVALIPVIKVLFITGVGLFLALDRVNLLGPDARNHLNKIVFYVFGPALVATNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A++ T +S++ LWFMP NILLTF++GSAL W+L K+TR P+HL+G+++G  +AGN+GNLP
Sbjct  61   AQTTTYESLVTLWFMPVNILLTFMIGSALAWLLIKITRTPKHLQGMVIGCCSAGNLGNLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMA  572
            +II+P++C E  +PFG +  C +    YASLSMA
Sbjct  121  LIIVPSVCEESNNPFGESSTCFSNAQAYASLSMA  154



>ref|XP_010680488.1| PREDICTED: uncharacterized transporter YBR287W-like [Beta vulgaris 
subsp. vulgaris]
Length=399

 Score =   187 bits (476),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 121/155 (78%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGFL+L  VA MPVLK LM++A+G +LA D  ++LG  AR +LNNMVF+VF+P L+ + L
Sbjct  1    MGFLALFMVALMPVLKTLMLTAVGVVLAMDRINLLGPTARHNLNNMVFYVFSPCLMGAYL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            AR+VT+D ++ +WFMP NIL+TF++GSALGWIL K+T+AP +L GL++G  AAGN+GNL 
Sbjct  61   ARTVTVDVMIDMWFMPVNILITFVIGSALGWILIKITKAPHNLHGLVIGCCAAGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +I+IPAICNE  +PFG   VC   G  Y S+SMA+
Sbjct  121  LIVIPAICNEPKNPFGEYSVCMADGAAYVSVSMAV  155



>gb|EEC84799.1| hypothetical protein OsI_31863 [Oryza sativa Indica Group]
Length=413

 Score =   188 bits (477),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 119/155 (77%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MG L L   A +PVL +L+++ +GS LA+D   IL ++AR +LNN+VF+VFNP+LV + L
Sbjct  1    MGLLELFITACVPVLNMLLVTGVGSFLATDFVGILNKDARKYLNNIVFYVFNPSLVATYL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+++TL+S+  LWFMP NILL    G  LGWI+  +TRAP  L+GLILG  +AGN GN+ 
Sbjct  61   AQTITLESLAKLWFMPVNILLACTFGLILGWIVVHVTRAPARLRGLILGCCSAGNWGNIF  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPA+C EKGSPFGA DVCHTYG+ Y+SLSMA+
Sbjct  121  LIIIPALCKEKGSPFGAPDVCHTYGLAYSSLSMAL  155



>dbj|BAH57041.1| AT1G76520 [Arabidopsis thaliana]
Length=255

 Score =   183 bits (464),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 117/151 (77%), Gaps = 0/151 (0%)
 Frame = +3

Query  120  LSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNLARS  299
            L L   +S PV+++L+I+++G  +A D  ++LG +AR +LNN+VF+VF+P+L+ S LA S
Sbjct  5    LELFITSSKPVVEILLITSVGFYMALDGVNLLGHDARKYLNNIVFYVFSPSLIGSRLADS  64

Query  300  VTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLPVII  479
            VT +S++ +WFMP N+LLTFI+GS LGWI+  +T+ P HL+GLILG  AAGN+GN+P+II
Sbjct  65   VTYESLVKMWFMPVNVLLTFIIGSLLGWIVIVITKPPSHLRGLILGCCAAGNLGNMPLII  124

Query  480  IPAICNEKGSPFGAADVCHTYGMVYASLSMA  572
            IPA+C EKG PFG  + C  YGM Y +LSMA
Sbjct  125  IPAVCKEKGGPFGDPESCQKYGMGYVALSMA  155



>ref|XP_004957210.1| PREDICTED: uncharacterized protein LOC101771023 [Setaria italica]
Length=415

 Score =   187 bits (475),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 116/155 (75%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MG L L   A +PV  +L+++ +GS LA+D A IL + AR HLNN+VF+VFNP+LV   L
Sbjct  1    MGLLELFVTACVPVFNMLLVTGVGSFLATDFAGILSKEARKHLNNIVFYVFNPSLVAIYL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+++T++S+  LWFMP NILL F  G   GWI+ K+TR P  L+GLILG  +AGN+GN+ 
Sbjct  61   AKTITMESLAKLWFMPVNILLAFTFGLFFGWIVVKVTRVPAKLRGLILGCCSAGNLGNIF  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPA+C EKGSPFG  DVC TYG+ Y+SLSMAI
Sbjct  121  LIIIPALCKEKGSPFGEHDVCQTYGLAYSSLSMAI  155



>ref|XP_010679878.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=398

 Score =   187 bits (474),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 120/155 (77%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L  +AS+PV+KVL+I+A+GS+LA +   ILGENAR HLN +VF+VFNP+LV  NL
Sbjct  1    MALLDLFVLASLPVVKVLLITAIGSVLALERIDILGENARHHLNKVVFYVFNPSLVAGNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A++VT +S + LWFMP NIL+TFI+GS LG I+ K      +LKGL++G+ +AGN+G + 
Sbjct  61   AKTVTFESFITLWFMPVNILMTFIIGSVLGCIIVKAAGVRNNLKGLVIGACSAGNLGGML  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +I++PA+C EKG+PFG  DVC TY + YASLS+AI
Sbjct  121  IILVPAMCKEKGNPFGETDVCETYALSYASLSLAI  155



>ref|XP_010679877.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=406

 Score =   186 bits (473),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 120/155 (77%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L  +AS+PV+KVL+I+A+GS+LA +   ILGENAR HLN +VF+VFNP+LV  NL
Sbjct  1    MALLDLFVLASLPVVKVLLITAIGSVLALERIDILGENARHHLNKVVFYVFNPSLVAGNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A++VT +S + LWFMP NIL+TFI+GS LG I+ K      +LKGL++G+ +AGN+G + 
Sbjct  61   AKTVTFESFITLWFMPVNILMTFIIGSVLGCIIVKAAGVRNNLKGLVIGACSAGNLGGML  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +I++PA+C EKG+PFG  DVC TY + YASLS+AI
Sbjct  121  IILVPAMCKEKGNPFGETDVCETYALSYASLSLAI  155



>ref|NP_001175916.1| Os09g0491740 [Oryza sativa Japonica Group]
 dbj|BAG93407.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH94644.1| Os09g0491740 [Oryza sativa Japonica Group]
Length=379

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MG L L   A +PVL +L+++ +GS LA+D   IL ++AR +LNN+VF+VFNP+LV + L
Sbjct  1    MGLLELFITACVPVLNMLLVTGVGSFLATDFVGILNKDARKYLNNIVFYVFNPSLVATYL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+++TL+ +  LWFMP NILL    G  LGWI+  +TRAP  L+GLILG  +AGN GN+ 
Sbjct  61   AQTITLEGLAKLWFMPVNILLACTFGLILGWIVVHVTRAPARLRGLILGCCSAGNWGNIF  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPA+C EKGSPFGA DVCHTYG+ Y+SLSMA+
Sbjct  121  LIIIPALCKEKGSPFGAPDVCHTYGLAYSSLSMAL  155



>ref|XP_010428716.1| PREDICTED: uncharacterized transporter YBR287W-like [Camelina 
sativa]
Length=393

 Score =   186 bits (472),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 119/155 (77%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L   +  PV+++L+I+++G  LA D  ++LG++AR HLNN+VF+VF+P L+ S L
Sbjct  2    MKILDLFITSLKPVVEILLITSVGFYLALDGVNLLGQDARKHLNNIVFYVFSPTLIGSRL  61

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A SVT +S++ +WFMP N+L TF++GS LGW++  +T+ PQHL+GLI+G SAAGN+GNLP
Sbjct  62   ADSVTYESLVKMWFMPVNVLFTFMIGSFLGWLVVVITKPPQHLRGLIVGCSAAGNLGNLP  121

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PA+C EKG PFG  + C  YG+ Y SLSMAI
Sbjct  122  LIIVPAVCKEKGGPFGDPESCQKYGLGYVSLSMAI  156



>gb|EEE69960.1| hypothetical protein OsJ_29847 [Oryza sativa Japonica Group]
Length=413

 Score =   186 bits (472),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MG L L   A +PVL +L+++ +GS LA+D   IL ++AR +LNN+VF+VFNP+LV + L
Sbjct  1    MGLLELFITACVPVLNMLLVTGVGSFLATDFVGILNKDARKYLNNIVFYVFNPSLVATYL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+++TL+ +  LWFMP NILL    G  LGWI+  +TRAP  L+GLILG  +AGN GN+ 
Sbjct  61   AQTITLEGLAKLWFMPVNILLACTFGLILGWIVVHVTRAPARLRGLILGCCSAGNWGNIF  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPA+C EKGSPFGA DVCHTYG+ Y+SLSMA+
Sbjct  121  LIIIPALCKEKGSPFGAPDVCHTYGLAYSSLSMAL  155



>ref|NP_683316.2| auxin efflux carrier-like protein [Arabidopsis thaliana]
 gb|AEE30042.1| auxin efflux carrier-like protein [Arabidopsis thaliana]
Length=472

 Score =   187 bits (475),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 120/155 (77%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L   +S+PV K+L+I+ +G  LA D  +IL  +AR  LNN+VF+VF+P+LV S+L
Sbjct  89   MRLLDLFITSSIPVAKILLITGIGFYLALDQVNILNHDARKQLNNIVFYVFSPSLVASSL  148

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            + ++T +S++ +WFMP N+LLTFI+GS LGWI+ K+T+ P HL+G+I+G  AAGN+GN+P
Sbjct  149  SETITYESMVKMWFMPLNVLLTFIIGSFLGWIVIKITKPPSHLRGIIVGCCAAGNLGNMP  208

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPAICNEKGSPFG  + C  +G+ Y +LSMAI
Sbjct  209  LIIIPAICNEKGSPFGDPESCEKFGLGYIALSMAI  243



>ref|XP_004231634.1| PREDICTED: uncharacterized protein LOC101264385 [Solanum lycopersicum]
Length=396

 Score =   185 bits (470),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 117/155 (75%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M F+ L  VA MPVLK L+I+A+G LLA +  ++LG  AR HLNN+VF++F PALV S+L
Sbjct  1    MAFVELFVVALMPVLKTLIITAVGLLLALEPVNLLGSTARHHLNNLVFYIFTPALVASSL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A +VT  +++ LWFMP NILLTFI+GS LGWIL K+T+ P HL GL++   +AGN+GNL 
Sbjct  61   AETVTSSNIVSLWFMPVNILLTFIIGSILGWILVKITKTPIHLHGLVISCCSAGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPA+C EK SPFG +  C T G  YASLSMA+
Sbjct  121  LIIIPAVCEEKNSPFGDSITCSTNGKAYASLSMAV  155



>ref|XP_002462579.1| hypothetical protein SORBIDRAFT_02g028510 [Sorghum bicolor]
 gb|EER99100.1| hypothetical protein SORBIDRAFT_02g028510 [Sorghum bicolor]
Length=414

 Score =   185 bits (470),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 117/155 (75%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L   A +PV  +L+++ +GS LA+D A IL + AR HLNN+VF+VF+P+LV   L
Sbjct  1    MDLLELFVTACVPVFNMLLVTGVGSFLATDFAGILSKEARKHLNNIVFYVFSPSLVAIYL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+++T++S+  LWFMP NILL F  G + GWI+ K+TRAP  L+GLILG  +AGN+GN+ 
Sbjct  61   AKTITMESLAKLWFMPVNILLAFTFGLSFGWIVVKVTRAPAKLRGLILGCCSAGNLGNIF  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPA+C EKGSPFGAADVC   G+ Y+SLSMAI
Sbjct  121  LIIIPALCQEKGSPFGAADVCQNIGLAYSSLSMAI  155



>gb|KCW76787.1| hypothetical protein EUGRSUZ_D01141 [Eucalyptus grandis]
Length=320

 Score =   183 bits (464),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 123/155 (79%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MG L L  VA MPVLKVL+++A+GSLLA +  ++LG +A+ H+NN+VF++F+P+L+ S L
Sbjct  1    MGVLDLFVVALMPVLKVLLVTAVGSLLAMERVNLLGRDAKQHVNNLVFYIFSPSLIASKL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++TL S++ LWFMP NILLTFI+GSAL W+L KLTR P+HL+ L++G  AAGN+GNL 
Sbjct  61   ADTITLSSLVTLWFMPVNILLTFIIGSALAWVLIKLTRTPRHLQSLVIGCCAAGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PA+C E  SPFG +  C TYG  YASLSMAI
Sbjct  121  LIILPAVCTETNSPFGDSSTCSTYGEAYASLSMAI  155



>ref|XP_002462580.1| hypothetical protein SORBIDRAFT_02g028520 [Sorghum bicolor]
 gb|EER99101.1| hypothetical protein SORBIDRAFT_02g028520 [Sorghum bicolor]
Length=414

 Score =   185 bits (470),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 117/155 (75%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MG + L   A +PV  +L+I+ +GS LA+D A IL + AR +LNN+VF+VFNP+LV   L
Sbjct  1    MGLIELFATACVPVFNMLLITGVGSFLATDFAGILSKEARKYLNNIVFYVFNPSLVAIYL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+++T++S+  LWFMP NILL FI G   GWI+ K+TRAP  LKGLILG  +AGN+GN+ 
Sbjct  61   AKTITMESLAKLWFMPVNILLAFIFGLFFGWIVVKVTRAPAKLKGLILGCCSAGNLGNIF  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPA+C EKGSPFGA DVC   G+ Y+SLS+AI
Sbjct  121  LIIIPALCKEKGSPFGAPDVCQDIGLAYSSLSLAI  155



>ref|XP_002317029.1| hypothetical protein POPTR_0011s14860g [Populus trichocarpa]
 gb|EEE97641.1| hypothetical protein POPTR_0011s14860g [Populus trichocarpa]
Length=388

 Score =   184 bits (468),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 114/155 (74%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGFL L   A MPVLKVL+I+ LG  LA D   +LG NAR ++NN+VF++F PALV S L
Sbjct  1    MGFLDLFVAALMPVLKVLLITGLGLFLALDRIDLLGANARHYMNNLVFYLFGPALVVSQL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
              ++T  S+  LWFMP NILLTF++GS L WIL K+T+ P HL+GL++G  +AGN+GNL 
Sbjct  61   GETITFQSLNTLWFMPVNILLTFMIGSILAWILIKITKTPPHLQGLVIGCCSAGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PA+C E  SPFG + +C T G  YASLSMA+
Sbjct  121  LIIVPAVCMESNSPFGDSTICSTNGTTYASLSMAV  155



>ref|XP_006377867.1| hypothetical protein POPTR_0011s14860g [Populus trichocarpa]
 gb|ERP55664.1| hypothetical protein POPTR_0011s14860g [Populus trichocarpa]
Length=405

 Score =   185 bits (469),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 114/155 (74%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGFL L   A MPVLKVL+I+ LG  LA D   +LG NAR ++NN+VF++F PALV S L
Sbjct  1    MGFLDLFVAALMPVLKVLLITGLGLFLALDRIDLLGANARHYMNNLVFYLFGPALVVSQL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
              ++T  S+  LWFMP NILLTF++GS L WIL K+T+ P HL+GL++G  +AGN+GNL 
Sbjct  61   GETITFQSLNTLWFMPVNILLTFMIGSILAWILIKITKTPPHLQGLVIGCCSAGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PA+C E  SPFG + +C T G  YASLSMA+
Sbjct  121  LIIVPAVCMESNSPFGDSTICSTNGTTYASLSMAV  155



>ref|XP_002887644.1| hypothetical protein ARALYDRAFT_895536 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63903.1| hypothetical protein ARALYDRAFT_895536 [Arabidopsis lyrata subsp. 
lyrata]
Length=391

 Score =   184 bits (468),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 118/153 (77%), Gaps = 0/153 (0%)
 Frame = +3

Query  117  FLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNLAR  296
             L L   +S PV+++L+I+++G  +A D  ++LG++AR +LNN+VF+VF P+L+ S LA 
Sbjct  4    LLELFITSSKPVVEILLITSVGFYMALDGVNLLGQDARKYLNNIVFYVFGPSLIGSRLAD  63

Query  297  SVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLPVI  476
            SVT +S++ +WFMP N+LLTFI+GS LGWI+  +T+ P HL+GLILG  AAGN+GN+P+I
Sbjct  64   SVTYESLVKMWFMPVNVLLTFIIGSLLGWIVIVITKPPSHLRGLILGCCAAGNLGNMPLI  123

Query  477  IIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            IIPA+C EKG PFG  + C  YGM Y +LSMA+
Sbjct  124  IIPAVCKEKGGPFGDPESCQKYGMGYVALSMAM  156



>ref|XP_009762862.1| PREDICTED: uncharacterized protein LOC104214838 isoform X2 [Nicotiana 
sylvestris]
Length=353

 Score =   183 bits (465),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 116/155 (75%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M F+ L  VA +PVLK L+I+A+G  LA +  ++LG  AR HLNN+VF++F PALV S+L
Sbjct  1    MAFVDLFVVALVPVLKTLIITAVGLFLALERVNLLGSTARHHLNNLVFYIFTPALVASSL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A +VT  +++ LWFMP NILLTFI+GSALGW+L K+TR P  L GL++   AAGN+GNL 
Sbjct  61   AETVTSSNIVSLWFMPVNILLTFIIGSALGWLLVKITRTPIELHGLVISCCAAGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPA+C EK SPFG +  C T G  YASLSMAI
Sbjct  121  LIIIPAVCVEKNSPFGDSVTCSTNGKAYASLSMAI  155



>gb|KDO71544.1| hypothetical protein CISIN_1g013221mg [Citrus sinensis]
 gb|KDO71545.1| hypothetical protein CISIN_1g013221mg [Citrus sinensis]
Length=278

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 121/155 (78%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGF +  +VASMP+++VL+IS LG+L+A+ + ++L  +AR  LN MVF VF P+L+F++L
Sbjct  1    MGFWTFFEVASMPIVQVLLISVLGALMATQYWNLLTADARRSLNKMVFTVFTPSLMFASL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A++VTL+ ++  WFMP N+ +TF++G  LGWI+ KL R   HL+GL++ + A+GN+GNL 
Sbjct  61   AKTVTLEEIISWWFMPVNVAMTFLIGGILGWIVVKLLRPKPHLEGLVIATCASGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PAIC+E+GSPFG  DVC + G+ YAS SMA+
Sbjct  121  LIIVPAICHEQGSPFGNRDVCSSVGLSYASFSMAL  155



>ref|XP_007010169.1| Auxin efflux carrier family protein [Theobroma cacao]
 gb|EOY18979.1| Auxin efflux carrier family protein [Theobroma cacao]
Length=446

 Score =   185 bits (470),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 119/161 (74%), Gaps = 1/161 (1%)
 Frame = +3

Query  96   RERF-GMGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPA  272
            RE F  MGFL+L  VA MPVLK+++I+A+G LLA D   +LG  A+ HLN +VF+VF+PA
Sbjct  33   RETFLQMGFLNLFIVAVMPVLKIILITAIGLLLALDRVKLLGPEAKHHLNKIVFYVFSPA  92

Query  273  LVFSNLARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAG  452
            L  S+LA ++T  S   LWFMP NIL+TF+LGSAL W+L K TR P+HL+G+++G  +AG
Sbjct  93   LAASSLAETMTFKSFTTLWFMPVNILITFVLGSALAWLLIKFTRTPKHLQGIVIGCCSAG  152

Query  453  NMGNLPVIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            N+ NLP+I++PA+C E  +PFG   VC T    YASLS++I
Sbjct  153  NLANLPLIMVPAVCEEPSNPFGDQSVCSTNAKPYASLSLSI  193



>ref|NP_565133.1| auxin efflux carrier family protein [Arabidopsis thaliana]
 ref|NP_849892.1| auxin efflux carrier family protein [Arabidopsis thaliana]
 gb|AAG51955.1|AC015450_16 unknown protein; 51686-53591 [Arabidopsis thaliana]
 gb|AAM20576.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15614.1| unknown protein [Arabidopsis thaliana]
 dbj|BAE98969.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE35854.1| auxin efflux carrier family protein [Arabidopsis thaliana]
 gb|AEE35855.1| auxin efflux carrier family protein [Arabidopsis thaliana]
Length=390

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 118/153 (77%), Gaps = 0/153 (0%)
 Frame = +3

Query  117  FLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNLAR  296
             L L   +S PV+++L+I+++G  +A D  ++LG +AR +LNN+VF+VF+P+L+ S LA 
Sbjct  4    LLELFITSSKPVVEILLITSVGFYMALDGVNLLGHDARKYLNNIVFYVFSPSLIGSRLAD  63

Query  297  SVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLPVI  476
            SVT +S++ +WFMP N+LLTFI+GS LGWI+  +T+ P HL+GLILG  AAGN+GN+P+I
Sbjct  64   SVTYESLVKMWFMPVNVLLTFIIGSLLGWIVIVITKPPSHLRGLILGCCAAGNLGNMPLI  123

Query  477  IIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            IIPA+C EKG PFG  + C  YGM Y +LSMA+
Sbjct  124  IIPAVCKEKGGPFGDPESCQKYGMGYVALSMAM  156



>gb|AAM62517.1| unknown [Arabidopsis thaliana]
Length=390

 Score =   183 bits (465),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 118/153 (77%), Gaps = 0/153 (0%)
 Frame = +3

Query  117  FLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNLAR  296
             L L   +S PV+++L+I+++G  +A D  ++LG +AR +LNN+VF+VF+P+L+ S LA 
Sbjct  4    LLELFITSSKPVVEILLITSVGFYMALDGVNLLGHDARKYLNNIVFYVFSPSLIGSRLAD  63

Query  297  SVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLPVI  476
            SVT +S++ +WFMP N+LLTFI+GS LGWI+  +T+ P HL+GLILG  AAGN+GN+P+I
Sbjct  64   SVTYESLVKMWFMPVNVLLTFIIGSLLGWIVIVITKPPSHLRGLILGCCAAGNLGNMPLI  123

Query  477  IIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            IIPA+C EKG PFG  + C  YGM Y +LSMA+
Sbjct  124  IIPAVCKEKGGPFGDPESCQKYGMGYVALSMAM  156



>ref|XP_009106321.1| PREDICTED: uncharacterized transporter YBR287W-like [Brassica 
rapa]
Length=389

 Score =   183 bits (465),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 120/155 (77%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L+L   +S PV+++L+I+ +G  LA D  ++LG++AR +LNN+VF+VF+P+L+ S L
Sbjct  2    MKLLNLFITSSKPVVEILLITIVGFYLALDGVNLLGQDARKYLNNIVFYVFSPSLIGSRL  61

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A SVT +S++ +WFMP N+LLTFI+GS LGWI+  +T+ P HL+GLI+G  AAGN+GN+P
Sbjct  62   ADSVTYESLVKMWFMPVNVLLTFIIGSLLGWIVIVITKPPSHLRGLIVGCCAAGNLGNMP  121

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PAIC E+G PFG  + C  YGM Y +LSMA+
Sbjct  122  LIIVPAICKERGGPFGDPENCQKYGMGYVALSMAM  156



>ref|XP_006350447.1| PREDICTED: uncharacterized transporter YBR287W-like [Solanum 
tuberosum]
Length=396

 Score =   183 bits (465),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 116/155 (75%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M F+ L  VA +PVLK L+I+A+G  LA +  ++LG  AR HLNN+VF++F PALV S+L
Sbjct  1    MAFVELFVVALVPVLKTLIITAVGLFLALERINLLGSTARHHLNNLVFYIFTPALVASSL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A +VT  +++ LWFMP NILLTFI+GS LGWIL K+T+ P HL GL++   +AGN+GNL 
Sbjct  61   AETVTSSNIVSLWFMPVNILLTFIIGSVLGWILVKITKTPIHLHGLVISCCSAGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPA+C EK SPFG +  C T G  YASLSMA+
Sbjct  121  LIIIPAVCEEKNSPFGDSITCSTNGKAYASLSMAV  155



>ref|XP_007010173.1| Auxin efflux carrier family protein [Theobroma cacao]
 gb|EOY18983.1| Auxin efflux carrier family protein [Theobroma cacao]
Length=408

 Score =   184 bits (466),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGFL+L  VA MPVLK+++I+A+G LLA D   +LG  A+ HLNN+VF+VF+PAL  S+L
Sbjct  1    MGFLNLFIVAVMPVLKIILITAIGLLLALDRMKLLGPEAKHHLNNIVFYVFSPALAASSL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++T  S   LWFMP NIL+TF+LGSAL W++ K+TR P+HL+G+++G  +AGNMGNLP
Sbjct  61   AETMTFKSFTTLWFMPVNILITFVLGSALAWLIIKITRTPKHLQGIVIGCCSAGNMGNLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            ++++PA+C E  +PFG   VC      YASLS++I
Sbjct  121  LVMVPALCEEPRNPFGDPSVCSRNAKPYASLSLSI  155



>ref|XP_003612404.1| Transporter, putative [Medicago truncatula]
 gb|AES95362.1| auxin efflux carrier family protein [Medicago truncatula]
Length=420

 Score =   184 bits (466),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 121/156 (78%), Gaps = 1/156 (1%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDH-AHILGENARMHLNNMVFFVFNPALVFSN  287
            MGFL LL+VASMPV++VL+ISALG+ +A+ +  ++L  + R  LN +VF VF P+LVF++
Sbjct  1    MGFLQLLEVASMPVIQVLLISALGAFMATQYFNNLLSPDFRKSLNKVVFIVFTPSLVFAS  60

Query  288  LARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNL  467
             A+SV+L+ ++  WFMP N+ LTF++G  LGWIL KL R    ++GLI+ S ++GNMGNL
Sbjct  61   FAKSVSLEDMISWWFMPVNVGLTFLIGGILGWILVKLLRPNLKVEGLIIASCSSGNMGNL  120

Query  468  PVIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            P++IIPAICNEKG PFGA DVCH+  + YAS SMA+
Sbjct  121  PIVIIPAICNEKGGPFGARDVCHSNALSYASFSMAL  156



>emb|CDX87589.1| BnaA07g32840D [Brassica napus]
Length=389

 Score =   183 bits (464),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 120/155 (77%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L+L   +S PV+++L+I+ +G  LA D  ++LG++AR +LNN+VF+VF+P+L+ S L
Sbjct  2    MKLLNLFITSSKPVVEILLITIVGFYLALDGVNLLGQDARKYLNNIVFYVFSPSLIGSRL  61

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A SVT +S++ +WFMP N+LLTFI+GS LGWI+  +T+ P HL+GLI+G  AAGN+GN+P
Sbjct  62   ADSVTYESLVKMWFMPVNVLLTFIIGSLLGWIVIVITKPPSHLRGLIVGCCAAGNLGNMP  121

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PAIC E+G PFG  + C  YGM Y +LSMA+
Sbjct  122  LIIVPAICKERGGPFGDPENCQKYGMGYVALSMAM  156



>emb|CDP01747.1| unnamed protein product [Coffea canephora]
Length=410

 Score =   183 bits (465),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 115/155 (74%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MG   LL VA MPVLK L+I+ +G  LA DH  IL   AR HLNN+V++VF P+L+ S+L
Sbjct  1    MGIDELLMVALMPVLKTLLIAVVGLFLAVDHISILSATARHHLNNLVYYVFFPSLLASSL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
              S++  +++ LWF P +ILLTFI+GSALGWIL ++T+ PQ L GL++GS AAGNMGNLP
Sbjct  61   VDSISATNIISLWFTPVSILLTFIIGSALGWILVRITKTPQQLHGLVIGSCAAGNMGNLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            VIIIPAIC EK +PFG +  C   GM Y SLSM+I
Sbjct  121  VIIIPAICAEKNNPFGDSFSCSRNGMAYVSLSMSI  155



>ref|XP_009762861.1| PREDICTED: uncharacterized protein LOC104214838 isoform X1 [Nicotiana 
sylvestris]
Length=415

 Score =   183 bits (465),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 116/155 (75%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M F+ L  VA +PVLK L+I+A+G  LA +  ++LG  AR HLNN+VF++F PALV S+L
Sbjct  1    MAFVDLFVVALVPVLKTLIITAVGLFLALERVNLLGSTARHHLNNLVFYIFTPALVASSL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A +VT  +++ LWFMP NILLTFI+GSALGW+L K+TR P  L GL++   AAGN+GNL 
Sbjct  61   AETVTSSNIVSLWFMPVNILLTFIIGSALGWLLVKITRTPIELHGLVISCCAAGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPA+C EK SPFG +  C T G  YASLSMAI
Sbjct  121  LIIIPAVCVEKNSPFGDSVTCSTNGKAYASLSMAI  155



>ref|XP_010428718.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X2 
[Camelina sativa]
Length=398

 Score =   183 bits (464),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 117/155 (75%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L   +S PV++ L+I+++G  LA D  ++LG +AR HLNN+VF+VF+P+L+ S L
Sbjct  1    MKLLELFIASSKPVVETLLITSVGFYLALDRVNLLGPDARKHLNNIVFYVFSPSLIGSRL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A SVT +S++ +WFMP N++LTFI+GS LGWI+  +T+ P HL+GLI+ S A+GN+G +P
Sbjct  61   ADSVTYESLVKMWFMPVNVMLTFIIGSLLGWIVIVITKPPSHLRGLIISSCASGNLGTMP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPAIC EKG PFG A+ C  YGM Y +LSM +
Sbjct  121  LIIIPAICKEKGGPFGDAESCEKYGMGYVTLSMTM  155



>ref|XP_010471808.1| PREDICTED: uncharacterized transporter YBR287W-like [Camelina 
sativa]
Length=445

 Score =   184 bits (467),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 122/170 (72%), Gaps = 2/170 (1%)
 Frame = +3

Query  72   KKIFTLE--RRERFGMGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNN  245
            KKI  LE  ++    M  L L   +S PV++ L+I+++G  LA D  ++LG +AR HLNN
Sbjct  33   KKILALEDYKKLEVEMKLLELFIASSKPVVETLLITSVGFYLALDRVNLLGPDARKHLNN  92

Query  246  MVFFVFNPALVFSNLARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKG  425
            +VF+VF+P+L+ S LA SVT +S++ +WFMP N+LLTFI+GS LGWI+  +T+ P HL+G
Sbjct  93   IVFYVFSPSLIGSRLADSVTYESLVKMWFMPVNVLLTFIIGSLLGWIVIVITKPPSHLRG  152

Query  426  LILGSSAAGNMGNLPVIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            LI+   A+GN+G +P+IIIPAIC EKG PFG  + C  YGM Y +LSM +
Sbjct  153  LIICCCASGNLGTMPLIIIPAICKEKGGPFGDPESCEKYGMGYVTLSMTM  202



>gb|AES95354.2| auxin efflux carrier family protein [Medicago truncatula]
Length=169

 Score =   176 bits (446),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 119/156 (76%), Gaps = 1/156 (1%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDH-AHILGENARMHLNNMVFFVFNPALVFSN  287
            MGF+ LL+VASMPV++VL++SALG+ +A+ +  ++L  + R  LN + FF+F P+L+FS+
Sbjct  1    MGFVQLLEVASMPVIQVLLVSALGAFMATQYFNNLLSPDFRKSLNKVAFFIFTPSLIFSS  60

Query  288  LARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNL  467
             A+SV+L  ++  WFMP N+ LTF++G  LGW+L KL R    ++GLI+ + ++GNMG L
Sbjct  61   FAKSVSLQDMISWWFMPVNVGLTFLIGGILGWLLVKLLRPNLKVEGLIIAACSSGNMGGL  120

Query  468  PVIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            PV+IIPAICNEKG PFGA DVCH+  + YAS SMA+
Sbjct  121  PVVIIPAICNEKGGPFGARDVCHSNALSYASFSMAV  156



>gb|ABK92888.1| unknown [Populus trichocarpa]
Length=405

 Score =   183 bits (464),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 113/155 (73%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGFL L     MPVLKVL+I+ LG  LA D   +LG NAR ++NN+VF++F PALV S L
Sbjct  1    MGFLDLFVAPLMPVLKVLLITGLGLFLALDRIDLLGANARHYMNNLVFYLFGPALVVSQL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
              ++T  S+  LWFMP NILLTF++GS L WIL K+T+ P HL+GL++G  +AGN+GNL 
Sbjct  61   GETITFQSLNTLWFMPVNILLTFMIGSILAWILIKITKTPPHLQGLVIGCCSAGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PA+C E  SPFG + +C T G  YASLSMA+
Sbjct  121  LIIVPAVCMESNSPFGDSTICSTNGTTYASLSMAV  155



>ref|XP_003578336.1| PREDICTED: uncharacterized protein LOC100826810 [Brachypodium 
distachyon]
 ref|XP_010238302.1| PREDICTED: uncharacterized protein LOC100826810 [Brachypodium 
distachyon]
 ref|XP_010238303.1| PREDICTED: uncharacterized protein LOC100826810 [Brachypodium 
distachyon]
Length=415

 Score =   183 bits (464),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 115/155 (74%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MG L L   A +PVL +L+++ +GS LASD A ILG+ AR HLN +VF+VFNP LV + L
Sbjct  1    MGLLELFITACVPVLNMLLVTGVGSFLASDFAGILGKEARKHLNFVVFYVFNPCLVATYL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+++TL+S+  LWFMP NIL  F  G   GWI+ K+T AP  L+GLILG  +AGN+GN+ 
Sbjct  61   AKTITLESLAKLWFMPVNILFAFTFGLIFGWIVVKVTGAPLKLRGLILGCCSAGNLGNIF  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPA+C EKGSPFG  D C TYG+ Y+SLS+A+
Sbjct  121  LIIIPALCKEKGSPFGNPDACQTYGLAYSSLSLAL  155



>ref|XP_010428717.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Camelina sativa]
Length=399

 Score =   182 bits (463),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L   +S PV++ L+I+++G  LA D  ++LG +AR HLNN+VF+VF+P+L+ S L
Sbjct  1    MKLLELFIASSKPVVETLLITSVGFYLALDRVNLLGPDARKHLNNIVFYVFSPSLIGSRL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A SVT +S++ +WFMP N++LTFI+GS LGWI+  +T+ P HL+GLI+ S A+GN+G +P
Sbjct  61   ADSVTYESLVKMWFMPVNVMLTFIIGSLLGWIVIVITKPPSHLRGLIISSCASGNLGTMP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMA  572
            +IIIPAIC EKG PFG A+ C  YGM Y +LSM 
Sbjct  121  LIIIPAICKEKGGPFGDAESCEKYGMGYVTLSMT  154



>ref|XP_002264606.1| PREDICTED: uncharacterized transporter C5D6.04 isoform X1 [Vitis 
vinifera]
 ref|XP_003631924.1| PREDICTED: uncharacterized transporter C5D6.04 isoform X1 [Vitis 
vinifera]
Length=418

 Score =   183 bits (464),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 114/155 (74%), Gaps = 1/155 (1%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGF SL   A MP+LKVL+++ +G  +A +   +LG  AR HLN +VF++F PALV SNL
Sbjct  1    MGFWSLFVTALMPILKVLVVTGIGLFIALERIDLLGPTARHHLNTLVFYIFYPALVASNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A +VT  S+  +WFMP NILLTFI+GSALGWIL K+TR PQHL  LILG  +AGNMGNL 
Sbjct  61   ADTVTASSLATMWFMPVNILLTFIIGSALGWILIKITRPPQHLHALILGCCSAGNMGNLF  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
             IIIPAIC E  +PFG++D C T G  YASLS A+
Sbjct  121  FIIIPAICEESDNPFGSSD-CSTDGDAYASLSSAL  154



>ref|XP_010416572.1| PREDICTED: uncharacterized transporter YBR287W-like [Camelina 
sativa]
Length=393

 Score =   182 bits (462),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L   +  PV+++L+I+++G  LA D  ++LG++AR HLNN+VF+VF+P L+ S L
Sbjct  2    MKILDLFITSLKPVVEILLITSVGFYLALDGVNLLGQDARKHLNNIVFYVFSPTLIGSRL  61

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A SVT +S++ +WFMP NIL TF++GS LGW++  +T+ P+HL+GL++G  AAGN+GNLP
Sbjct  62   ADSVTYESLVKMWFMPINILFTFMIGSFLGWLVVVITKPPRHLRGLVVGCCAAGNLGNLP  121

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PA+C EKG PFG  + C  YG+ Y SLSMAI
Sbjct  122  LIIVPAVCKEKGGPFGDPESCQKYGLGYVSLSMAI  156



>ref|XP_006584228.1| PREDICTED: uncharacterized protein LOC100807965 [Glycine max]
Length=478

 Score =   184 bits (467),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M    L  +A MP LKVL+I+ LG+ LA +   IL E AR ++N MV+FVF+PAL  S+L
Sbjct  1    MDIWKLFVIALMPNLKVLLITVLGTFLAINRLDILTETARKNMNTMVYFVFSPALACSSL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+++TL S++ LWFMP +ILLT I+G+ALGW+L K+ R P+HL+GL+LG  A GN+GNLP
Sbjct  61   AKTITLRSMITLWFMPLSILLTIIIGTALGWLLVKIARVPRHLRGLVLGCCAVGNLGNLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PAIC E+ +PFG  D+C+  G+ YASLS+A+
Sbjct  121  LIIVPAICKERSNPFGDVDICYKNGLAYASLSLAL  155



>ref|XP_009366044.1| PREDICTED: uncharacterized transporter YBR287W-like [Pyrus x 
bretschneideri]
Length=378

 Score =   181 bits (460),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 116/155 (75%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M    LL  A +PVLKVL I+ALGS LA D  +ILGE  R +LN +VF+VF PALV SN+
Sbjct  1    MELKQLLVTALIPVLKVLSITALGSYLALDRVNILGEVTRKNLNTVVFYVFGPALVSSNV  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A++ T  +++ +WF+P NIL+TFI+GS LG +L +L R P HL+GL+LG  AAGN+G + 
Sbjct  61   AQTSTYRNMVKMWFIPVNILITFIIGSILGCLLIQLIRPPAHLRGLVLGCCAAGNLGMML  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+P +C EKGSPFGA DVCH Y M YASLSMA+
Sbjct  121  LIIVPEVCKEKGSPFGAPDVCHIYAMGYASLSMAV  155



>ref|XP_009600852.1| PREDICTED: uncharacterized protein LOC104096217 isoform X2 [Nicotiana 
tomentosiformis]
Length=351

 Score =   181 bits (458),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 116/155 (75%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGF+ L  VA +PVLK L+I+A+G  LA +  ++LG  AR +LNN+VF++F PALV S+L
Sbjct  1    MGFVDLFVVALVPVLKTLIITAVGLFLALERVNLLGSAARHYLNNLVFYIFTPALVASSL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A +VT  +++ LWFMP NILLTFI+GSALGW+L K+T  P  L GL++   AAGN+GNL 
Sbjct  61   AETVTSSNIVSLWFMPVNILLTFIIGSALGWVLVKITTTPIQLHGLVISCCAAGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPA+C EK SPFG +  C T G  YASLSMAI
Sbjct  121  LIIIPAVCVEKNSPFGDSITCSTNGKAYASLSMAI  155



>gb|KDO71541.1| hypothetical protein CISIN_1g013221mg [Citrus sinensis]
 gb|KDO71542.1| hypothetical protein CISIN_1g013221mg [Citrus sinensis]
Length=332

 Score =   180 bits (457),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 121/155 (78%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGF +  +VASMP+++VL+IS LG+L+A+ + ++L  +AR  LN MVF VF P+L+F++L
Sbjct  1    MGFWTFFEVASMPIVQVLLISVLGALMATQYWNLLTADARRSLNKMVFTVFTPSLMFASL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A++VTL+ ++  WFMP N+ +TF++G  LGWI+ KL R   HL+GL++ + A+GN+GNL 
Sbjct  61   AKTVTLEEIISWWFMPVNVAMTFLIGGILGWIVVKLLRPKPHLEGLVIATCASGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PAIC+E+GSPFG  DVC + G+ YAS SMA+
Sbjct  121  LIIVPAICHEQGSPFGNRDVCSSVGLSYASFSMAL  155



>ref|NP_001241160.1| uncharacterized protein LOC100807081 [Glycine max]
 gb|ACU24249.1| unknown [Glycine max]
Length=386

 Score =   181 bits (460),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 115/155 (74%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M F  L   + M +LK+L+I+ALG+ LA D  +IL ENAR HLN MV+FVF PAL++S++
Sbjct  1    MNFWKLYIASFMSILKLLLITALGAFLAHDRFNILRENARKHLNAMVYFVFTPALIYSSM  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            + ++T  S+++LWFMP +ILLT+I G+ LGWIL K  R P HL GL+LG  AAGN+ +LP
Sbjct  61   SNTLTFRSMVMLWFMPLSILLTYIAGTVLGWILIKTIRVPHHLHGLVLGCCAAGNLASLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +I++P IC +K SPFG   VCH  G+ YASLSMAI
Sbjct  121  LIVVPTICKDKNSPFGDEVVCHKNGLAYASLSMAI  155



>ref|XP_006425253.1| hypothetical protein CICLE_v10025741mg [Citrus clementina]
 gb|ESR38493.1| hypothetical protein CICLE_v10025741mg [Citrus clementina]
Length=407

 Score =   182 bits (461),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 122/155 (79%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGF +L +VASMP+++VL+IS LG+L+A+ + ++L  +AR  LN MVF VF P+L+F++L
Sbjct  1    MGFWTLFEVASMPIVQVLLISVLGALMATQYWNLLTADARRSLNKMVFTVFTPSLMFASL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A++VTL+ ++  WFMP N+ +TF++G  LGWI+ KL R   HL+GL++ + A+GN+GNL 
Sbjct  61   AKTVTLEEIISWWFMPVNVAMTFLIGGILGWIVVKLLRPKPHLEGLVIATCASGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PAIC+E+GSPFG  DVC + G+ YAS SMA+
Sbjct  121  LIIVPAICHEQGSPFGNRDVCSSVGLSYASFSMAL  155



>ref|XP_010052720.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010052721.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010052722.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010052723.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Eucalyptus grandis]
 gb|KCW76786.1| hypothetical protein EUGRSUZ_D01141 [Eucalyptus grandis]
Length=420

 Score =   182 bits (462),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 123/155 (79%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MG L L  VA MPVLKVL+++A+GSLLA +  ++LG +A+ H+NN+VF++F+P+L+ S L
Sbjct  1    MGVLDLFVVALMPVLKVLLVTAVGSLLAMERVNLLGRDAKQHVNNLVFYIFSPSLIASKL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++TL S++ LWFMP NILLTFI+GSAL W+L KLTR P+HL+ L++G  AAGN+GNL 
Sbjct  61   ADTITLSSLVTLWFMPVNILLTFIIGSALAWVLIKLTRTPRHLQSLVIGCCAAGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PA+C E  SPFG +  C TYG  YASLSMAI
Sbjct  121  LIILPAVCTETNSPFGDSSTCSTYGEAYASLSMAI  155



>ref|XP_006467106.1| PREDICTED: uncharacterized transporter YBR287W-like [Citrus sinensis]
Length=423

 Score =   182 bits (462),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 122/155 (79%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGF +L +VASMP+++VL+IS LG+L+A+ + ++L  +AR  LN MVF VF P+L+F++L
Sbjct  1    MGFWTLFEVASMPIVQVLLISVLGALMATQYWNLLTADARRSLNKMVFTVFTPSLMFASL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A++VTL+ ++  WFMP N+ +TF++G  LGWI+ KL R   HL+GL++ + A+GN+GNL 
Sbjct  61   AKTVTLEEIISWWFMPVNVAMTFLIGGILGWIVVKLLRPKPHLEGLVIATCASGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PAIC+E+GSPFG  DVC + G+ YAS SMA+
Sbjct  121  LIIVPAICHEQGSPFGNRDVCSSVGLSYASFSMAL  155



>ref|XP_006390184.1| hypothetical protein EUTSA_v10018685mg [Eutrema salsugineum]
 gb|ESQ27470.1| hypothetical protein EUTSA_v10018685mg [Eutrema salsugineum]
Length=390

 Score =   181 bits (460),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 120/155 (77%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L   +S PV+++L+I+++G  +A D  ++LG++AR +LN++VF+VF+P+L+ S L
Sbjct  2    MKLLDLFITSSKPVVEILLITSVGFYMALDGVNLLGQDARKYLNSIVFYVFSPSLIGSRL  61

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A SVT +S++ +WFMP N+L TFI+GS LGWI+  +T+ P +L+GLILG  AAGN+GN+P
Sbjct  62   ADSVTYESLVKMWFMPVNVLFTFIIGSLLGWIVIVITKPPSNLRGLILGCCAAGNLGNMP  121

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPA+C EKG PFG  + C  YGM YA+LSMA+
Sbjct  122  LIIIPAVCKEKGGPFGDPESCQKYGMGYAALSMAM  156



>gb|KDO71543.1| hypothetical protein CISIN_1g013221mg [Citrus sinensis]
Length=356

 Score =   181 bits (458),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 121/155 (78%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGF +  +VASMP+++VL+IS LG+L+A+ + ++L  +AR  LN MVF VF P+L+F++L
Sbjct  1    MGFWTFFEVASMPIVQVLLISVLGALMATQYWNLLTADARRSLNKMVFTVFTPSLMFASL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A++VTL+ ++  WFMP N+ +TF++G  LGWI+ KL R   HL+GL++ + A+GN+GNL 
Sbjct  61   AKTVTLEEIISWWFMPVNVAMTFLIGGILGWIVVKLLRPKPHLEGLVIATCASGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PAIC+E+GSPFG  DVC + G+ YAS SMA+
Sbjct  121  LIIVPAICHEQGSPFGNRDVCSSVGLSYASFSMAL  155



>dbj|BAH19704.1| AT2G17500 [Arabidopsis thaliana]
Length=210

 Score =   176 bits (445),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 117/155 (75%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGF SLL+VASMPV++VL +S +G+ +ASD   +    AR  +N +VF +F PAL+F+NL
Sbjct  1    MGFWSLLEVASMPVIQVLFMSLVGAFMASDRCKLFPVEARNSMNKVVFVLFAPALMFANL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A++VTL+ ++  WFMP N+ LTF++G  LGW++ K+ + P +L+GLI+ + +AGNMGNLP
Sbjct  61   AQTVTLEDIISWWFMPVNMGLTFLIGGLLGWLVVKILKPPPYLEGLIVATCSAGNMGNLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +I++PAIC+E  SPFG   VC T G+ YAS SMA+
Sbjct  121  IILVPAICDEDKSPFGNRSVCRTVGLSYASFSMAL  155



>ref|XP_009600851.1| PREDICTED: uncharacterized protein LOC104096217 isoform X1 [Nicotiana 
tomentosiformis]
Length=413

 Score =   181 bits (458),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 116/155 (75%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGF+ L  VA +PVLK L+I+A+G  LA +  ++LG  AR +LNN+VF++F PALV S+L
Sbjct  1    MGFVDLFVVALVPVLKTLIITAVGLFLALERVNLLGSAARHYLNNLVFYIFTPALVASSL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A +VT  +++ LWFMP NILLTFI+GSALGW+L K+T  P  L GL++   AAGN+GNL 
Sbjct  61   AETVTSSNIVSLWFMPVNILLTFIIGSALGWVLVKITTTPIQLHGLVISCCAAGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPA+C EK SPFG +  C T G  YASLSMAI
Sbjct  121  LIIIPAVCVEKNSPFGDSITCSTNGKAYASLSMAI  155



>ref|XP_006661381.1| PREDICTED: uncharacterized protein LOC102707339 [Oryza brachyantha]
Length=443

 Score =   181 bits (460),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 117/155 (75%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L   A +PVL +L+++ +GS LA+D A +L + AR +LNN+VF+VF+P+LV + L
Sbjct  1    MDLLQLFITACVPVLNMLLVTGVGSFLATDFAGLLNKEARKYLNNIVFYVFSPSLVATYL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+++TL+S+  LWFMP NILL    G   GWI+  +TRAP  L+GLILG  +AGN GN+ 
Sbjct  61   AQTITLESLAKLWFMPVNILLACTFGLIFGWIVIHVTRAPARLRGLILGCCSAGNWGNIF  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +IIIPA+C EKGSPFGA DVCHTYG+ Y+SLSMA+
Sbjct  121  LIIIPALCKEKGSPFGAPDVCHTYGLAYSSLSMAL  155



>gb|KEH27632.1| auxin efflux carrier family protein [Medicago truncatula]
Length=303

 Score =   177 bits (450),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 120/156 (77%), Gaps = 1/156 (1%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDH-AHILGENARMHLNNMVFFVFNPALVFSN  287
            MGF+ LL+VASMPV++VL++SALG+ +A+ +  ++L  + R  LN +VFF+F P+L+FS+
Sbjct  1    MGFVQLLEVASMPVIQVLLVSALGAFMATQYFNNLLSPDFRKSLNKVVFFIFTPSLIFSS  60

Query  288  LARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNL  467
             A+SV+L  ++  WFMP N+ LTF++G  LGW+L KL R    ++GLI+ + ++GNMGNL
Sbjct  61   FAKSVSLQDMISWWFMPVNVGLTFLIGGILGWLLVKLLRPNLKVEGLIIAACSSGNMGNL  120

Query  468  PVIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            P++IIPAIC+EKG PFGA DVC +  + YAS SMA+
Sbjct  121  PIVIIPAICDEKGGPFGARDVCRSNALSYASFSMAL  156



>gb|KDO71532.1| hypothetical protein CISIN_1g013221mg [Citrus sinensis]
 gb|KDO71533.1| hypothetical protein CISIN_1g013221mg [Citrus sinensis]
Length=423

 Score =   181 bits (458),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 121/155 (78%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGF +  +VASMP+++VL+IS LG+L+A+ + ++L  +AR  LN MVF VF P+L+F++L
Sbjct  1    MGFWTFFEVASMPIVQVLLISVLGALMATQYWNLLTADARRSLNKMVFTVFTPSLMFASL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A++VTL+ ++  WFMP N+ +TF++G  LGWI+ KL R   HL+GL++ + A+GN+GNL 
Sbjct  61   AKTVTLEEIISWWFMPVNVAMTFLIGGILGWIVVKLLRPKPHLEGLVIATCASGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PAIC+E+GSPFG  DVC + G+ YAS SMA+
Sbjct  121  LIIVPAICHEQGSPFGNRDVCSSVGLSYASFSMAL  155



>ref|XP_010471806.1| PREDICTED: uncharacterized transporter YBR287W-like [Camelina 
sativa]
Length=393

 Score =   180 bits (456),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 117/155 (75%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L   +  PV+++L+I+++G  LA D  ++LG++AR HLNN+VF+VF+P L+ S L
Sbjct  2    MKILDLFITSLKPVVEILLITSVGFYLALDGVNLLGQDARKHLNNIVFYVFSPTLIGSRL  61

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
              SVT +S++ +WFMP N+L TF++GS LGW++  +T+ P+HL+GL++G  AAGN+GNLP
Sbjct  62   VDSVTYESLVKMWFMPINVLFTFMIGSFLGWLVVVITKPPRHLRGLVVGCCAAGNLGNLP  121

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PA+C EKG PFG  + C  YG+ Y SLSMAI
Sbjct  122  LIIVPAVCKEKGGPFGDPESCQKYGLGYVSLSMAI  156



>gb|KDO71539.1| hypothetical protein CISIN_1g013221mg [Citrus sinensis]
Length=398

 Score =   180 bits (456),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 121/155 (78%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGF +  +VASMP+++VL+IS LG+L+A+ + ++L  +AR  LN MVF VF P+L+F++L
Sbjct  1    MGFWTFFEVASMPIVQVLLISVLGALMATQYWNLLTADARRSLNKMVFTVFTPSLMFASL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A++VTL+ ++  WFMP N+ +TF++G  LGWI+ KL R   HL+GL++ + A+GN+GNL 
Sbjct  61   AKTVTLEEIISWWFMPVNVAMTFLIGGILGWIVVKLLRPKPHLEGLVIATCASGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PAIC+E+GSPFG  DVC + G+ YAS SMA+
Sbjct  121  LIIVPAICHEQGSPFGNRDVCSSVGLSYASFSMAL  155



>gb|KDO71534.1| hypothetical protein CISIN_1g013221mg [Citrus sinensis]
Length=447

 Score =   181 bits (459),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 121/155 (78%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGF +  +VASMP+++VL+IS LG+L+A+ + ++L  +AR  LN MVF VF P+L+F++L
Sbjct  1    MGFWTFFEVASMPIVQVLLISVLGALMATQYWNLLTADARRSLNKMVFTVFTPSLMFASL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A++VTL+ ++  WFMP N+ +TF++G  LGWI+ KL R   HL+GL++ + A+GN+GNL 
Sbjct  61   AKTVTLEEIISWWFMPVNVAMTFLIGGILGWIVVKLLRPKPHLEGLVIATCASGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PAIC+E+GSPFG  DVC + G+ YAS SMA+
Sbjct  121  LIIVPAICHEQGSPFGNRDVCSSVGLSYASFSMAL  155



>gb|KDO71540.1| hypothetical protein CISIN_1g013221mg [Citrus sinensis]
Length=422

 Score =   180 bits (457),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 121/155 (78%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGF +  +VASMP+++VL+IS LG+L+A+ + ++L  +AR  LN MVF VF P+L+F++L
Sbjct  1    MGFWTFFEVASMPIVQVLLISVLGALMATQYWNLLTADARRSLNKMVFTVFTPSLMFASL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A++VTL+ ++  WFMP N+ +TF++G  LGWI+ KL R   HL+GL++ + A+GN+GNL 
Sbjct  61   AKTVTLEEIISWWFMPVNVAMTFLIGGILGWIVVKLLRPKPHLEGLVIATCASGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PAIC+E+GSPFG  DVC + G+ YAS SMA+
Sbjct  121  LIIVPAICHEQGSPFGNRDVCSSVGLSYASFSMAL  155



>ref|XP_010681117.1| PREDICTED: uncharacterized transporter C5D6.04-like isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=397

 Score =   179 bits (455),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 115/153 (75%), Gaps = 9/153 (6%)
 Frame = +3

Query  117  FLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNLAR  296
            + +LL VASMPVLKVL+I+ALG  LA +   ILGE    HLN +VFFVF PALV SNLA+
Sbjct  4    WFNLLFVASMPVLKVLLITALGLFLALNRIDILGEAVTNHLNKVVFFVFGPALVGSNLAK  63

Query  297  SVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLPVI  476
            +VT +S L LWFM   IL+TF++GS +GW+L K+T+AP+H+K         GN+GNLP+I
Sbjct  64   TVTFESFLTLWFMLVKILITFLIGSTMGWVLAKVTKAPKHIK---------GNLGNLPII  114

Query  477  IIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            I+PAIC EKGS FGA ++C  YG+ YASLSMAI
Sbjct  115  ILPAICKEKGSRFGAPNICERYGLAYASLSMAI  147



>emb|CDY20402.1| BnaC02g24140D [Brassica napus]
Length=387

 Score =   179 bits (454),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L   +S PV+++L+I+ +G  +A D  ++LG++AR  LNN+VF+VF+P+L+ S L
Sbjct  2    MKLLHLFITSSKPVVEILLITTVGFYMALDGVNLLGQDARKFLNNIVFYVFSPSLIGSRL  61

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A SVT +S++ +WFMP N+LLTFI+GS LGWI+  +T+ P HL+GLI+G  AAGN+GN+P
Sbjct  62   ANSVTYESLMQMWFMPVNVLLTFIIGSFLGWIVILITKPPSHLRGLIVGCCAAGNLGNMP  121

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PA+C EKG PFG  + C  YG+ Y +LSMA+
Sbjct  122  LIIVPAVCKEKGGPFGDPENCQKYGVGYVALSMAM  156



>ref|XP_009128182.1| PREDICTED: uncharacterized transporter YBR287W-like [Brassica 
rapa]
Length=387

 Score =   179 bits (454),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L   +S PV+++L+I+ +G  +A D  ++LG++AR  LNN+VF+VF+P+L+ S L
Sbjct  2    MKLLHLFITSSKPVVEILLITTVGFYMALDGVNLLGQDARKFLNNIVFYVFSPSLIGSRL  61

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A SVT +S++ +WFMP N+LLTFI+GS LGWI+  +T+ P HL+GLI+G  AAGN+GN+P
Sbjct  62   ANSVTYESLMQMWFMPVNVLLTFIIGSFLGWIVILITKPPSHLRGLIVGCCAAGNLGNMP  121

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PA+C EKG PFG  + C  YG+ Y +LSMA+
Sbjct  122  LIIVPAVCKEKGGPFGDPENCQKYGVGYVALSMAM  156



>ref|XP_010467522.1| PREDICTED: uncharacterized transporter YBR287W-like [Camelina 
sativa]
 ref|XP_010467523.1| PREDICTED: uncharacterized transporter YBR287W-like [Camelina 
sativa]
Length=393

 Score =   179 bits (454),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGF SLL+VASMPV++VL++S +G+ LASD   +    AR  +N +VF +F PAL+F+NL
Sbjct  1    MGFWSLLEVASMPVIQVLIMSIVGAFLASDRCKLFPIEARNSMNKVVFVLFAPALMFANL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            AR+VTL+ ++  WFMP N+ LTF++G  LGWI+ K+ + P +L+GLI+ + ++GNMGNLP
Sbjct  61   ARTVTLEDIISWWFMPVNMGLTFLIGGLLGWIVVKILKPPPYLEGLIIATCSSGNMGNLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +I++PAIC+E  SPFG   VC T G+ YAS SMA+
Sbjct  121  IILVPAICDEDKSPFGNRSVCRTVGLSYASFSMAL  155



>emb|CDP01772.1| unnamed protein product [Coffea canephora]
Length=422

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 119/155 (77%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGF +LL+VASMP+++VL+IS LG+++A++H ++L  +AR  LN +VF VF P+L+F++L
Sbjct  1    MGFWTLLEVASMPIIQVLLISVLGAVMATEHLNLLPADARKSLNKIVFMVFTPSLMFASL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A++VTLD ++  WFMP NI LTF+ G  LGWI  KL +   HL+GL++ + ++GN+GNL 
Sbjct  61   AKTVTLDDIISWWFMPVNIGLTFVFGGILGWIAVKLVKPRPHLEGLVIATCSSGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PAIC E GSPFG  + C T G+ YAS SMA+
Sbjct  121  LIIVPAICKEDGSPFGDHNTCSTIGLSYASFSMAL  155



>ref|XP_007158024.1| hypothetical protein PHAVU_002G117700g [Phaseolus vulgaris]
 gb|ESW30018.1| hypothetical protein PHAVU_002G117700g [Phaseolus vulgaris]
Length=418

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 121/156 (78%), Gaps = 1/156 (1%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDH-AHILGENARMHLNNMVFFVFNPALVFSN  287
            MGF+ LL+VASMP+++VL+ISALG+L+A+ +  H+L  + R  LN +VFF+F P+L+F++
Sbjct  1    MGFVELLEVASMPIIQVLLISALGALMATRYFDHLLSSDIRKALNKIVFFIFTPSLIFAS  60

Query  288  LARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNL  467
             A+SV+L+ ++  WFMP N+ LTF++G  +GWIL KL +    ++GLI+ + ++GNMGNL
Sbjct  61   FAKSVSLEDMISWWFMPVNVGLTFLIGGIIGWILVKLLKPNLKVEGLIIAACSSGNMGNL  120

Query  468  PVIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            P++IIPAIC+EKG PFGA DVC    + YAS SMA+
Sbjct  121  PIVIIPAICDEKGGPFGARDVCRNNALSYASFSMAL  156



>ref|XP_009614500.1| PREDICTED: uncharacterized protein LOC104107409 isoform X1 [Nicotiana 
tomentosiformis]
Length=416

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 120/155 (77%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGF +L +VASMP+L+VL+IS LG+L+A+D+  +L  +AR  LN +VF +F P+L+F++L
Sbjct  1    MGFWTLFEVASMPILQVLLISILGALMATDYLKLLHSDARRSLNKIVFVIFTPSLMFASL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A++VTLD ++  WFMP NI LTF++G  LGW++ K+ +   HL+GLI+ + +AGN+GNL 
Sbjct  61   AKTVTLDDIISWWFMPINIGLTFLVGGILGWLVVKILKPELHLEGLIIATCSAGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +I+IPAIC EKGSPFG   +C + G+ YAS SMA+
Sbjct  121  LIVIPAICKEKGSPFGDHGICASVGLSYASFSMAV  155



>ref|XP_004145562.1| PREDICTED: uncharacterized protein LOC101208244 [Cucumis sativus]
Length=401

 Score =   179 bits (454),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 106/137 (77%), Gaps = 0/137 (0%)
 Frame = +3

Query  165  MISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNLARSVTLDSVLLLWFMPFN  344
            M + LGS LA     ILG+ AR HLN +VF+VFNPALV SNLA ++T  +++ +WFMPFN
Sbjct  1    MATRLGSFLALPSIDILGQEARKHLNGVVFYVFNPALVSSNLAETITYSNMVKMWFMPFN  60

Query  345  ILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLPVIIIPAICNEKGSPFGAA  524
            IL+TFI+GS  GWI+ + T+ P HL+GLILG  +AGN+GN+ +II+PA+C EKGSPFG +
Sbjct  61   ILITFIVGSLFGWIVIQWTKPPPHLRGLILGCCSAGNLGNILLIIVPAVCQEKGSPFGDS  120

Query  525  DVCHTYGMVYASLSMAI  575
            D C TYGM Y SLSMAI
Sbjct  121  DKCTTYGMAYVSLSMAI  137



>ref|XP_006409300.1| hypothetical protein EUTSA_v10022717mg [Eutrema salsugineum]
 gb|ESQ50753.1| hypothetical protein EUTSA_v10022717mg [Eutrema salsugineum]
Length=397

 Score =   179 bits (453),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGF SLL+VASMPV++VL+IS +G+ LA+D   +    AR  +N +VF +F PAL+F+NL
Sbjct  1    MGFFSLLEVASMPVIQVLIISLVGAFLATDRCKLFPVEARNSMNKVVFVIFAPALMFANL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A++VTL  ++  WFMP N+ LTF++G  LGW++ K+ + P +L+GLI+ +S++GNMGNLP
Sbjct  61   AQTVTLQDMISWWFMPVNMGLTFLIGGILGWMVVKILKPPPYLEGLIVATSSSGNMGNLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +I++PAIC+E  SPFG   VC T G+ YAS SMA+
Sbjct  121  IILVPAICDEDKSPFGNRSVCRTVGLSYASFSMAL  155



>ref|XP_007010166.1| Auxin efflux carrier family protein [Theobroma cacao]
 gb|EOY18976.1| Auxin efflux carrier family protein [Theobroma cacao]
Length=408

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 120/155 (77%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGFL+LL VA MPVLK+++I+A+G LLA D   +LG  A  H+NN+VF+VF+PAL  S+L
Sbjct  1    MGFLNLLIVAVMPVLKIILITAIGLLLALDRLKLLGPEANHHMNNIVFYVFSPALAASSL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A +VT  S+  LWFMP N+LLTF+LGSAL W+L K+TR P+HL+G+++G  +AGN+GNLP
Sbjct  61   AETVTFKSLTTLWFMPVNLLLTFVLGSALAWLLIKITRTPKHLQGIVIGCCSAGNLGNLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +I++PA+C E  +PFG   VC T    YASLS++I
Sbjct  121  LIMVPAVCEEPSNPFGDPSVCSTNAKPYASLSLSI  155



>ref|XP_009104669.1| PREDICTED: uncharacterized transporter YBR287W-like [Brassica 
rapa]
 ref|XP_009104670.1| PREDICTED: uncharacterized transporter YBR287W-like [Brassica 
rapa]
 ref|XP_009104671.1| PREDICTED: uncharacterized transporter YBR287W-like [Brassica 
rapa]
 emb|CDX68094.1| BnaA07g21340D [Brassica napus]
Length=388

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 119/153 (78%), Gaps = 0/153 (0%)
 Frame = +3

Query  117  FLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNLAR  296
             L L   +S PV+++L+I+++G  +A D  ++LG +AR +LN++VF+VFNP+LV S LA 
Sbjct  4    LLHLFITSSKPVVEILLITSVGLYMALDGVNLLGPDARKYLNDIVFYVFNPSLVGSRLAD  63

Query  297  SVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLPVI  476
            SVT DS++ +WFMP N+LLTFI+GS LGWI+  +T+ P +L+GLI+G  AAGN+GN+P+I
Sbjct  64   SVTYDSLVKMWFMPINLLLTFIIGSLLGWIVILITKPPSNLRGLIVGCCAAGNLGNMPLI  123

Query  477  IIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            IIPA+C +KG PFG  + C+ YGM Y +LSMA+
Sbjct  124  IIPAVCKDKGGPFGDPENCNKYGMGYVALSMAM  156



>ref|XP_003612396.1| hypothetical protein MTR_5g024580 [Medicago truncatula]
Length=172

 Score =   172 bits (436),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 120/159 (75%), Gaps = 4/159 (3%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDH-AHILGENARMHLNNMVFFVFNPALVFSN  287
            MGF+ LL+VASMPV++VL++SALG+ +A+ +  ++L  + R  LN + FF+F P+L+FS+
Sbjct  1    MGFVQLLEVASMPVIQVLLVSALGAFMATQYFNNLLSPDFRKSLNKVAFFIFTPSLIFSS  60

Query  288  LARSVTLDSVL---LLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNM  458
             A+SV+L  ++   + WFMP N+ LTF++G  LGW+L KL R    ++GLI+ + ++GNM
Sbjct  61   FAKSVSLQDMISWYIWWFMPVNVGLTFLIGGILGWLLVKLLRPNLKVEGLIIAACSSGNM  120

Query  459  GNLPVIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            G LPV+IIPAICNEKG PFGA DVCH+  + YAS SMA+
Sbjct  121  GGLPVVIIPAICNEKGGPFGARDVCHSNALSYASFSMAV  159



>ref|XP_010489377.1| PREDICTED: uncharacterized transporter YBR287W-like [Camelina 
sativa]
 ref|XP_010489378.1| PREDICTED: uncharacterized transporter YBR287W-like [Camelina 
sativa]
 ref|XP_010489379.1| PREDICTED: uncharacterized transporter YBR287W-like [Camelina 
sativa]
 ref|XP_010489380.1| PREDICTED: uncharacterized transporter YBR287W-like [Camelina 
sativa]
Length=393

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGF SLL+VASMPV++VL++S +G+ LASD   +    AR  +N +VF +F PAL+F+NL
Sbjct  1    MGFWSLLEVASMPVIQVLIMSLVGAFLASDRCKLFPIEARNTMNKVVFVLFAPALMFANL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            AR+VTL+ ++  WFMP N+ LTF++G  LGWI+ K+ + P +L+GLI+ + ++GNMGNLP
Sbjct  61   ARTVTLEDIISWWFMPVNMGLTFLIGGLLGWIVVKILKPPPYLEGLIVATCSSGNMGNLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +I++PAIC+E  SPFG   VC T G+ YAS SMA+
Sbjct  121  IILVPAICDEDKSPFGNRSVCRTVGLSYASFSMAL  155



>ref|XP_003537691.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Glycine max]
 ref|XP_006590759.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X2 
[Glycine max]
Length=419

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 119/156 (76%), Gaps = 1/156 (1%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDH-AHILGENARMHLNNMVFFVFNPALVFSN  287
            MGFL LL+VASMPV++VL+ISALG+L+A+    +IL  + R  LN +VF +F P+LVFS+
Sbjct  1    MGFLELLEVASMPVIQVLLISALGALMATQFFDNILSPDIRKALNKIVFVIFTPSLVFSS  60

Query  288  LARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNL  467
             A+SV+LD ++  WFMP N+ LTF++G  +GWIL KL +    ++GLI+ + ++GNMGNL
Sbjct  61   FAKSVSLDDMISWWFMPVNVGLTFLIGGIIGWILVKLLKPNLKVEGLIIAACSSGNMGNL  120

Query  468  PVIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            P++IIPAIC+EKG PFGA D+C    + YAS SMA+
Sbjct  121  PIVIIPAICDEKGGPFGARDICRNNALSYASFSMAL  156



>gb|AFW58767.1| hypothetical protein ZEAMMB73_122963 [Zea mays]
Length=454

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 115/161 (71%), Gaps = 0/161 (0%)
 Frame = +3

Query  93   RRERFGMGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPA  272
               ++ M  + L   A +PV  +L+++ +GS LA+D A IL + AR HLNN+VF+VFNP+
Sbjct  31   ESSKWKMDLIQLFITACVPVFNMLLVTGVGSFLATDFAGILSKEARKHLNNVVFYVFNPS  90

Query  273  LVFSNLARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAG  452
             V   LA+++T++S+  LWFMP NILL F  G   GWI+ K+TRAP  L+GLILG  +AG
Sbjct  91   FVSIYLAKTITMESLAKLWFMPVNILLAFTFGLFFGWIVVKVTRAPAKLRGLILGCCSAG  150

Query  453  NMGNLPVIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            N+GN+ +I+IPA+C EKGSPFGA DVC   G+ Y SLSMAI
Sbjct  151  NLGNIFLIVIPALCKEKGSPFGAPDVCQDIGLAYFSLSMAI  191



>tpg|DAA62056.1| TPA: hypothetical protein ZEAMMB73_195263 [Zea mays]
Length=454

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 115/161 (71%), Gaps = 0/161 (0%)
 Frame = +3

Query  93   RRERFGMGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPA  272
               ++ M  + L   A +PV  +L+++ +GS LA+D A IL + AR HLNN+VF+VFNP+
Sbjct  31   ESSKWKMDLIQLFITACVPVFNMLLVTGVGSFLAADFAGILSKEARKHLNNVVFYVFNPS  90

Query  273  LVFSNLARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAG  452
             V   LA+++T++S+  LWFMP NILL F  G   GWI+ K+TRAP  L+GLILG  +AG
Sbjct  91   FVSIYLAKTITMESLAKLWFMPVNILLAFTFGLFFGWIVVKVTRAPAKLRGLILGCCSAG  150

Query  453  NMGNLPVIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            N+GN+ +I+IPA+C EKGSPFGA DVC   G+ Y SLSMAI
Sbjct  151  NLGNIFLIVIPALCKEKGSPFGAPDVCQDIGLAYFSLSMAI  191



>gb|KEH27633.1| auxin efflux carrier family protein [Medicago truncatula]
Length=381

 Score =   177 bits (450),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 120/156 (77%), Gaps = 1/156 (1%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDH-AHILGENARMHLNNMVFFVFNPALVFSN  287
            MGF+ LL+VASMPV++VL++SALG+ +A+ +  ++L  + R  LN +VFF+F P+L+FS+
Sbjct  1    MGFVQLLEVASMPVIQVLLVSALGAFMATQYFNNLLSPDFRKSLNKVVFFIFTPSLIFSS  60

Query  288  LARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNL  467
             A+SV+L  ++  WFMP N+ LTF++G  LGW+L KL R    ++GLI+ + ++GNMGNL
Sbjct  61   FAKSVSLQDMISWWFMPVNVGLTFLIGGILGWLLVKLLRPNLKVEGLIIAACSSGNMGNL  120

Query  468  PVIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            P++IIPAIC+EKG PFGA DVC +  + YAS SMA+
Sbjct  121  PIVIIPAICDEKGGPFGARDVCRSNALSYASFSMAL  156



>gb|KJB60463.1| hypothetical protein B456_009G306300 [Gossypium raimondii]
Length=298

 Score =   175 bits (444),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 114/155 (74%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGFL LL VA +P+LKVL+++ +G  L  +  ++LG  AR +LN +VF+V +P L+FSNL
Sbjct  1    MGFLDLLVVALVPILKVLLVTGVGLFLGIEKINLLGPEARDYLNKIVFYVLSPCLLFSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++T  S++ LWFMP N+LLTF++GSALGWIL KLT+ P+HL+G+++G  + GN+GNL 
Sbjct  61   AETITYKSLVTLWFMPLNVLLTFLVGSALGWILAKLTKTPRHLQGIVIGCCSTGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +I+ P IC+E  SPF     C T    YASLSMA+
Sbjct  121  LIVFPDICDESNSPFSKLSTCSTDAEAYASLSMAV  155



>ref|XP_002526514.1| auxin:hydrogen symporter, putative [Ricinus communis]
 gb|EEF35905.1| auxin:hydrogen symporter, putative [Ricinus communis]
Length=434

 Score =   179 bits (453),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 120/156 (77%), Gaps = 0/156 (0%)
 Frame = +3

Query  108  GMGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSN  287
             MGF  L  VA MPVLKVL+++A+G  LA+D  H+LG +AR HLNN+VF+VF+PAL+ S+
Sbjct  32   AMGFWDLFVVALMPVLKVLLVTAIGLFLATDGIHLLGASARNHLNNLVFYVFSPALIGSS  91

Query  288  LARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNL  467
            LA +VTLDS++ LWFMP NILLTFI+GSALGW L K+T  P+HL G I+   +AGN+GNL
Sbjct  92   LANTVTLDSLVTLWFMPVNILLTFIIGSALGWALVKITHTPKHLHGTIISCCSAGNLGNL  151

Query  468  PVIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
             +II+PA+C E  SPFG +  C  YG  YASLSMA+
Sbjct  152  LLIILPALCEENNSPFGDSTACSAYGQAYASLSMAV  187



>ref|XP_008663364.1| PREDICTED: uncharacterized protein LOC103641814 [Zea mays]
Length=418

 Score =   178 bits (452),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 113/155 (73%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  + L   A +PV  +L+++ +GS LA+D A IL + AR HLNN+VF+VFNP+ V   L
Sbjct  1    MDLIQLFITACVPVFNMLLVTGVGSFLATDFAGILSKEARKHLNNVVFYVFNPSFVSIYL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+++T++S+  LWFMP NILL F  G   GWI+ K+TRAP  L+GLILG  +AGN+GN+ 
Sbjct  61   AKTITMESLAKLWFMPVNILLAFTFGLFFGWIVVKVTRAPAKLRGLILGCCSAGNLGNIF  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +I+IPA+C EKGSPFGA DVC   G+ Y SLSMAI
Sbjct  121  LIVIPALCKEKGSPFGAPDVCQDIGLAYFSLSMAI  155



>ref|XP_003517128.1| PREDICTED: uncharacterized transporter YBR287W-like isoformX2 
[Glycine max]
 ref|XP_006573516.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X3 
[Glycine max]
 gb|KHN35945.1| Putative transporter [Glycine soja]
Length=419

 Score =   178 bits (452),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 120/156 (77%), Gaps = 1/156 (1%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDH-AHILGENARMHLNNMVFFVFNPALVFSN  287
            MGFL LL+VAS+PV++VL+ISALG+L+A+ +  ++L  + R  LN +VF +F P+LVFS+
Sbjct  1    MGFLELLEVASLPVIQVLLISALGALMATQYFDNLLSPDIRKALNKIVFLIFTPSLVFSS  60

Query  288  LARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNL  467
             A+SV+LD ++  WFMP N+ LTF++G  +GWIL KL +    ++GLI+ + ++GNMGNL
Sbjct  61   FAKSVSLDDMISWWFMPVNVGLTFLIGGIIGWILVKLLKPNLKVEGLIIAACSSGNMGNL  120

Query  468  PVIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            P++IIPAIC+EKG PFGA D+C    + YAS SMA+
Sbjct  121  PIVIIPAICDEKGGPFGARDICRNNALSYASFSMAL  156



>emb|CDY24342.1| BnaA07g02670D [Brassica napus]
Length=393

 Score =   177 bits (450),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 117/155 (75%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGF SLL+VASMPV++VL IS +G+ LA+D   +    AR  +N +VF +F PAL+F+NL
Sbjct  1    MGFWSLLEVASMPVIQVLFISVVGAFLATDRCKLFPVEARNSMNKVVFVLFAPALMFANL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A++VTL+ ++  WFMP N+ LTF++G  LGWI+ K+ + P +L+GLI+ + ++GNMGNLP
Sbjct  61   AQTVTLEDMISWWFMPVNMGLTFLIGGILGWIVVKILKPPPYLEGLIVATCSSGNMGNLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +I++PAIC+E  SPFG   VC T G+ YAS SMA+
Sbjct  121  IILVPAICDEDKSPFGNRSVCRTVGLSYASFSMAL  155



>ref|XP_008652869.1| PREDICTED: uncharacterized protein LOC103632939 [Zea mays]
Length=418

 Score =   178 bits (451),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 113/155 (73%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  + L   A +PV  +L+++ +GS LA+D A IL + AR HLNN+VF+VFNP+ V   L
Sbjct  1    MDLIQLFITACVPVFNMLLVTGVGSFLAADFAGILSKEARKHLNNVVFYVFNPSFVSIYL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+++T++S+  LWFMP NILL F  G   GWI+ K+TRAP  L+GLILG  +AGN+GN+ 
Sbjct  61   AKTITMESLAKLWFMPVNILLAFTFGLFFGWIVVKVTRAPAKLRGLILGCCSAGNLGNIF  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +I+IPA+C EKGSPFGA DVC   G+ Y SLSMAI
Sbjct  121  LIVIPALCKEKGSPFGAPDVCQDIGLAYFSLSMAI  155



>ref|XP_009121108.1| PREDICTED: uncharacterized transporter YBR287W [Brassica rapa]
Length=393

 Score =   177 bits (450),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 117/155 (75%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGF SLL+VASMPV++VL IS +G+ LA+D   +    AR  +N +VF +F PAL+F+NL
Sbjct  1    MGFWSLLEVASMPVIQVLFISVVGAFLATDRCKLFPVEARNSMNKVVFVLFAPALMFANL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A++VTL+ ++  WFMP N+ LTF++G  LGWI+ K+ + P +L+GLI+ + ++GNMGNLP
Sbjct  61   AQTVTLEDMISWWFMPVNMGLTFLIGGILGWIVVKILKPPPYLEGLIVATCSSGNMGNLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +I++PAIC+E  SPFG   VC T G+ YAS SMA+
Sbjct  121  IILVPAICDEDKSPFGNRSVCRTVGLSYASFSMAL  155



>ref|XP_010514952.1| PREDICTED: uncharacterized transporter YBR287W-like [Camelina 
sativa]
 ref|XP_010514959.1| PREDICTED: uncharacterized transporter YBR287W-like [Camelina 
sativa]
 ref|XP_010514966.1| PREDICTED: uncharacterized transporter YBR287W-like [Camelina 
sativa]
Length=387

 Score =   177 bits (449),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGF SLL+VASMPV++VL++S +G+ LASD   +    AR  +N +VF +F PAL+F+NL
Sbjct  1    MGFWSLLEVASMPVIQVLIMSLVGAFLASDRCKLFPIEARNTMNKVVFVLFAPALMFANL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            AR+VTL+ ++  WFMP N+ LTF++G  LGWI+ K+ + P +L+GLI+ + ++GNMGNLP
Sbjct  61   ARTVTLEDIISWWFMPVNMGLTFLIGGLLGWIVVKILKPPPYLEGLIIATCSSGNMGNLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +I++PAIC+E  +PFG   VC T G+ YAS SMA+
Sbjct  121  IILVPAICDEDKNPFGNRSVCRTVGLSYASFSMAL  155



>ref|XP_006485670.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Citrus sinensis]
 ref|XP_006485671.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X2 
[Citrus sinensis]
 ref|XP_006485672.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X3 
[Citrus sinensis]
 gb|KDO48347.1| hypothetical protein CISIN_1g014701mg [Citrus sinensis]
Length=420

 Score =   178 bits (451),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L   A +PVLKVL+++ALG  LA D   ILG+ AR HLN +VFFVFNPALV S+L
Sbjct  1    MKILDLFIAAFIPVLKVLLLTALGLFLALDRIDILGDLARQHLNKVVFFVFNPALVGSSL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A  +T + + +LWFMP NIL+T+I+GS+LGWI+ K T+AP  L GL+LG  AAGN+GN+ 
Sbjct  61   ADHITAEGIGMLWFMPLNILITYIVGSSLGWIVLKTTKAPYDLWGLVLGCCAAGNLGNML  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
             IIIPAIC E+GSPFG AD C+  GMVY++LSMAI
Sbjct  121  FIIIPAICKERGSPFGDADACYRQGMVYSALSMAI  155



>ref|XP_006451737.1| hypothetical protein CICLE_v10010809mg [Citrus clementina]
 gb|ESR64977.1| hypothetical protein CICLE_v10010809mg [Citrus clementina]
Length=420

 Score =   178 bits (451),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L   A +PVLKVL+++ALG  LA D   ILG+ AR HLN +VFFVFNPALV S+L
Sbjct  1    MKILDLFIAAFIPVLKVLLLTALGLFLALDRIDILGDLARQHLNKVVFFVFNPALVGSSL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A  +T + + +LWFMP NIL+T+I+GS+LGWI+ K T+AP  L GL+LG  AAGN+GN+ 
Sbjct  61   ADHITAEGIGMLWFMPLNILITYIVGSSLGWIVLKTTKAPYDLWGLVLGCCAAGNLGNML  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
             IIIPAIC E+GSPFG AD C+  GMVY++LSMAI
Sbjct  121  FIIIPAICKERGSPFGDADACYRQGMVYSALSMAI  155



>ref|XP_002884062.1| auxin efflux carrier family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60321.1| auxin efflux carrier family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=396

 Score =   177 bits (449),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGF SLL+VASMPV++VL++S +G+ LASD   +    AR  +N +VF +F PAL+F+NL
Sbjct  1    MGFWSLLEVASMPVIQVLVMSLVGAFLASDRCKLFPVEARNSMNKVVFVLFAPALMFANL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A++VTL+ ++  WFMP N+ LTF++G  LGW++ K+ + P +L+GLI+ + +AGNMGNLP
Sbjct  61   AQTVTLEDIISWWFMPVNMGLTFLIGGLLGWMVVKILKPPPYLEGLIVATCSAGNMGNLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +I++PAIC+E  SPFG   VC T G+ YAS SMA+
Sbjct  121  IILVPAICDEDKSPFGNRSVCRTVGLSYASFSMAL  155



>gb|KEH17831.1| auxin efflux carrier family protein [Medicago truncatula]
Length=416

 Score =   177 bits (450),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 117/155 (75%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M FL L  VA  PVL  L I+ +G++LA D+  IL +NA+ HLN +V+FVF PAL++S+L
Sbjct  1    MNFLKLFLVALAPVLNTLFIAIIGAVLALDNIGILTKNAKKHLNIIVYFVFTPALLYSSL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+++TL S+++LWFMP NILL +I+G+ L WIL K+TR P+HL GL++G  AAGN+G+LP
Sbjct  61   AKTITLKSLIMLWFMPLNILLRYIIGTTLAWILTKITRVPRHLHGLVMGCCAAGNLGSLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +II+PAIC  +  PFG  D C+  G+ + SL+MA+
Sbjct  121  LIIVPAICKGRSHPFGDVDSCYHKGLAFTSLTMAV  155



>ref|XP_003612402.1| Transporter, putative [Medicago truncatula]
 gb|AES95360.1| auxin efflux carrier family protein [Medicago truncatula]
Length=421

 Score =   177 bits (450),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 120/156 (77%), Gaps = 1/156 (1%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDH-AHILGENARMHLNNMVFFVFNPALVFSN  287
            MGF+ LL+VASMPV++VL++SALG+ +A+ +  ++L  + R  LN +VFF+F P+L+FS+
Sbjct  1    MGFVQLLEVASMPVIQVLLVSALGAFMATQYFNNLLSPDFRKSLNKVVFFIFTPSLIFSS  60

Query  288  LARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNL  467
             A+SV+L  ++  WFMP N+ LTF++G  LGW+L KL R    ++GLI+ + ++GNMGNL
Sbjct  61   FAKSVSLQDMISWWFMPVNVGLTFLIGGILGWLLVKLLRPNLKVEGLIIAACSSGNMGNL  120

Query  468  PVIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            P++IIPAIC+EKG PFGA DVC +  + YAS SMA+
Sbjct  121  PIVIIPAICDEKGGPFGARDVCRSNALSYASFSMAL  156



>gb|AAM60930.1| unknown [Arabidopsis thaliana]
Length=396

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 117/155 (75%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGF SLL+VASMPV++VL +S +G+ +ASD   +    AR  +N +VF +F PAL+F+NL
Sbjct  1    MGFWSLLEVASMPVIQVLFMSLVGAFMASDRCKLFPVEARNSMNKVVFVLFAPALMFANL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A++VTL+ ++  WFMP N+ LTF++G  LGW++ K+ + P +L+GLI+ + +AGNMGNLP
Sbjct  61   AQTVTLEDIISWWFMPVNMGLTFLIGGLLGWLVVKILKPPPYLEGLIVATCSAGNMGNLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +I++PAIC+E  SPFG   VC T G+ YAS SMA+
Sbjct  121  IILVPAICDEDKSPFGNRSVCRTVGLSYASFSMAL  155



>ref|NP_565417.1| auxin efflux carrier family protein [Arabidopsis thaliana]
 ref|NP_849964.1| auxin efflux carrier family protein [Arabidopsis thaliana]
 ref|NP_973479.1| auxin efflux carrier family protein [Arabidopsis thaliana]
 ref|NP_001031363.1| auxin efflux carrier family protein [Arabidopsis thaliana]
 gb|AAD32907.1| expressed protein [Arabidopsis thaliana]
 dbj|BAE98473.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC06634.1| auxin efflux carrier family protein [Arabidopsis thaliana]
 gb|AEC06635.1| auxin efflux carrier family protein [Arabidopsis thaliana]
 gb|AEC06636.1| auxin efflux carrier family protein [Arabidopsis thaliana]
 gb|AEC06637.1| auxin efflux carrier family protein [Arabidopsis thaliana]
Length=396

 Score =   176 bits (445),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 117/155 (75%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGF SLL+VASMPV++VL +S +G+ +ASD   +    AR  +N +VF +F PAL+F+NL
Sbjct  1    MGFWSLLEVASMPVIQVLFMSLVGAFMASDRCKLFPVEARNSMNKVVFVLFAPALMFANL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A++VTL+ ++  WFMP N+ LTF++G  LGW++ K+ + P +L+GLI+ + +AGNMGNLP
Sbjct  61   AQTVTLEDIISWWFMPVNMGLTFLIGGLLGWLVVKILKPPPYLEGLIVATCSAGNMGNLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +I++PAIC+E  SPFG   VC T G+ YAS SMA+
Sbjct  121  IILVPAICDEDKSPFGNRSVCRTVGLSYASFSMAL  155



>ref|XP_010550503.1| PREDICTED: uncharacterized transporter YBR287W isoform X4 [Tarenaya 
hassleriana]
Length=396

 Score =   176 bits (445),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 117/155 (75%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGFL+LL+VASMP+++VL+IS LG+ LA+D+  +L    R  LN +VF VF P L+F++L
Sbjct  1    MGFLALLEVASMPIVQVLLISVLGAFLATDYCSLLSAETRRSLNKLVFVVFTPCLMFASL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A++VTL  ++  WFMP N+ +TF++G  LGW++ K+ +    L GLI+ + A+GNMGNL 
Sbjct  61   AKTVTLQDIISWWFMPLNVGITFLVGGVLGWLVVKVLKPKPQLHGLIIATCASGNMGNLM  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +I++PAIC+E+GSPFG+  VC + G+ YAS SMA+
Sbjct  121  LILVPAICDEEGSPFGSRSVCRSIGLSYASFSMAL  155



>ref|XP_009779996.1| PREDICTED: uncharacterized protein LOC104229115 [Nicotiana sylvestris]
 ref|XP_009779997.1| PREDICTED: uncharacterized protein LOC104229115 [Nicotiana sylvestris]
Length=419

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 119/155 (77%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGF +L +VASMP+L+VL+IS LG+L+A+D+  +L  +AR  LN +VF VF P+L+F++L
Sbjct  1    MGFWTLFEVASMPILQVLLISILGALMATDYLKLLHSDARRSLNKIVFVVFTPSLMFASL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A++VTLD ++  WFMP NI LTF++G  LGW++ K+ +   HL+GLI+ + +AGN+GNL 
Sbjct  61   AKTVTLDDIISWWFMPINIGLTFLVGGILGWLVVKILKPDLHLEGLIIATCSAGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +I+IPAIC EK SPFG   +C + G+ YAS SMA+
Sbjct  121  LIVIPAICKEKRSPFGDHGICASVGLSYASFSMAV  155



>emb|CDY26812.1| BnaC09g09390D [Brassica napus]
Length=393

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 117/155 (75%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGF SLL+VASMPV++VL+IS +G+ LA+D   +    AR  +N +VF +F PAL+F+NL
Sbjct  1    MGFWSLLEVASMPVIQVLIISLVGAYLATDRCKLFPVEARNSMNKVVFVIFAPALMFANL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A++VTL  ++  WFMP N+ LTF++G  LGW++ K+ + P +L+GLI+ + ++GNMGNLP
Sbjct  61   AQTVTLQDMVSWWFMPVNMGLTFLIGGLLGWMVVKILKPPPYLEGLIVATCSSGNMGNLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +I++PAIC+E  SPFG   VC T G+ YAS SMA+
Sbjct  121  IILVPAICDEDKSPFGNRSVCRTVGLSYASFSMAL  155



>ref|XP_006299821.1| hypothetical protein CARUB_v10016022mg [Capsella rubella]
 gb|EOA32719.1| hypothetical protein CARUB_v10016022mg [Capsella rubella]
Length=393

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGF SLL+VASMPV++VL++S +G+ LASD   +    AR  +N +VF +F PAL+F+NL
Sbjct  1    MGFWSLLEVASMPVIQVLIMSLVGAFLASDRCKLFPIEARNTMNKVVFVLFAPALMFANL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A++VTL+ ++  WFMP N+ LTF++G  LGW++ K+ + P +L+GLI+ + ++GNMGNLP
Sbjct  61   AQTVTLEDIISWWFMPVNMGLTFLIGGLLGWMVVKILKPPPYLEGLIVATCSSGNMGNLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +I++PAIC+E  SPFG   VC T G+ YAS SMA+
Sbjct  121  IILVPAICDEDKSPFGNRSVCRTVGLSYASFSMAL  155



>gb|KDO71531.1| hypothetical protein CISIN_1g013221mg [Citrus sinensis]
Length=396

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 119/154 (77%), Gaps = 0/154 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGF +  +VASMP+++VL+IS LG+L+A+ + ++L  +AR  LN MVF VF P+L+F++L
Sbjct  1    MGFWTFFEVASMPIVQVLLISVLGALMATQYWNLLTADARRSLNKMVFTVFTPSLMFASL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A++VTL+ ++  WFMP N+ +TF++G  LGWI+ KL R   HL+GL++ + A+GN+GNL 
Sbjct  61   AKTVTLEEIISWWFMPVNVAMTFLIGGILGWIVVKLLRPKPHLEGLVIATCASGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMA  572
            +II+PAIC+E+GSPFG  DVC + G+ Y +L+ A
Sbjct  121  LIIVPAICHEQGSPFGNRDVCSSVGLSYKALAQA  154



>gb|ABR16386.1| unknown [Picea sitchensis]
Length=426

 Score =   176 bits (446),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 119/155 (77%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M F  LL VASMPV+K+L+IS LG++L++ +A +L E++  H+N ++F VF PAL+F++L
Sbjct  1    MAFWDLLIVASMPVVKILLISGLGAVLSTRYAGVLTEDSLKHVNKVIFVVFTPALMFASL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A+SVT + ++  W MPFN+ LTF+ G+ LGWI+ K+T+ P++L G+++ +  AGNMGNL 
Sbjct  61   AQSVTFEDLISWWSMPFNVFLTFLFGAILGWIIVKITKPPEYLNGIVVANCCAGNMGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +I++PA+C+EKGSPFG   VC   G+ YAS SMA+
Sbjct  121  LIVVPALCHEKGSPFGEPSVCKLNGIAYASFSMAL  155



>ref|XP_009112433.1| PREDICTED: uncharacterized transporter YBR287W-like [Brassica 
rapa]
 ref|XP_009112434.1| PREDICTED: uncharacterized transporter YBR287W-like [Brassica 
rapa]
 emb|CDY30361.1| BnaA09g09160D [Brassica napus]
Length=393

 Score =   175 bits (444),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 117/155 (75%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGF SLL+VASMPV++VL+IS +G+ LA+D   +    AR  +N +VF +F PAL+F+NL
Sbjct  1    MGFWSLLEVASMPVIQVLIISLVGAYLATDRCKLFPVEARNSMNKVVFVIFAPALMFANL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A++VTL  ++  WFMP N+ LTF++G  LGW++ K+ + P +L+GLI+ + ++GNMGNLP
Sbjct  61   AQTVTLQDMVSWWFMPVNMGLTFLIGGLLGWMVVKILKPPPYLEGLIVATCSSGNMGNLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +I++PAIC+E  SPFG   VC T G+ YAS SMA+
Sbjct  121  IILVPAICDEDKSPFGNRSVCRTVGLSYASFSMAL  155



>gb|KHG24871.1| Transporter protein [Gossypium arboreum]
Length=402

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 114/155 (74%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGFL++  VA MPVLKV++++ +G  +A DH  +LG  A  HLNN+VF+V +PA+  S+L
Sbjct  1    MGFLNIFIVALMPVLKVILMTGIGLFIALDHIKLLGPEANHHLNNIVFYVLSPAIAASSL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++T  S + LWFMP NILLTF+ GS L W+L K+T+ P+HL+G+++G  +AGN+GNLP
Sbjct  61   AETITFQSFITLWFMPLNILLTFVFGSILAWLLIKITKTPKHLRGIVIGCCSAGNLGNLP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +I++PA+C E  +PFG   VC      YASLS+A+
Sbjct  121  LIMVPAVCEEANNPFGDPSVCSLLARPYASLSLAM  155



>ref|XP_009112263.1| PREDICTED: uncharacterized transporter YBR287W [Brassica rapa]
Length=393

 Score =   175 bits (444),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 115/155 (74%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGFL LL+VASMP+++VL+IS LG+ LA+D+  +L  + R  +N +VF VF P ++F+NL
Sbjct  1    MGFLELLEVASMPIVQVLLISVLGAFLATDYCSLLSADTRRSVNKLVFVVFTPCIMFANL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A++VTL  ++  WFMP N+ +TF++G  LGW++ KL      L GLI+ + A+GNMGNL 
Sbjct  61   AQTVTLQDIISWWFMPINVGITFLVGGILGWLVVKLLNPKPQLHGLIIATCASGNMGNLM  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +I++PAIC+E+GSPFG   VC + G+ YAS SMA+
Sbjct  121  IILVPAICDEEGSPFGNRSVCRSIGLSYASFSMAL  155



>emb|CDY18579.1| BnaA09g08160D [Brassica napus]
Length=394

 Score =   175 bits (444),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 115/155 (74%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGFL LL+VASMP+++VL+IS LG+ LA+D+  +L  + R  +N +VF VF P ++F+NL
Sbjct  1    MGFLELLEVASMPIVQVLLISVLGAFLATDYCSLLSADTRRSVNKLVFVVFTPCIMFANL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A++VTL  ++  WFMP N+ +TF++G  LGW++ KL      L GLI+ + A+GNMGNL 
Sbjct  61   AQTVTLQDIISWWFMPINVGITFLVGGILGWLVVKLLNPKPQLHGLIIATCASGNMGNLM  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +I++PAIC+E+GSPFG   VC + G+ YAS SMA+
Sbjct  121  IILVPAICDEEGSPFGNRSVCRSIGLSYASFSMAL  155



>emb|CDX81425.1| BnaC09g08360D [Brassica napus]
Length=393

 Score =   175 bits (444),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 115/155 (74%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGFL LL+VASMP+++VL+IS LG+ LA+D+  +L  + R  +N +VF VF P ++F+NL
Sbjct  1    MGFLELLEVASMPIVQVLLISVLGAFLATDYCSLLSADTRRSVNKLVFVVFTPCIMFANL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A++VTL  ++  WFMP N+ +TF++G  LGW++ KL      L GLI+ + A+GNMGNL 
Sbjct  61   AQTVTLQDIISWWFMPINVGITFLVGGILGWLVVKLLNPKPQLHGLIIATCASGNMGNLM  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +I++PAIC+E+GSPFG   VC + G+ YAS SMA+
Sbjct  121  IILVPAICDEEGSPFGNRSVCRSIGLSYASFSMAL  155



>gb|KJB10399.1| hypothetical protein B456_001G199900 [Gossypium raimondii]
Length=309

 Score =   173 bits (438),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 117/155 (75%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGF +L +VA+MP+L+VL+IS LG+ LA+D+  +  E+ R  LN +VF VF P+L+F++L
Sbjct  1    MGFWTLFEVAAMPILQVLIISLLGAFLATDYCKLFPEDTRRSLNKLVFVVFTPSLMFASL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A++VTL  ++  WFMP N+ +TF++G  +GW + K+ R   HL+GLI+ + +AGN+GNL 
Sbjct  61   AKTVTLQDIISWWFMPVNMGITFLVGGIVGWFVVKILRPKPHLEGLIIATCSAGNVGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +I++PA+CNE  SPFG  DVC++ G+ YAS SMA+
Sbjct  121  LILVPAVCNEDRSPFGNRDVCNSVGLSYASFSMAL  155



>ref|XP_007046465.1| Auxin efflux carrier family protein isoform 1 [Theobroma cacao]
 gb|EOX90622.1| Auxin efflux carrier family protein isoform 1 [Theobroma cacao]
Length=420

 Score =   176 bits (445),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 117/155 (75%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M F +L +VASMP+L+VL+IS LG+ +A+DH  +L  + R  LN +VF VF P+L+F++L
Sbjct  1    MSFWTLFEVASMPILQVLIISVLGAFMATDHCKLLSADTRRSLNKLVFVVFTPSLMFASL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A++VTL  ++  WFMP NI +TF++G  +GWI+ K+ R   HL+GLI+ + ++GN+GNL 
Sbjct  61   AKTVTLQDIISWWFMPVNIGITFLVGGIVGWIVVKILRPKPHLEGLIIATCSSGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +I++PA+CNE GSPFG  +VC + G+ YAS SMA+
Sbjct  121  LIVVPAVCNEDGSPFGNRNVCSSVGLSYASFSMAL  155



>ref|XP_007046466.1| Auxin efflux carrier family protein isoform 2 [Theobroma cacao]
 gb|EOX90623.1| Auxin efflux carrier family protein isoform 2 [Theobroma cacao]
Length=421

 Score =   176 bits (445),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 117/155 (75%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M F +L +VASMP+L+VL+IS LG+ +A+DH  +L  + R  LN +VF VF P+L+F++L
Sbjct  1    MSFWTLFEVASMPILQVLIISVLGAFMATDHCKLLSADTRRSLNKLVFVVFTPSLMFASL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A++VTL  ++  WFMP NI +TF++G  +GWI+ K+ R   HL+GLI+ + ++GN+GNL 
Sbjct  61   AKTVTLQDIISWWFMPVNIGITFLVGGIVGWIVVKILRPKPHLEGLIIATCSSGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +I++PA+CNE GSPFG  +VC + G+ YAS SMA+
Sbjct  121  LIVVPAVCNEDGSPFGNRNVCSSVGLSYASFSMAL  155



>ref|NP_177779.1| auxin efflux carrier family protein [Arabidopsis thaliana]
 gb|AAG51958.1|AC015450_19 unknown protein; 54709-56576 [Arabidopsis thaliana]
 gb|AEE35856.1| auxin efflux carrier family protein [Arabidopsis thaliana]
Length=415

 Score =   175 bits (444),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 114/154 (74%), Gaps = 0/154 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            M  L L   +S PV++ L+I+++G  LA D  ++LG +AR HLNN+VF+VF+P+L+ S L
Sbjct  1    MKLLELFIASSKPVVETLLITSVGFYLALDTVNLLGHDARKHLNNIVFYVFSPSLIGSRL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A SVT +S++ +WFMP N+LLTF++GS LGWI+  +T+ P  L+GLI+   A+GN+G +P
Sbjct  61   ADSVTYESLVKMWFMPVNVLLTFMIGSLLGWIVIVITKPPSQLRGLIISCCASGNLGTMP  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMA  572
            +IIIPAIC EKG PFG ++ C  YGM Y +LSM 
Sbjct  121  LIIIPAICKEKGGPFGDSESCEKYGMGYVTLSMT  154



>ref|XP_004232583.1| PREDICTED: uncharacterized transporter C5D6.04-like [Solanum 
lycopersicum]
Length=405

 Score =   175 bits (443),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 116/155 (75%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGF++LL+VASMP+L+VL++S LG+++A+D+  +L  +AR +LN +VF +F PAL+F++L
Sbjct  1    MGFMTLLEVASMPILQVLIVSGLGAVMATDYLKLLPADARKYLNRIVFVIFTPALMFASL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A SVT   ++  WFMP N+ LTF+ G  LGWI  K+ +   HL+GLI+ + ++GN+GNL 
Sbjct  61   AESVTFQDIITWWFMPVNVGLTFLFGGILGWIAMKILKPKPHLEGLIIATCSSGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +I+IPAIC E GSPFG    C + G+ YAS SMA+
Sbjct  121  LIVIPAICKEDGSPFGDHKTCASVGLSYASFSMAL  155



>gb|KJB60464.1| hypothetical protein B456_009G306300 [Gossypium raimondii]
 gb|KJB60465.1| hypothetical protein B456_009G306300 [Gossypium raimondii]
 gb|KJB60467.1| hypothetical protein B456_009G306300 [Gossypium raimondii]
Length=413

 Score =   175 bits (444),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 114/155 (74%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGFL LL VA +P+LKVL+++ +G  L  +  ++LG  AR +LN +VF+V +P L+FSNL
Sbjct  1    MGFLDLLVVALVPILKVLLVTGVGLFLGIEKINLLGPEARDYLNKIVFYVLSPCLLFSNL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A ++T  S++ LWFMP N+LLTF++GSALGWIL KLT+ P+HL+G+++G  + GN+GNL 
Sbjct  61   AETITYKSLVTLWFMPLNVLLTFLVGSALGWILAKLTKTPRHLQGIVIGCCSTGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +I+ P IC+E  SPF     C T    YASLSMA+
Sbjct  121  LIVFPDICDESNSPFSKLSTCSTDAEAYASLSMAV  155



>ref|XP_010270517.1| PREDICTED: uncharacterized protein LOC104606827 [Nelumbo nucifera]
 ref|XP_010270519.1| PREDICTED: uncharacterized protein LOC104606827 [Nelumbo nucifera]
Length=419

 Score =   175 bits (444),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 119/155 (77%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MGFLSLLKVASMPVLKVLMISALGSLLASDHAHILGENARMHLNNMVFFVFNPALVFSNL  290
            MGF +L +VASMPVL+VL+IS LG+ +A+++ ++L  +AR H+N +VF  F P+L+F+ L
Sbjct  1    MGFWTLFQVASMPVLQVLLISILGAFMATNYCNLLNADARRHMNKIVFITFTPSLMFACL  60

Query  291  ARSVTLDSVLLLWFMPFNILLTFILGSALGWILFKLTRAPQHLKGLILGSSAAGNMGNLP  470
            A++VT   ++  WFMP NI LTF++G  LGWIL K+ +   +L+GL++ + +AGN+GNL 
Sbjct  61   AKTVTFQDIISWWFMPVNIGLTFLIGGILGWILVKILKPEPYLEGLVIATCSAGNLGNLL  120

Query  471  VIIIPAICNEKGSPFGAADVCHTYGMVYASLSMAI  575
            +I++PAICNE GSPFG  +VC + G+ YAS+SMA+
Sbjct  121  LIVVPAICNEDGSPFGDHNVCGSVGLSYASMSMAL  155



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 696633491985