BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001D09

Length=541
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009606902.1|  PREDICTED: probable WRKY transcription facto...  56.6    2e-06   Nicotiana tomentosiformis
ref|XP_009775524.1|  PREDICTED: probable WRKY transcription facto...  55.5    5e-06   Nicotiana sylvestris
ref|XP_009606903.1|  PREDICTED: probable WRKY transcription facto...  55.5    6e-06   Nicotiana tomentosiformis
ref|XP_009775525.1|  PREDICTED: probable WRKY transcription facto...  53.9    1e-05   Nicotiana sylvestris
ref|XP_009784443.1|  PREDICTED: WRKY transcription factor 1-like ...  49.3    6e-04   Nicotiana sylvestris



>ref|XP_009606902.1| PREDICTED: probable WRKY transcription factor 33 isoform X1 [Nicotiana 
tomentosiformis]
Length=615

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 71/132 (54%), Gaps = 15/132 (11%)
 Frame = +2

Query  143  LMGTPMEEGVDEGSLGKLQPKREPNNGSLESETEHKVSDELVTAEGVSGKVQKRLSPNVK  322
            +MGTP EE  +E S   LQ K +P+  +   E + K   E ++A+ VSG++QKRLSP   
Sbjct  25   IMGTPREEATNEVSSENLQRKPDPDPATNNPELKEKGRCEPISADVVSGELQKRLSPAAD  84

Query  323  AEASESSERKDGVPDKCETVPSDM-QRRQGVVNGssassqsekeksshsGIQVKDGEEVQ  499
            A+AS+S++ +   P  C+ V S++ Q  Q  ++ S                Q    E V+
Sbjct  85   AQASKSNQEETTHPSTCQDVSSNVSQSNQEDISLSKE--------------QQYQSENVR  130

Query  500  QKQGVXSDTDAA  535
            QKQG+ S+ DA+
Sbjct  131  QKQGLKSEGDAS  142



>ref|XP_009775524.1| PREDICTED: probable WRKY transcription factor 20 isoform X1 [Nicotiana 
sylvestris]
Length=555

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 46/136 (34%), Positives = 75/136 (55%), Gaps = 15/136 (11%)
 Frame = +2

Query  134  VSGLMGTPMEEGVDEGSLGKLQPK--REPNNGSLESETEHKVSDELVTAEGVSGKVQKRL  307
            +  +MGTP EE  ++     LQPK   +P+  +   E + K S E ++A+ VSG++QKRL
Sbjct  1    MYWIMGTPREEATNKVPSENLQPKPDTDPDPATNNPELKEKGSCESISADVVSGELQKRL  60

Query  308  SPNVKAEASESSERKDGVPDKCETVPSDMQRRQGVVNGssassqsekeksshsGIQVKDG  487
            SP   A+AS+S++ +   P  C+ V +++ +             S +E  S S +Q    
Sbjct  61   SPATDAQASKSNQEETTHPSTCQDVSNNVSQ-------------SNQEDISLSKVQEYQS  107

Query  488  EEVQQKQGVXSDTDAA  535
            E V+QKQG+ S+ DA+
Sbjct  108  ETVRQKQGLKSEGDAS  123



>ref|XP_009606903.1| PREDICTED: probable WRKY transcription factor 20 isoform X2 [Nicotiana 
tomentosiformis]
 ref|XP_009606904.1| PREDICTED: probable WRKY transcription factor 20 isoform X2 [Nicotiana 
tomentosiformis]
Length=590

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 70/131 (53%), Gaps = 15/131 (11%)
 Frame = +2

Query  146  MGTPMEEGVDEGSLGKLQPKREPNNGSLESETEHKVSDELVTAEGVSGKVQKRLSPNVKA  325
            MGTP EE  +E S   LQ K +P+  +   E + K   E ++A+ VSG++QKRLSP   A
Sbjct  1    MGTPREEATNEVSSENLQRKPDPDPATNNPELKEKGRCEPISADVVSGELQKRLSPAADA  60

Query  326  EASESSERKDGVPDKCETVPSDM-QRRQGVVNGssassqsekeksshsGIQVKDGEEVQQ  502
            +AS+S++ +   P  C+ V S++ Q  Q  ++ S                Q    E V+Q
Sbjct  61   QASKSNQEETTHPSTCQDVSSNVSQSNQEDISLSKE--------------QQYQSENVRQ  106

Query  503  KQGVXSDTDAA  535
            KQG+ S+ DA+
Sbjct  107  KQGLKSEGDAS  117



>ref|XP_009775525.1| PREDICTED: probable WRKY transcription factor 20 isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009775526.1| PREDICTED: probable WRKY transcription factor 20 isoform X2 [Nicotiana 
sylvestris]
Length=551

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 73/132 (55%), Gaps = 15/132 (11%)
 Frame = +2

Query  146  MGTPMEEGVDEGSLGKLQPK--REPNNGSLESETEHKVSDELVTAEGVSGKVQKRLSPNV  319
            MGTP EE  ++     LQPK   +P+  +   E + K S E ++A+ VSG++QKRLSP  
Sbjct  1    MGTPREEATNKVPSENLQPKPDTDPDPATNNPELKEKGSCESISADVVSGELQKRLSPAT  60

Query  320  KAEASESSERKDGVPDKCETVPSDMQRRQGVVNGssassqsekeksshsGIQVKDGEEVQ  499
             A+AS+S++ +   P  C+ V +++ +             S +E  S S +Q    E V+
Sbjct  61   DAQASKSNQEETTHPSTCQDVSNNVSQ-------------SNQEDISLSKVQEYQSETVR  107

Query  500  QKQGVXSDTDAA  535
            QKQG+ S+ DA+
Sbjct  108  QKQGLKSEGDAS  119



>ref|XP_009784443.1| PREDICTED: WRKY transcription factor 1-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009784444.1| PREDICTED: WRKY transcription factor 1-like isoform X1 [Nicotiana 
sylvestris]
Length=507

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/92 (33%), Positives = 59/92 (64%), Gaps = 0/92 (0%)
 Frame = +2

Query  146  MGTPMEEGVDEGSLGKLQPKREPNNGSLESETEHKVSDELVTAEGVSGKVQKRLSPNVKA  325
            MGT  E+  DE S  KLQ K++ +  +  SE++ K   E ++AE +SG++QKR+SP+   
Sbjct  1    MGTHKEDVTDEVSSEKLQRKQDLDTVTYRSESKEKGICESMSAEVISGELQKRVSPDALE  60

Query  326  EASESSERKDGVPDKCETVPSDMQRRQGVVNG  421
            ++S+S++ ++ +   C+ V  +++ ++ V+ G
Sbjct  61   KSSQSNQDENALSTTCQEVSGEVKPKKSVIEG  92



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 565229601645