BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001D11

Length=492
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

sp|O22046.1|CHSE_IPONI  RecName: Full=Chalcone synthase E; AltNam...    294   1e-95   Ipomoea nil [qian niu]
gb|AAB41103.1|  chalcone synthase                                       290   5e-95   Ipomoea purpurea
sp|O22047.1|CHSE_IPOPU  RecName: Full=Chalcone synthase E; AltNam...    292   6e-95   Ipomoea purpurea
gb|ACD31533.1|  chalcone synthase 2                                     280   5e-92   Nicotiana attenuata
gb|AIY22756.1|  chalcone synthase                                       281   1e-90   Iochroma cyaneum
ref|XP_009774927.1|  PREDICTED: chalcone synthase 2                     281   2e-90   Nicotiana sylvestris
gb|AIY22757.1|  chalcone synthase                                       281   2e-90   Iochroma cyaneum
ref|XP_010264138.1|  PREDICTED: chalcone synthase G-like                275   4e-90   Nelumbo nucifera [Indian lotus]
gb|AHK22740.1|  chalcone synthase                                       280   4e-90   Nicotiana tabacum [American tobacco]
gb|ACS12837.1|  chalcone synthase                                       280   5e-90   Nicotiana alata [flowering tobacco]
ref|XP_009616637.1|  PREDICTED: chalcone synthase 2                     280   5e-90   Nicotiana tomentosiformis
gb|AIV99854.1|  chalcone synthase                                       279   5e-90   Iochroma calycinum
ref|XP_011091402.1|  PREDICTED: chalcone synthase                       279   5e-90   Sesamum indicum [beniseed]
ref|NP_001275296.1|  chalcone synthase 2                                279   9e-90   Solanum tuberosum [potatoes]
sp|Q43163.1|CHSB_SOLTU  RecName: Full=Chalcone synthase 1B; AltNa...    279   1e-89   Solanum tuberosum [potatoes]
ref|XP_009764938.1|  PREDICTED: chalcone synthase A                     278   1e-89   Nicotiana sylvestris
dbj|BAB20074.1|  chalcone synthase                                      278   1e-89   Torenia hybrid cultivar
ref|NP_001275352.1|  chalcone synthase 1A                               278   1e-89   Solanum tuberosum [potatoes]
gb|ABN80439.1|  chalcone synthase                                       278   1e-89   Nicotiana benthamiana
gb|ABS52573.1|  chalcone synthase                                       278   2e-89   Gossypium hirsutum [American cotton]
ref|NP_001234036.1|  chalcone synthase 2                                278   2e-89   
gb|ACH56521.1|  chalcone synthase                                       278   2e-89   Gossypium hirsutum [American cotton]
ref|XP_006586314.1|  PREDICTED: chalcone synthase 2-like                271   3e-89   
gb|AEN83501.1|  chalcone synthase                                       277   3e-89   Solanum tuberosum [potatoes]
gb|AGU70032.1|  chalcone synthase                                       277   3e-89   Solanum tuberosum [potatoes]
sp|P22928.2|CHSJ_PETHY  RecName: Full=Chalcone synthase J; AltNam...    277   3e-89   Petunia x hybrida [garden petunia]
gb|AAK49457.1|  chalcone synthase                                       277   4e-89   Nicotiana tabacum [American tobacco]
gb|KJB28222.1|  hypothetical protein B456_005G035100                    277   4e-89   Gossypium raimondii
gb|KJB61068.1|  hypothetical protein B456_009G339300                    277   5e-89   Gossypium raimondii
gb|KHG25969.1|  Chalcone synthase 1                                     277   5e-89   Gossypium arboreum [tree cotton]
gb|KDP20327.1|  hypothetical protein JCGZ_06413                         277   6e-89   Jatropha curcas
ref|XP_011020681.1|  PREDICTED: chalcone synthase 1                     276   8e-89   Populus euphratica
gb|KJB72142.1|  hypothetical protein B456_011G161200                    276   8e-89   Gossypium raimondii
gb|ACU23477.1|  unknown                                                 273   9e-89   Glycine max [soybeans]
gb|AEO96985.1|  chalcone synthase                                       276   1e-88   Gossypium hirsutum [American cotton]
ref|XP_009619773.1|  PREDICTED: chalcone synthase 1B                    276   1e-88   
gb|ADW11243.1|  chalcone synthase 2                                     276   1e-88   Camellia chekiangoleosa
gb|AEO96989.1|  chalcone synthase                                       276   1e-88   Gossypium hirsutum [American cotton]
gb|ACV72638.1|  chalcone synthase 1                                     276   1e-88   Gossypium hirsutum [American cotton]
sp|P48387.1|CHS2_CAMSI  RecName: Full=Chalcone synthase 2; AltNam...    276   1e-88   Camellia sinensis [black tea]
gb|AFM29141.1|  chalcone synthase                                       275   2e-88   Lycium barbarum [Duke of Argyll's teatree]
ref|XP_006420608.1|  hypothetical protein CICLE_v10005133mg             275   2e-88   Citrus clementina [clementine]
gb|AJO53275.1|  chalcone synthase                                       275   2e-88   Pogostemon cablin
gb|KJB72144.1|  hypothetical protein B456_011G161300                    275   2e-88   Gossypium raimondii
gb|AJM90013.1|  chalcone synthase                                       275   2e-88   Apocynum venetum
dbj|BAE45039.1|  chalcone synthase                                      275   3e-88   Gentiana triflora
gb|AAX63402.1|  chalcone synthase                                       275   3e-88   Solanum pinnatisectum
gb|AGW22222.1|  chalcone synthase                                       275   4e-88   Abelmoschus esculentus [gumbo]
ref|XP_007034442.1|  Chalcone and stilbene synthase family protein      275   4e-88   Theobroma cacao [chocolate]
ref|XP_006489796.1|  PREDICTED: chalcone synthase 1-like                275   4e-88   Citrus sinensis [apfelsine]
gb|ACE60221.1|  chalcone synthase                                       274   6e-88   Abelmoschus manihot [aibika]
sp|Q9ZRS4.1|CHSY_CATRO  RecName: Full=Chalcone synthase; AltName:...    274   6e-88   Catharanthus roseus [chatas]
gb|ABI79305.1|  chalcone synthase                                       274   7e-88   Pyrus communis
ref|XP_002299281.2|  naregenin-chalcone synthase family protein         274   7e-88   Populus trichocarpa [western balsam poplar]
ref|XP_009376347.1|  PREDICTED: polyketide synthase 5                   274   8e-88   Pyrus x bretschneideri [bai li]
gb|AFQ92052.1|  chalcone synthase                                       274   8e-88   Pyrus pyrifolia [sha li]
gb|AAX16494.1|  chalcone synthase                                       274   8e-88   Pyrus communis
ref|XP_011020677.1|  PREDICTED: chalcone synthase 1-like isoform X1     274   9e-88   Populus euphratica
ref|XP_011020680.1|  PREDICTED: chalcone synthase 1-like isoform X2     273   1e-87   Populus euphratica
dbj|BAM17286.1|  chalcone synthase                                      273   1e-87   Petunia x hybrida [garden petunia]
ref|XP_007157049.1|  hypothetical protein PHAVU_002G0390000g            267   1e-87   Phaseolus vulgaris [French bean]
gb|ACN60400.1|  chalcone synthase                                       273   1e-87   Capsicum annuum
ref|XP_003531225.1|  PREDICTED: chalcone synthase 1 isoform X1          273   1e-87   
ref|XP_011034458.1|  PREDICTED: chalcone synthase 1-like                273   1e-87   Populus euphratica
emb|CAJ44127.1|  chalcone synthase                                      273   1e-87   Misopates orontium
ref|XP_007157047.1|  hypothetical protein PHAVU_002G0389000g            264   1e-87   Phaseolus vulgaris [French bean]
ref|XP_010023738.1|  PREDICTED: chalcone synthase 1                     273   1e-87   Eucalyptus grandis [rose gum]
gb|AFL47798.1|  chalcone synthase                                       273   2e-87   Capsicum annuum
ref|XP_010099135.1|  Chalcone synthase                                  273   2e-87   Morus notabilis
gb|ABB89213.1|  chalcone synthase                                       273   2e-87   Sorbus aucuparia [European mountain ash]
ref|XP_007198981.1|  hypothetical protein PRUPE_ppa023080mg             267   2e-87   
ref|XP_002299282.1|  naregenin-chalcone synthase family protein         273   2e-87   Populus trichocarpa [western balsam poplar]
gb|ACN30003.1|  chalcone synthase                                       273   2e-87   Vitis rotundifolia [fox grape]
ref|XP_008380609.1|  PREDICTED: polyketide synthase 5                   273   2e-87   
gb|AEK80412.1|  type III polyketide synthase                            273   2e-87   Acer maximowiczianum [Nikko maple]
gb|ADD74168.1|  chalcone synthase                                       273   2e-87   Nelumbo nucifera [Indian lotus]
gb|AHA61354.1|  chalcone synthase                                       273   2e-87   Phyllanthus emblica [amla]
gb|AEW12813.1|  chalcone synthase                                       273   2e-87   Brunfelsia brasiliensis subsp. macrocalyx
gb|AFC37244.1|  chalcone synthase 3                                     273   3e-87   Camellia chekiangoleosa
gb|AFM36768.1|  chalcone synthase                                       273   3e-87   Narcissus tazetta subsp. chinensis
gb|AAF60297.1|AF233638_1  chalcone synthase                             272   3e-87   Petunia x hybrida [garden petunia]
sp|P08894.1|CHSA_PETHY  RecName: Full=Chalcone synthase A; AltNam...    272   3e-87   Petunia x hybrida [garden petunia]
sp|O04111.1|CHSY_PERFR  RecName: Full=Chalcone synthase; AltName:...    272   3e-87   Perilla frutescens [beefsteak-mint]
sp|P17957.1|CHS2_SOYBN  RecName: Full=Chalcone synthase 2; AltNam...    272   3e-87   Glycine max [soybeans]
dbj|BAM17287.1|  chalcone synthase                                      272   3e-87   Petunia x hybrida [garden petunia]
gb|AAQ62588.1|  chalcone synthase CHS4                                  272   4e-87   Glycine max [soybeans]
ref|XP_003524935.1|  PREDICTED: chalcone synthase                       272   4e-87   
ref|XP_010264137.1|  PREDICTED: chalcone synthase 1-like                268   4e-87   Nelumbo nucifera [Indian lotus]
gb|AAN05791.1|  chalcone synthase                                       272   4e-87   Mazus pumilus [tokiwahaze]
ref|XP_002303821.2|  naregenin-chalcone synthase family protein         272   4e-87   Populus trichocarpa [western balsam poplar]
gb|AFH68066.1|  chalcone synthase                                       272   4e-87   Pyrus pyrifolia [sha li]
ref|XP_003516867.1|  PREDICTED: chalcone synthase 6-like                272   4e-87   Glycine max [soybeans]
gb|AIB06736.1|  chalcone synthases-1                                    272   4e-87   Mangifera indica
dbj|BAB92996.1|  chalcone synthase                                      272   5e-87   Malus domestica [apple tree]
gb|AAO32821.1|  chalcone synthase                                       272   5e-87   Arachis hypogaea [goober]
dbj|BAM17288.1|  chalcone synthase                                      272   5e-87   Petunia x hybrida [garden petunia]
dbj|BAA19548.1|  chalcone synthase                                      271   5e-87   Perilla frutescens [beefsteak-mint]
sp|P19168.1|CHS3_SOYBN  RecName: Full=Chalcone synthase 3; AltNam...    271   5e-87   Glycine max [soybeans]
gb|ABP57071.1|  chalcone synthase                                       271   6e-87   Plectranthus scutellarioides
ref|XP_006585154.1|  PREDICTED: chalcone synthase 3-like isoform X2     271   6e-87   
ref|NP_001276296.1|  chalcone synthase                                  271   6e-87   Glycine max [soybeans]
gb|AFM74036.1|  chalcone synthase                                       271   8e-87   Acer palmatum [Japanese maple]
gb|AGH13332.1|  chalcone synthase                                       271   8e-87   Rhus chinensis
gb|AAO13091.1|  chalcone synthase                                       271   8e-87   Camellia sinensis [black tea]
gb|AFM36767.1|  chalcone synthase                                       271   8e-87   Narcissus tazetta subsp. chinensis
dbj|BAI66465.1|  chalcone synthase                                      271   8e-87   Camellia japonica [common camellia]
gb|KHN12336.1|  Chalcone synthase 1                                     271   9e-87   Glycine soja [wild soybean]
gb|AFC37242.1|  chalcone synthase 1                                     271   9e-87   Camellia chekiangoleosa
gb|AHY35308.1|  chalcone synthase 1                                     271   1e-86   Morus notabilis
gb|KHN23260.1|  Chalcone synthase 6                                     272   1e-86   Glycine soja [wild soybean]
ref|XP_002303820.1|  naregenin-chalcone synthase family protein         271   1e-86   
ref|XP_003531219.1|  PREDICTED: chalcone synthase 5-like                271   1e-86   
gb|AGI02994.1|  chalcone synthase                                       271   1e-86   Camellia sinensis [black tea]
sp|P48386.1|CHS1_CAMSI  RecName: Full=Chalcone synthase 1; AltNam...    271   1e-86   Camellia sinensis [black tea]
dbj|BAC10998.1|  chalcone synthase                                      271   1e-86   Nierembergia sp. NB17
gb|AEN04070.1|  chalcone synthase                                       271   1e-86   Narcissus tazetta subsp. chinensis
emb|CAA32731.1|  chalcone synthase                                      270   2e-86   Petunia x hybrida [garden petunia]
emb|CAA64452.1|  naringenin-chalcone synthase                           270   2e-86   Juglans nigra x Juglans regia
sp|Q9ZRR8.1|CHS1_CASGL  RecName: Full=Chalcone synthase; AltName:...    270   2e-86   Casuarina glauca
ref|NP_001234033.1|  chalcone synthase 1                                270   2e-86   
ref|XP_011034455.1|  PREDICTED: chalcone synthase 1-like                270   2e-86   Populus euphratica
gb|AAB36038.1|  chalcone synthase                                       270   2e-86   Petunia x hybrida [garden petunia]
ref|XP_011034457.1|  PREDICTED: chalcone synthase 1-like                270   2e-86   Populus euphratica
gb|AAU43217.1|  chalcone synthase                                       270   3e-86   Arachis hypogaea [goober]
gb|AFM36766.1|  chalcone synthase                                       270   3e-86   Narcissus tazetta subsp. chinensis
sp|P06515.1|CHSY_ANTMA  RecName: Full=Chalcone synthase; AltName:...    270   3e-86   Antirrhinum majus [garden snapdragon]
gb|AGE84303.1|  chalcone synthase                                       270   3e-86   Malus domestica [apple tree]
emb|CAC88858.1|  chalcone synthase                                      270   3e-86   Rhododendron simsii
gb|AID69535.1|  chalcone synthase                                       270   3e-86   Phlomoides rotata
ref|XP_008380608.1|  PREDICTED: polyketide synthase 5-like              270   3e-86   
gb|AFE56210.1|  chalcone synthase                                       269   4e-86   Camellia sinensis [black tea]
gb|AFX71920.1|  CHS2 chalcone synthase                                  269   4e-86   Malus domestica [apple tree]
gb|ACA04008.1|  chalcone synthase                                       269   4e-86   Diplacus aurantiacus
ref|XP_010264056.1|  PREDICTED: chalcone synthase 1                     269   5e-86   
gb|AAL67805.1|AF461105_1  chalcone synthase                             269   5e-86   Hypericum perforatum
dbj|BAE17123.1|  chalcone synthase                                      269   5e-86   Fragaria x ananassa
ref|XP_009376348.1|  PREDICTED: polyketide synthase 5-like              269   6e-86   Pyrus x bretschneideri [bai li]
gb|AGV53049.1|  chalcone synthase                                       269   6e-86   Actinidia chinensis
sp|Q9XJ58.1|CHS1_CITSI  RecName: Full=Chalcone synthase 1; AltNam...    269   6e-86   Citrus sinensis [apfelsine]
gb|ADD74167.1|  chalcone synthase                                       269   6e-86   Nelumbo nucifera [Indian lotus]
ref|XP_004306543.1|  PREDICTED: polyketide synthase 1                   269   6e-86   Fragaria vesca subsp. vesca
sp|P23569.1|CHSY_PUEML  RecName: Full=Chalcone synthase; AltName:...    269   6e-86   Pueraria montana var. lobata [kudzu]
gb|AAM00232.1|AF358432_1  root-specific chalcone synthase               269   6e-86   Senna alata [bajagua]
gb|ABF59866.1|  chalcone synthase                                       269   7e-86   Lupinus luteus
dbj|BAE17124.1|  chalcone synthase                                      269   7e-86   Fragaria x ananassa
ref|XP_007223028.1|  hypothetical protein PRUPE_ppa006899mg             269   7e-86   Prunus persica
ref|XP_003533807.1|  PREDICTED: chalcone synthase 6                     269   7e-86   Glycine max [soybeans]
gb|ABF59867.1|  chalcone synthase                                       268   7e-86   Lupinus luteus
dbj|BAE17122.1|  chalcone synthase                                      269   7e-86   Fragaria x ananassa
gb|AEJ88217.1|  chalcone synthase                                       269   7e-86   Prunus persica
gb|AAM90651.1|AF400566_1  chalcone synthase 11                          269   7e-86   Rubus idaeus [European raspberry]
gb|ACJ54531.1|  chalcone synthase                                       268   8e-86   Malus domestica [apple tree]
gb|AGW24283.1|  chalcone synthase                                       268   9e-86   Melastoma malabathricum
gb|ABM63466.1|  aromatic polyketide synthase                            268   9e-86   Hypericum hookerianum
gb|AAM00231.1|AF358431_1  root-specific chalcone synthase               268   9e-86   Senna alata [bajagua]
ref|XP_009353801.1|  PREDICTED: chalcone synthase                       268   9e-86   Pyrus x bretschneideri [bai li]
sp|Q9FUB7.1|CHSY_HYPAN  RecName: Full=Chalcone synthase; AltName:...    268   1e-85   Hypericum androsaemum
gb|AFU52909.1|  chalcone synthase                                       268   1e-85   Hypericum sampsonii
ref|XP_010249317.1|  PREDICTED: chalcone synthase                       268   1e-85   Nelumbo nucifera [Indian lotus]
gb|ACD31532.1|  chalcone synthase 1                                     265   1e-85   Nicotiana attenuata
ref|XP_009370115.1|  PREDICTED: chalcone synthase-like                  268   1e-85   Pyrus x bretschneideri [bai li]
gb|ADV29810.1|  chalcone synthase                                       268   1e-85   Malus toringoides [cutleaf crab apple]
gb|AFM36769.1|  chalcone synthase                                       268   1e-85   Narcissus tazetta subsp. chinensis
ref|XP_007032052.1|  Chalcone and stilbene synthase family protein      268   1e-85   
emb|CAA64366.1|  naringenin-chalcone synthase                           268   1e-85   Juglans nigra x Juglans regia
gb|AFJ49141.1|  CHS                                                     268   1e-85   Prunus persica
gb|AGZ15299.1|  chalcone synthase                                       268   1e-85   Pyrus x bretschneideri [bai li]
ref|XP_007157050.1|  hypothetical protein PHAVU_002G039100g             268   1e-85   Phaseolus vulgaris [French bean]
ref|XP_007223025.1|  hypothetical protein PRUPE_ppa006888mg             268   1e-85   Prunus persica
ref|XP_003531223.1|  PREDICTED: chalcone synthase 1                     268   1e-85   Glycine max [soybeans]
sp|P49440.1|CHSY_PHAVU  RecName: Full=Chalcone synthase 17; AltNa...    268   1e-85   Phaseolus vulgaris [French bean]
ref|XP_004504355.1|  PREDICTED: chalcone synthase 1-like                268   1e-85   Cicer arietinum [garbanzo]
ref|XP_009376346.1|  PREDICTED: chalcone synthase-like                  268   2e-85   
dbj|BAC87863.1|  chalcone synthase                                      268   2e-85   Torenia hybrid cultivar
sp|B0LDU6.1|PKS5_RUBID  RecName: Full=Polyketide synthase 5; Shor...    268   2e-85   Rubus idaeus [European raspberry]
ref|XP_007157043.1|  hypothetical protein PHAVU_002G038700g             268   2e-85   Phaseolus vulgaris [French bean]
ref|XP_007158815.1|  hypothetical protein PHAVU_002G184300g             268   2e-85   Phaseolus vulgaris [French bean]
ref|XP_007157042.1|  hypothetical protein PHAVU_002G038600g             268   2e-85   Phaseolus vulgaris [French bean]
gb|AJO67963.1|  chalcone synthase                                       268   2e-85   Prunus avium [gean]
gb|ADZ54780.1|  naringenin-chalcone synthase                            268   2e-85   Prunus avium [gean]
ref|XP_008224578.1|  PREDICTED: polyketide synthase 5                   267   2e-85   Prunus mume [ume]
gb|AHL69646.1|  chalcone synthase 1                                     267   3e-85   Phyllanthus emblica [amla]
dbj|BAO58433.1|  chalcone synthase                                      267   3e-85   Vaccinium ashei
gb|EPS72180.1|  chalcone synthase                                       267   3e-85   Genlisea aurea
ref|XP_002264019.1|  PREDICTED: chalcone synthase 2                     267   4e-85   Vitis vinifera
dbj|BAC66467.1|  chalcone synthase                                      267   4e-85   Rosa hybrid cultivar
ref|XP_008358057.1|  PREDICTED: polyketide synthase 5                   267   4e-85   
sp|P48388.1|CHS3_CAMSI  RecName: Full=Chalcone synthase 3; AltNam...    267   4e-85   Camellia sinensis [black tea]
gb|AEC13058.1|  chalcone synthase protein                               266   5e-85   Rosa chinensis [China rose]
gb|AEP17003.1|  chalcone synthase                                       266   5e-85   Vitis vinifera
gb|ABF59869.1|  chalcone synthase                                       266   5e-85   Lupinus luteus
ref|XP_004306542.1|  PREDICTED: polyketide synthase 1                   266   5e-85   Fragaria vesca subsp. vesca
gb|AAM90652.1|AF400567_1  chalcone synthase 6                           266   5e-85   Rubus idaeus [European raspberry]
gb|AEP17004.1|  chalcone synthase 3                                     265   5e-85   Vitis vinifera
ref|XP_003601647.1|  Chalcone synthase                                  266   5e-85   Medicago truncatula
sp|Q9AU11.1|PKS1_RUBID  RecName: Full=Polyketide synthase 1; Shor...    266   6e-85   Rubus idaeus [European raspberry]
ref|XP_009353802.1|  PREDICTED: chalcone synthase-like                  266   6e-85   Pyrus x bretschneideri [bai li]
sp|P51090.1|CHSY_VITVI  RecName: Full=Chalcone synthase; AltName:...    266   6e-85   Vitis vinifera
ref|XP_008224579.1|  PREDICTED: polyketide synthase 5-like              266   6e-85   Prunus mume [ume]
ref|NP_001267879.1|  chalcone synthase                                  266   6e-85   Vitis vinifera
gb|AAM90650.1|AF400565_1  chalcone synthase 5                           266   6e-85   Rubus idaeus [European raspberry]
ref|XP_007157053.1|  hypothetical protein PHAVU_002G039300g             266   7e-85   Phaseolus vulgaris [French bean]
sp|B0LDU5.1|PKS4_RUBID  RecName: Full=Polyketide synthase 4; Shor...    266   7e-85   Rubus idaeus [European raspberry]
ref|XP_007161599.1|  hypothetical protein PHAVU_001G083000g             266   7e-85   Phaseolus vulgaris [French bean]
ref|XP_008224580.1|  PREDICTED: polyketide synthase 5-like              266   7e-85   Prunus mume [ume]
gb|AFJ44312.1|  chalcone synthase                                       266   7e-85   Lonicera japonica [Japanese honeysuckle]
gb|AGL50915.1|  chalcone synthase                                       266   7e-85   Pyrus communis
gb|AAM00230.1|AF358430_1  root-specific chalcone synthase               266   8e-85   Senna alata [bajagua]
gb|ADP37944.1|  chalcone synthase                                       258   8e-85   Fragaria chiloensis
gb|AAK39112.1|AF358656_1  chalcone synthase                             265   9e-85   Ipomoea purpurea
gb|ACT32034.1|  chalcone synthase                                       266   1e-84   Glycine soja [wild soybean]
ref|XP_003537853.1|  PREDICTED: chalcone synthase                       266   1e-84   
gb|AFK33946.1|  unknown                                                 266   1e-84   Lotus japonicus
gb|ACU21426.1|  unknown                                                 266   1e-84   Glycine max [soybeans]
gb|AIC75908.1|  chalcone synthase                                       265   1e-84   Hibiscus cannabinus [bimli-jute]
gb|AFL72079.1|  chalcone synthase                                       265   1e-84   Agastache rugosa
gb|ACS36661.1|  CHS4                                                    265   1e-84   Vitis labrusca x Vitis vinifera [Labruscan grape]
gb|ABV23279.1|  chalcone synthase                                       265   1e-84   Lupinus albus
gb|AFM36770.1|  chalcone synthase                                       265   2e-84   Narcissus tazetta subsp. chinensis
dbj|BAA31259.1|  chalcone synthase                                      265   2e-84   Vitis vinifera
gb|AAX99413.1|  chalcone synthase                                       265   2e-84   Fragaria x ananassa
ref|XP_003518828.1|  PREDICTED: chalcone synthase 6-like                265   2e-84   Glycine max [soybeans]
sp|O22045.1|CHSD_IPONI  RecName: Full=Chalcone synthase D; AltNam...    265   2e-84   Ipomoea nil [qian niu]
dbj|BAA22045.1|  chalcone synthase                                      263   2e-84   Pisum sativum [garden pea]
gb|ABB30178.1|  chalcone synthase 1                                     265   2e-84   Glycine max [soybeans]
gb|AGI02993.1|  chalcone synthase                                       265   2e-84   Camellia sinensis [black tea]
sp|P51089.1|CHSY_VIGUN  RecName: Full=Chalcone synthase; AltName:...    265   2e-84   Vigna unguiculata
gb|AGI02996.1|  chalcone synthase                                       265   3e-84   Camellia sinensis [black tea]
dbj|BAO58435.1|  chalcone synthase                                      265   3e-84   Vaccinium ashei
gb|AEO36937.1|  CHS                                                     256   3e-84   Canarium album [Chinese white-olive]
sp|Q8RVK9.1|CHS_CANSA  RecName: Full=Naringenin-chalcone synthase       264   4e-84   Cannabis sativa
ref|XP_010099134.1|  Chalcone synthase                                  264   5e-84   Morus notabilis
dbj|BAB84112.1|  chalcone synthase                                      264   5e-84   Vitis vinifera
gb|ABY68457.1|  chalcone synthase                                       264   5e-84   Ipomoea batatas [batate]
gb|AIA22214.1|  chalcone synthase                                       264   5e-84   Hibiscus cannabinus [bimli-jute]
gb|AHB50476.1|  putative stilbene synthase                              264   5e-84   Arachis hypogaea [goober]
gb|ADZ45296.1|  chalcone synthase 2                                     264   5e-84   Glycyrrhiza uralensis [Chinese licorice]
gb|ABL14036.1|  chalcone synthase 2                                     259   5e-84   Astragalus mongholicus
gb|ACH67480.1|  chalcone synthase                                       264   5e-84   Glycyrrhiza inflata
gb|AHJ80976.1|  chalcone synthase                                       264   5e-84   Erythranthe lewisii
dbj|BAA75310.1|  Chalcone synthase                                      264   5e-84   Ipomoea batatas [batate]
sp|P51082.1|CHSB_PEA  RecName: Full=Chalcone synthase 1B; AltName...    264   6e-84   Pisum sativum [garden pea]
gb|ABM66532.1|  chalcone synthase                                       264   6e-84   Glycyrrhiza uralensis [Chinese licorice]
dbj|BAF49290.1|  chalcone synthase                                      264   6e-84   Clitoria ternatea
dbj|BAO58434.1|  chalcone synthase                                      264   6e-84   Vaccinium ashei
gb|AAT75302.1|  chalcone synthase                                       264   6e-84   Camellia sinensis [black tea]
ref|XP_002518132.1|  Chalcone synthase, putative                        264   7e-84   Ricinus communis
gb|ACB78187.1|  chalcone synthase                                       264   7e-84   Senna tora
sp|Q9MB38.1|CHS6_IPOBA  RecName: Full=Chalcone synthase DII; AltN...    264   7e-84   Ipomoea batatas [batate]
gb|ACT31917.1|  chalcone synthase                                       264   8e-84   Ipomoea batatas [batate]
gb|ABL14038.1|  chalcone synthase 4                                     259   8e-84   Astragalus mongholicus
ref|XP_004502226.1|  PREDICTED: chalcone synthase 1B-like               263   9e-84   Cicer arietinum [garbanzo]
gb|ABO31370.1|  chalcone synthase                                       259   9e-84   Gossypium hirsutum [American cotton]
gb|AEO36981.1|  chalcone synthase                                       263   1e-83   Dimocarpus longan [longan]
gb|AAK39113.1|AF358657_1  chalcone synthase                             263   1e-83   Ipomoea purpurea
emb|CAK19319.1|  naringenin-chalcone synthase                           263   1e-83   Humulus lupulus [common hop]
gb|ACM17224.1|  naringenin-chalcone synthase                            263   1e-83   Humulus lupulus [common hop]
emb|CAK19318.1|  naringenin-chalcone synthase                           263   1e-83   Humulus lupulus [common hop]
emb|CAK19317.1|  naringenin-chalcone synthase                           263   1e-83   Humulus lupulus [common hop]
gb|AFW98276.1|  chalone synthase                                        263   1e-83   Senna tora
emb|CAA05512.1|  chalcone synthase                                      263   1e-83   Digitalis lanata [Grecian foxglove]
gb|AAK39114.1|AF358658_1  chalcone synthase                             263   2e-83   Ipomoea purpurea
gb|AAO67373.1|  chalcone synthase                                       263   2e-83   Glycine max [soybeans]
gb|AHK07000.1|  chalcone synthase                                       263   2e-83   Olea europaea
gb|ABW69675.1|  chalcone synthase D                                     263   2e-83   Ipomoea purpurea
gb|AAK39111.1|AF358655_1  chalcone synthase                             263   2e-83   Ipomoea purpurea
gb|EYU43821.1|  hypothetical protein MIMGU_mgv1a007904mg                263   2e-83   Erythranthe guttata [common monkey flower]
sp|Q9MB41.1|CHS2_IPOBA  RecName: Full=Chalcone synthase LF2; AltN...    263   2e-83   Ipomoea batatas [batate]
gb|AAK39110.1|AF358654_1  chalcone synthase                             262   2e-83   Ipomoea purpurea
sp|Q9MB36.1|CHS8_IPOBA  RecName: Full=Chalcone synthase DIV; AltN...    262   2e-83   Ipomoea batatas [batate]
gb|EYU43822.1|  hypothetical protein MIMGU_mgv1a007937mg                262   3e-83   Erythranthe guttata [common monkey flower]
ref|XP_003601648.1|  Chalcone synthase                                  262   3e-83   Medicago truncatula
gb|ADZ45294.1|  chalcone synthase 3                                     262   3e-83   Glycyrrhiza uralensis [Chinese licorice]
gb|ABK22869.1|  unknown                                                 255   3e-83   Picea sitchensis
sp|P51081.1|CHSA_PEA  RecName: Full=Chalcone synthase 1A; AltName...    262   3e-83   Pisum sativum [garden pea]
gb|AFU90825.1|  chalcone synthase                                       262   3e-83   Epimedium sagittatum
ref|XP_002303819.2|  naregenin-chalcone synthase family protein         262   3e-83   Populus trichocarpa [western balsam poplar]
gb|AFD36435.1|  chalcone synthase 1                                     262   3e-83   Astragalus membranaceus
gb|AHC07953.1|  chalcone synthase                                       262   3e-83   Indosasa hispida
sp|Q9MB33.1|CHS1_IPOBA  RecName: Full=Chalcone synthase LF1; AltN...    262   4e-83   
gb|ADZ45298.1|  chalcone synthase 1                                     261   5e-83   
gb|KEH27375.1|  chalcone and stilbene synthase family protein           261   5e-83   
sp|Q9MB39.1|CHS4_IPOBA  RecName: Full=Chalcone synthase LF4; AltN...    261   6e-83   
gb|AFA55180.1|  chalcone synthase                                       261   7e-83   
gb|ABE01413.1|  chalcone synthase                                       261   7e-83   
sp|A2ZEX7.1|CHS1_ORYSI  RecName: Full=Chalcone synthase 1; Short=...    261   7e-83   
ref|NP_001068009.1|  Os11g0530600                                       261   8e-83   
gb|AID51449.1|  chalcone synthase 2                                     261   8e-83   
gb|AHZ97870.1|  chalcone synthase                                       261   9e-83   
gb|AEK70334.1|  chalcone synthase                                       261   9e-83   
dbj|BAD34456.1|  chalcone synthase                                      261   1e-82   
sp|P51077.1|CHS3_MEDSA  RecName: Full=Chalcone synthase 4-1; AltN...    260   1e-82   
gb|AFK48401.1|  unknown                                                 260   1e-82   
ref|XP_006446902.1|  hypothetical protein CICLE_v10015535mg             261   1e-82   
gb|ABF59865.1|  chalcone synthase                                       260   1e-82   
gb|ACX37403.1|  chalcone synthase                                       261   1e-82   
ref|XP_006468926.1|  PREDICTED: chalcone synthase 2-like                260   1e-82   
gb|KDO45963.1|  hypothetical protein CISIN_1g016330mg                   260   1e-82   
sp|Q9AU09.1|PKS3_RUBID  RecName: Full=Polyketide synthase 3; Shor...    260   1e-82   
sp|Q9AU10.1|PKS2_RUBID  RecName: Full=Inactive polyketide synthas...    260   1e-82   
gb|KEH27376.1|  chalcone and stilbene synthase family protein           260   1e-82   
gb|ACQ41890.1|  chalcone synthase                                       260   1e-82   
sp|P30077.1|CHS9_MEDSA  RecName: Full=Chalcone synthase 9; AltNam...    260   1e-82   
gb|AHY35309.1|  chalcone synthase 2                                     260   2e-82   
gb|ADZ45299.1|  chalcone synthase 1                                     260   2e-82   
gb|ADZ45295.1|  chalcone synthase 3                                     260   2e-82   
gb|KJB33196.1|  hypothetical protein B456_006G000200                    260   2e-82   
sp|Q9MB37.1|CHS7_IPOBA  RecName: Full=Chalcone synthase DIII; Alt...    260   2e-82   
emb|CAC19808.1|  chalcone synthase                                      260   2e-82   
gb|AFA53723.1|  chalcone synthase                                       261   2e-82   
sp|O82144.1|CHSY_HYDMC  RecName: Full=Chalcone synthase; AltName:...    259   2e-82   
gb|AEY75224.1|  chalcone synthase                                       256   3e-82   
ref|XP_006662967.1|  PREDICTED: chalcone synthase 1-like                259   3e-82   
sp|Q9MB40.1|CHS3_IPOBA  RecName: Full=Chalcone synthase LF3; AltN...    259   3e-82   
sp|P51075.2|CHSY_BETPN  RecName: Full=Chalcone synthase; AltName:...    259   3e-82   
gb|AAD49355.1|AF169800_1  chalcone synthase                             259   4e-82   
ref|XP_010908134.1|  PREDICTED: chalcone synthase 3-like                259   4e-82   
gb|AAP20864.1|  putative chalcone synthase                              259   5e-82   
ref|XP_004493096.1|  PREDICTED: chalcone synthase-like                  259   5e-82   
ref|XP_002450870.1|  hypothetical protein SORBIDRAFT_05g020160          259   5e-82   
ref|XP_002449616.1|  hypothetical protein SORBIDRAFT_05g020150          259   5e-82   
gb|AGM46641.1|  chalcone synthase protein                               259   5e-82   
gb|ADZ45297.1|  chalcone synthase 2                                     259   5e-82   
gb|KHN25612.1|  Chalcone synthase 7                                     259   5e-82   
ref|XP_003517529.1|  PREDICTED: chalcone synthase 7                     259   5e-82   
ref|XP_003624524.1|  Chalcone synthase                                  259   5e-82   
ref|XP_002450871.1|  hypothetical protein SORBIDRAFT_05g020170          259   6e-82   
ref|XP_002450877.1|  hypothetical protein SORBIDRAFT_05g020230          259   6e-82   
ref|XP_008808809.1|  PREDICTED: chalcone synthase 3                     259   6e-82   
sp|Q9SBL7.1|CHS2_SORBI  RecName: Full=Chalcone synthase 2; AltNam...    259   6e-82   
gb|ACX31605.1|  chalcone synthase                                       259   6e-82   
gb|AEF14414.1|  chalcone synthase                                       259   6e-82   
gb|ACU20027.1|  unknown                                                 259   6e-82   
ref|XP_002450874.1|  hypothetical protein SORBIDRAFT_05g020200          259   6e-82   
gb|AIM54369.1|  chalcone synthase                                       259   7e-82   
ref|XP_003553986.1|  PREDICTED: chalcone synthase-like                  258   8e-82   
ref|XP_010908135.1|  PREDICTED: chalcone synthase 3-like                258   9e-82   
sp|O23882.1|CHS4_PEA  RecName: Full=Chalcone synthase 4; AltName:...    258   9e-82   
gb|AAW56963.1|  chalcone synthase C2-Idf-III                            258   9e-82   
pdb|1JWX|A  Chain A, Chalcone Synthase--F215s Mutant                    258   9e-82   
pdb|1CML|A  Chain A, Chalcone Synthase From Alfalfa Complexed Wit...    258   9e-82   
pdb|1I86|A  Chain A, Chalcone Synthase, G256a Mutant                    258   9e-82   
pdb|1CHW|A  Chain A, Chalcone Synthase From Alfalfa Complexed Wit...    258   1e-81   
pdb|1I88|A  Chain A, Chalcone Synthase (G256v)                          258   1e-81   
gb|ABC71308.1|  chalcone synthase                                       258   1e-81   
pdb|1BI5|A  Chain A, Chalcone Synthase From Alfalfa                     258   1e-81   
pdb|1I89|A  Chain A, Chalcone Synthase (G256l)                          258   1e-81   
gb|ADZ45300.1|  chalcone synthase 1                                     258   1e-81   
emb|CAP20328.1|  chalcone synthase                                      258   1e-81   
pdb|1I8B|A  Chain A, Chalcone Synthase (g256f)                          258   1e-81   
sp|Q9FSB7.1|CHS3_RUTGR  RecName: Full=Chalcone synthase 3; AltNam...    258   1e-81   
ref|XP_002450875.1|  hypothetical protein SORBIDRAFT_05g020210          258   1e-81   
emb|CAH61575.1|  chalcone synthase                                      258   1e-81   
pdb|4WUM|A  Chain A, X-ray Crystal Structure Of Chalcone Synthase...    258   1e-81   
sp|P30074.1|CHS2_MEDSA  RecName: Full=Chalcone synthase 2; AltNam...    258   1e-81   
ref|XP_010907554.1|  PREDICTED: chalcone synthase 3-like                258   1e-81   
ref|NP_001142246.1|  chalcone synthase C2                               258   2e-81   
sp|Q9FSB8.1|CHS2_RUTGR  RecName: Full=Chalcone synthase 2; AltNam...    258   2e-81   
gb|AGE10597.1|  chalcone synthase                                       258   2e-81   
ref|XP_003610852.1|  Chalcone synthase                                  258   2e-81   
sp|O23883.1|CHS3_PEA  RecName: Full=Chalcone synthase 3; AltName:...    257   2e-81   
emb|CAC20725.1|  putative chalcone synthase                             257   2e-81   
ref|XP_003621538.1|  Chalcone synthase                                  257   2e-81   
sp|Q9SBL4.1|CHS5_SORBI  RecName: Full=Chalcone synthase 5; AltNam...    258   2e-81   
sp|Q01288.1|CHS6_PEA  RecName: Full=Chalcone synthase 6; AltName:...    257   2e-81   
ref|XP_002450876.1|  hypothetical protein SORBIDRAFT_05g020220          258   2e-81   
sp|O23884.1|CHS5_PEA  RecName: Full=Chalcone synthase 5; AltName:...    257   2e-81   
dbj|BAD34457.1|  chalcone synthase                                      257   3e-81   
ref|XP_004979391.1|  PREDICTED: chalcone synthase C2-like               257   3e-81   
dbj|BAJ88598.1|  predicted protein                                      257   3e-81   
gb|ABK21514.1|  unknown                                                 249   4e-81   
gb|ABD24222.1|  chalcone synthase                                       257   4e-81   
gb|EMS66719.1|  Chalcone synthase 2                                     257   4e-81   
gb|ABL14037.1|  chalcone synthase 3                                     253   4e-81   
ref|XP_003610855.1|  Chalcone synthase                                  256   4e-81   
gb|ADF57184.1|  chalcone synthase                                       257   5e-81   
gb|AFU90824.1|  chalcone synthase                                       256   5e-81   
gb|ADB44077.1|  chalcone synthase                                       256   5e-81   
gb|ACJ85105.1|  unknown                                                 250   5e-81   
gb|ADB44076.1|  chalcone synthase                                       256   5e-81   
emb|CAA10131.1|  chalcone synthase                                      256   6e-81   
pdb|1BQ6|A  Chain A, Chalcone Synthase From Alfalfa With Coenzyme A     256   7e-81   
pdb|1D6I|A  Chain A, Chalcone Synthase (H303q Mutant)                   256   7e-81   
gb|ADM86717.1|  chalcone synthase                                       256   7e-81   
gb|AIB06737.1|  chalcone synthases-1                                    256   7e-81   
ref|NP_001268064.1|  chalcone synthase                                  258   7e-81   
gb|AEN84253.1|  chalcone synthase                                       256   8e-81   
gb|ABK23777.1|  unknown                                                 256   8e-81   
ref|XP_010909688.1|  PREDICTED: chalcone synthase 3-like                256   9e-81   
ref|XP_003621532.1|  Chalcone synthase                                  256   9e-81   
gb|EMT10555.1|  Chalcone synthase 1                                     256   1e-80   
ref|XP_011006130.1|  PREDICTED: chalcone synthase                       256   1e-80   
sp|P51086.1|CHS4_TRISU  RecName: Full=Chalcone synthase 4; AltNam...    253   1e-80   
sp|P30075.2|CHS4_MEDSA  RecName: Full=Chalcone synthase 4; AltNam...    255   1e-80   
gb|ABD38604.1|  chalcone synthase                                       256   1e-80   
gb|AIU98510.1|  chalcone synthase                                       256   1e-80   
sp|Q01287.1|CHS2_PEA  RecName: Full=Chalcone synthase 2; AltName:...    255   1e-80   
gb|AFC87828.1|  chalcone synthase                                       255   1e-80   
gb|ABD38596.1|  chalcone synthase                                       255   1e-80   
ref|XP_002321081.1|  chalcone synthase family protein                   255   1e-80   
gb|ABD24230.1|  chalcone synthase                                       255   1e-80   
gb|KDP41871.1|  hypothetical protein JCGZ_26889                         255   1e-80   
gb|ABD24251.1|  chalcone synthase                                       255   1e-80   
gb|ABD38595.1|  chalcone synthase                                       255   2e-80   
gb|ABC86919.1|  chalcone synthase                                       255   2e-80   
dbj|BAB40787.2|  chalcone synthase                                      255   2e-80   
gb|ACM62742.1|  chalcone synthase                                       254   2e-80   
gb|ABD24228.1|  chalcone synthase                                       254   2e-80   
gb|EMS64381.1|  Chalcone synthase 2                                     255   2e-80   
sp|O65872.1|CHSY_PINST  RecName: Full=Chalcone synthase; AltName:...    254   3e-80   
gb|ADB28916.1|  chalcone synthase                                       254   3e-80   
gb|AAD49353.1|AF169798_1  chalcone synthase                             254   3e-80   
pdb|1D6H|A  Chain A, Chalone Synthase (N336a Mutant Complexed Wit...    254   3e-80   
ref|XP_010929491.1|  PREDICTED: chalcone synthase 2                     254   3e-80   
gb|EMT14846.1|  Chalcone synthase 2                                     254   3e-80   
sp|P53414.1|CHS1_SECCE  RecName: Full=Chalcone synthase 1; AltNam...    254   3e-80   
gb|AAQ19321.1|  chalcone synthase                                       254   3e-80   
sp|P53415.1|CHS2_SECCE  RecName: Full=Chalcone synthase 2; AltNam...    254   3e-80   
gb|EMT16500.1|  Chalcone synthase 2                                     254   3e-80   
gb|AAQ19318.1|  chalcone synthase                                       254   3e-80   
ref|XP_010910437.1|  PREDICTED: chalcone synthase 3-like                254   3e-80   
gb|ABD24236.1|  chalcone synthase                                       254   4e-80   
ref|XP_003592022.1|  Chalcone synthase                                  254   4e-80   
gb|KEH43642.1|  chalcone and stilbene synthase family protein           254   4e-80   
sp|P26018.1|CHS1_HORVU  RecName: Full=Chalcone synthase 1; AltNam...    254   4e-80   
gb|ADK78881.1|  chalcone synthase                                       254   4e-80   
sp|Q9M5M0.1|CHS7_PICMA  RecName: Full=Chalcone synthase 7; AltNam...    254   4e-80   
gb|AAQ19319.1|  chalcone synthase                                       254   4e-80   
gb|AGY80771.1|  chalcone synthase                                       254   4e-80   
gb|ACJ85339.1|  unknown                                                 254   4e-80   
gb|AEO96986.1|  chalcone synthase                                       254   4e-80   
gb|AAQ19323.1|  chalcone synthase                                       254   4e-80   
ref|XP_003621536.1|  Chalcone synthase                                  254   4e-80   
sp|Q9FSB9.1|CHS1_RUTGR  RecName: Full=Chalcone synthase 1; AltNam...    254   5e-80   
ref|XP_003592044.1|  Chalcone synthase                                  254   5e-80   
ref|XP_003621530.1|  Chalcone synthase                                  254   5e-80   
sp|P30076.1|CHS8_MEDSA  RecName: Full=Chalcone synthase 8; AltNam...    254   5e-80   
gb|ADM73845.1|  chalcone synthase-like protein                          251   5e-80   
sp|P51084.1|CHS2_TRISU  RecName: Full=Chalcone synthase 2; AltNam...    254   5e-80   
gb|AAN87170.1|  chalcone synthase                                       254   6e-80   
gb|ACH42078.1|  chalcone synthase                                       254   6e-80   
gb|ABR16308.1|  unknown                                                 254   6e-80   
gb|ABK25177.1|  unknown                                                 254   6e-80   
gb|ABR16506.1|  unknown                                                 254   6e-80   
gb|AEN84248.1|  chalcone synthase                                       253   7e-80   
ref|XP_003577513.1|  PREDICTED: chalcone synthase 2                     254   7e-80   
ref|XP_008797107.1|  PREDICTED: chalcone synthase 1                     253   7e-80   
ref|XP_003621534.1|  Chalcone synthase                                  253   8e-80   
gb|AIJ27448.1|  chalcone synthase                                       253   8e-80   
gb|AAQ19320.1|  chalcone synthase                                       253   9e-80   
gb|AEN84242.1|  chalcone synthase                                       253   1e-79   
gb|AEN84262.1|  chalcone synthase                                       253   1e-79   
gb|ADM73853.1|  chalcone synthase-like protein                          250   1e-79   
ref|XP_009404732.1|  PREDICTED: chalcone synthase 2                     253   1e-79   
sp|Q01286.1|CHS1_PEA  RecName: Full=Chalcone synthase 1; AltName:...    253   1e-79   
gb|AEN84264.1|  chalcone synthase                                       253   1e-79   
sp|P51083.1|CHS1_TRISU  RecName: Full=Chalcone synthase 1; AltNam...    253   1e-79   
gb|AAN87169.1|  chalcone synthase                                       253   1e-79   
emb|CAP09644.1|  chalcone synthase                                      253   1e-79   
gb|ABK21072.1|  unknown                                                 253   1e-79   
gb|AGU91424.1|  chalcone synthase                                       253   1e-79   
gb|ADM73864.1|  chalcone synthase-like protein                          249   1e-79   
gb|AGU43679.1|  pinocembrin chalcone synthase                           253   2e-79   
dbj|BAA94594.1|  pinocembrin chalcone synthase                          253   2e-79   
dbj|BAJ85286.1|  predicted protein                                      253   2e-79   
gb|AFK65634.1|  chalcone synthase 2                                     253   2e-79   
ref|NP_001149022.1|  chalcone synthase                                  253   2e-79   
sp|P51087.1|CHS5_TRISU  RecName: Full=Chalcone synthase 5; AltNam...    252   2e-79   
sp|P51085.1|CHS3_TRISU  RecName: Full=Chalcone synthase 3; AltNam...    252   2e-79   
gb|AHZ30595.1|  chalcone synthase                                       252   2e-79   
sp|Q9SML4.1|CHS1_CICAR  RecName: Full=Chalcone synthase 1; AltNam...    252   2e-79   
gb|AAP85249.1|  chalcone synthase                                       252   2e-79   
gb|ADM73843.1|  chalcone synthase-like protein                          249   2e-79   
gb|ADM73849.1|  chalcone synthase-like protein                          249   2e-79   
gb|EMT05352.1|  Chalcone synthase 2                                     252   3e-79   
gb|ADM73859.1|  chalcone synthase-like protein                          249   3e-79   
sp|P51088.1|CHS6_TRISU  RecName: Full=Chalcone synthase 6; AltNam...    252   3e-79   
ref|XP_010028921.1|  PREDICTED: chalcone synthase 3                     252   3e-79   
gb|ADM73878.1|  chalcone synthase-like protein                          249   3e-79   
gb|ABD24227.1|  chalcone synthase                                       251   4e-79   
gb|ADM73862.1|  chalcone synthase-like protein                          248   4e-79   
dbj|BAH16615.1|  chalcone synthase                                      251   5e-79   
dbj|BAE79201.1|  chalcon synthase                                       251   5e-79   
gb|AFK35602.1|  unknown                                                 251   5e-79   
emb|CEL26669.1|  chalcone synthase                                      251   6e-79   
gb|ABF82595.1|  chalcone synthase                                       251   6e-79   
ref|XP_008808192.1|  PREDICTED: chalcone synthase C2                    251   6e-79   
dbj|BAJ14517.1|  chalcone synthase type 3                               251   7e-79   
dbj|BAJ14516.1|  chalcone synthase type 2                               251   7e-79   
ref|XP_004511429.1|  PREDICTED: chalcone synthase 1-like                251   7e-79   
gb|ADM73861.1|  chalcone synthase-like protein                          248   7e-79   
sp|P30079.1|CHSY_PINSY  RecName: Full=Chalcone synthase; AltName:...    251   7e-79   
dbj|BAJ14518.1|  chalcone synthase type 4                               251   7e-79   
gb|ADM73867.1|  chalcone synthase-like protein                          248   7e-79   
gb|AGQ04099.1|  chalcone synthase                                       244   7e-79   
gb|AGN74747.1|  chalcone syntase                                        246   7e-79   
gb|ABD24244.1|  chalcone synthase                                       251   8e-79   
gb|AIZ70321.1|  chalcone synthase                                       251   8e-79   
gb|AEN84237.1|  chalcone synthase                                       251   8e-79   
gb|AEN84263.1|  chalcone synthase                                       251   8e-79   



>sp|O22046.1|CHSE_IPONI RecName: Full=Chalcone synthase E; AltName: Full=Naringenin-chalcone 
synthase E; Short=CHS-E [Ipomoea nil]
 dbj|BAA21788.1| chalcone synthase [Ipomoea nil]
 dbj|BAA87338.1| chalcone synthase [Ipomoea nil]
Length=389

 Score =   294 bits (752),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/139 (100%), Positives = 139/139 (100%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC
Sbjct  1    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AAB41103.1| chalcone synthase [Ipomoea purpurea]
Length=340

 Score =   290 bits (743),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 138/139 (99%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC
Sbjct  1    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYMYLTEEIL ENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61   EKSMIKKRYMYLTEEILTENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>sp|O22047.1|CHSE_IPOPU RecName: Full=Chalcone synthase E; AltName: Full=Naringenin-chalcone 
synthase E; Short=CHS-E [Ipomoea purpurea]
 dbj|BAA21789.1| chalcone synthase [Ipomoea purpurea]
 dbj|BAA87337.1| chalcone synthase [Ipomoea purpurea]
Length=389

 Score =   292 bits (747),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 138/139 (99%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC
Sbjct  1    MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYMYLTEEIL ENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61   EKSMIKKRYMYLTEEILTENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|ACD31533.1| chalcone synthase 2 [Nicotiana attenuata]
Length=267

 Score =   280 bits (717),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 131/139 (94%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEE R+AQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH VELKEKFKRMC
Sbjct  1    MVTVEEFRRAQRAEGPATVMAIGTATPSNCVDQSTYPDYYFRITNSEHKVELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYM+LTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61   EKSMIKKRYMHLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AIY22756.1| chalcone synthase [Iochroma cyaneum]
Length=389

 Score =   281 bits (718),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVR+AQRA+GPATIMAIGT+TP NCVDQSTYPDYYFRITNSEH+ ELKEKFKRMC
Sbjct  1    MVTVEEVRRAQRAKGPATIMAIGTATPSNCVDQSTYPDYYFRITNSEHMTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYM+LTEEILKENPNIC YMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61   DKSMIKKRYMHLTEEILKENPNICEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>ref|XP_009774927.1| PREDICTED: chalcone synthase 2 [Nicotiana sylvestris]
Length=389

 Score =   281 bits (718),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 137/139 (99%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVR+AQRA+GPATIMAIGT+TP NCVDQSTYPDYYFR+TNSEH++ELKEKFKRMC
Sbjct  1    MVTVEEVRRAQRAKGPATIMAIGTATPSNCVDQSTYPDYYFRVTNSEHMIELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYM+LTEEILKENPNIC YMAPSLDARQDIVVVE+PKLGKEAAQKAIKEWGQP
Sbjct  61   DKSMIKKRYMHLTEEILKENPNICEYMAPSLDARQDIVVVEIPKLGKEAAQKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AIY22757.1| chalcone synthase [Iochroma cyaneum]
Length=389

 Score =   281 bits (718),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVR+AQRA+GPATIMAIGT+TP NCVDQSTYPDYYFRITNSEH+ ELKEKFKRMC
Sbjct  1    MVTVEEVRRAQRAKGPATIMAIGTATPSNCVDQSTYPDYYFRITNSEHMTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYM+LTEEILKENPNIC YMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61   DKSMIKKRYMHLTEEILKENPNICEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>ref|XP_010264138.1| PREDICTED: chalcone synthase G-like [Nelumbo nucifera]
Length=239

 Score =   275 bits (702),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVE++RKAQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVTVEDIRKAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYM+LTEEILKENPN+CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   EKSMIKKRYMHLTEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AHK22740.1| chalcone synthase [Nicotiana tabacum]
Length=389

 Score =   280 bits (715),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVR+AQRA+GPATIMAIGT+TP NCVDQSTYPDYYFR+TNSEH+ ELKEKFKRMC
Sbjct  1    MVTVEEVRRAQRAKGPATIMAIGTATPSNCVDQSTYPDYYFRVTNSEHMTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYM+LTEEILKENPNIC YMAPSLDARQDIVVVE+PKLGKEAAQKAIKEWGQP
Sbjct  61   DKSMIKKRYMHLTEEILKENPNICEYMAPSLDARQDIVVVEIPKLGKEAAQKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|ACS12837.1| chalcone synthase [Nicotiana alata]
Length=389

 Score =   280 bits (715),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEE R+AQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVTVEEFRRAQRAEGPATVMAIGTATPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYM+LTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61   EKSMIKKRYMHLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>ref|XP_009616637.1| PREDICTED: chalcone synthase 2 [Nicotiana tomentosiformis]
Length=389

 Score =   280 bits (715),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVR+AQRA+GPATIMAIGT+TP NCVDQSTYPDYYFR+TNSEH+ ELKEKFKRMC
Sbjct  1    MVTVEEVRRAQRAKGPATIMAIGTATPSNCVDQSTYPDYYFRVTNSEHMTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYM+LTEEILKENPNIC YMAPSLDARQDIVVVE+PKLGKEAAQKAIKEWGQP
Sbjct  61   DKSMIKKRYMHLTEEILKENPNICEYMAPSLDARQDIVVVEIPKLGKEAAQKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AIV99854.1| chalcone synthase [Iochroma calycinum]
 gb|AIY22758.1| chalcone synthase [Iochroma calycinum]
Length=389

 Score =   279 bits (714),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            M+TVEEVR+AQRA+GPATIMAIGT+TP NCVDQSTYPDYYFRITNSEH+ ELKEKFKRMC
Sbjct  1    MMTVEEVRRAQRAKGPATIMAIGTATPSNCVDQSTYPDYYFRITNSEHMTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYM+LTEEILKENPNIC YMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61   DKSMIKKRYMHLTEEILKENPNICEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>ref|XP_011091402.1| PREDICTED: chalcone synthase [Sesamum indicum]
Length=390

 Score =   279 bits (714),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEE+R+AQRA+GPAT++AIGT+TP NCVDQSTYPDYYFRIT+SEH  ELKEKFKRMC
Sbjct  1    MVTVEEIRRAQRAEGPATVLAIGTATPTNCVDQSTYPDYYFRITDSEHKTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61   EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>ref|NP_001275296.1| chalcone synthase 2 [Solanum tuberosum]
 sp|Q43188.1|CHS2_SOLTU RecName: Full=Chalcone synthase 2; AltName: Full=Naringenin-chalcone 
synthase 2 [Solanum tuberosum]
 gb|AAB05239.1| chalcone synthase 2 [Solanum tuberosum]
Length=389

 Score =   279 bits (713),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPATIMAIGT+TP NCVDQSTYPDYYFRITNSEH+ ELKEKFKRMC
Sbjct  1    MVTVEEVRKAQRAKGPATIMAIGTATPSNCVDQSTYPDYYFRITNSEHMTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMI KRYM+LTEEILKENPNIC YMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61   DKSMINKRYMHLTEEILKENPNICEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITH+VFCTTSGVDMPG
Sbjct  121  KSKITHVVFCTTSGVDMPG  139



>sp|Q43163.1|CHSB_SOLTU RecName: Full=Chalcone synthase 1B; AltName: Full=Naringenin-chalcone 
synthase 1B [Solanum tuberosum]
 gb|AAB67735.1| chalcone synthase 1b [Solanum tuberosum]
Length=389

 Score =   279 bits (713),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEE RKAQRA+GPATI+AIGTSTP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVTVEEYRKAQRAEGPATILAIGTSTPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYM+LTEEILKENPN+CAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61   DKSMIKKRYMHLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>ref|XP_009764938.1| PREDICTED: chalcone synthase A [Nicotiana sylvestris]
Length=389

 Score =   278 bits (712),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEE R+AQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVTVEEFRRAQRAEGPATVMAIGTATPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYM+LTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61   EKSMIKKRYMHLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKI+HLVFCTTSGVDMPG
Sbjct  121  KSKISHLVFCTTSGVDMPG  139



>dbj|BAB20074.1| chalcone synthase [Torenia hybrid cultivar]
Length=388

 Score =   278 bits (712),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEE+R+AQRA+GPATI+AIGTSTP NCVDQSTYPDYYFRITNSEH+ ELKEKFKRMC
Sbjct  1    MVTVEEIRRAQRAEGPATILAIGTSTPANCVDQSTYPDYYFRITNSEHMTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYM+LTE+ LKENPN+CAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61   EKSMIKKRYMHLTEDYLKENPNVCAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHL+FCTTSGVDMPG
Sbjct  121  KSKITHLIFCTTSGVDMPG  139



>ref|NP_001275352.1| chalcone synthase 1A [Solanum tuberosum]
 sp|Q41436.1|CHSA_SOLTU RecName: Full=Chalcone synthase 1A; AltName: Full=Naringenin-chalcone 
synthase 1A [Solanum tuberosum]
 gb|AAB67734.1| chalcone synthase 1a [Solanum tuberosum]
Length=389

 Score =   278 bits (712),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEE RKAQRA+GPATI+AIGTSTP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVTVEEYRKAQRAEGPATILAIGTSTPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYM+LTEEILKENPN+CAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61   DKSMIKKRYMHLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|ABN80439.1| chalcone synthase [Nicotiana benthamiana]
Length=389

 Score =   278 bits (711),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEE R+AQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVTVEEFRRAQRAEGPATVMAIGTATPFNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYM+LTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61   EKSMIKKRYMHLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|ABS52573.1| chalcone synthase [Gossypium hirsutum]
 gb|AEO96990.1| chalcone synthase [Gossypium hirsutum]
 gb|KHF97262.1| Chalcone synthase 1 [Gossypium arboreum]
 gb|KHG14487.1| Chalcone synthase 1 [Gossypium arboreum]
 gb|KHG14899.1| Chalcone synthase 1 [Gossypium arboreum]
Length=389

 Score =   278 bits (711),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRAQGPAT++AIGTSTP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVTVEEVRKAQRAQGPATVLAIGTSTPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYMYLTEEILKENPN+C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   EKSMIKKRYMYLTEEILKENPNVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>ref|NP_001234036.1| chalcone synthase 2 [Solanum lycopersicum]
 sp|P23419.2|CHS2_SOLLC RecName: Full=Chalcone synthase 2; AltName: Full=Naringenin-chalcone 
synthase 2 [Solanum lycopersicum]
 emb|CAA38981.1| chalcone synthase [Solanum lycopersicum]
 gb|AEK99072.1| chalcone synthase [Solanum lycopersicum]
Length=389

 Score =   278 bits (710),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVR+AQRA+GPATIMAIGT+TP NCVDQSTYPDYYFRITNSEH+ ELKEKFKRMC
Sbjct  1    MVTVEEVRRAQRAKGPATIMAIGTATPSNCVDQSTYPDYYFRITNSEHMTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMI KRYM+LTEEILKENPNIC YMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61   DKSMINKRYMHLTEEILKENPNICEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITH+VFCTTSGVDMPG
Sbjct  121  KSKITHVVFCTTSGVDMPG  139



>gb|ACH56521.1| chalcone synthase [Gossypium hirsutum]
 gb|AEO96988.1| chalcone synthase [Gossypium hirsutum]
Length=389

 Score =   278 bits (710),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRAQGPAT++AIGTSTP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVTVEEVRKAQRAQGPATVLAIGTSTPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYMYLTEEILKENPN+C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   EKSMIKKRYMYLTEEILKENPNVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>ref|XP_006586314.1| PREDICTED: chalcone synthase 2-like [Glycine max]
Length=222

 Score =   271 bits (694),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV+VEE+RKAQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH+ ELKEKFKRMC
Sbjct  1    MVSVEEIRKAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHMTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYL EEILKENP++CAYMAPSLDARQD+VV+EVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLNEEILKENPSVCAYMAPSLDARQDMVVMEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHL+FCTTSGVDMPG
Sbjct  121  KSKITHLIFCTTSGVDMPG  139



>gb|AEN83501.1| chalcone synthase [Solanum tuberosum]
Length=389

 Score =   277 bits (709),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVE+ RKAQRA+GPATI+AIGTSTP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVTVEQYRKAQRAEGPATILAIGTSTPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYM+LTEEILKENPN+CAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61   DKSMIKKRYMHLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AGU70032.1| chalcone synthase [Solanum tuberosum]
Length=389

 Score =   277 bits (709),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVE+ RKAQRA+GPATI+AIGTSTP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVTVEQYRKAQRAEGPATILAIGTSTPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYM+LTEEILKENPN+CAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61   DKSMIKKRYMHLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>sp|P22928.2|CHSJ_PETHY RecName: Full=Chalcone synthase J; AltName: Full=Naringenin-chalcone 
synthase J [Petunia x hybrida]
 emb|CAA32737.1| chalcone synthase [Petunia x hybrida]
Length=389

 Score =   277 bits (709),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEE+R+AQRA+GPATIMAIGT+TP NCVDQSTYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1    MVTVEEIRRAQRAEGPATIMAIGTATPSNCVDQSTYPDYYFRITNSEHKTELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYM+LTEEILKENPNIC YMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61   DKSMIKKRYMHLTEEILKENPNICEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AAK49457.1| chalcone synthase [Nicotiana tabacum]
Length=389

 Score =   277 bits (709),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEE R+AQ A+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH VELKEKFKRMC
Sbjct  1    MVTVEEFRRAQCAEGPATVMAIGTATPSNCVDQSTYPDYYFRITNSEHKVELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYM+LTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61   EKSMIKKRYMHLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|KJB28222.1| hypothetical protein B456_005G035100 [Gossypium raimondii]
Length=389

 Score =   277 bits (708),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPAT++AIGTSTP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVTVEEVRKAQRAEGPATVLAIGTSTPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYMYLTEEILKENPN+C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   EKSMIKKRYMYLTEEILKENPNVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|KJB61068.1| hypothetical protein B456_009G339300 [Gossypium raimondii]
Length=389

 Score =   277 bits (708),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRAQGPAT++AIGTSTP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVTVEEVRKAQRAQGPATVLAIGTSTPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYMYLTEEILKENPN+CAYM PSLDARQD+VVVEVPKLGKEAA +AIKEWGQP
Sbjct  61   EKSMIKKRYMYLTEEILKENPNVCAYMEPSLDARQDMVVVEVPKLGKEAAARAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|KHG25969.1| Chalcone synthase 1 [Gossypium arboreum]
Length=389

 Score =   277 bits (708),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPAT++AIGTSTP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVTVEEVRKAQRAEGPATVLAIGTSTPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYMYLTEEILKENPN+C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   EKSMIKKRYMYLTEEILKENPNVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|KDP20327.1| hypothetical protein JCGZ_06413 [Jatropha curcas]
 gb|AIC83903.1| chalcone synthase [Jatropha curcas]
Length=389

 Score =   277 bits (708),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRAQGPAT++AIGT+TP NCVDQSTYPDYYFRITNSEH VELKEKFKRMC
Sbjct  1    MVTVEEVRKAQRAQGPATVLAIGTATPSNCVDQSTYPDYYFRITNSEHKVELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYM+LTE+ILKENPNIC YMAPSLDARQDIVVVE+PKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMHLTEDILKENPNICEYMAPSLDARQDIVVVEIPKLGKEAAVKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>ref|XP_011020681.1| PREDICTED: chalcone synthase 1 [Populus euphratica]
Length=391

 Score =   276 bits (707),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTV+E+RK+QRA+GPATIMAIGTSTP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVTVDEIRKSQRAEGPATIMAIGTSTPPNCVDQSTYPDYYFRITNSEHKAELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYMYLTEEILKENP++CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   EKSMIKKRYMYLTEEILKENPSVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|KJB72142.1| hypothetical protein B456_011G161200 [Gossypium raimondii]
Length=389

 Score =   276 bits (706),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRAQGPAT++AIGTSTP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVTVEEVRKAQRAQGPATVLAIGTSTPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYMYLTEEIL ENPN+C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   EKSMIKKRYMYLTEEILNENPNVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|ACU23477.1| unknown [Glycine max]
Length=283

 Score =   273 bits (697),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV+VEE+RKAQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH+ ELKEKFKRMC
Sbjct  1    MVSVEEIRKAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHMTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYL EEILKENP++CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLNEEILKENPSVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHL+FCTTSGVDMPG
Sbjct  121  KSKITHLIFCTTSGVDMPG  139



>gb|AEO96985.1| chalcone synthase [Gossypium hirsutum]
Length=389

 Score =   276 bits (706),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPAT++AIGTSTP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVTVEEVRKAQRAEGPATVLAIGTSTPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYMYLTEEILKENPN+C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61   EKSMIKKRYMYLTEEILKENPNVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>ref|XP_009619773.1| PREDICTED: chalcone synthase 1B [Nicotiana tomentosiformis]
 gb|ACS12836.1| chalcone synthase [Nicotiana tomentosiformis]
Length=389

 Score =   276 bits (705),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEE R+AQ A+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH VELKEKFKRMC
Sbjct  1    MVTVEEFRRAQCAEGPATVMAIGTATPSNCVDQSTYPDYYFRITNSEHKVELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYM+LTEEILK+NPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61   EKSMIKKRYMHLTEEILKDNPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|ADW11243.1| chalcone synthase 2 [Camellia chekiangoleosa]
 gb|AFC37243.1| chalcone synthase 2 [Camellia chekiangoleosa]
Length=389

 Score =   276 bits (705),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVR+AQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1    MVTVEEVRRAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKTELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENPN+CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AEO96989.1| chalcone synthase [Gossypium hirsutum]
Length=389

 Score =   276 bits (705),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRAQGPAT++AIGTSTP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVTVEEVRKAQRAQGPATVLAIGTSTPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYM+LTEEILKENPN+CAYM PSLDARQD+VVVEVPKLGKEAA +AIKEWGQP
Sbjct  61   EKSMIKKRYMFLTEEILKENPNVCAYMEPSLDARQDMVVVEVPKLGKEAAARAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|ACV72638.1| chalcone synthase 1 [Gossypium hirsutum]
Length=389

 Score =   276 bits (705),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRAQGPAT++AIGTSTP NCVDQSTYPDYYF ITNSEH  ELKEKFKRMC
Sbjct  1    MVTVEEVRKAQRAQGPATVLAIGTSTPPNCVDQSTYPDYYFHITNSEHKTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYMYLTEEILKENPN+C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   EKSMIKKRYMYLTEEILKENPNVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>sp|P48387.1|CHS2_CAMSI RecName: Full=Chalcone synthase 2; AltName: Full=Naringenin-chalcone 
synthase 2 [Camellia sinensis]
 dbj|BAA05641.1| chalcone synthase [Camellia sinensis]
 gb|AGI02995.1| chalcone synthase [Camellia sinensis]
Length=389

 Score =   276 bits (705),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVR+AQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1    MVTVEEVRRAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKTELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENPN+CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AFM29141.1| chalcone synthase, partial [Lycium barbarum]
Length=383

 Score =   275 bits (704),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEE RKAQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRIT+SEH  ELKEKFKRMC
Sbjct  1    MVTVEEYRKAQRAEGPATVMAIGTATPSNCVDQSTYPDYYFRITDSEHKTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYM+LTEEILKENPN+CAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61   DKSMIKKRYMHLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>ref|XP_006420608.1| hypothetical protein CICLE_v10005133mg [Citrus clementina]
 gb|ESR33848.1| hypothetical protein CICLE_v10005133mg [Citrus clementina]
Length=390

 Score =   275 bits (704),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTV+EVRKAQRAQGPATIMAIGT+TP NCVDQSTYPDYYFRITNSEH+ +LKEKFKRMC
Sbjct  1    MVTVDEVRKAQRAQGPATIMAIGTATPPNCVDQSTYPDYYFRITNSEHMTDLKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENPN+CAYMAPSLD RQD+VVVEVP+LGKEAA +AIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPNVCAYMAPSLDTRQDMVVVEVPRLGKEAATEAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AJO53275.1| chalcone synthase [Pogostemon cablin]
Length=390

 Score =   275 bits (704),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEE+R+AQRA+GPA I+AIGT+TP NCVDQSTYPDYYFRITNSEH+ ELKEKF RMC
Sbjct  1    MVTVEEIRRAQRAEGPANILAIGTATPPNCVDQSTYPDYYFRITNSEHMTELKEKFTRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMI+KRYMYLTEE LKENPN+CAYMAPSLDARQD+VVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61   EKSMIRKRYMYLTEEYLKENPNVCAYMAPSLDARQDVVVVEVPKLGKEAAQKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|KJB72144.1| hypothetical protein B456_011G161300 [Gossypium raimondii]
Length=389

 Score =   275 bits (703),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRAQGPAT++AIGTSTP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVTVEEVRKAQRAQGPATVLAIGTSTPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYMYLTEEILKENPN+C YMA SLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   EKSMIKKRYMYLTEEILKENPNVCEYMASSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AJM90013.1| chalcone synthase [Apocynum venetum]
Length=389

 Score =   275 bits (703),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV+VE+VR+AQRA+GPAT+MAIGT+TP NCV+QSTYPDYYFR+TNSEH  ELKEKFKRMC
Sbjct  1    MVSVEDVRRAQRAEGPATVMAIGTATPPNCVEQSTYPDYYFRVTNSEHKTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYMYLTEEILKENPN+CAYMAPSLDARQD+VVVE+PKLGKEAAQKAIKEWGQP
Sbjct  61   EKSMIKKRYMYLTEEILKENPNVCAYMAPSLDARQDMVVVEIPKLGKEAAQKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>dbj|BAE45039.1| chalcone synthase [Gentiana triflora]
Length=389

 Score =   275 bits (703),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEE+RKAQRA+GPAT++AIGT+TP NCVDQSTYPDYYFRIT+SEH  ELKEKFKRMC
Sbjct  1    MVTVEEIRKAQRAEGPATVLAIGTATPVNCVDQSTYPDYYFRITDSEHKTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMI+KRYM+LTE+ILKENPN+CAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61   EKSMIRKRYMHLTEDILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AAX63402.1| chalcone synthase [Solanum pinnatisectum]
Length=389

 Score =   275 bits (703),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEE RKAQRA+GPATI+AIGTSTP NCVDQSTYPDYYFRITNSEH  ELKEKFKRM 
Sbjct  1    MVTVEEYRKAQRAEGPATILAIGTSTPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMS  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYM+LTEEILKENPN+CAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61   DKSMIKKRYMHLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AGW22222.1| chalcone synthase [Abelmoschus esculentus]
Length=389

 Score =   275 bits (702),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPAT++AIGTSTP NCVDQSTYPDYYFRIT+SEH  ELKEKFKRMC
Sbjct  1    MVTVEEVRKAQRAEGPATVLAIGTSTPPNCVDQSTYPDYYFRITSSEHKTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYMYLTEEILKENPN+C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   EKSMIKKRYMYLTEEILKENPNVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>ref|XP_007034442.1| Chalcone and stilbene synthase family protein [Theobroma cacao]
 gb|EOY05368.1| Chalcone and stilbene synthase family protein [Theobroma cacao]
Length=389

 Score =   275 bits (702),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPAT++AIGTSTP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVTVEEVRKAQRAEGPATVLAIGTSTPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIK+RYMYLTEEILKENPNICAYMA SLDARQD+VVVEVPKLGKEAA +AIKEWGQP
Sbjct  61   EKSMIKRRYMYLTEEILKENPNICAYMATSLDARQDMVVVEVPKLGKEAATRAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>ref|XP_006489796.1| PREDICTED: chalcone synthase 1-like [Citrus sinensis]
Length=390

 Score =   275 bits (702),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            M+TV+EVRKAQRA+GPATIMAIGT+TP NCVDQSTYPDYYFRITNSEH+ +LKEKFKRMC
Sbjct  1    MLTVDEVRKAQRAEGPATIMAIGTATPPNCVDQSTYPDYYFRITNSEHMTDLKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENPN+CAYMAPSLD RQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPNVCAYMAPSLDTRQDMVVVEVPRLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|ACE60221.1| chalcone synthase [Abelmoschus manihot]
Length=389

 Score =   274 bits (701),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPAT++AIGTSTP NCVDQSTYPDYYFRIT SEH  ELKEKFKRMC
Sbjct  1    MVTVEEVRKAQRAEGPATVLAIGTSTPPNCVDQSTYPDYYFRITKSEHKTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYMYLTEEILKENPN+C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   EKSMIKKRYMYLTEEILKENPNVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>sp|Q9ZRS4.1|CHSY_CATRO RecName: Full=Chalcone synthase; AltName: Full=Naringenin-chalcone 
synthase [Catharanthus roseus]
 emb|CAA10511.1| chalcone synthase [Catharanthus roseus]
Length=389

 Score =   274 bits (701),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV VEE+R AQRAQGPAT++AIGTSTP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVNVEEIRNAQRAQGPATVLAIGTSTPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYM+LTEEIL+ENPNICAYMAPSLDARQ+IVVVEVPKLGKEAAQKAIKEWGQ 
Sbjct  61   EKSMIKKRYMHLTEEILQENPNICAYMAPSLDARQNIVVVEVPKLGKEAAQKAIKEWGQS  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|ABI79305.1| chalcone synthase [Pyrus communis]
Length=389

 Score =   274 bits (700),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPAT+MAIGTSTP NCVDQ+TYPDYYFRITNSEH VELKEKF+RMC
Sbjct  1    MVTVEEVRKAQRAEGPATVMAIGTSTPSNCVDQATYPDYYFRITNSEHRVELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENP++C YMAPS+DARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPSVCEYMAPSIDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>ref|XP_002299281.2| naregenin-chalcone synthase family protein [Populus trichocarpa]
 gb|EEE84086.2| naregenin-chalcone synthase family protein [Populus trichocarpa]
Length=391

 Score =   274 bits (700),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTV+E+RKAQRA+GPATI+AIGTSTP NCVDQSTYPDYYFRITNSEH VELKEKFKRMC
Sbjct  1    MVTVDEIRKAQRAEGPATILAIGTSTPPNCVDQSTYPDYYFRITNSEHKVELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYM+LTEEILKENP++C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   EKSMIKKRYMHLTEEILKENPSVCEYMAPSLDARQDMVVVEVPKLGKEAAAKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>ref|XP_009376347.1| PREDICTED: polyketide synthase 5 [Pyrus x bretschneideri]
Length=391

 Score =   274 bits (700),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPAT+MAIGTSTP NCVDQ+TYPDYYFRITNSEH VELKEKF+RMC
Sbjct  1    MVTVEEVRKAQRAEGPATVMAIGTSTPSNCVDQATYPDYYFRITNSEHKVELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENP++C YMAPS+DARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPSVCEYMAPSIDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AFQ92052.1| chalcone synthase [Pyrus pyrifolia]
 gb|AGL81345.1| chalcone synthase [Pyrus communis]
Length=391

 Score =   274 bits (700),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPAT+MAIGTSTP NCVDQ+TYPDYYFRITNSEH VELKEKF+RMC
Sbjct  1    MVTVEEVRKAQRAEGPATVMAIGTSTPSNCVDQATYPDYYFRITNSEHKVELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENP++C YMAPS+DARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPSVCEYMAPSIDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AAX16494.1| chalcone synthase [Pyrus communis]
Length=391

 Score =   274 bits (700),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPAT+MAIGTSTP NCVDQ+TYPDYYFRITNSEH VELKEKF+RMC
Sbjct  1    MVTVEEVRKAQRAEGPATVMAIGTSTPSNCVDQATYPDYYFRITNSEHKVELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENP++C YMAPS+DARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPSVCEYMAPSIDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>ref|XP_011020677.1| PREDICTED: chalcone synthase 1-like isoform X1 [Populus euphratica]
 ref|XP_011020678.1| PREDICTED: chalcone synthase 1-like isoform X1 [Populus euphratica]
 ref|XP_011020679.1| PREDICTED: chalcone synthase 1-like isoform X1 [Populus euphratica]
Length=391

 Score =   274 bits (700),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTV EVRK QRA+GPATIMAIGTSTP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVTVNEVRKGQRAEGPATIMAIGTSTPPNCVDQSTYPDYYFRITNSEHKAELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYMYLTE+ILKENPN+CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQ 
Sbjct  61   EKSMIKKRYMYLTEDILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQS  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>ref|XP_011020680.1| PREDICTED: chalcone synthase 1-like isoform X2 [Populus euphratica]
Length=391

 Score =   273 bits (699),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTV EVRK QRA+GPATIMAIGTSTP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVTVNEVRKGQRAEGPATIMAIGTSTPPNCVDQSTYPDYYFRITNSEHKAELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYMYLTE+ILKENPN+CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQ 
Sbjct  61   EKSMIKKRYMYLTEDILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQS  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>dbj|BAM17286.1| chalcone synthase [Petunia x hybrida]
Length=389

 Score =   273 bits (699),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEE RKAQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVTVEEYRKAQRAEGPATVMAIGTATPTNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYM+LTEEILKENP++C YMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61   EKSMIKKRYMHLTEEILKENPSMCEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>ref|XP_007157049.1| hypothetical protein PHAVU_002G0390000g, partial [Phaseolus vulgaris]
 gb|ESW29043.1| hypothetical protein PHAVU_002G0390000g, partial [Phaseolus vulgaris]
Length=207

 Score =   267 bits (683),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV+V E+R+AQRA+GPATI+AIGT+TP NCVDQSTYPDYYFRITNSEH+ +LKEKF+RMC
Sbjct  1    MVSVSEIRQAQRAEGPATILAIGTATPSNCVDQSTYPDYYFRITNSEHMTDLKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYM+L EEILKENPN+CAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMHLNEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHL+FCTTSGVDMPG
Sbjct  121  KSKITHLIFCTTSGVDMPG  139



>gb|ACN60400.1| chalcone synthase, partial [Capsicum annuum]
Length=386

 Score =   273 bits (698),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVR+ QRA+GPATIMAIGT+TP NCVDQ+TYPDYYFRITNSEH+ ELKEKF+RMC
Sbjct  1    MVTVEEVRREQRAKGPATIMAIGTATPSNCVDQATYPDYYFRITNSEHMTELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYM+LTEEILKENPNIC YMAPSLDARQDIVVVE+PKLGKEAA+KAIKEWGQP
Sbjct  61   DKSMIKKRYMHLTEEILKENPNICEYMAPSLDARQDIVVVEIPKLGKEAAKKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>ref|XP_003531225.1| PREDICTED: chalcone synthase 1 isoform X1 [Glycine max]
 ref|XP_006585155.1| PREDICTED: chalcone synthase 1 isoform X2 [Glycine max]
 sp|P24826.1|CHS1_SOYBN RecName: Full=Chalcone synthase 1; AltName: Full=Naringenin-chalcone 
synthase 1 [Glycine max]
 emb|CAA38456.1| naregenin-chalcone synthase [Glycine max]
 dbj|BAB71954.1| chalcone synthase [Glycine max]
 gb|AAQ62590.1| chalcone synthase CHS1 [Glycine max]
 gb|AAQ62597.1| chalcone synthase CHS1 [Glycine max]
 dbj|BAF62128.1| chalcone synthase [Glycine max]
 dbj|BAH70473.1| chalcone synthase [Glycine max]
 dbj|BAH70474.1| chalcone synthase [Glycine max]
Length=388

 Score =   273 bits (699),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV+VEE+RKAQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH+ ELKEKFKRMC
Sbjct  1    MVSVEEIRKAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHMTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYL EEILKENP++CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLNEEILKENPSVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHL+FCTTSGVDMPG
Sbjct  121  KSKITHLIFCTTSGVDMPG  139



>ref|XP_011034458.1| PREDICTED: chalcone synthase 1-like [Populus euphratica]
Length=399

 Score =   273 bits (699),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEE+RKAQRA+GPATI+AIGTSTP NCVDQSTYPDYYFRITNSEH VELKEKFKRMC
Sbjct  1    MVTVEEIRKAQRAEGPATILAIGTSTPPNCVDQSTYPDYYFRITNSEHKVELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYM+LTEEILKENP++C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   EKSMIKKRYMHLTEEILKENPSVCEYMAPSLDARQDMVVVEVPKLGKEAAVKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>emb|CAJ44127.1| chalcone synthase [Misopates orontium]
Length=390

 Score =   273 bits (699),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVR+AQRA+GPAT++AIGT+TP NCVDQSTYPDYYFRITNSEH+ +LKEKFKRMC
Sbjct  1    MVTVEEVRRAQRAEGPATVLAIGTATPANCVDQSTYPDYYFRITNSEHMTDLKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYM+LTEEILKENP +C YMAPSLDARQDIVVVEVP+LGKEAAQKAIKEWGQP
Sbjct  61   EKSMIKKRYMHLTEEILKENPAMCEYMAPSLDARQDIVVVEVPRLGKEAAQKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>ref|XP_007157047.1| hypothetical protein PHAVU_002G0389000g, partial [Phaseolus vulgaris]
 gb|ESW29041.1| hypothetical protein PHAVU_002G0389000g, partial [Phaseolus vulgaris]
Length=138

 Score =   264 bits (675),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 120/138 (87%), Positives = 133/138 (96%), Gaps = 0/138 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV+V E+R+AQRA+GPATI+AIGT+TP NCVDQSTYPDYYFRITNSEH+ +LKEKF+RMC
Sbjct  1    MVSVSEIRQAQRAEGPATILAIGTATPSNCVDQSTYPDYYFRITNSEHMTDLKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYM+L EEILKENPN+CAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMHLNEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMP  487
            KSKITHL+FCTTSGVDMP
Sbjct  121  KSKITHLIFCTTSGVDMP  138



>ref|XP_010023738.1| PREDICTED: chalcone synthase 1 [Eucalyptus grandis]
 gb|KCW60095.1| hypothetical protein EUGRSUZ_H02828 [Eucalyptus grandis]
Length=391

 Score =   273 bits (698),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVR+AQRA+GPATIMAIGT+TP NCVDQS YPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVTVEEVRRAQRAEGPATIMAIGTATPPNCVDQSAYPDYYFRITNSEHKTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYM+LTE+ILKENPNICAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   EKSMIKKRYMHLTEDILKENPNICAYMAPSLDARQDMVVVEVPKLGKEAAVKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSK+THL+FCTTSGVDMPG
Sbjct  121  KSKVTHLIFCTTSGVDMPG  139



>gb|AFL47798.1| chalcone synthase [Capsicum annuum]
Length=402

 Score =   273 bits (699),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVR+ QRA+GPATIMAIGT+TP NCVDQ+TYPDYYFRITNSEH+ ELKEKF+RMC
Sbjct  1    MVTVEEVRREQRAKGPATIMAIGTATPSNCVDQATYPDYYFRITNSEHMTELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYM+LTEEILKENPNIC YMAPSLDARQDIVVVE+PKLGKEAA+KAIKEWGQP
Sbjct  61   DKSMIKKRYMHLTEEILKENPNICEYMAPSLDARQDIVVVEIPKLGKEAAKKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>ref|XP_010099135.1| Chalcone synthase [Morus notabilis]
 gb|EXB76929.1| Chalcone synthase [Morus notabilis]
Length=389

 Score =   273 bits (697),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPATIMAIGT+TP NC+DQS+YPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVTVEEVRKAQRAEGPATIMAIGTATPPNCIDQSSYPDYYFRITNSEHKTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKS IKKRYMYL EEILKENPNICAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   EKSQIKKRYMYLHEEILKENPNICAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|ABB89213.1| chalcone synthase [Sorbus aucuparia]
Length=391

 Score =   273 bits (697),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPAT+MAIGT+TP NCVDQ+TYPDYYFRITNSEH VELKEKF+RMC
Sbjct  1    MVTVEEVRKAQRAEGPATVMAIGTATPSNCVDQATYPDYYFRITNSEHKVELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENP++C YMAPS+DARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPSVCEYMAPSIDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>ref|XP_007198981.1| hypothetical protein PRUPE_ppa023080mg, partial [Prunus persica]
 gb|EMJ00180.1| hypothetical protein PRUPE_ppa023080mg, partial [Prunus persica]
Length=216

 Score =   267 bits (682),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPAT++AIGT+TP NCVDQ+TYPDYYFRITNSEH VELKEKF+RMC
Sbjct  1    MVTVEEVRKAQRAEGPATVLAIGTATPPNCVDQATYPDYYFRITNSEHKVELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTE+ILKENP +C YMAPSLDARQD+VVVE+PKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEDILKENPTMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>ref|XP_002299282.1| naregenin-chalcone synthase family protein [Populus trichocarpa]
 gb|ABK95125.1| unknown [Populus trichocarpa]
 gb|EEE84087.1| naregenin-chalcone synthase family protein [Populus trichocarpa]
Length=390

 Score =   273 bits (697),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTV+EVRKAQRA+GPA I+AIGTSTP NCVDQSTYPDYYFRITNSEH VELKEKFKRMC
Sbjct  1    MVTVDEVRKAQRAEGPAVILAIGTSTPPNCVDQSTYPDYYFRITNSEHKVELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYM+LTEEILKENP++C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   EKSMIKKRYMHLTEEILKENPSVCEYMAPSLDARQDMVVVEVPKLGKEAAAKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|ACN30003.1| chalcone synthase [Vitis rotundifolia]
Length=393

 Score =   273 bits (697),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTV EVR AQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVTVNEVRNAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYM+LTEEILKENPN+CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMHLTEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAAAKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>ref|XP_008380609.1| PREDICTED: polyketide synthase 5 [Malus domestica]
 gb|AAX16492.1| chalcone synthase [Malus domestica]
 gb|ACJ54530.1| chalcone synthase [Malus domestica]
Length=391

 Score =   273 bits (697),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPAT+MAIGT+TP NCVDQ+TYPDYYFRITNSEH VELKEKF+RMC
Sbjct  1    MVTVEEVRKAQRAEGPATVMAIGTATPSNCVDQATYPDYYFRITNSEHKVELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENP++C YMAPS+DARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPSVCEYMAPSIDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AEK80412.1| type III polyketide synthase [Acer maximowiczianum]
Length=390

 Score =   273 bits (697),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRAQGPATI+AIGT+TP NCVDQS YPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVTVEEVRKAQRAQGPATILAIGTATPPNCVDQSEYPDYYFRITNSEHKTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENPN+CAY APSLDARQD+VVVE+PKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPNVCAYEAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|ADD74168.1| chalcone synthase [Nelumbo nucifera]
Length=389

 Score =   273 bits (697),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVE++ KAQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVTVEDILKAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYM+LTEEILKENPN+CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   EKSMIKKRYMHLTEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AHA61354.1| chalcone synthase [Phyllanthus emblica]
Length=390

 Score =   273 bits (697),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA GPAT+MAIGT+ P NCVDQSTYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1    MVTVEEVRKAQRASGPATVMAIGTAVPPNCVDQSTYPDYYFRITNSEHKTELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYL EEILKENPNICAYMAPSLDARQDIVVVE+PKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLNEEILKENPNICAYMAPSLDARQDIVVVEIPKLGKEAAVKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AEW12813.1| chalcone synthase [Brunfelsia brasiliensis subsp. macrocalyx]
Length=389

 Score =   273 bits (697),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEE RKAQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1    MVTVEEYRKAQRAEGPATVMAIGTATPSNCVDQSTYPDYYFRITNSEHKTELKEKFRRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYM+LTEEILKENP IC YMAPSLDARQDIVVVE+PKLGKEAAQKAIKEWGQP
Sbjct  61   DKSMIKKRYMHLTEEILKENPKICEYMAPSLDARQDIVVVEIPKLGKEAAQKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AFC37244.1| chalcone synthase 3 [Camellia chekiangoleosa]
Length=389

 Score =   273 bits (697),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVE+VR+AQRAQGPAT++AIGT+TP NCVDQSTYPDYYFRITNSEH VELKEKFKRMC
Sbjct  1    MVTVEDVRRAQRAQGPATVLAIGTATPPNCVDQSTYPDYYFRITNSEHKVELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENP +C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPQVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AFM36768.1| chalcone synthase [Narcissus tazetta var. chinensis]
Length=390

 Score =   273 bits (697),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVT++E+RKAQRA GPATI+AIGT+ PQNC++QSTYPDYYFR+TNSEH+VELK+KFKRMC
Sbjct  1    MVTIDEIRKAQRADGPATILAIGTANPQNCIEQSTYPDYYFRVTNSEHMVELKQKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYMYLTEEILK+NPN+CAYMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61   EKSMIKKRYMYLTEEILKQNPNLCAYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AAF60297.1|AF233638_1 chalcone synthase [Petunia x hybrida]
 gb|AGZ04577.1| chalcone synthase [Petunia x hybrida]
Length=389

 Score =   272 bits (696),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEE RKAQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH  +LKEKFKRMC
Sbjct  1    MVTVEEYRKAQRAEGPATVMAIGTATPTNCVDQSTYPDYYFRITNSEHKTDLKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYM+LTEEILKENP++C YMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61   EKSMIKKRYMHLTEEILKENPSMCEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>sp|P08894.1|CHSA_PETHY RecName: Full=Chalcone synthase A; AltName: Full=Naringenin-chalcone 
synthase A [Petunia x hybrida]
 emb|CAA27718.1| unnamed protein product [Petunia x hybrida]
Length=389

 Score =   272 bits (696),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEE RKAQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH  +LKEKFKRMC
Sbjct  1    MVTVEEYRKAQRAEGPATVMAIGTATPTNCVDQSTYPDYYFRITNSEHKTDLKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYM+LTEEILKENP++C YMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61   EKSMIKKRYMHLTEEILKENPSMCEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>sp|O04111.1|CHSY_PERFR RecName: Full=Chalcone synthase; AltName: Full=Naringenin-chalcone 
synthase [Perilla frutescens]
 dbj|BAA19656.1| chalcone synthase [Perilla frutescens]
Length=391

 Score =   272 bits (696),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVE++R+AQRA+GPAT+MAIGT+TP+NCVDQSTYPDYYFRITNSEH  +LKEKFKRMC
Sbjct  1    MVTVEDIRRAQRAEGPATVMAIGTATPENCVDQSTYPDYYFRITNSEHRTDLKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMI+KRYM+LTEE LKENPN+ AYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61   EKSMIRKRYMHLTEEFLKENPNMTAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>sp|P17957.1|CHS2_SOYBN RecName: Full=Chalcone synthase 2; AltName: Full=Naringenin-chalcone 
synthase 2 [Glycine max]
 emb|CAA36317.1| chalcone synthase [Glycine max]
Length=388

 Score =   272 bits (696),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV+VEE+RKAQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH+ ELKEKFKRMC
Sbjct  1    MVSVEEIRKAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHMTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYL EEILKENP++CAYMAPSLDARQD+VV+EVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLNEEILKENPSVCAYMAPSLDARQDMVVMEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHL+FCTTSGVDMPG
Sbjct  121  KSKITHLIFCTTSGVDMPG  139



>dbj|BAM17287.1| chalcone synthase [Petunia x hybrida]
Length=389

 Score =   272 bits (696),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEE RKAQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH  +LKEKFKRMC
Sbjct  1    MVTVEEYRKAQRAEGPATVMAIGTATPTNCVDQSTYPDYYFRITNSEHKTDLKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYM+LTEEILKENP++C YMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61   EKSMIKKRYMHLTEEILKENPSMCEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AAQ62588.1| chalcone synthase CHS4 [Glycine max]
 gb|AAQ62595.1| chalcone synthase CHS4 [Glycine max]
Length=388

 Score =   272 bits (695),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV+VEE+RKAQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH+ ELKEKFKRMC
Sbjct  1    MVSVEEIRKAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHMTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYL EEILKENP++CAYMAPSLDARQD+VV+EVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLNEEILKENPSVCAYMAPSLDARQDMVVMEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHL+FCTTSGVDMPG
Sbjct  121  KSKITHLIFCTTSGVDMPG  139



>ref|XP_003524935.1| PREDICTED: chalcone synthase [Glycine max]
 emb|CAA46590.1| naregenin-chalcone synthase [Glycine max]
Length=388

 Score =   272 bits (695),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV+VEE+R+AQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH+ ELKEKFKRMC
Sbjct  1    MVSVEEIRQAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHMTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYL EEILKENP++CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLNEEILKENPSVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHL+FCTTSGVDMPG
Sbjct  121  KSKITHLIFCTTSGVDMPG  139



>ref|XP_010264137.1| PREDICTED: chalcone synthase 1-like [Nelumbo nucifera]
Length=288

 Score =   268 bits (686),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVE++RKAQRA+GPAT+MAIGT+ P NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVTVEDIRKAQRAEGPATVMAIGTANPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYM+LTEEILKENPNIC YMA SLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   EKSMIKKRYMHLTEEILKENPNICEYMASSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AAN05791.1| chalcone synthase [Mazus pumilus]
Length=392

 Score =   272 bits (695),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 123/137 (90%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  80   TVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMCEK  259
            TVEE+R+AQRA+GPAT++AIGT+TP NCVDQSTYPDYYFRITNSEH+ +LKEKFKRMCEK
Sbjct  4    TVEEIRRAQRAEGPATVLAIGTATPSNCVDQSTYPDYYFRITNSEHMTDLKEKFKRMCEK  63

Query  260  SMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKS  439
            S IKKRYM+LTEEILKENPN+CAYMAPSLDARQDIVVVE+PKLGKEAAQKAIKEWGQPKS
Sbjct  64   SYIKKRYMHLTEEILKENPNMCAYMAPSLDARQDIVVVEIPKLGKEAAQKAIKEWGQPKS  123

Query  440  KITHLVFCTTSGVDMPG  490
            KITHLVFCTTSGVDMPG
Sbjct  124  KITHLVFCTTSGVDMPG  140



>ref|XP_002303821.2| naregenin-chalcone synthase family protein [Populus trichocarpa]
 gb|EEE78800.2| naregenin-chalcone synthase family protein [Populus trichocarpa]
Length=391

 Score =   272 bits (695),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTV+E+RK+QRA+GPATIMAIGTSTP NCVDQSTYP+YYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVTVDEIRKSQRAEGPATIMAIGTSTPPNCVDQSTYPEYYFRITNSEHKAELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYMYLTEEILKENP++C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   EKSMIKKRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AFH68066.1| chalcone synthase [Pyrus pyrifolia]
Length=389

 Score =   272 bits (695),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPAT+MAIGTSTP NCVDQ+TYPDYYFRITNSEH VELKEKF+RMC
Sbjct  1    MVTVEEVRKAQRAEGPATVMAIGTSTPSNCVDQATYPDYYFRITNSEHKVELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENP++C YMAPS+DARQD+VVV+VPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPSVCEYMAPSIDARQDMVVVKVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>ref|XP_003516867.1| PREDICTED: chalcone synthase 6-like [Glycine max]
Length=388

 Score =   272 bits (695),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV+VEE+RKAQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNS+H+ ELKEKFKRMC
Sbjct  1    MVSVEEIRKAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSDHMTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYL EEILKENP++CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLNEEILKENPSVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHL+FCTTSGVDMPG
Sbjct  121  KSKITHLIFCTTSGVDMPG  139



>gb|AIB06736.1| chalcone synthases-1 [Mangifera indica]
Length=390

 Score =   272 bits (695),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTV+EVRKAQRA+GPATIMAIGT+ P NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVTVDEVRKAQRAEGPATIMAIGTANPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYMYLTEEILKENP IC YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   EKSMIKKRYMYLTEEILKENPAICEYMAPSLDARQDMVVVEVPKLGKEAAAKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>dbj|BAB92996.1| chalcone synthase [Malus domestica]
 gb|ACJ54532.1| chalcone synthase [Malus domestica]
Length=391

 Score =   272 bits (695),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPAT+MAIGT+TP NCVDQ+TYPDYYFRITNSEH VELKEKF+RMC
Sbjct  1    MVTVEEVRKAQRAEGPATVMAIGTATPSNCVDQATYPDYYFRITNSEHKVELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENP++C YMAPS+DARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPSVCEYMAPSIDARQDMVVVEVPKLGKEAAIKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AAO32821.1| chalcone synthase [Arachis hypogaea]
 gb|ABZ80827.1| chalcone synthase [Arachis hypogaea]
Length=389

 Score =   272 bits (695),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV V E+RKAQRA+GPATIMAIGT+TPQNCVDQSTYPDYYFRITNS+H+ ELKEKF+RMC
Sbjct  1    MVNVSEIRKAQRAEGPATIMAIGTATPQNCVDQSTYPDYYFRITNSQHMTELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENPN+C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPNMCKYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHL+FCTTSGVDMPG
Sbjct  121  KSKITHLIFCTTSGVDMPG  139



>dbj|BAM17288.1| chalcone synthase [Petunia x hybrida]
Length=389

 Score =   272 bits (695),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEE RKAQRA+GPAT+MAIGT+TP NCVDQSTYPD+YFRITNSEH  +LKEKFKRMC
Sbjct  1    MVTVEEYRKAQRAEGPATVMAIGTATPSNCVDQSTYPDFYFRITNSEHKTDLKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYM+LTEEILKENP++C YMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61   EKSMIKKRYMHLTEEILKENPSMCEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>dbj|BAA19548.1| chalcone synthase [Perilla frutescens]
Length=379

 Score =   271 bits (693),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVE++R+AQRA+GPAT++AIGT+TP+NCVDQSTYPDYYFRITNSEH  +LKEKFKRMC
Sbjct  1    MVTVEDIRRAQRAEGPATVLAIGTATPENCVDQSTYPDYYFRITNSEHRTDLKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMI+KRYM+LTEE LKENPN+ AYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61   EKSMIRKRYMHLTEEFLKENPNMTAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>sp|P19168.1|CHS3_SOYBN RecName: Full=Chalcone synthase 3; AltName: Full=Naringenin-chalcone 
synthase 3 [Glycine max]
 emb|CAA37909.1| naregenin-chalcone synthase [Glycine max]
Length=388

 Score =   271 bits (694),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV+VEE+R AQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH+ ELKEKFKRMC
Sbjct  1    MVSVEEIRNAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHMTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYL EEILKENP++CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLNEEILKENPSVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHL+FCTTSGVDMPG
Sbjct  121  KSKITHLIFCTTSGVDMPG  139



>gb|ABP57071.1| chalcone synthase [Solenostemon scutellarioides]
 gb|ABP57072.1| chalcone synthase [Solenostemon scutellarioides]
Length=390

 Score =   271 bits (694),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVE++R+AQRA+GPAT++AIGTSTP NCVDQSTYPDYYFRITNSEH  +LKEKFKRMC
Sbjct  1    MVTVEDIRRAQRAEGPATVLAIGTSTPSNCVDQSTYPDYYFRITNSEHKTDLKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMI+KRYM+LTEE LKENPN+ AYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61   EKSMIRKRYMHLTEEFLKENPNMTAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>ref|XP_006585154.1| PREDICTED: chalcone synthase 3-like isoform X2 [Glycine max]
Length=388

 Score =   271 bits (694),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV+VEE+R AQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH+ ELKEKFKRMC
Sbjct  1    MVSVEEIRNAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHMTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYL EEILKENP++CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLNEEILKENPSVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHL+FCTTSGVDMPG
Sbjct  121  KSKITHLIFCTTSGVDMPG  139



>ref|NP_001276296.1| chalcone synthase [Glycine max]
 ref|XP_003531220.1| PREDICTED: chalcone synthase 3-like [Glycine max]
 gb|AAQ62589.1| chalcone synthase CHS3 [Glycine max]
 gb|AAQ62596.1| chalcone synthase CHS3 [Glycine max]
 gb|ACN81822.1| chalcone synthase [Glycine max]
 gb|KHN15230.1| Chalcone synthase 3 [Glycine soja]
Length=388

 Score =   271 bits (694),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV+VEE+R AQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH+ ELKEKFKRMC
Sbjct  1    MVSVEEIRNAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHMTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYL EEILKENP++CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLNEEILKENPSVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHL+FCTTSGVDMPG
Sbjct  121  KSKITHLIFCTTSGVDMPG  139



>gb|AFM74036.1| chalcone synthase [Acer palmatum]
Length=390

 Score =   271 bits (693),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTV+EVRKAQRAQGPATI+AIGT+TP NCVDQS YPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVTVDEVRKAQRAQGPATILAIGTATPPNCVDQSEYPDYYFRITNSEHKTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYMYLTEEILKENPN+CAY APSLDARQD+VVVE+PKLGKEAA KAIKEWGQP
Sbjct  61   EKSMIKKRYMYLTEEILKENPNVCAYEAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFC+TSGVDMPG
Sbjct  121  KSKITHLVFCSTSGVDMPG  139



>gb|AGH13332.1| chalcone synthase [Rhus chinensis]
Length=390

 Score =   271 bits (693),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV+V+EVRKAQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVSVDEVRKAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYMYLTEEILKENP +C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   EKSMIKKRYMYLTEEILKENPAVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AAO13091.1| chalcone synthase [Camellia sinensis]
Length=389

 Score =   271 bits (693),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVE++R+AQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVTVEDIRRAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKAELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENP +C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPQVCGYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AFM36767.1| chalcone synthase [Narcissus tazetta var. chinensis]
Length=390

 Score =   271 bits (693),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVT++E+RKAQRA GPATI+AIGT+ PQNC++QSTYPDYYFR+TNSEH+VELK+KFKRMC
Sbjct  1    MVTIDEIRKAQRADGPATILAIGTANPQNCIEQSTYPDYYFRVTNSEHMVELKQKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYMYLTEEIL++NPN+CAYMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61   EKSMIKKRYMYLTEEILEQNPNLCAYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>dbj|BAI66465.1| chalcone synthase [Camellia japonica]
 gb|ADZ28512.1| chalcone synthase [Camellia nitidissima]
Length=389

 Score =   271 bits (693),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVE+VR+AQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVTVEDVRRAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKAELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENP +C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPQVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|KHN12336.1| Chalcone synthase 1 [Glycine soja]
Length=388

 Score =   271 bits (693),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV+VE +RKAQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH+ ELKEKFKRMC
Sbjct  1    MVSVEAIRKAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHMTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYL EEILKENP++CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLNEEILKENPSVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHL+FCTTSGVDMPG
Sbjct  121  KSKITHLIFCTTSGVDMPG  139



>gb|AFC37242.1| chalcone synthase 1 [Camellia chekiangoleosa]
Length=389

 Score =   271 bits (693),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVE+VR+AQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVTVEDVRRAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKAELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENP +C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPQVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AHY35308.1| chalcone synthase 1 [Morus notabilis]
Length=389

 Score =   271 bits (693),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GP TIMAIGT+TP NC+DQS+YPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVTVEEVRKAQRAEGPVTIMAIGTATPPNCIDQSSYPDYYFRITNSEHKTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKS IKKRYMYL EEILKENPNICAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   EKSQIKKRYMYLHEEILKENPNICAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|KHN23260.1| Chalcone synthase 6 [Glycine soja]
Length=426

 Score =   272 bits (695),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 123/140 (88%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = +2

Query  71   KMVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRM  250
            +MV+VEE+R AQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH+ ELKEKFKRM
Sbjct  61   RMVSVEEIRNAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHMTELKEKFKRM  120

Query  251  CEKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQ  430
            C+KSMIKKRYMYL EEILKENP++CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQ
Sbjct  121  CDKSMIKKRYMYLNEEILKENPSVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQ  180

Query  431  PKSKITHLVFCTTSGVDMPG  490
            PKSKITHL+FCTTSGVDMPG
Sbjct  181  PKSKITHLIFCTTSGVDMPG  200


 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/59 (86%), Positives = 57/59 (97%), Gaps = 0/59 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRM  250
            MV+VEE+RKAQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH+ ELKEKFKRM
Sbjct  1    MVSVEEIRKAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHMTELKEKFKRM  59



>ref|XP_002303820.1| naregenin-chalcone synthase family protein [Populus trichocarpa]
 gb|EEE78799.1| naregenin-chalcone synthase family protein [Populus trichocarpa]
Length=391

 Score =   271 bits (692),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTV+E+RK QRA+GPATIMAIGTSTP NCVDQS YPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVTVDEIRKTQRAEGPATIMAIGTSTPPNCVDQSAYPDYYFRITNSEHKAELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYMYLTEEILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61   EKSMIKKRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>ref|XP_003531219.1| PREDICTED: chalcone synthase 5-like [Glycine max]
 ref|XP_003531226.1| PREDICTED: chalcone synthase 5-like [Glycine max]
 sp|P48406.1|CHS5_SOYBN RecName: Full=Chalcone synthase 5; AltName: Full=Naringenin-chalcone 
synthase 5 [Glycine max]
 gb|AAB01004.1| chalcone synthase [Glycine max]
Length=388

 Score =   271 bits (692),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV+VEE+R+AQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH+ ELKEKFKRMC
Sbjct  1    MVSVEEIRQAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHMTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYL EEILKENP++CAYMAPSLDARQD+VV+EVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLNEEILKENPSVCAYMAPSLDARQDMVVMEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHL+FCTTSGVDMPG
Sbjct  121  KSKITHLIFCTTSGVDMPG  139



>gb|AGI02994.1| chalcone synthase [Camellia sinensis]
Length=389

 Score =   271 bits (692),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVE++R+AQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVTVEDIRRAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKAELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENP +C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPQVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>sp|P48386.1|CHS1_CAMSI RecName: Full=Chalcone synthase 1; AltName: Full=Naringenin-chalcone 
synthase 1 [Camellia sinensis]
 dbj|BAA05640.1| chalcone synthase [Camellia sinensis]
 gb|AGI02992.1| chalcone synthase [Camellia sinensis]
Length=389

 Score =   271 bits (692),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVE++R+AQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVTVEDIRRAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKAELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENP +C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPQVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>dbj|BAC10998.1| chalcone synthase [Nierembergia sp. NB17]
Length=389

 Score =   271 bits (692),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVR++QRA GPATIMAIGT+TP NCVDQ+TYPD+YFRITNSEH  ELKEKF+RMC
Sbjct  1    MVTVEEVRRSQRAIGPATIMAIGTATPSNCVDQTTYPDFYFRITNSEHKTELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENP++C YMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPSMCEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AEN04070.1| chalcone synthase [Narcissus tazetta var. chinensis]
Length=390

 Score =   271 bits (692),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVT++E+RKAQRA GPATI+AIGT+ PQNC++QSTYPDYYFR+TNSEH+VELK+KFKRMC
Sbjct  1    MVTIDEIRKAQRADGPATILAIGTANPQNCIEQSTYPDYYFRVTNSEHMVELKQKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYMYLTEEILK+NPN+CAYMAPSLDARQD+VVVEVP+LGK AA KAIKEWGQP
Sbjct  61   EKSMIKKRYMYLTEEILKQNPNLCAYMAPSLDARQDMVVVEVPRLGKAAAVKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>emb|CAA32731.1| chalcone synthase [Petunia x hybrida]
Length=389

 Score =   270 bits (691),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEE RKAQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH  +LKEKFKRMC
Sbjct  1    MVTVEEYRKAQRAEGPATVMAIGTATPTNCVDQSTYPDYYFRITNSEHKTDLKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYM+LTEEILKENP++C YMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61   EKSMIKKRYMHLTEEILKENPSMCEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHL FCTTSGVDMPG
Sbjct  121  KSKITHLFFCTTSGVDMPG  139



>emb|CAA64452.1| naringenin-chalcone synthase [Juglans nigra x Juglans regia]
Length=389

 Score =   270 bits (691),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVE+VR+AQRA+GPAT+MAIGT+TP NCVDQS YPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVTVEDVRRAQRAEGPATVMAIGTATPPNCVDQSAYPDYYFRITNSEHKTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYM+LTEEILKENPN+CAYMA SLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   EKSMIKKRYMHLTEEILKENPNVCAYMASSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>sp|Q9ZRR8.1|CHS1_CASGL RecName: Full=Chalcone synthase; AltName: Full=Naringenin-chalcone 
synthase [Casuarina glauca]
 emb|CAA10641.1| chalcone synthase [Casuarina glauca]
Length=389

 Score =   270 bits (691),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPAT++AIGT+TP NC+DQSTYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1    MVTVEEVRKAQRAEGPATVLAIGTATPPNCLDQSTYPDYYFRITNSEHKTELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKE+PN+CAYMAPSLDARQD+VVVE+PKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKEHPNMCAYMAPSLDARQDMVVVEIPKLGKEAAVKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>ref|NP_001234033.1| chalcone synthase 1 [Solanum lycopersicum]
 sp|P23418.2|CHS1_SOLLC RecName: Full=Chalcone synthase 1; AltName: Full=Naringenin-chalcone 
synthase 1 [Solanum lycopersicum]
 emb|CAA38980.1| chalcone synthase [Solanum lycopersicum]
Length=389

 Score =   270 bits (691),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 126/138 (91%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEE RKAQRA+GPATI+AIGTSTP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVTVEEYRKAQRAEGPATILAIGTSTPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYM+LTEEILKENPN+CAYMAPSLDARQDIVVVEVPKLGK   QKAIKEWGQP
Sbjct  61   DKSMIKKRYMHLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKRGTQKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMP  487
            KSKITHLVFCTTSGVDMP
Sbjct  121  KSKITHLVFCTTSGVDMP  138



>ref|XP_011034455.1| PREDICTED: chalcone synthase 1-like [Populus euphratica]
Length=391

 Score =   270 bits (690),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTV+E+RKAQRA+GPATI+AIGTSTP NCVDQ TYPDYYFRITNSEH VELKEKFKRMC
Sbjct  1    MVTVDEIRKAQRAEGPATILAIGTSTPPNCVDQCTYPDYYFRITNSEHKVELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYM+LTEEILKENP++C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   EKSMIKKRYMHLTEEILKENPSVCEYMAPSLDARQDMVVVEVPKLGKEAAVKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AAB36038.1| chalcone synthase [Petunia x hybrida]
Length=389

 Score =   270 bits (690),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEE RKAQR +GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH  +LKEKFKRMC
Sbjct  1    MVTVEEYRKAQRCEGPATVMAIGTATPTNCVDQSTYPDYYFRITNSEHKTDLKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYM+LTEEILKENP++C YMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61   EKSMIKKRYMHLTEEILKENPSMCEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>ref|XP_011034457.1| PREDICTED: chalcone synthase 1-like [Populus euphratica]
Length=390

 Score =   270 bits (690),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTV+EVRKAQRA+GPA I+AIGTSTP NCVDQSTYPDYYFRITNSEH VELKEKFKRMC
Sbjct  1    MVTVDEVRKAQRAEGPAAILAIGTSTPPNCVDQSTYPDYYFRITNSEHKVELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYM+LTEEILKENP+IC Y APSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   EKSMIKKRYMHLTEEILKENPSICEYRAPSLDARQDMVVVEVPKLGKEAAAKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AAU43217.1| chalcone synthase [Arachis hypogaea]
Length=389

 Score =   270 bits (690),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV V E+RKAQRA+GPATIMAIGT+TPQNCVDQSTYPDYYFR TNS+H+ ELKEKF+RMC
Sbjct  1    MVNVSEIRKAQRAEGPATIMAIGTATPQNCVDQSTYPDYYFRTTNSQHMTELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENPN+C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPNMCKYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHL+FCTTSGVDMPG
Sbjct  121  KSKITHLIFCTTSGVDMPG  139



>gb|AFM36766.1| chalcone synthase [Narcissus tazetta var. chinensis]
Length=390

 Score =   270 bits (689),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVT++E+RKAQRA GPATI+AIGT+ P NC++QSTYPDYYFR+TNSEH+VELK+KFKRMC
Sbjct  1    MVTIDEIRKAQRADGPATILAIGTANPPNCIEQSTYPDYYFRVTNSEHMVELKQKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYMYLTEEILK+NPN+CAYMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61   EKSMIKKRYMYLTEEILKQNPNLCAYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>sp|P06515.1|CHSY_ANTMA RecName: Full=Chalcone synthase; AltName: Full=Naringenin-chalcone 
synthase [Antirrhinum majus]
 emb|CAA27338.1| chalcone synthase [Antirrhinum majus]
 dbj|BAM29290.1| chalcone synthase [Antirrhinum majus]
 dbj|BAM29291.1| chalcone synthase [Antirrhinum majus]
 dbj|BAM29292.1| chalcone synthase [Antirrhinum majus]
Length=390

 Score =   270 bits (689),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVR+AQRA+GPAT++AIGT+TP NCVDQSTYPDYYFRITNSEH+ ELKEKFKRMC
Sbjct  1    MVTVEEVRRAQRAEGPATVLAIGTATPANCVDQSTYPDYYFRITNSEHMTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KS IK+RYM+LTEEILKENP +C YMAPSLDARQDIVVVEVP+LGKEAAQKAIKEWGQP
Sbjct  61   DKSNIKRRYMHLTEEILKENPAMCEYMAPSLDARQDIVVVEVPRLGKEAAQKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AGE84303.1| chalcone synthase [Malus domestica]
Length=389

 Score =   270 bits (689),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPAT++AIGT+TP NCVDQ+TYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1    MVTVEEVRKAQRAEGPATVLAIGTATPSNCVDQATYPDYYFRITNSEHKTELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENP +C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPTVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>emb|CAC88858.1| chalcone synthase [Rhododendron simsii]
Length=389

 Score =   270 bits (689),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVE+VR+AQRA+GPAT+MAIGT+TP NCVDQSTYPD+YFRITNSEH  ELKEKF+RMC
Sbjct  1    MVTVEDVRRAQRAEGPATVMAIGTATPSNCVDQSTYPDFYFRITNSEHKAELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENP++C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AID69535.1| chalcone synthase [Phlomoides rotata]
Length=391

 Score =   270 bits (689),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVE+ R+AQRA+GPAT++AIGT+TP NCVDQSTYPDYYFRITNSEH+ ELKEKFKRMC
Sbjct  1    MVTVEDFRRAQRAEGPATVLAIGTATPSNCVDQSTYPDYYFRITNSEHMTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKS I KRYM+LTE+ LKENPN+CAYMAPSLDARQD+VVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61   EKSTINKRYMHLTEDYLKENPNVCAYMAPSLDARQDLVVVEVPKLGKEAAQKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>ref|XP_008380608.1| PREDICTED: polyketide synthase 5-like [Malus domestica]
Length=389

 Score =   270 bits (689),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPAT++AIGT+TP NCVDQ+TYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1    MVTVEEVRKAQRAEGPATVLAIGTATPSNCVDQATYPDYYFRITNSEHKTELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENP +C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPTVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AFE56210.1| chalcone synthase [Camellia sinensis]
Length=389

 Score =   269 bits (688),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTV+++R+AQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVTVQDIRRAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKAELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENP +C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPQVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AFX71920.1| CHS2 chalcone synthase [Malus domestica]
Length=389

 Score =   269 bits (688),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPAT++AIGT+TP NCVDQ+TYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1    MVTVEEVRKAQRAEGPATVLAIGTATPSNCVDQATYPDYYFRITNSEHKTELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENP +C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPTVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|ACA04008.1| chalcone synthase, partial [Diplacus aurantiacus]
Length=370

 Score =   269 bits (687),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEV +AQRA+GPATI+AIGT+TP NCVDQS+YPDYYFRITNSEH VELKEKFKRMC
Sbjct  1    MVTVEEVCRAQRAEGPATILAIGTATPPNCVDQSSYPDYYFRITNSEHKVELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENP++CAY+APSLDARQDIVV EVPKLGK+AAQKAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPDMCAYVAPSLDARQDIVVAEVPKLGKDAAQKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSG+DMPG
Sbjct  121  KSKITHLVFCTTSGIDMPG  139



>ref|XP_010264056.1| PREDICTED: chalcone synthase 1 [Nelumbo nucifera]
 gb|ADD74169.1| chalcone synthase [Nelumbo nucifera]
 gb|ADD74170.1| chalcone synthase [Nelumbo nucifera]
 gb|ADD74171.1| chalcone synthase [Nelumbo nucifera]
 gb|ADD74172.1| chalcone synthase [Nelumbo nucifera]
Length=389

 Score =   269 bits (688),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVE++RKAQRA+GPAT+MAIGT+ P NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVTVEDIRKAQRAEGPATVMAIGTANPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYM+LTEEILKENPNIC YMA SLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   EKSMIKKRYMHLTEEILKENPNICEYMASSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AAL67805.1|AF461105_1 chalcone synthase [Hypericum perforatum]
Length=389

 Score =   269 bits (688),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPAT+MAIGT+ P NCVDQ+TYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1    MVTVEEVRKAQRAEGPATVMAIGTAVPPNCVDQATYPDYYFRITNSEHKAELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KS IKKRYMYL EEILKENPN+CAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSQIKKRYMYLNEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>dbj|BAE17123.1| chalcone synthase [Fragaria x ananassa]
Length=389

 Score =   269 bits (688),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPAT++AIGT+TP NC+DQSTYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1    MVTVEEVRKAQRAEGPATVLAIGTATPPNCIDQSTYPDYYFRITNSEHKAELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENP++C YMAPSLDARQD+VVVE+PKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAAVKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>ref|XP_009376348.1| PREDICTED: polyketide synthase 5-like [Pyrus x bretschneideri]
Length=396

 Score =   269 bits (688),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPATI+AIGT+TP NCVDQ+TYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1    MVTVEEVRKAQRAEGPATILAIGTATPPNCVDQATYPDYYFRITNSEHKTELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENP +C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPTVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AGV53049.1| chalcone synthase [Actinidia chinensis]
Length=389

 Score =   269 bits (687),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVR+AQRA+G ATIMAIGTSTP NCVDQS YPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1    MVTVEEVRRAQRAEGLATIMAIGTSTPPNCVDQSEYPDYYFRITNSEHKTELKEKFRRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIK RYMYLTEEILKENPN+CAYMAPSLDARQD+VVVE+PKLGKEAA KAIKEWGQP
Sbjct  61   EKSMIKMRYMYLTEEILKENPNVCAYMAPSLDARQDMVVVEIPKLGKEAAVKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>sp|Q9XJ58.1|CHS1_CITSI RecName: Full=Chalcone synthase 1; AltName: Full=Naringenin-chalcone 
synthase 1 [Citrus sinensis]
 dbj|BAA81663.1| chalcone synthase [Citrus sinensis]
Length=389

 Score =   269 bits (687),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 134/139 (96%), Gaps = 1/139 (1%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTV+EVRKAQRAQGPATIMAIGT+TP NCVDQSTYPDYYFRITNSEH+ +LKEKFKRMC
Sbjct  1    MVTVDEVRKAQRAQGPATIMAIGTATPPNCVDQSTYPDYYFRITNSEHMTDLKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENPN+CAYMAPSLD RQD+VVVEVP+LGK AA +AIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPNVCAYMAPSLDTRQDMVVVEVPRLGK-AATEAIKEWGQP  119

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  120  KSKITHLVFCTTSGVDMPG  138



>gb|ADD74167.1| chalcone synthase [Nelumbo nucifera]
Length=389

 Score =   269 bits (687),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVE++RKAQRA+GPAT+MAIGT+ P NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVTVEDIRKAQRAEGPATVMAIGTANPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYM+LTEEILKENPNIC YMA SLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   EKSMIKKRYMHLTEEILKENPNICEYMASSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>ref|XP_004306543.1| PREDICTED: polyketide synthase 1 [Fragaria vesca subsp. vesca]
Length=389

 Score =   269 bits (687),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPAT++AIGT+TP NC+DQSTYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1    MVTVEEVRKAQRAEGPATVLAIGTATPPNCIDQSTYPDYYFRITNSEHKAELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENP++C YMAPSLDARQD+VVVE+PKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAAVKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>sp|P23569.1|CHSY_PUEML RecName: Full=Chalcone synthase; AltName: Full=Naringenin-chalcone 
synthase [Pueraria montana var. lobata]
 dbj|BAA01075.1| chalcone synthase [Pueraria montana var. lobata]
 prf||2204192A chalcone synthase
Length=389

 Score =   269 bits (687),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV+V E+R+AQRA+GPATI+AIGT+ P NCVDQSTYPDYYFRITNSEH+ ELKEKF+RMC
Sbjct  1    MVSVAEIRQAQRAEGPATILAIGTANPPNCVDQSTYPDYYFRITNSEHMTELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENPN+CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHL+FCTTSGVDMPG
Sbjct  121  KSKITHLIFCTTSGVDMPG  139



>gb|AAM00232.1|AF358432_1 root-specific chalcone synthase [Senna alata]
Length=389

 Score =   269 bits (687),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV VEE+RKAQRA+G AT+MAIGT+TP NCVDQSTYPDYYFRITNSEH+ ELKEKF+RMC
Sbjct  1    MVKVEEIRKAQRAEGAATVMAIGTATPANCVDQSTYPDYYFRITNSEHMTELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYM+LTEEILKENPN+CAYMAPS+DARQDIVV+EVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMHLTEEILKENPNMCAYMAPSIDARQDIVVLEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHL+FCTTSGVDMPG
Sbjct  121  KSKITHLIFCTTSGVDMPG  139



>gb|ABF59866.1| chalcone synthase [Lupinus luteus]
Length=390

 Score =   269 bits (687),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV+VEE+R AQ+AQGPATIMAIGT+TP NCVDQSTYPD+YFR+TNSEH  ELKEKFKRMC
Sbjct  1    MVSVEEIRNAQKAQGPATIMAIGTATPSNCVDQSTYPDFYFRVTNSEHKAELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYM+LTE+ILKENP+ICAYMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61   EKSMIKKRYMHLTEDILKENPSICAYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHL+FCTTSGVDMPG
Sbjct  121  KSKITHLIFCTTSGVDMPG  139



>dbj|BAE17124.1| chalcone synthase [Fragaria x ananassa]
Length=389

 Score =   269 bits (687),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPAT++AIGT+TP NC+DQSTYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1    MVTVEEVRKAQRAEGPATVLAIGTATPPNCIDQSTYPDYYFRITNSEHKAELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENP++C YMAPSLDARQD+VVVE+PKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAAVKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>ref|XP_007223028.1| hypothetical protein PRUPE_ppa006899mg [Prunus persica]
 gb|EMJ24227.1| hypothetical protein PRUPE_ppa006899mg [Prunus persica]
Length=391

 Score =   269 bits (687),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPAT++AIGT+TP NCVDQ+TYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1    MVTVEEVRKAQRAEGPATVLAIGTATPPNCVDQATYPDYYFRITNSEHKTELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENP++C YMAPSLDARQD+VVVE+PKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>ref|XP_003533807.1| PREDICTED: chalcone synthase 6 [Glycine max]
 sp|P30080.1|CHS6_SOYBN RecName: Full=Chalcone synthase 6; AltName: Full=Naringenin-chalcone 
synthase 6 [Glycine max]
 gb|AAA33951.1| chalcone synthase [Glycine max]
Length=388

 Score =   269 bits (687),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV+VEE+RKAQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNS+H+ ELKEKFKRMC
Sbjct  1    MVSVEEIRKAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSDHMNELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYL EEILKENP++CAYM PSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLNEEILKENPSVCAYMEPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHL+FCTTSGVDMPG
Sbjct  121  KSKITHLIFCTTSGVDMPG  139



>gb|ABF59867.1| chalcone synthase [Lupinus luteus]
Length=381

 Score =   268 bits (686),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV+VEE+R AQ+AQGPATIMAIGT+TP NCVDQSTYPD+YFR+TNSEH  ELKEKFKRMC
Sbjct  1    MVSVEEIRNAQKAQGPATIMAIGTATPSNCVDQSTYPDFYFRVTNSEHKAELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYM+LTE+ILKENP+ICAYMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61   EKSMIKKRYMHLTEDILKENPSICAYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHL+FCTTSGVDMPG
Sbjct  121  KSKITHLIFCTTSGVDMPG  139



>dbj|BAE17122.1| chalcone synthase [Fragaria x ananassa]
Length=389

 Score =   269 bits (687),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPAT++AIGT+TP NC+DQSTYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1    MVTVEEVRKAQRAEGPATVLAIGTATPPNCIDQSTYPDYYFRITNSEHKAELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENP++C YMAPSLDARQD+VVVE+PKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAAVKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AEJ88217.1| chalcone synthase [Prunus persica]
Length=391

 Score =   269 bits (687),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPAT++AIGT+TP NCVDQ+TYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1    MVTVEEVRKAQRAEGPATVLAIGTATPPNCVDQATYPDYYFRITNSEHKTELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENP++C YMAPSLDARQD+VVVE+PKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AAM90651.1|AF400566_1 chalcone synthase 11 [Rubus idaeus]
Length=391

 Score =   269 bits (687),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPAT++AIGT+TP NC+DQSTYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1    MVTVEEVRKAQRAEGPATVLAIGTATPPNCIDQSTYPDYYFRITNSEHKTELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENP++C YMAPSLDARQD+VVVE+PKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|ACJ54531.1| chalcone synthase [Malus domestica]
Length=389

 Score =   268 bits (686),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPAT+ AIGT+TP NCVDQ+TYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1    MVTVEEVRKAQRAEGPATVFAIGTATPPNCVDQATYPDYYFRITNSEHKAELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AGW24283.1| chalcone synthase [Melastoma malabathricum]
Length=391

 Score =   268 bits (686),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVR++QRA+GPATI+AIGT+TP NCVDQSTYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1    MVTVEEVRRSQRAEGPATILAIGTATPPNCVDQSTYPDYYFRITNSEHKAELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENP++CAY APSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPSVCAYEAPSLDARQDMVVVEVPKLGKEAAAKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|ABM63466.1| aromatic polyketide synthase [Hypericum hookerianum]
Length=390

 Score =   268 bits (686),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPAT+MAIGT+ P NCVDQ+TYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1    MVTVEEVRKAQRAEGPATVMAIGTAVPPNCVDQATYPDYYFRITNSEHKAELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KS IKKRYMYL EE+LKENPN+CAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSQIKKRYMYLNEEVLKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AAM00231.1|AF358431_1 root-specific chalcone synthase [Senna alata]
Length=390

 Score =   268 bits (686),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV+VEE+RKAQRAQGPAT++AIGT+TP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVSVEEIRKAQRAQGPATVLAIGTATPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYM+LTE++LKENPN+CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   EKSMIKKRYMHLTEDLLKENPNMCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHL+ CTTSGVDMPG
Sbjct  121  KSKITHLIVCTTSGVDMPG  139



>ref|XP_009353801.1| PREDICTED: chalcone synthase [Pyrus x bretschneideri]
Length=389

 Score =   268 bits (686),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPAT+ AIGT+TP NCVDQ+TYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1    MVTVEEVRKAQRAEGPATVFAIGTATPPNCVDQATYPDYYFRITNSEHKAELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>sp|Q9FUB7.1|CHSY_HYPAN RecName: Full=Chalcone synthase; AltName: Full=Naringenin-chalcone 
synthase [Hypericum androsaemum]
 gb|AAG30295.1|AF315345_1 chalcone synthase [Hypericum androsaemum]
Length=390

 Score =   268 bits (686),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPAT+MAIGT+ P NCVDQ+TYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1    MVTVEEVRKAQRAEGPATVMAIGTAVPPNCVDQATYPDYYFRITNSEHKAELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KS IKKRYMYL EE+LKENPN+CAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSQIKKRYMYLNEEVLKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AFU52909.1| chalcone synthase [Hypericum sampsonii]
Length=390

 Score =   268 bits (686),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPAT+MAIGT+ P NCVDQ+TYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1    MVTVEEVRKAQRAEGPATVMAIGTAVPPNCVDQATYPDYYFRITNSEHKAELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KS IKKRYMYL EE+LKENPN+CAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSQIKKRYMYLNEEVLKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>ref|XP_010249317.1| PREDICTED: chalcone synthase [Nelumbo nucifera]
Length=393

 Score =   268 bits (686),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV+VEE+R AQRAQGPAT++AIGT+TP NCV Q+ YPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVSVEEIRNAQRAQGPATVLAIGTATPANCVYQADYPDYYFRITNSEHKTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYM+LTEEILKENPNICAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   EKSMIKKRYMHLTEEILKENPNICAYMAPSLDARQDMVVVEVPKLGKEAASKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|ACD31532.1| chalcone synthase 1 [Nicotiana attenuata]
Length=288

 Score =   265 bits (677),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVR+AQRA+GPATIMAIGT+TP NCVDQSTYPDYYFR+TNSEH+ +LKEKFKRMC
Sbjct  1    MVTVEEVRRAQRAKGPATIMAIGTATPSNCVDQSTYPDYYFRVTNSEHMTKLKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYM+LTEEILKENPNI  YMAPSLDARQDIVVVE+PKLGKEAAQ AI+EW QP
Sbjct  61   DKSMIKKRYMHLTEEILKENPNISEYMAPSLDARQDIVVVEIPKLGKEAAQNAIEEWDQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCT +GVDMPG
Sbjct  121  KSKITHLVFCTMNGVDMPG  139



>ref|XP_009370115.1| PREDICTED: chalcone synthase-like [Pyrus x bretschneideri]
Length=390

 Score =   268 bits (686),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPAT+ AIGT+TP NCVDQ+TYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1    MVTVEEVRKAQRAEGPATVFAIGTATPPNCVDQATYPDYYFRITNSEHKAELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|ADV29810.1| chalcone synthase [Malus toringoides]
Length=389

 Score =   268 bits (686),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPAT+ AIGT+TP NCVDQ+TYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1    MVTVEEVRKAQRAEGPATVFAIGTATPPNCVDQATYPDYYFRITNSEHKAELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AFM36769.1| chalcone synthase [Narcissus tazetta var. chinensis]
Length=390

 Score =   268 bits (685),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVT++E+RKAQRA GPATI+AIGT+ P NC++QSTYPDYYFR+TNSEH+VEL++KFKRMC
Sbjct  1    MVTIDEIRKAQRADGPATILAIGTANPPNCIEQSTYPDYYFRVTNSEHMVELEQKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYMYLTEEILK+NPN+CAYMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61   EKSMIKKRYMYLTEEILKQNPNLCAYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>ref|XP_007032052.1| Chalcone and stilbene synthase family protein [Theobroma cacao]
 gb|EOY02978.1| Chalcone and stilbene synthase family protein [Theobroma cacao]
Length=395

 Score =   268 bits (686),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            M +VEE+RKAQRAQGPAT++AIGT+TP NCV Q+ YPDYYFRITNSEHL ELKEKFKRMC
Sbjct  3    MASVEEIRKAQRAQGPATVLAIGTATPPNCVSQADYPDYYFRITNSEHLTELKEKFKRMC  62

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENPN+CAYMA SLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  63   DKSMIKKRYMYLTEEILKENPNMCAYMASSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  122

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  123  KSKITHLVFCTTSGVDMPG  141



>emb|CAA64366.1| naringenin-chalcone synthase [Juglans nigra x Juglans regia]
Length=389

 Score =   268 bits (685),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVE+VR+AQRA+GPAT+MAIGT+TP NCVDQS YPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVTVEDVRRAQRAEGPATVMAIGTATPPNCVDQSAYPDYYFRITNSEHKTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
             KSMIKKRYM+LTEEILKENPN+CAYMA SLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   GKSMIKKRYMHLTEEILKENPNVCAYMASSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AFJ49141.1| CHS [Prunus persica]
Length=379

 Score =   268 bits (684),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPAT++AIGT+TP NCVDQ+TYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1    MVTVEEVRKAQRAEGPATVLAIGTATPPNCVDQATYPDYYFRITNSEHKAELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENP +C YMAPSLDARQD+VVVE+PKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPTMCEYMAPSLDARQDVVVVEIPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AGZ15299.1| chalcone synthase [Pyrus x bretschneideri]
 gb|AGZ15300.1| chalcone synthase [Pyrus x bretschneideri]
Length=389

 Score =   268 bits (685),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPAT++AIGTSTP NCVDQ+TYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1    MVTVEEVRKAQRAEGPATVLAIGTSTPPNCVDQATYPDYYFRITNSEHKTELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIK RYMYLTEEILKENP +C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61   DKSMIKTRYMYLTEEILKENPTVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>ref|XP_007157050.1| hypothetical protein PHAVU_002G039100g [Phaseolus vulgaris]
 gb|ESW29044.1| hypothetical protein PHAVU_002G039100g [Phaseolus vulgaris]
Length=389

 Score =   268 bits (685),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV+V E+R+AQRA+GPATI+AIGT+TP NCVDQSTYPDYYFRITNSEH+ +LKEKF+RMC
Sbjct  1    MVSVSEIRQAQRAEGPATILAIGTATPSNCVDQSTYPDYYFRITNSEHMTDLKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYM+L EEILKENPN+CAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMHLNEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHL+FCTTSGVDMPG
Sbjct  121  KSKITHLIFCTTSGVDMPG  139



>ref|XP_007223025.1| hypothetical protein PRUPE_ppa006888mg [Prunus persica]
 gb|EMJ24224.1| hypothetical protein PRUPE_ppa006888mg [Prunus persica]
 gb|AJA79072.1| chalcone synthase [Prunus persica]
 gb|AJA79077.1| chalcone synthase [Prunus persica]
Length=391

 Score =   268 bits (685),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPAT++AIGT+TP NCVDQ+TYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1    MVTVEEVRKAQRAEGPATVLAIGTATPPNCVDQATYPDYYFRITNSEHKAELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENP +C YMAPSLDARQD+VVVE+PKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPTMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>ref|XP_003531223.1| PREDICTED: chalcone synthase 1 [Glycine max]
 gb|ABQ63059.1| chalcone synthase 9 [Glycine max]
Length=388

 Score =   268 bits (685),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV+VE +RKAQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH+ ELKEKFKRMC
Sbjct  1    MVSVEAIRKAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHMTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKK YMYL EEILKENP++CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKLYMYLNEEILKENPSVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHL+FCTTSGVDMPG
Sbjct  121  KSKITHLIFCTTSGVDMPG  139



>sp|P49440.1|CHSY_PHAVU RecName: Full=Chalcone synthase 17; AltName: Full=Naringenin-chalcone 
synthase 17 [Phaseolus vulgaris]
 emb|CAA29700.1| unnamed protein product [Phaseolus vulgaris]
Length=389

 Score =   268 bits (685),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV+V E+R+AQRA+GPATI+AIGT+TP NCVDQSTYPDYYFRITNSEH+ +LKEKF+RMC
Sbjct  1    MVSVSEIRQAQRAEGPATILAIGTATPSNCVDQSTYPDYYFRITNSEHMTDLKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYM+L EEILKENPN+CAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMHLNEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHL+FCTTSGVDMPG
Sbjct  121  KSKITHLIFCTTSGVDMPG  139



>ref|XP_004504355.1| PREDICTED: chalcone synthase 1-like [Cicer arietinum]
Length=389

 Score =   268 bits (685),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV V+E+RKAQRA+GPAT+MAIGT+TP N +DQS YPDYYFR+TNSEH  ELKEKFKRMC
Sbjct  1    MVNVDEIRKAQRAEGPATVMAIGTATPPNFIDQSDYPDYYFRVTNSEHKTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYMYLTEEILKENPN+CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   EKSMIKKRYMYLTEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>ref|XP_009376346.1| PREDICTED: chalcone synthase-like [Pyrus x bretschneideri]
 gb|ADP09376.1| chalcone synthase [Pyrus pyrifolia]
 gb|AGV40323.1| chalcone synthase [Pyrus x bretschneideri]
Length=389

 Score =   268 bits (685),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPAT++AIGTSTP NCVDQ+TYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1    MVTVEEVRKAQRAEGPATVLAIGTSTPPNCVDQATYPDYYFRITNSEHKTELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIK RYMYLTEEILKENP +C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61   DKSMIKTRYMYLTEEILKENPTVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>dbj|BAC87863.1| chalcone synthase [Torenia hybrid cultivar]
Length=391

 Score =   268 bits (685),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV VE +R+AQRA+G ATI+AIGTSTPQNCVDQSTYPDYYFRITNSEH+ ELK+KF RMC
Sbjct  1    MVIVEAIRRAQRAEGAATILAIGTSTPQNCVDQSTYPDYYFRITNSEHMTELKDKFTRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYM+LTE+ LK+NPNICAYM PSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61   EKSMIKKRYMHLTEDYLKQNPNICAYMEPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>sp|B0LDU6.1|PKS5_RUBID RecName: Full=Polyketide synthase 5; Short=RiPKS5; AltName: Full=Naringenin-chalcone 
synthase PKS5 [Rubus idaeus]
 gb|ABV54603.1| polyketide synthase 5 [Rubus idaeus]
Length=391

 Score =   268 bits (685),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTV+EVRKAQRA+GPAT++AIGT+TP NC+DQSTYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1    MVTVDEVRKAQRAEGPATVLAIGTATPPNCIDQSTYPDYYFRITNSEHKTELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENP++C YMAPSLDARQD+VVVE+PKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>ref|XP_007157043.1| hypothetical protein PHAVU_002G038700g [Phaseolus vulgaris]
 gb|ESW29037.1| hypothetical protein PHAVU_002G038700g [Phaseolus vulgaris]
Length=389

 Score =   268 bits (684),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV+V E+R+AQRA+GPATI+AIGT+TP NCVDQSTYPDYYFRITNSEH+ +LKEKF+RMC
Sbjct  1    MVSVSEIRQAQRAEGPATILAIGTATPSNCVDQSTYPDYYFRITNSEHMTDLKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYM+L EEILKENPN+CAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMHLDEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHL+FCTTSGVDMPG
Sbjct  121  KSKITHLIFCTTSGVDMPG  139



>ref|XP_007158815.1| hypothetical protein PHAVU_002G184300g [Phaseolus vulgaris]
 gb|ESW30809.1| hypothetical protein PHAVU_002G184300g [Phaseolus vulgaris]
Length=389

 Score =   268 bits (684),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV+V E+R+AQRA+GPA I+AIGT+TP NCVDQSTYPDYYFRITNSEH+ ELKEKF+RMC
Sbjct  1    MVSVSEIRQAQRAEGPANILAIGTATPSNCVDQSTYPDYYFRITNSEHMTELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYM+L EEILKENPN+CAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMHLNEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHL+FCTTSGVDMPG
Sbjct  121  KSKITHLIFCTTSGVDMPG  139



>ref|XP_007157042.1| hypothetical protein PHAVU_002G038600g [Phaseolus vulgaris]
 gb|ESW29036.1| hypothetical protein PHAVU_002G038600g [Phaseolus vulgaris]
Length=389

 Score =   268 bits (684),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV+V E+R+AQRA+GPATI+AIGT+TP NCVDQSTYPDYYFRITNSEH+ +LKEKF+RMC
Sbjct  1    MVSVSEIRQAQRAEGPATILAIGTATPSNCVDQSTYPDYYFRITNSEHMTDLKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYM+L EEILKENPN+CAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMHLDEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHL+FCTTSGVDMPG
Sbjct  121  KSKITHLIFCTTSGVDMPG  139



>gb|AJO67963.1| chalcone synthase [Prunus avium]
Length=391

 Score =   268 bits (684),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPAT++AIGTS P NCVDQ+TYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1    MVTVEEVRKAQRAEGPATVLAIGTSNPPNCVDQATYPDYYFRITNSEHKTELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENP +C YMAPSLDARQD+VVVE+PKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPTMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|ADZ54780.1| naringenin-chalcone synthase [Prunus avium]
Length=391

 Score =   268 bits (684),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPAT++AIGTS P NCVDQ+TYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1    MVTVEEVRKAQRAEGPATVLAIGTSNPPNCVDQATYPDYYFRITNSEHKTELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENP +C YMAPSLDARQD+VVVE+PKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPTMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>ref|XP_008224578.1| PREDICTED: polyketide synthase 5 [Prunus mume]
Length=391

 Score =   267 bits (683),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPAT++AIGT+TP NCVDQ+TYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1    MVTVEEVRKAQRAEGPATVLAIGTATPPNCVDQATYPDYYFRITNSEHKAELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTE+ILKENP++C YMAPSLDARQD+VVVE+PKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEDILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AHL69646.1| chalcone synthase 1 [Phyllanthus emblica]
Length=390

 Score =   267 bits (683),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA GPAT+MAIGT+ P NCVDQSTYPDYYFRITNSEH  E KEKF+RMC
Sbjct  1    MVTVEEVRKAQRASGPATVMAIGTAVPPNCVDQSTYPDYYFRITNSEHKTEPKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYL EEILKENP+ICAYMAPSLDARQDIVVVE+PKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLNEEILKENPDICAYMAPSLDARQDIVVVEIPKLGKEAAVKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>dbj|BAO58433.1| chalcone synthase [Vaccinium ashei]
Length=389

 Score =   267 bits (683),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA GPAT+MAIGT+TP NCVDQSTYPD+YFRITNSEH  ELKEKF+RMC
Sbjct  1    MVTVEEVRKAQRAAGPATVMAIGTATPPNCVDQSTYPDFYFRITNSEHKTELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYL EEILKENP +C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLNEEILKENPGVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|EPS72180.1| chalcone synthase [Genlisea aurea]
Length=390

 Score =   267 bits (683),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV+VEE+R+AQRA+GPA ++AIGT+TP NCV+Q+TYPDYYFRITNSEH+ ELK+KFKRMC
Sbjct  1    MVSVEEIRRAQRAEGPAAVLAIGTATPANCVEQATYPDYYFRITNSEHMTELKDKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIK+RYMYLTEEILKENP++CAYM+PSLDARQDIVVVEVP+LGKEAAQKAIKEWGQP
Sbjct  61   DKSMIKRRYMYLTEEILKENPDMCAYMSPSLDARQDIVVVEVPRLGKEAAQKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITH++FCTTSGVDMPG
Sbjct  121  KSKITHVIFCTTSGVDMPG  139



>ref|XP_002264019.1| PREDICTED: chalcone synthase 2 [Vitis vinifera]
 dbj|BAB84111.1| chalcone synthase [Vitis vinifera]
 emb|CAN75038.1| hypothetical protein VITISV_030544 [Vitis vinifera]
Length=389

 Score =   267 bits (682),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTV EVR AQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVTVNEVRNAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYM+LTEEILKENPN+C YMA SLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMHLTEEILKENPNVCEYMAASLDARQDMVVVEVPKLGKEAAAKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>dbj|BAC66467.1| chalcone synthase [Rosa hybrid cultivar 'Kardinal']
Length=389

 Score =   267 bits (682),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPAT++AIGT+TP NC+DQSTYPDYYFRIT SEH  ELKEKF+RMC
Sbjct  1    MVTVEEVRKAQRAEGPATVLAIGTATPPNCIDQSTYPDYYFRITKSEHKAELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENP++C YMAPSLDARQD+VVVE+PKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>ref|XP_008358057.1| PREDICTED: polyketide synthase 5 [Malus domestica]
 gb|AAY45748.1| chalcone synthase [Malus domestica]
 gb|ACJ54533.1| chalcone synthase [Malus domestica]
 gb|ACN25139.1| chalcone sythase [Malus hybrid cultivar]
Length=389

 Score =   267 bits (682),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPAT++AIGT+TP NCVDQ+TYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1    MVTVEEVRKAQRAEGPATVLAIGTATPPNCVDQATYPDYYFRITNSEHKTELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIK RYMYLTEEILKENP +C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61   DKSMIKTRYMYLTEEILKENPTVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>sp|P48388.1|CHS3_CAMSI RecName: Full=Chalcone synthase 3; AltName: Full=Naringenin-chalcone 
synthase 3 [Camellia sinensis]
 dbj|BAA05642.1| chalcone synthase [Camellia sinensis]
Length=389

 Score =   267 bits (682),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVE+V +AQRA+GPAT++AIGT+TP NCVDQSTYPDYYFRITNSEH VELKEKFKRMC
Sbjct  1    MVTVEDVWRAQRARGPATVLAIGTATPPNCVDQSTYPDYYFRITNSEHKVELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENP +C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPLVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AEC13058.1| chalcone synthase protein [Rosa chinensis]
Length=389

 Score =   266 bits (681),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPAT++AIGT+TP NC+DQSTYPDYYFRIT SEH  ELKEKF+RMC
Sbjct  1    MVTVEEVRKAQRAEGPATVLAIGTATPPNCIDQSTYPDYYFRITKSEHKAELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENP++C YMAPSLDARQD+VVVE+PKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AEP17003.1| chalcone synthase [Vitis vinifera]
Length=389

 Score =   266 bits (681),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTV EVR AQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVTVNEVRNAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYM+LTEEILKENPN+C YMA SLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMHLTEEILKENPNVCEYMAASLDARQDMVVVEVPKLGKEAAAKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|ABF59869.1| chalcone synthase [Lupinus luteus]
Length=389

 Score =   266 bits (681),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV+VEE+R AQRAQGPATIMAIGT+TP NCVDQ+TYPDYYFR+TNSEH  ELK KFKRMC
Sbjct  1    MVSVEEIRNAQRAQGPATIMAIGTATPSNCVDQTTYPDYYFRVTNSEHKTELKHKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYMYLTE+ILKENP++CAYMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61   EKSMIKKRYMYLTEDILKENPSVCAYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITH++FCTTSG+D+PG
Sbjct  121  KSKITHVIFCTTSGIDLPG  139



>ref|XP_004306542.1| PREDICTED: polyketide synthase 1 [Fragaria vesca subsp. vesca]
Length=389

 Score =   266 bits (681),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPAT++AIGT+TP NC+DQSTYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1    MVTVEEVRKAQRAEGPATVLAIGTATPPNCIDQSTYPDYYFRITNSEHKAELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENP++C YMAPSLDARQD+VVVE+PKLGK+AA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKDAAVKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KS+ITHLVFCTTSGVDMPG
Sbjct  121  KSRITHLVFCTTSGVDMPG  139



>gb|AAM90652.1|AF400567_1 chalcone synthase 6 [Rubus idaeus]
Length=391

 Score =   266 bits (681),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTV+EVRKAQRA+GPATI+AIGT+TP NCVDQSTYPDYYFRIT SEH  ELKEKF+RMC
Sbjct  1    MVTVDEVRKAQRAEGPATILAIGTATPPNCVDQSTYPDYYFRITKSEHKTELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENP++C YMAPSLDARQD+VVVE+PKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AEP17004.1| chalcone synthase 3 [Vitis vinifera]
Length=348

 Score =   265 bits (678),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTV EVR AQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVTVNEVRNAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRY++LTEEILKENPN+C YMA SLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYLHLTEEILKENPNVCEYMAASLDARQDMVVVEVPKLGKEAAAKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>ref|XP_003601647.1| Chalcone synthase [Medicago truncatula]
 gb|AES71898.1| chalcone and stilbene synthase family protein [Medicago truncatula]
Length=389

 Score =   266 bits (681),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVT +E+R+AQRA GPAT++AIGT+TPQNCVDQSTYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1    MVTFDEIRQAQRADGPATVLAIGTATPQNCVDQSTYPDYYFRITNSEHKTELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHL+FCTTSGVDMPG
Sbjct  121  KSKITHLIFCTTSGVDMPG  139



>sp|Q9AU11.1|PKS1_RUBID RecName: Full=Polyketide synthase 1; Short=RiPKS1; AltName: Full=Naringenin-chalcone 
synthase PKS1 [Rubus idaeus]
 gb|AAK15174.1|AF292367_1 aromatic polyketide synthase [Rubus idaeus]
 gb|ACF72868.1| aromatic polyketide synthase [Rubus idaeus]
Length=391

 Score =   266 bits (681),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTV+EVRKAQRA+GPATI+AIGT+TP NCVDQSTYPDYYFRIT SEH  ELKEKF+RMC
Sbjct  1    MVTVDEVRKAQRAEGPATILAIGTATPPNCVDQSTYPDYYFRITKSEHKTELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENP++C YMAPSLDARQD+VVVE+PKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>ref|XP_009353802.1| PREDICTED: chalcone synthase-like [Pyrus x bretschneideri]
Length=390

 Score =   266 bits (681),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPAT+ AIGT+TP NCVDQ+TYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1    MVTVEEVRKAQRAEGPATVFAIGTATPPNCVDQATYPDYYFRITNSEHKAELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENP++C Y+APSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPSVCEYVAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>sp|P51090.1|CHSY_VITVI RecName: Full=Chalcone synthase; AltName: Full=Naringenin-chalcone 
synthase [Vitis vinifera]
 emb|CAA53583.1| chalcone synthase [Vitis vinifera]
 gb|ADG35962.1| chalcone synthase [Vitis hybrid cultivar]
Length=393

 Score =   266 bits (681),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV+V E+RKAQRA+GPAT++AIGT+TP NCV Q+ YPDYYFRITNSEH+ ELKEKFKRMC
Sbjct  1    MVSVAEIRKAQRAEGPATVLAIGTATPANCVYQADYPDYYFRITNSEHMTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMI KRYM+LTEEILKENPN+CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   EKSMINKRYMHLTEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAAAKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>ref|XP_008224579.1| PREDICTED: polyketide synthase 5-like [Prunus mume]
Length=391

 Score =   266 bits (681),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPAT++AIGT+TP NC++Q+TYPDYYFRITNSEH VELKEKF+RMC
Sbjct  1    MVTVEEVRKAQRAEGPATVLAIGTATPPNCIEQATYPDYYFRITNSEHKVELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTE+ILKENP++C YMAPSLDARQD+VVVE+PKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEDILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>ref|NP_001267879.1| chalcone synthase [Vitis vinifera]
 gb|ABM67586.1| chalcone synthase [Vitis vinifera]
Length=393

 Score =   266 bits (681),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV+V E+RKAQRA+GPAT++AIGT+TP NCV Q+ YPDYYFRITNSEH+ ELKEKFKRMC
Sbjct  1    MVSVAEIRKAQRAEGPATVLAIGTATPANCVYQADYPDYYFRITNSEHMTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMI KRYM+LTEEILKENPN+CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   EKSMINKRYMHLTEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAAAKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AAM90650.1|AF400565_1 chalcone synthase 5 [Rubus idaeus]
Length=391

 Score =   266 bits (681),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTV+EVRKAQRA+GPATI+AIGT+TP NCVDQSTYPDYYFRIT SEH  ELKEKF+RMC
Sbjct  1    MVTVDEVRKAQRAEGPATILAIGTATPPNCVDQSTYPDYYFRITKSEHKTELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENP++C YMAPSLDARQD+VVVE+PKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>ref|XP_007157053.1| hypothetical protein PHAVU_002G039300g [Phaseolus vulgaris]
 gb|ESW29047.1| hypothetical protein PHAVU_002G039300g [Phaseolus vulgaris]
Length=389

 Score =   266 bits (680),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV+V E+R+ QRA+GPATI+AIGT+TP NCVDQSTYPDYYFRITNSEH+ +LKEKF+RMC
Sbjct  1    MVSVSEIRQVQRAEGPATILAIGTATPSNCVDQSTYPDYYFRITNSEHMTDLKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYM+L EEILKENPN+CAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMHLNEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHL+FCTTSGVDMPG
Sbjct  121  KSKITHLIFCTTSGVDMPG  139



>sp|B0LDU5.1|PKS4_RUBID RecName: Full=Polyketide synthase 4; Short=RiPKS4; AltName: Full=Benzalacetone 
synthase PKS4; Short=RiBAS; AltName: Full=Naringenin-chalcone 
synthase PKS4 [Rubus idaeus]
 gb|ABV54602.1| polyketide synthase 4 [Rubus idaeus]
Length=383

 Score =   266 bits (680),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPAT++AIGT+TP NCV QSTYPDYYFRITNSEH +ELK+KF+RMC
Sbjct  1    MVTVEEVRKAQRAEGPATVLAIGTATPPNCVGQSTYPDYYFRITNSEHKIELKQKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENP++C YMAPSLDARQD+V+VE+PKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPSMCEYMAPSLDARQDMVIVEIPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>ref|XP_007161599.1| hypothetical protein PHAVU_001G083000g [Phaseolus vulgaris]
 gb|ESW33593.1| hypothetical protein PHAVU_001G083000g [Phaseolus vulgaris]
Length=391

 Score =   266 bits (681),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEE+R AQR+ GPATI+A GT+TP NC+ Q+ YPDYYFRITNSEH+ +LKEKFKRMC
Sbjct  1    MVTVEEIRNAQRSHGPATILAFGTATPSNCISQADYPDYYFRITNSEHMTDLKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYM+LTEE LKENPN+CAYMAPSLDARQDIVVVEVPKLGKEAA+KAIKEWGQP
Sbjct  61   EKSMIKKRYMHLTEEFLKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAARKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>ref|XP_008224580.1| PREDICTED: polyketide synthase 5-like [Prunus mume]
Length=391

 Score =   266 bits (680),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPAT++AIGT+TP NCVDQ+TYPDYYFRITNS+H  ELKEKF+RMC
Sbjct  1    MVTVEEVRKAQRAEGPATVLAIGTATPPNCVDQATYPDYYFRITNSQHKTELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTE+ILKENP++C YMAPSLDARQD+VVVE+PKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEDILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AFJ44312.1| chalcone synthase [Lonicera japonica]
Length=389

 Score =   266 bits (680),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPAT+MAIGTSTP NCV QS YPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVTVEEVRKAQRAEGPATVMAIGTSTPPNCVYQSAYPDYYFRITNSEHKTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMI+KRYMYLTEE LKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61   EKSMIRKRYMYLTEEFLKENPSMCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AGL50915.1| chalcone synthase [Pyrus communis]
Length=389

 Score =   266 bits (680),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPAT+ AIGT+TP NCVDQ+TYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1    MVTVEEVRKAQRAEGPATVFAIGTATPPNCVDQATYPDYYFRITNSEHKTELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIK RYMYLTEEILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61   DKSMIKTRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AAM00230.1|AF358430_1 root-specific chalcone synthase [Senna alata]
Length=389

 Score =   266 bits (680),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV VEE+RKAQRA+G AT+MAIGT+TP NCV+QSTYPDYYFR+TNSEH+ ELKEKF+RMC
Sbjct  1    MVKVEEIRKAQRAEGAATVMAIGTATPANCVEQSTYPDYYFRVTNSEHMTELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYM+LTEEILKENPN+CAYMAPS+DARQDIVV+EVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMHLTEEILKENPNMCAYMAPSIDARQDIVVLEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHL+FCTTSGVDMPG
Sbjct  121  KSKITHLIFCTTSGVDMPG  139



>gb|ADP37944.1| chalcone synthase [Fragaria chiloensis]
Length=142

 Score =   258 bits (658),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 118/134 (88%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  89   EVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMCEKSMI  268
            EVRKAQRA+GPAT++AIGT+TP NC+DQSTYPDYYFRITNSEH  ELKEKF+RMC+KSMI
Sbjct  1    EVRKAQRAEGPATVLAIGTATPPNCIDQSTYPDYYFRITNSEHKAELKEKFQRMCDKSMI  60

Query  269  KKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKIT  448
            KKRYMYLTEEILKENP++C YMAPSLDARQD+VVVE+PKLGKEAA KAIKEWGQPKSKIT
Sbjct  61   KKRYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAAVKAIKEWGQPKSKIT  120

Query  449  HLVFCTTSGVDMPG  490
            HLVFCTTSGVDMPG
Sbjct  121  HLVFCTTSGVDMPG  134



>gb|AAK39112.1|AF358656_1 chalcone synthase, partial [Ipomoea purpurea]
Length=368

 Score =   265 bits (678),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPATI+AIGT+TP NCVDQSTYPDYYFRITNS+H+ +LK+KF+RMC
Sbjct  1    MVTVEEVRKAQRAEGPATILAIGTATPANCVDQSTYPDYYFRITNSDHMTDLKQKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMI KRYM+LTEEILKENP+ C YMAPSLDARQDIVVVEVPKLGKEAAQ AIKEWGQP
Sbjct  61   DKSMITKRYMHLTEEILKENPSFCEYMAPSLDARQDIVVVEVPKLGKEAAQSAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITH++FCTTSGVDMPG
Sbjct  121  KSKITHVIFCTTSGVDMPG  139



>gb|ACT32034.1| chalcone synthase [Glycine soja]
Length=389

 Score =   266 bits (679),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV+V E+R+AQRA+GPATI+AIGT+ P NCVDQSTYPDYYFRITNSEH+ ELKEKF+RMC
Sbjct  1    MVSVAEIRQAQRAEGPATILAIGTANPPNCVDQSTYPDYYFRITNSEHMTELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIK+RYMYL EEILKENPN+CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKRRYMYLNEEILKENPNMCAYMAPSLDARQDMVVVEVPKLGKEAAVKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHL+FCTTSGVDMPG
Sbjct  121  KSKITHLIFCTTSGVDMPG  139



>ref|XP_003537853.1| PREDICTED: chalcone synthase [Glycine max]
 gb|KHN35131.1| Chalcone synthase [Glycine soja]
Length=389

 Score =   266 bits (679),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV+V E+R+AQRA+GPATI+AIGT+ P NCVDQSTYPDYYFRITNSEH+ ELKEKF+RMC
Sbjct  1    MVSVAEIRQAQRAEGPATILAIGTANPPNCVDQSTYPDYYFRITNSEHMTELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIK+RYMYL EEILKENPN+CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKRRYMYLNEEILKENPNMCAYMAPSLDARQDMVVVEVPKLGKEAAVKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHL+FCTTSGVDMPG
Sbjct  121  KSKITHLIFCTTSGVDMPG  139



>gb|AFK33946.1| unknown [Lotus japonicus]
Length=389

 Score =   266 bits (679),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV+V E+RKAQRA+GPATI+AIGT+ P NCVDQSTYPD+YF+ITNSEH+ ELKEKF+RMC
Sbjct  1    MVSVAEIRKAQRAEGPATILAIGTANPPNCVDQSTYPDFYFKITNSEHMTELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYL EEILKENPN+CAYMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLNEEILKENPNLCAYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHL+FCTTSGVDMPG
Sbjct  121  KSKITHLIFCTTSGVDMPG  139



>gb|ACU21426.1| unknown [Glycine max]
Length=389

 Score =   266 bits (679),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV+V E+R+AQRA+GPATI+AIGT+ P NCVDQSTYPDYYFRITNSEH+ ELKEKF+RMC
Sbjct  1    MVSVAEIRQAQRAEGPATILAIGTANPPNCVDQSTYPDYYFRITNSEHMTELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIK+RYMYL EEILKENPN+CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKRRYMYLNEEILKENPNMCAYMAPSLDARQDMVVVEVPKLGKEAAVKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHL+FCTTSGVDMPG
Sbjct  121  KSKITHLIFCTTSGVDMPG  139



>gb|AIC75908.1| chalcone synthase [Hibiscus cannabinus]
Length=389

 Score =   265 bits (678),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            M T+EE+RKAQRA+GPAT++AIGTSTP NCVDQSTYPD+YFR+T SEH  ELKEKFKRMC
Sbjct  1    MSTIEEIRKAQRAEGPATVLAIGTSTPPNCVDQSTYPDFYFRVTKSEHKAELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYMYLTE+ILKENPN+C YMAPSLDARQD+VVVEVPK GKEAA +AIKEWGQP
Sbjct  61   EKSMIKKRYMYLTEDILKENPNVCEYMAPSLDARQDMVVVEVPKFGKEAATRAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AFL72079.1| chalcone synthase [Agastache rugosa]
Length=391

 Score =   265 bits (678),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEE+R+AQRA+GPAT++AIGT+ P NCVDQSTYPDYYFRITNSEH  +LKEKF RMC
Sbjct  1    MVTVEEIRRAQRAEGPATVLAIGTAVPTNCVDQSTYPDYYFRITNSEHKTDLKEKFVRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYM+LTEE LKENPNI AYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQ 
Sbjct  61   EKSMIKKRYMHLTEEYLKENPNITAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQS  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|ACS36661.1| CHS4 [Vitis labrusca x Vitis vinifera]
Length=393

 Score =   265 bits (678),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV+V E+RKAQRA+GPAT++AIGT+TP NCV Q+ YPDYYFRITNSEH+ ELKEKFKRMC
Sbjct  1    MVSVAEIRKAQRAEGPATVLAIGTATPANCVYQADYPDYYFRITNSEHMTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMI KRYM+LTEEILKENPN+CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   EKSMINKRYMHLTEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAAVKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|ABV23279.1| chalcone synthase [Lupinus albus]
Length=362

 Score =   265 bits (676),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV+V E+RKAQRA+GPATI AIGT+TP NCVDQSTYPDYYFRITNSE  VELKEKF+RMC
Sbjct  1    MVSVAEIRKAQRAEGPATIFAIGTATPPNCVDQSTYPDYYFRITNSEDKVELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENP++CAYMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPSVCAYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHL+FCTTSGVDMPG
Sbjct  121  KSKITHLIFCTTSGVDMPG  139



>gb|AFM36770.1| chalcone synthase [Narcissus tazetta var. chinensis]
Length=390

 Score =   265 bits (678),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVT++E+RKAQRA GPATI+AIGT+ P NC++QSTYPDYYFR+T SEH+VELK+KFKRMC
Sbjct  1    MVTIDEIRKAQRADGPATILAIGTANPPNCIEQSTYPDYYFRVTKSEHMVELKQKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYMYLTEEIL++NPN+CAYMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61   EKSMIKKRYMYLTEEILEQNPNLCAYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>dbj|BAA31259.1| chalcone synthase [Vitis vinifera]
Length=393

 Score =   265 bits (678),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV+V E+RKAQRA+GPAT++AIGT+TP NCV Q+ YPDYYFRITNSEH+ ELKEKFKRMC
Sbjct  1    MVSVAEIRKAQRAEGPATVLAIGTATPANCVYQADYPDYYFRITNSEHMTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMI KRYM+LTEEILKENPN+CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   EKSMINKRYMHLTEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAAVKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AAX99413.1| chalcone synthase [Fragaria x ananassa]
Length=389

 Score =   265 bits (678),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPAT++AIGT+TP NC+DQSTYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1    MVTVEEVRKAQRAEGPATVLAIGTATPPNCIDQSTYPDYYFRITNSEHKAELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENP++C YMAPSLDARQD+VVVE+PKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAAVKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLV CTTSGVDMPG
Sbjct  121  KSKITHLVSCTTSGVDMPG  139



>ref|XP_003518828.1| PREDICTED: chalcone synthase 6-like [Glycine max]
Length=388

 Score =   265 bits (678),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV+VEE+RKAQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNS+H+ ELKEKFKRMC
Sbjct  1    MVSVEEIRKAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSDHMTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYL EEILKENP++ AYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQ 
Sbjct  61   DKSMIKKRYMYLNEEILKENPSVGAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQS  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHL+FCTTSGVDMPG
Sbjct  121  KSKITHLIFCTTSGVDMPG  139



>sp|O22045.1|CHSD_IPONI RecName: Full=Chalcone synthase D; AltName: Full=Naringenin-chalcone 
synthase D; Short=CHS-D [Ipomoea nil]
 dbj|BAA21787.1| chalcone synthase [Ipomoea nil]
 dbj|BAA87336.1| chalcone synthase [Ipomoea nil]
 dbj|BAH28850.1| chalcone synthase [Ipomoea nil]
 dbj|BAH28851.1| chalcone synthase [Ipomoea nil]
Length=388

 Score =   265 bits (678),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPATI+AIGT+TP NCVDQSTYPDYYFRITNS+H+ +LK+KF+RMC
Sbjct  1    MVTVEEVRKAQRAEGPATILAIGTATPANCVDQSTYPDYYFRITNSDHMTDLKQKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMI KRYM+LTEEILKENP+ C YMAPSLDARQDIVVVEVPKLGKEAAQ AIKEWGQP
Sbjct  61   DKSMITKRYMHLTEEILKENPSFCEYMAPSLDARQDIVVVEVPKLGKEAAQSAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITH++FCTTSGVDMPG
Sbjct  121  KSKITHVIFCTTSGVDMPG  139



>dbj|BAA22045.1| chalcone synthase [Pisum sativum]
Length=318

 Score =   263 bits (672),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTV+E+R+AQ+A+GPAT++AIGT+TP NCVDQSTYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1    MVTVDEIRQAQKAEGPATVLAIGTATPPNCVDQSTYPDYYFRITNSEHKTELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYM+LTEEILKENP++C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMHLTEEILKENPSVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHL+FCTTSGVDMPG
Sbjct  121  KSKITHLIFCTTSGVDMPG  139



>gb|ABB30178.1| chalcone synthase 1 [Glycine max]
Length=383

 Score =   265 bits (677),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 120/134 (90%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  89   EVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMCEKSMI  268
            E+RKAQRA+GPAT+MAIGT+TP NCVDQSTYPDYYFRITNSEH+ ELKEKFKRMC+KSMI
Sbjct  1    EIRKAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHMTELKEKFKRMCDKSMI  60

Query  269  KKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKIT  448
            KKRYMYL EEILKENP++CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQPKSKIT
Sbjct  61   KKRYMYLNEEILKENPSVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKIT  120

Query  449  HLVFCTTSGVDMPG  490
            HL+FCTTSGVDMPG
Sbjct  121  HLIFCTTSGVDMPG  134



>gb|AGI02993.1| chalcone synthase [Camellia sinensis]
Length=389

 Score =   265 bits (677),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVE+V +AQRA+GPAT++AIGT+TP NCVDQSTYPDYYFRITNSEH VELKEKFKRMC
Sbjct  1    MVTVEDVWRAQRARGPATVLAIGTATPPNCVDQSTYPDYYFRITNSEHKVELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENP +C Y+APSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPLVCEYVAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>sp|P51089.1|CHSY_VIGUN RecName: Full=Chalcone synthase; AltName: Full=Naringenin-chalcone 
synthase [Vigna unguiculata]
 emb|CAA52819.1| chalcone synthase [Vigna unguiculata]
Length=388

 Score =   265 bits (677),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV+V E+R+AQRA+GPATI+AIGT+TP NCVDQSTYPDYYFRITNSEH+ +LKEKF+RMC
Sbjct  1    MVSVSEIRQAQRAEGPATILAIGTATPPNCVDQSTYPDYYFRITNSEHMTDLKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYM++TEEILKENP++CAYMAPSLDARQDIVVVEVP+LGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMHVTEEILKENPSMCAYMAPSLDARQDIVVVEVPRLGKEAAVKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHL+FCTTSGVDMPG
Sbjct  121  KSKITHLIFCTTSGVDMPG  139



>gb|AGI02996.1| chalcone synthase [Camellia sinensis]
Length=389

 Score =   265 bits (676),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVE+V +AQRA+GPAT++AIGT+TP NCVDQSTYPDYYFRITNSEH VELKEKFKRMC
Sbjct  1    MVTVEDVWRAQRARGPATVLAIGTATPPNCVDQSTYPDYYFRITNSEHKVELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENP +C Y+APSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPLVCEYVAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>dbj|BAO58435.1| chalcone synthase [Vaccinium ashei]
Length=398

 Score =   265 bits (677),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = +2

Query  77   VTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMCE  256
            V+VEE+RKAQRAQGPAT++AIGT+TP NCV+Q+ YPD+YFRITNSEH  ELKEKFKRMCE
Sbjct  6    VSVEEIRKAQRAQGPATVLAIGTATPANCVNQAEYPDFYFRITNSEHKTELKEKFKRMCE  65

Query  257  KSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPK  436
            KSMIKKRYMYLTEEILKENP++C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQPK
Sbjct  66   KSMIKKRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPK  125

Query  437  SKITHLVFCTTSGVDMPG  490
            SKITHLVFCTTSGVDMPG
Sbjct  126  SKITHLVFCTTSGVDMPG  143



>gb|AEO36937.1| CHS [Canarium album]
Length=146

 Score =   256 bits (654),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            M  +EE+RKAQRA+GPA I+AIGT+TP NCV Q+ YPDYYFRITNSEH+ ELKEKFKRMC
Sbjct  1    MAGIEEIRKAQRAEGPANILAIGTATPANCVLQADYPDYYFRITNSEHMTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYM+LTEE LKENPN+CAYMA SLDARQDIVVVE PKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMHLTEEFLKENPNMCAYMAQSLDARQDIVVVEAPKLGKEAAVKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>sp|Q8RVK9.1|CHS_CANSA RecName: Full=Naringenin-chalcone synthase [Cannabis sativa]
 gb|AAL92879.1| chalcone synthase [Cannabis sativa]
Length=389

 Score =   264 bits (675),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEE RKAQRA+GPATIMAIGT+TP NCV QS YPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVTVEEFRKAQRAEGPATIMAIGTATPANCVLQSEYPDYYFRITNSEHKTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMI+KRYM+LTEEILKENPN+CAY APSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIRKRYMHLTEEILKENPNLCAYEAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>ref|XP_010099134.1| Chalcone synthase [Morus notabilis]
 gb|EXB76928.1| Chalcone synthase [Morus notabilis]
Length=389

 Score =   264 bits (675),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEV +AQRA+GPATIMAIGT+ P NC DQ TYPD+YFRITNSEH  ELKEKFKRMC
Sbjct  1    MVTVEEVCRAQRAEGPATIMAIGTANPPNCFDQRTYPDFYFRITNSEHKTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKS+IKKRYMYL EEILKENPNICAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   EKSLIKKRYMYLHEEILKENPNICAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>dbj|BAB84112.1| chalcone synthase [Vitis vinifera]
Length=393

 Score =   264 bits (675),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV+V E+RK+QRA+GPAT++AIGT+TP NCV Q+ YPDYYFRITNSEH+ ELKEKFKRMC
Sbjct  1    MVSVGEIRKSQRAEGPATVLAIGTATPANCVYQADYPDYYFRITNSEHMTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMI KRYM+LTEEILKENPN+CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   EKSMINKRYMHLTEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAAVKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|ABY68457.1| chalcone synthase [Ipomoea batatas]
Length=393

 Score =   264 bits (675),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPATI+AIGT+TP NCV+QSTYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1    MVTVEEVRKAQRAEGPATILAIGTATPANCVNQSTYPDYYFRITNSEHKTELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMI KRYM+LTEEILKENP++C YMAPSLDARQDI VVEVPKLGKEAAQ AIKEWGQP
Sbjct  61   DKSMITKRYMHLTEEILKENPSVCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITH+VFCTTSGVDMPG
Sbjct  121  KSKITHVVFCTTSGVDMPG  139



>gb|AIA22214.1| chalcone synthase [Hibiscus cannabinus]
Length=389

 Score =   264 bits (675),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            M T+EE+RKAQRA+GPAT++AIGTSTP NCVDQSTYPD+YFR+T SEH  ELKEKFKRMC
Sbjct  1    MSTIEEIRKAQRAEGPATVLAIGTSTPPNCVDQSTYPDFYFRVTKSEHKAELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYMYLTE+ILKENPN+C Y APSLDARQD+VVVEVPKLGKEAA +AIKEWGQP
Sbjct  61   EKSMIKKRYMYLTEDILKENPNVCEYKAPSLDARQDMVVVEVPKLGKEAATRAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AHB50476.1| putative stilbene synthase [Arachis hypogaea]
Length=389

 Score =   264 bits (675),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV+V  +RK QRA+GPATIMAIGT+TP NCVDQSTYPDYYFRITNSEH+ +LK+KF+RMC
Sbjct  1    MVSVSGIRKVQRAEGPATIMAIGTATPPNCVDQSTYPDYYFRITNSEHMSDLKKKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEE+LKENPN+CAYMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEMLKENPNMCAYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHL+FCTTSGVDMPG
Sbjct  121  KSKITHLIFCTTSGVDMPG  139



>gb|ADZ45296.1| chalcone synthase 2 [Glycyrrhiza uralensis]
Length=390

 Score =   264 bits (675),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = +2

Query  80   TVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMCEK  259
            TV E+RKAQRA+GPAT++AIGT+TP NCV+QS+YPDYYFRITNSEH  ELKEKFKRMCEK
Sbjct  4    TVGEIRKAQRAEGPATVLAIGTATPPNCVEQSSYPDYYFRITNSEHKTELKEKFKRMCEK  63

Query  260  SMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKS  439
            SMIKKRYM+LTEEILKENPNIC YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQPKS
Sbjct  64   SMIKKRYMHLTEEILKENPNICGYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKS  123

Query  440  KITHLVFCTTSGVDMPG  490
            KITHL+FCTTSGVDMPG
Sbjct  124  KITHLIFCTTSGVDMPG  140



>gb|ABL14036.1| chalcone synthase 2, partial [Astragalus mongholicus]
Length=234

 Score =   259 bits (661),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV+V E+RKAQRA+GPA  +AIGT+ P NCV+QSTYPDYYFR+TNSEH+ ELKEKF+RMC
Sbjct  1    MVSVAEIRKAQRAEGPAPFLAIGTANPSNCVEQSTYPDYYFRVTNSEHMTELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIK RYMYLTEEILKENP++C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKSRYMYLTEEILKENPSLCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHL+FCTTSGVDMPG
Sbjct  121  KSKITHLIFCTTSGVDMPG  139



>gb|ACH67480.1| chalcone synthase [Glycyrrhiza inflata]
Length=389

 Score =   264 bits (674),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV+V E+RKAQRA+GPA I+AIGT+ P NCVDQSTYPD+YF+ITNSEH  ELKEKF+RMC
Sbjct  1    MVSVAEIRKAQRAEGPANILAIGTANPPNCVDQSTYPDFYFKITNSEHKTELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENPNICAYMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHL+FCTTSGVDMPG
Sbjct  121  KSKITHLIFCTTSGVDMPG  139



>gb|AHJ80976.1| chalcone synthase [Erythranthe lewisii]
Length=390

 Score =   264 bits (674),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            M ++EE+R+AQRA+GPATI+AIGT+TP NCV QS YPD+YFRIT+SEH+ +LKEKFKRMC
Sbjct  1    MASIEEIRRAQRAEGPATILAIGTATPANCVTQSEYPDFYFRITDSEHMTDLKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKS I KRYM+LTEEILKENPN+CAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
Sbjct  61   EKSQINKRYMHLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>dbj|BAA75310.1| Chalcone synthase [Ipomoea batatas]
Length=393

 Score =   264 bits (675),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPATI+AIGT+TP NCV+QSTYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1    MVTVEEVRKAQRAEGPATILAIGTATPANCVNQSTYPDYYFRITNSEHKTELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMI KRYM+LTEEILKENP++C YMAPSLDARQDI VVEVPKLGKEAAQ AIKEWGQP
Sbjct  61   DKSMITKRYMHLTEEILKENPSVCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITH+VFCTTSGVDMPG
Sbjct  121  KSKITHVVFCTTSGVDMPG  139



>sp|P51082.1|CHSB_PEA RecName: Full=Chalcone synthase 1B; AltName: Full=Naringenin-chalcone 
synthase 1B [Pisum sativum]
 emb|CAA56317.1| naringenin-chalcone synthase [Pisum sativum]
Length=389

 Score =   264 bits (674),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTV+E+R+AQ+A+GPAT++AIGT+TP NCVDQSTYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1    MVTVDEIRQAQKAEGPATVLAIGTATPPNCVDQSTYPDYYFRITNSEHKTELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYM+LTEEILKENP++C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMHLTEEILKENPSVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHL+FCTTSGVDMPG
Sbjct  121  KSKITHLIFCTTSGVDMPG  139



>gb|ABM66532.1| chalcone synthase [Glycyrrhiza uralensis]
Length=389

 Score =   264 bits (674),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV+V E+RKAQRA+GPA I+AIGT+ P NCVDQSTYPD+YF+ITNSEH  ELKEKF+RMC
Sbjct  1    MVSVAEIRKAQRAEGPANILAIGTANPPNCVDQSTYPDFYFKITNSEHKTELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYMYLTEEILKENPNICAYMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHL+FCTTSGVDMPG
Sbjct  121  KSKITHLIFCTTSGVDMPG  139



>dbj|BAF49290.1| chalcone synthase [Clitoria ternatea]
Length=389

 Score =   264 bits (674),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV+VEE+RKAQRA GPAT++AIGT+TP NCVDQS YPDYYFRITNSEH  ELKEKFKRMC
Sbjct  1    MVSVEEIRKAQRAVGPATVLAIGTATPPNCVDQSAYPDYYFRITNSEHKTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            EKSMIKKRYM+LTEEILKENP+IC YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQ 
Sbjct  61   EKSMIKKRYMHLTEEILKENPSICEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQA  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHL+FCTTSGVDMPG
Sbjct  121  KSKITHLIFCTTSGVDMPG  139



>dbj|BAO58434.1| chalcone synthase [Vaccinium ashei]
Length=389

 Score =   264 bits (674),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKA RA+GPAT++AIGT+TP +CV+Q+TYPDYYFR+TNSEH  ELKEKF+RMC
Sbjct  1    MVTVEEVRKAMRAEGPATVLAIGTATPAHCVEQATYPDYYFRVTNSEHKAELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KS IKKRYMYLTEEILKENPN+CAYMAPSLDARQD+VVVE+PKLGKEAA KAIKEWGQP
Sbjct  61   DKSQIKKRYMYLTEEILKENPNVCAYMAPSLDARQDMVVVEIPKLGKEAAVKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|AAT75302.1| chalcone synthase [Camellia sinensis]
Length=389

 Score =   264 bits (674),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVE+V +AQRA+GPAT++AIGT+TP NCVDQSTYPDYYFRITNSEH VELKEKFKRMC
Sbjct  1    MVTVEDVWRAQRARGPATVLAIGTATPPNCVDQSTYPDYYFRITNSEHKVELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSM KKRYMYLTEEILKENP +C YMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMNKKRYMYLTEEILKENPLVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>ref|XP_002518132.1| Chalcone synthase, putative [Ricinus communis]
 gb|EEF44265.1| Chalcone synthase, putative [Ricinus communis]
Length=390

 Score =   264 bits (674),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV+V++VR+ QRA+GPAT++AIGT TP N VDQSTYPDYYFR+TNSEH  ELKEKFKRMC
Sbjct  1    MVSVQDVRRTQRAEGPATVLAIGTVTPTNSVDQSTYPDYYFRVTNSEHKTELKEKFKRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYM+LTEE+LKENPNICAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMHLTEEMLKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHLVFCTTSGVDMPG
Sbjct  121  KSKITHLVFCTTSGVDMPG  139



>gb|ACB78187.1| chalcone synthase [Senna tora]
Length=390

 Score =   264 bits (674),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MV+V E+RKAQRA+GPAT+MAIGT+TP NCVDQS YPDYYFRIT SEH+ ELKEKF+RMC
Sbjct  1    MVSVSEIRKAQRAEGPATVMAIGTATPPNCVDQSEYPDYYFRITQSEHMTELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMIKKRYM++TE+ILKENPN+CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQP
Sbjct  61   DKSMIKKRYMHVTEDILKENPNMCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITHL+FCTTSGVDMPG
Sbjct  121  KSKITHLIFCTTSGVDMPG  139



>sp|Q9MB38.1|CHS6_IPOBA RecName: Full=Chalcone synthase DII; AltName: Full=Naringenin-chalcone 
synthase DII [Ipomoea batatas]
 dbj|BAA90330.1| chalcone synthase CHS-DII [Ipomoea batatas]
Length=393

 Score =   264 bits (674),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPATI+AIGT+TP NCV+QSTYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1    MVTVEEVRKAQRAEGPATILAIGTATPANCVNQSTYPDYYFRITNSEHKTELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMI KRYM+LTEEILKENP+ C YMAPSLDARQDI VVEVPKLGKEAAQ AIKEWGQP
Sbjct  61   DKSMITKRYMHLTEEILKENPSFCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITH+VFCTTSGVDMPG
Sbjct  121  KSKITHVVFCTTSGVDMPG  139



>gb|ACT31917.1| chalcone synthase [Ipomoea batatas]
Length=393

 Score =   264 bits (674),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMC  253
            MVTVEEVRKAQRA+GPATI+AIGT+TP NCV+QSTYPDYYFRITNSEH  ELKEKF+RMC
Sbjct  1    MVTVEEVRKAQRAEGPATILAIGTATPANCVNQSTYPDYYFRITNSEHKTELKEKFQRMC  60

Query  254  EKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP  433
            +KSMI KRYM+LTEEILKENP+ C YMAPSLDARQDI VVEVPKLGKEAAQ AIKEWGQP
Sbjct  61   DKSMITKRYMHLTEEILKENPSFCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKEWGQP  120

Query  434  KSKITHLVFCTTSGVDMPG  490
            KSKITH+VFCTTSGVDMPG
Sbjct  121  KSKITHVVFCTTSGVDMPG  139



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 555143417780