BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001D08

Length=608
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAE94407.1|  WD40 repeat protein                                    340   5e-115   Ipomoea nil [qian niu]
dbj|BAE94398.1|  WD40 repeat protein                                    340   6e-114   Ipomoea nil [qian niu]
gb|ADZ24798.1|  WD40 repeat protein                                     340   1e-113   Ipomoea muricata [lilac-bell]
gb|ADZ24794.1|  WD40 repeat protein                                     339   2e-113   Ipomoea alba [moonflower]
gb|ADZ24792.1|  WD40 repeat protein                                     338   3e-113   Ipomoea tricolor [campanilla]
gb|ADZ24799.1|  WD40 repeat protein                                     338   8e-113   Ipomoea violacea [beach moonflower]
gb|ADZ24791.1|  WD40 repeat protein                                     338   8e-113   Ipomoea hochstetteri
gb|ADZ24796.1|  WD40 repeat protein                                     337   2e-112   Ipomoea trifida
gb|ADZ24790.1|  WD40 repeat protein                                     336   3e-112   Ipomoea horsfalliae [Kuhio-vine]
gb|ABW69689.1|  anthocyanin synthesis WDR regulatory protein            335   5e-112   Ipomoea purpurea
gb|ADZ24801.1|  WD40 repeat protein                                     335   1e-111   Ipomoea obscura
gb|ADZ24797.1|  WD40 repeat protein                                     334   2e-111   Stictocardia tiliifolia
dbj|BAE94396.1|  WD40 repeat protein                                    334   2e-111   Ipomoea purpurea
gb|ADZ24795.1|  WD40 repeat protein                                     334   2e-111   Ipomoea urbinei
gb|ADZ24800.1|  WD40 repeat protein                                     332   1e-110   Ipomoea quamoclit [bejuco de cipres]
gb|ADZ24793.1|  WD40 repeat protein                                     326   4e-108   Ipomoea coccinea [red morning-glory]
gb|AFP53225.1|  WDR1                                                    325   4e-108   Ipomoea purpurea
gb|AFP53019.1|  WDR1                                                    325   5e-108   Ipomoea purpurea
gb|AFP53231.1|  WDR1                                                    325   8e-108   Ipomoea purpurea
gb|AFP53223.1|  WDR1                                                    324   2e-107   Ipomoea purpurea
gb|AFP53228.1|  WDR1                                                    323   4e-107   Ipomoea purpurea
gb|AFK09335.1|  WDR1                                                    283   1e-91    Ipomoea alba [moonflower]
ref|XP_009600651.1|  PREDICTED: protein TRANSPARENT TESTA GLABRA 1      270   4e-86    
ref|XP_009782290.1|  PREDICTED: protein TRANSPARENT TESTA GLABRA 1      267   3e-85    Nicotiana sylvestris
gb|ACT35693.1|  WD-repeat protein                                       267   4e-85    Nicotiana tabacum [American tobacco]
ref|XP_006347519.1|  PREDICTED: protein TRANSPARENT TESTA GLABRA ...    261   7e-83    Solanum tuberosum [potatoes]
ref|XP_004235332.1|  PREDICTED: protein TRANSPARENT TESTA GLABRA ...    258   2e-81    Solanum lycopersicum
gb|AEF01097.1|  AN11                                                    254   5e-80    Solanum tuberosum [potatoes]
ref|XP_006347612.1|  PREDICTED: protein TRANSPARENT TESTA GLABRA ...    254   6e-80    
gb|AIP93870.1|  anthocyanin WD40 protein                                253   2e-79    Solanum melongena [aubergine]
gb|AGC31678.1|  WD40 repeat protein                                     251   5e-79    Solanum tuberosum [potatoes]
gb|AJN91103.1|  anthocyanin-related transcription factor TTG1           251   5e-79    Solanum melongena [aubergine]
ref|XP_008376821.1|  PREDICTED: protein TRANSPARENT TESTA GLABRA 1      249   4e-78    Malus domestica [apple tree]
gb|AHM88209.1|  TTG1 protein                                            249   6e-78    Malus hybrid cultivar
gb|AJB28501.1|  WD40                                                    248   7e-78    Prunus avium [gean]
ref|XP_008343816.1|  PREDICTED: protein TRANSPARENT TESTA GLABRA ...    248   1e-77    Malus domestica [apple tree]
gb|AHZ56765.1|  transcription factor WD40                               248   1e-77    Malus hybrid cultivar
ref|XP_007218262.1|  hypothetical protein PRUPE_ppa008187mg             247   3e-77    Prunus persica
gb|AFY23208.1|  transparent testa glabra 1                              246   4e-77    Rosa rugosa [Japanese rose]
ref|XP_008234637.1|  PREDICTED: protein TRANSPARENT TESTA GLABRA ...    246   5e-77    Prunus mume [ume]
ref|XP_008234636.1|  PREDICTED: protein TRANSPARENT TESTA GLABRA ...    246   5e-77    Prunus mume [ume]
gb|AJB28502.1|  WD40                                                    245   5e-77    Prunus cerasus [pie cherry]
gb|AIU98520.1|  WD40 protein                                            246   7e-77    Paeonia suffruticosa [moutan peony]
gb|ADU25044.1|  WD40 protein                                            245   9e-77    Pyrus pyrifolia [sha li]
ref|XP_009351914.1|  PREDICTED: protein TRANSPARENT TESTA GLABRA ...    245   1e-76    Pyrus x bretschneideri [bai li]
gb|AGL81358.1|  WD40 repeat protein                                     245   1e-76    Pyrus communis
ref|XP_004307911.1|  PREDICTED: protein TRANSPARENT TESTA GLABRA 1      245   1e-76    Fragaria vesca subsp. vesca
gb|ACQ65867.1|  transparent testa glabra 1                              242   3e-75    Prunus persica
gb|AEI55401.1|  TTG1                                                    241   4e-75    Rubus idaeus [European raspberry]
ref|XP_010251384.1|  PREDICTED: protein TRANSPARENT TESTA GLABRA 1      240   8e-75    Nelumbo nucifera [Indian lotus]
gb|AAC18914.1|  AN11                                                    240   1e-74    Petunia x hybrida [garden petunia]
emb|CBK62755.1|  WD-repeat protein                                      239   3e-74    Humulus lupulus [common hop]
emb|CBI23093.3|  unnamed protein product                                237   3e-74    Vitis vinifera
ref|XP_010099415.1|  Protein TRANSPARENT TESTA GLABRA 1                 238   5e-74    Morus notabilis
ref|XP_010048437.1|  PREDICTED: protein TRANSPARENT TESTA GLABRA 1      238   5e-74    Eucalyptus grandis [rose gum]
gb|AFL02466.1|  transcription factor TTG1                               238   7e-74    Fragaria x ananassa
ref|NP_001268101.1|  WD-repeat 1                                        238   7e-74    Vitis vinifera
ref|XP_004502764.1|  PREDICTED: protein TRANSPARENT TESTA GLABRA ...    238   8e-74    Cicer arietinum [garbanzo]
gb|ADQ27315.1|  truncated A2 protein                                    232   4e-73    Pisum sativum [garden pea]
gb|AJB28508.1|  WD40                                                    236   5e-73    Prunus avium [gean]
emb|CDP04984.1|  unnamed protein product                                235   1e-72    Coffea canephora [robusta coffee]
gb|ADQ27311.1|  truncated A2 protein                                    230   1e-72    Pisum sativum [garden pea]
gb|ADV40946.1|  WD40-repeat protein                                     234   3e-72    Punica granatum [granado]
gb|KDP45023.1|  hypothetical protein JCGZ_01523                         234   3e-72    Jatropha curcas
gb|AIT76564.1|  WDR protein                                             233   7e-72    Trifolium repens [creeping white clover]
gb|ADQ27310.1|  A2 protein                                              231   2e-71    Pisum sativum [garden pea]
gb|AFS65006.1|  transparent testa                                       230   5e-71    Salvia miltiorrhiza [Chinese salvia]
ref|XP_002530884.1|  WD-repeat protein, putative                        229   2e-70    
dbj|BAH28880.1|  WD40 repeats protein LjTTG1                            229   3e-70    Lotus japonicus
dbj|BAB58883.1|  putative regulatory protein in anthocyanin biosy...    228   5e-70    Perilla frutescens [beefsteak-mint]
gb|ABQ18246.1|  transcription factor WD-repeat protein 1                227   1e-69    Caragana jubata [camel's tail]
ref|XP_002318500.2|  TRANSPARENT TESTA GLABRA 1 family protein          227   2e-69    Populus trichocarpa [western balsam poplar]
ref|XP_003602392.1|  Protein TRANSPARENT TESTA GLABRA                   227   2e-69    Medicago truncatula
ref|XP_011005345.1|  PREDICTED: protein TRANSPARENT TESTA GLABRA ...    226   3e-69    Populus euphratica
ref|XP_011005348.1|  PREDICTED: protein TRANSPARENT TESTA GLABRA ...    226   4e-69    Populus euphratica
ref|XP_011075888.1|  PREDICTED: protein TRANSPARENT TESTA GLABRA 1      225   6e-69    Sesamum indicum [beniseed]
emb|CAN67365.1|  hypothetical protein VITISV_033304                     225   6e-69    Vitis vinifera
ref|XP_003523314.1|  PREDICTED: protein TRANSPARENT TESTA GLABRA ...    225   7e-69    Glycine max [soybeans]
ref|XP_007039211.1|  Transducin/WD40 repeat-like superfamily prot...    225   9e-69    
ref|XP_007136431.1|  hypothetical protein PHAVU_009G044700g             224   2e-68    Phaseolus vulgaris [French bean]
gb|AFD20562.1|  transparent testa glabra 3                              224   2e-68    Gossypium arboreum [tree cotton]
gb|AAM95645.1|  WD-repeat protein GhTTG3                                223   4e-68    Gossypium hirsutum [American cotton]
gb|AAK19614.1|AF336281_1  GHTTG1                                        223   5e-68    Gossypium hirsutum [American cotton]
ref|XP_011003289.1|  PREDICTED: protein TRANSPARENT TESTA GLABRA ...    222   1e-67    Populus euphratica
ref|XP_003526764.1|  PREDICTED: protein TRANSPARENT TESTA GLABRA ...    222   1e-67    Glycine max [soybeans]
ref|XP_010519573.1|  PREDICTED: protein TRANSPARENT TESTA GLABRA 1      219   2e-66    Tarenaya hassleriana [spider flower]
ref|XP_006288106.1|  hypothetical protein CARUB_v10001339mg             218   4e-66    Capsella rubella
gb|KDO75095.1|  hypothetical protein CISIN_1g038533mg                   218   6e-66    Citrus sinensis [apfelsine]
gb|AHJ80982.1|  WD-repeat containing protein                            217   7e-66    Erythranthe lewisii
ref|XP_006419648.1|  hypothetical protein CICLE_v10005375mg             217   1e-65    Citrus clementina [clementine]
ref|XP_006347640.1|  PREDICTED: protein TRANSPARENT TESTA GLABRA ...    217   1e-65    
dbj|BAJ33517.1|  WD-repeats transcriptional factor                      217   1e-65    Dahlia pinnata
ref|XP_010421276.1|  PREDICTED: protein TRANSPARENT TESTA GLABRA 1      216   2e-65    Camelina sativa [gold-of-pleasure]
gb|AEC11089.1|  WD40 transcription factor                               215   5e-65    Diospyros kaki [Japanese persimmon]
gb|AFM74035.1|  WD repeat family protein                                214   1e-64    Acer palmatum [Japanese maple]
gb|KJB24019.1|  hypothetical protein B456_004G125200                    214   2e-64    Gossypium raimondii
gb|KFK27728.1|  protein transparent testa glabra 1                      213   3e-64    Arabis alpina [alpine rockcress]
ref|XP_006394707.1|  hypothetical protein EUTSA_v10004515mg             213   4e-64    Eutrema salsugineum [saltwater cress]
gb|AAM95641.1|  WD-repeat protein GhTTG1                                213   5e-64    Gossypium hirsutum [American cotton]
gb|AFD20561.1|  transparent testa glabra 1                              212   9e-64    Gossypium arboreum [tree cotton]
ref|NP_197840.1|  protein TRANSPARENT TESTA GLABRA 1                    212   1e-63    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002874204.1|  hypothetical protein ARALYDRAFT_489315             212   1e-63    
gb|ACJ06978.1|  transparent testa glabra 1                              212   1e-63    Nicotiana tabacum [American tobacco]
ref|XP_004235027.1|  PREDICTED: protein TRANSPARENT TESTA GLABRA ...    212   1e-63    Solanum lycopersicum
dbj|BAD89974.1|  mutant protein of TTG1                                 211   1e-63    Arabidopsis thaliana [mouse-ear cress]
gb|AAM95642.1|  WD-repeat protein GhTTG1                                209   9e-63    Gossypium hirsutum [American cotton]
emb|CAC10524.1|  transparent testa glabra 1                             209   9e-63    Arabidopsis thaliana [mouse-ear cress]
gb|ACN58396.1|  WD40 protein                                            209   1e-62    Saussurea medusa
gb|ADP38078.1|  WD40 transcription regulator                            208   2e-62    Brassica oleracea var. botrytis [cauliflower]
gb|ADV03945.1|  WD40 regulatory factor BolC.TTG1                        208   2e-62    Brassica oleracea
gb|ABY59776.1|  WD-repeat regulatory factor                             208   3e-62    Brassica napus [oilseed rape]
ref|XP_009150977.1|  PREDICTED: protein TRANSPARENT TESTA GLABRA 1      208   3e-62    Brassica rapa
gb|ABY59775.1|  WD-repeat regulatory factor                             208   3e-62    Brassica napus [oilseed rape]
gb|ABP04014.1|  transparent testa glabra 1 isoform 2                    208   3e-62    Brassica napus [oilseed rape]
gb|AGW45475.1|  BVTTG1                                                  207   6e-62    Brassica villosa
gb|ADK11704.1|  transparent testa glabra 1                              207   7e-62    Brassica rapa subsp. rapa
ref|XP_002321353.2|  hypothetical protein POPTR_0015s00470g             206   2e-61    
emb|CAE53274.1|  transparenta testa glabra 1 protein                    205   4e-61    Matthiola incana
emb|CEL26643.1|  WD40                                                   198   5e-59    Ribes uva-crispa [English gooseberry]
emb|CEL26644.1|  WD40                                                   197   7e-59    Ribes nigrum [European black currant]
gb|EPS57104.1|  hypothetical protein M569_17720                         199   1e-58    Genlisea aurea
ref|NP_001267687.1|  protein TRANSPARENT TESTA GLABRA 1-like            187   3e-54    Cucumis sativus [cucumbers]
ref|XP_008455615.1|  PREDICTED: protein TRANSPARENT TESTA GLABRA 1      187   4e-54    Cucumis melo [Oriental melon]
ref|XP_010671335.1|  PREDICTED: protein TRANSPARENT TESTA GLABRA 1      177   5e-50    Beta vulgaris subsp. vulgaris [field beet]
gb|AFY06991.1|  TTG1                                                    176   7e-50    Beta vulgaris [beet]
ref|XP_001767313.1|  predicted protein                                  176   9e-50    
gb|ABR16505.1|  unknown                                                 176   1e-49    Picea sitchensis
ref|XP_009400480.1|  PREDICTED: protein TRANSPARENT TESTA GLABRA ...    176   3e-49    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008783532.1|  PREDICTED: protein TRANSPARENT TESTA GLABRA ...    174   5e-49    Phoenix dactylifera
ref|XP_009397632.1|  PREDICTED: protein TRANSPARENT TESTA GLABRA ...    173   1e-48    
ref|XP_008797643.1|  PREDICTED: protein TRANSPARENT TESTA GLABRA ...    172   2e-48    Phoenix dactylifera
ref|XP_001780909.1|  predicted protein                                  169   2e-47    
ref|XP_010934016.1|  PREDICTED: protein TRANSPARENT TESTA GLABRA ...    169   8e-47    Elaeis guineensis
ref|XP_006829207.1|  hypothetical protein AMTR_s00001p00271900          168   9e-47    Amborella trichopoda
gb|AIC79628.1|  WD40-repeat protein                                     167   1e-46    Ginkgo biloba [ginkgo]
ref|XP_010919075.1|  PREDICTED: protein TRANSPARENT TESTA GLABRA ...    161   3e-44    Elaeis guineensis
gb|EYU43248.1|  hypothetical protein MIMGU_mgv1a009118mg                160   7e-44    Erythranthe guttata [common monkey flower]
ref|XP_006844718.1|  hypothetical protein AMTR_s00016p00252480          160   1e-43    Amborella trichopoda
gb|AHJ80983.1|  WD-repeat containing protein                            160   1e-43    Erythranthe lewisii
gb|KHN46371.1|  WD repeat-containing protein LWD1                       159   2e-43    Glycine soja [wild soybean]
ref|XP_001774625.1|  predicted protein                                  159   2e-43    
ref|XP_003553993.1|  PREDICTED: WD repeat-containing protein LWD1...    159   3e-43    Glycine max [soybeans]
gb|AIU39032.1|  WD40 protein                                            159   4e-43    Narcissus tazetta subsp. chinensis
ref|XP_010250423.1|  PREDICTED: WD repeat-containing protein LWD1       158   6e-43    Nelumbo nucifera [Indian lotus]
gb|EYU19155.1|  hypothetical protein MIMGU_mgv1a027016mg                157   1e-42    Erythranthe guttata [common monkey flower]
ref|XP_002969454.1|  hypothetical protein SELMODRAFT_146202             157   1e-42    
ref|XP_011096638.1|  PREDICTED: WD repeat-containing protein LWD1       157   2e-42    Sesamum indicum [beniseed]
gb|AIU98519.1|  WD40 protein                                            156   3e-42    Paeonia suffruticosa [moutan peony]
gb|AHJ80984.1|  WD-repeat containing protein                            156   4e-42    Erythranthe lewisii
ref|XP_002960560.1|  hypothetical protein SELMODRAFT_270223             155   4e-42    
gb|EPS65480.1|  hypothetical protein M569_09298                         155   5e-42    Genlisea aurea
ref|XP_005642574.1|  WD40 repeat-like protein                           155   8e-42    Coccomyxa subellipsoidea C-169
ref|XP_006446863.1|  hypothetical protein CICLE_v10015815mg             155   1e-41    Citrus clementina [clementine]
ref|XP_006851474.1|  hypothetical protein AMTR_s00040p00131380          154   1e-41    Amborella trichopoda
ref|XP_006468950.1|  PREDICTED: WD repeat-containing protein LWD1...    154   1e-41    Citrus sinensis [apfelsine]
ref|XP_002512788.1|  WD-repeat protein, putative                        154   2e-41    Ricinus communis
ref|XP_009118046.1|  PREDICTED: WD repeat-containing protein LWD1       154   3e-41    Brassica rapa
gb|KDP41899.1|  hypothetical protein JCGZ_26917                         153   3e-41    Jatropha curcas
ref|XP_009404200.1|  PREDICTED: WD repeat-containing protein LWD1...    154   4e-41    Musa acuminata subsp. malaccensis [pisang utan]
gb|AIS35935.1|  WD40 repeat protein                                     153   5e-41    Phalaenopsis equestris
ref|XP_001774264.1|  predicted protein                                  153   5e-41    
ref|XP_010528111.1|  PREDICTED: WD repeat-containing protein LWD1       153   5e-41    Tarenaya hassleriana [spider flower]
emb|CDY16039.1|  BnaC08g40840D                                          153   5e-41    Brassica napus [oilseed rape]
ref|XP_011003601.1|  PREDICTED: WD repeat-containing protein LWD1       152   7e-41    Populus euphratica
ref|XP_002301564.1|  transducin family protein                          152   8e-41    Populus trichocarpa [western balsam poplar]
ref|XP_004304579.1|  PREDICTED: WD repeat-containing protein LWD1       152   8e-41    Fragaria vesca subsp. vesca
ref|XP_004238433.1|  PREDICTED: WD repeat-containing protein LWD1       152   9e-41    Solanum lycopersicum
ref|XP_004493117.1|  PREDICTED: WD repeat-containing protein LWD1...    152   9e-41    Cicer arietinum [garbanzo]
ref|XP_006342135.1|  PREDICTED: WD repeat-containing protein LWD1...    152   1e-40    Solanum tuberosum [potatoes]
ref|XP_006417175.1|  hypothetical protein EUTSA_v10008091mg             152   1e-40    Eutrema salsugineum [saltwater cress]
ref|XP_010682212.1|  PREDICTED: WD repeat-containing protein LWD1       152   2e-40    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011033708.1|  PREDICTED: WD repeat-containing protein LWD1       152   2e-40    Populus euphratica
ref|XP_007032099.1|  Transducin/WD40 repeat-like superfamily prot...    152   2e-40    
gb|AAC18912.1|  ATAN11                                                  151   2e-40    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007032098.1|  Transducin/WD40 repeat-like superfamily prot...    151   2e-40    Theobroma cacao [chocolate]
ref|XP_006304591.1|  hypothetical protein CARUB_v10011643mg             151   2e-40    Capsella rubella
ref|NP_172751.1|  protein LIGHT-REGULATED WD1                           151   2e-40    Arabidopsis thaliana [mouse-ear cress]
gb|AAM65213.1|  flower pigmentation protein ATAN11                      151   2e-40    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010494757.1|  PREDICTED: WD repeat-containing protein LWD1       151   2e-40    Camelina sativa [gold-of-pleasure]
ref|XP_002321066.1|  hypothetical protein POPTR_0014s13680g             151   2e-40    Populus trichocarpa [western balsam poplar]
ref|XP_004145624.1|  PREDICTED: WD repeat-containing protein LWD1...    150   4e-40    Cucumis sativus [cucumbers]
emb|CAE76645.1|  WD 40 protein                                          150   4e-40    Matthiola incana
ref|XP_002892720.1|  ATAN11                                             150   5e-40    Arabidopsis lyrata subsp. lyrata
gb|KJB72048.1|  hypothetical protein B456_011G155800                    150   5e-40    Gossypium raimondii
gb|AAM95643.1|  WD-repeat protein GhTTG2                                150   6e-40    Gossypium hirsutum [American cotton]
ref|XP_010476271.1|  PREDICTED: WD repeat-containing protein LWD1...    150   6e-40    Camelina sativa [gold-of-pleasure]
gb|AES80772.2|  transducin/WD-like repeat-protein                       150   6e-40    Medicago truncatula
ref|XP_006395537.1|  hypothetical protein EUTSA_v10005280mg             150   7e-40    Eutrema salsugineum [saltwater cress]
emb|CDY26600.1|  BnaA09g46770D                                          150   8e-40    Brassica napus [oilseed rape]
gb|ACA04014.1|  WD40 repeat protein                                     144   8e-40    Diplacus aurantiacus
ref|NP_001268006.1|  WD repeat 2                                        150   8e-40    Vitis vinifera
ref|XP_003078700.1|  WD-repeat protein GhTTG2 (ISS)                     149   8e-40    Ostreococcus tauri
ref|XP_009622678.1|  PREDICTED: WD repeat-containing protein LWD1       150   9e-40    Nicotiana tomentosiformis
dbj|BAE94397.1|  WD40 repeat protein                                    149   1e-39    Ipomoea purpurea
ref|XP_007161787.1|  hypothetical protein PHAVU_001G098000g             149   1e-39    Phaseolus vulgaris [French bean]
ref|XP_010514320.1|  PREDICTED: WD repeat-containing protein LWD2       149   2e-39    Camelina sativa [gold-of-pleasure]
gb|KFK33589.1|  wd repeat-containing protein lwd2                       149   2e-39    Arabis alpina [alpine rockcress]
ref|NP_189298.1|  protein LIGHT-REGULATED WD 2                          149   2e-39    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009380013.1|  PREDICTED: WD repeat-containing protein LWD1...    149   2e-39    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010425377.1|  PREDICTED: WD repeat-containing protein LWD2...    149   3e-39    Camelina sativa [gold-of-pleasure]
gb|AAO42231.1|  putative transcriptional regulator protein              148   3e-39    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002875329.1|  transducin family protein                          148   4e-39    Arabidopsis lyrata subsp. lyrata
ref|XP_003624554.1|  WD repeat protein                                  150   4e-39    
ref|XP_006291421.1|  hypothetical protein CARUB_v10017559mg             148   4e-39    Capsella rubella
gb|KFK43561.1|  wd repeat-containing protein lwd1                       148   4e-39    Arabis alpina [alpine rockcress]
gb|AHM25607.1|  WD40 repeat protein                                     147   5e-39    Ipomoea batatas [batate]
ref|XP_002507884.1|  predicted protein                                  147   7e-39    Micromonas commoda
ref|XP_001417471.1|  predicted protein                                  147   7e-39    Ostreococcus lucimarinus CCE9901
ref|XP_010458730.1|  PREDICTED: WD repeat-containing protein LWD1...    147   7e-39    Camelina sativa [gold-of-pleasure]
ref|XP_003058080.1|  predicted protein                                  146   1e-38    Micromonas pusilla CCMP1545
emb|CDP16753.1|  unnamed protein product                                146   2e-38    Coffea canephora [robusta coffee]
ref|XP_007215608.1|  hypothetical protein PRUPE_ppa007783mg             146   2e-38    Prunus persica
ref|XP_010271596.1|  PREDICTED: WD repeat-containing protein LWD1...    145   2e-38    Nelumbo nucifera [Indian lotus]
ref|XP_010507001.1|  PREDICTED: WD repeat-containing protein LWD2...    147   3e-38    
gb|AAM95646.1|  WD-repeat protein GhTTG4                                145   3e-38    Gossypium hirsutum [American cotton]
gb|KJB30089.1|  hypothetical protein B456_005G129400                    145   3e-38    Gossypium raimondii
ref|XP_009378073.1|  PREDICTED: WD repeat-containing protein LWD1       145   5e-38    Pyrus x bretschneideri [bai li]
ref|XP_005847572.1|  hypothetical protein CHLNCDRAFT_56155              145   8e-38    Chlorella variabilis
ref|XP_010929534.1|  PREDICTED: WD repeat-containing protein LWD1       145   8e-38    Elaeis guineensis
ref|XP_008387037.1|  PREDICTED: WD repeat-containing protein LWD1...    144   9e-38    
gb|AFK49516.1|  unknown                                                 144   1e-37    Medicago truncatula
ref|XP_005833209.1|  hypothetical protein GUITHDRAFT_86758              144   1e-37    Guillardia theta CCMP2712
ref|XP_009350670.1|  PREDICTED: WD repeat-containing protein LWD1...    144   1e-37    Pyrus x bretschneideri [bai li]
ref|XP_008379028.1|  PREDICTED: WD repeat-containing protein LWD1       144   1e-37    
ref|XP_008178829.1|  PREDICTED: DDB1- and CUL4-associated factor 7      144   1e-37    Acyrthosiphon pisum
gb|ADQ27313.1|  truncated A2 protein                                    137   1e-37    Pisum sativum [garden pea]
gb|KDR15607.1|  WD repeat-containing protein 68                         144   1e-37    Zootermopsis nevadensis
dbj|BAJ33518.1|  WD-repeats transcriptional factor                      144   2e-37    Dahlia pinnata
ref|XP_010942310.1|  PREDICTED: WD repeat-containing protein LWD1...    144   2e-37    
ref|XP_011049094.1|  PREDICTED: DDB1- and CUL4-associated factor 7      144   2e-37    Acromyrmex echinatior
gb|EGI68826.1|  WD repeat-containing protein 68                         144   2e-37    Acromyrmex echinatior
ref|XP_010090944.1|  WD repeat-containing protein LWD1                  144   3e-37    Morus notabilis
ref|XP_002025332.1|  GL13429                                            144   3e-37    
ref|XP_001355291.2|  GA13113                                            144   3e-37    
gb|AAK19620.1|AF336287_1  WD1521                                        142   3e-37    Gossypium hirsutum [American cotton]
ref|XP_007204870.1|  hypothetical protein PRUPE_ppa017145mg             142   3e-37    
emb|CAN66600.1|  hypothetical protein VITISV_035207                     142   5e-37    Vitis vinifera
ref|XP_004929529.1|  PREDICTED: DDB1- and CUL4-associated factor ...    142   5e-37    
ref|XP_009345155.1|  PREDICTED: WD repeat-containing protein LWD1       142   5e-37    Pyrus x bretschneideri [bai li]
ref|XP_001655183.1|  AAEL011196-PA                                      143   6e-37    
ref|XP_004303529.1|  PREDICTED: WD repeat-containing protein LWD1...    142   6e-37    Fragaria vesca subsp. vesca
gb|EFX69222.1|  hypothetical protein DAPPUDRAFT_301020                  142   6e-37    Daphnia pulex
ref|XP_008341194.1|  PREDICTED: WD repeat-containing protein LWD1...    142   6e-37    
ref|XP_002281909.1|  PREDICTED: WD repeat-containing protein LWD1       142   6e-37    Vitis vinifera
ref|XP_003570109.1|  PREDICTED: protein TRANSPARENT TESTA GLABRA 1      142   6e-37    Brachypodium distachyon [annual false brome]
ref|XP_009372526.1|  PREDICTED: WD repeat-containing protein LWD2...    142   7e-37    Pyrus x bretschneideri [bai li]
gb|EKC36908.1|  WD repeat-containing protein 68                         147   7e-37    Crassostrea gigas
ref|XP_002044542.1|  GM11725                                            140   8e-37    Drosophila sechellia
ref|XP_002599459.1|  hypothetical protein BRAFLDRAFT_58976              142   8e-37    Branchiostoma floridae
gb|ADN52336.1|  WD40-1 protein                                          142   8e-37    Pyrus pyrifolia [sha li]
ref|XP_011258161.1|  PREDICTED: DDB1- and CUL4-associated factor 7      142   8e-37    Camponotus floridanus
ref|XP_011143556.1|  PREDICTED: DDB1- and CUL4-associated factor 7      142   9e-37    
ref|XP_002594571.1|  hypothetical protein BRAFLDRAFT_264459             142   9e-37    Branchiostoma floridae
ref|XP_003706011.1|  PREDICTED: DDB1- and CUL4-associated factor 7      142   9e-37    Megachile rotundata
ref|XP_008544764.1|  PREDICTED: DDB1- and CUL4-associated factor 7      142   9e-37    
ref|XP_008197847.1|  PREDICTED: DDB1- and CUL4-associated factor ...    141   1e-36    Tribolium castaneum [rust-red flour beetle]
ref|XP_011335130.1|  PREDICTED: DDB1- and CUL4-associated factor 7      141   1e-36    Ooceraea biroi
ref|XP_008214784.1|  PREDICTED: LOW QUALITY PROTEIN: DDB1- and CU...    141   1e-36    Nasonia vitripennis
ref|XP_008797649.1|  PREDICTED: LOW QUALITY PROTEIN: WD repeat-co...    142   1e-36    Phoenix dactylifera
ref|XP_011505104.1|  PREDICTED: DDB1- and CUL4-associated factor 7      141   1e-36    Ceratosolen solmsi marchali
ref|XP_966430.2|  PREDICTED: DDB1- and CUL4-associated factor 7 i...    142   1e-36    Tribolium castaneum [rust-red flour beetle]
gb|KJB62075.1|  hypothetical protein B456_009G399800                    141   1e-36    Gossypium raimondii
ref|XP_008243507.1|  PREDICTED: WD repeat-containing protein LWD1...    141   2e-36    Prunus mume [ume]
ref|NP_608461.1|  wings apart, isoform A                                141   2e-36    Drosophila melanogaster
ref|XP_008378323.1|  PREDICTED: WD repeat-containing protein LWD1...    141   2e-36    Malus domestica [apple tree]
ref|XP_011451310.1|  PREDICTED: DDB1- and CUL4-associated factor 7      141   2e-36    Crassostrea gigas
gb|AAZ83353.1|  TTG1-like protein                                       140   2e-36    Gossypium hirsutum [American cotton]
ref|XP_001995538.1|  GH17806                                            140   2e-36    Drosophila grimshawi
ref|XP_002452749.1|  hypothetical protein SORBIDRAFT_04g031730          140   2e-36    
ref|XP_002308459.1|  hypothetical protein POPTR_0006s225601g            140   2e-36    
ref|XP_008391929.1|  PREDICTED: WD repeat-containing protein LWD2...    140   2e-36    
ref|XP_011046931.1|  PREDICTED: WD repeat-containing protein LWD1...    140   2e-36    Populus euphratica
ref|XP_002430112.1|  WD-repeat protein, putative                        140   2e-36    Pediculus humanus corporis [human body lice]
ref|XP_011208501.1|  PREDICTED: DDB1- and CUL4-associated factor 7      140   3e-36    Bactrocera dorsalis [papaya fruit fly]
ref|XP_001870751.1|  transparent testa glabra1                          140   3e-36    Culex quinquefasciatus
ref|XP_006647692.1|  PREDICTED: protein TRANSPARENT TESTA GLABRA ...    140   3e-36    Oryza brachyantha
ref|XP_004363383.1|  WD-repeat protein GhTTG1                           140   3e-36    Capsaspora owczarzaki ATCC 30864
ref|XP_010258659.1|  PREDICTED: WD repeat-containing protein LWD1...    140   3e-36    Nelumbo nucifera [Indian lotus]
gb|KHG07746.1|  WD repeat-containing LWD1 -like protein                 140   3e-36    Gossypium arboreum [tree cotton]
ref|NP_001047751.1|  Os02g0682500                                       140   4e-36    
dbj|BAG99547.1|  unnamed protein product                                140   4e-36    
ref|XP_395370.1|  PREDICTED: DDB1- and CUL4-associated factor 7-like    140   4e-36    
gb|AFN17366.1|  Tan1                                                    140   5e-36    
ref|XP_004529656.1|  PREDICTED: DDB1- and CUL4-associated factor ...    140   5e-36    
ref|XP_009012368.1|  hypothetical protein HELRODRAFT_185332             140   5e-36    
gb|EKC40240.1|  WD repeat-containing protein 68                         140   6e-36    
gb|EAY87087.1|  hypothetical protein OsI_08485                          139   7e-36    
ref|XP_003390698.1|  PREDICTED: DDB1- and CUL4-associated factor ...    134   7e-36    
ref|XP_002530536.1|  WD-repeat protein, putative                        139   7e-36    
ref|XP_001743483.1|  hypothetical protein                               139   7e-36    
ref|XP_005098200.1|  PREDICTED: DDB1- and CUL4-associated factor ...    139   8e-36    
gb|ACI33744.1|  WD repeat-containing protein 68                         139   8e-36    
gb|ETN67604.1|  transparent testa glabra1                               139   1e-35    
ref|XP_003437059.1|  AGAP000678-PB                                      139   1e-35    
ref|XP_005183334.1|  PREDICTED: DDB1- and CUL4-associated factor 7      139   1e-35    
emb|CDJ05721.1|  WD repeat containing protein 68                        139   1e-35    
ref|XP_002108036.1|  hypothetical protein TRIADDRAFT_52100              139   1e-35    
gb|KDP36194.1|  hypothetical protein JCGZ_08838                         138   1e-35    
ref|XP_008646062.1|  PREDICTED: protein TRANSPARENT TESTA GLABRA 1      139   1e-35    
ref|XP_007027837.1|  TTG1-like protein                                  138   2e-35    
emb|CDS17945.1|  WD repeat containing protein 68                        139   2e-35    
ref|XP_010770957.1|  PREDICTED: DDB1- and CUL4-associated factor ...    138   2e-35    
ref|XP_311206.3|  AGAP000678-PA                                         139   2e-35    
ref|XP_010902258.1|  PREDICTED: DDB1- and CUL4-associated factor ...    138   2e-35    
ref|XP_010872469.1|  PREDICTED: DDB1- and CUL4-associated factor ...    138   2e-35    
ref|XP_006146901.1|  PREDICTED: DDB1- and CUL4-associated factor 7      138   2e-35    
ref|XP_010902266.1|  PREDICTED: DDB1- and CUL4-associated factor ...    138   2e-35    
ref|XP_010028897.1|  PREDICTED: WD repeat-containing protein LWD1       138   2e-35    
ref|XP_011177302.1|  PREDICTED: DDB1- and CUL4-associated factor 7      138   3e-35    
ref|NP_001086790.1|  MGC82392 protein                                   137   3e-35    
ref|XP_004953461.1|  PREDICTED: protein TRANSPARENT TESTA GLABRA ...    138   3e-35    
dbj|BAM36704.1|  WD protein AN11 homolog                                137   3e-35    
ref|XP_010767373.1|  PREDICTED: DDB1- and CUL4-associated factor 7      137   3e-35    
ref|XP_002067436.1|  GK16186                                            137   3e-35    
ref|XP_005164053.1|  PREDICTED: DDB1- and CUL4-associated factor ...    137   4e-35    
ref|NP_956363.1|  DDB1- and CUL4-associated factor 7                    137   4e-35    
gb|ELR44950.1|  DDB1- and CUL4-associated factor 7                      137   4e-35    
ref|NP_989097.1|  DDB1 and CUL4 associated factor 7                     137   4e-35    
ref|XP_009034919.1|  hypothetical protein AURANDRAFT_52888              138   4e-35    
ref|XP_003222428.1|  PREDICTED: DDB1- and CUL4-associated factor 7      137   4e-35    
ref|XP_003290791.1|  hypothetical protein DICPUDRAFT_155324             137   4e-35    
ref|XP_003727070.1|  PREDICTED: DDB1- and CUL4-associated factor 7      137   5e-35    
gb|ACO08999.1|  WD repeat protein 68                                    137   5e-35    
ref|XP_002125252.1|  PREDICTED: DDB1- and CUL4-associated factor 7      137   5e-35    
ref|XP_003442033.1|  PREDICTED: DDB1- and CUL4-associated factor ...    137   5e-35    
ref|XP_006638166.1|  PREDICTED: DDB1- and CUL4-associated factor ...    137   6e-35    
ref|XP_010006395.1|  PREDICTED: DDB1- and CUL4-associated factor 7      137   6e-35    
ref|XP_002742402.1|  PREDICTED: DDB1- and CUL4-associated factor ...    137   6e-35    
ref|NP_082222.1|  DDB1- and CUL4-associated factor 7                    137   6e-35    
gb|AAH48165.1|  WD repeat domain 68                                     137   6e-35    
ref|XP_010292409.1|  PREDICTED: DDB1- and CUL4-associated factor 7      136   6e-35    
gb|KFB41910.1|  hypothetical protein ZHAS_00009471                      138   7e-35    
ref|XP_003964977.1|  PREDICTED: DDB1- and CUL4-associated factor ...    137   7e-35    
dbj|BAE32807.1|  unnamed protein product                                137   7e-35    
gb|EUB55383.1|  DDB1- and CUL4-associated factor                        139   7e-35    
gb|EHJ69229.1|  hypothetical protein KGM_12904                          137   8e-35    
ref|XP_009575952.1|  PREDICTED: DDB1- and CUL4-associated factor 7      136   9e-35    
ref|XP_001637037.1|  predicted protein                                  136   9e-35    
emb|CDW86829.1|  wd repeat-containing protein 68                        136   1e-34    
gb|KHJ94486.1|  hypothetical protein OESDEN_05582                       133   1e-34    
ref|XP_005994662.1|  PREDICTED: DDB1- and CUL4-associated factor ...    136   1e-34    
ref|XP_005760730.1|  hypothetical protein EMIHUDRAFT_459986             136   1e-34    
ref|XP_008470613.1|  PREDICTED: DDB1- and CUL4-associated factor 7      136   1e-34    
ref|XP_007910702.1|  PREDICTED: DDB1- and CUL4-associated factor 7      135   2e-34    
emb|CAE53275.1|  transparenta testa glabra 1 protein                    134   2e-34    
dbj|BAG58007.1|  unnamed protein product                                130   2e-34    
ref|XP_003746092.1|  PREDICTED: DDB1- and CUL4-associated factor 7      135   2e-34    
ref|XP_003385536.2|  PREDICTED: DDB1- and CUL4-associated factor ...    135   2e-34    
gb|ENN79188.1|  hypothetical protein YQE_04372                          137   3e-34    
ref|XP_009373032.1|  PREDICTED: WD repeat-containing protein LWD2...    135   3e-34    
ref|XP_005402263.1|  PREDICTED: DDB1- and CUL4-associated factor ...    136   3e-34    
emb|CBN74989.1|  conserved unknown protein                              136   3e-34    
emb|CDJ90385.1|  WD40 repeat domain containing protein                  135   5e-34    
ref|XP_010749608.1|  PREDICTED: DDB1- and CUL4-associated factor ...    134   6e-34    
emb|CDJ88194.1|  WD40 repeat domain containing protein                  135   6e-34    
ref|XP_004339158.1|  WD40 repeat protein                                134   6e-34    
ref|XP_008569378.1|  PREDICTED: DDB1- and CUL4-associated factor 7      135   7e-34    
gb|KFU83683.1|  DDB1- and CUL4-associated factor 7                      129   8e-34    
dbj|BAK06996.1|  predicted protein                                      134   9e-34    
gb|KFQ81900.1|  DDB1- and CUL4-associated factor 7                      128   9e-34    
gb|KFO62816.1|  DDB1- and CUL4-associated factor 7                      129   9e-34    
gb|EYB92774.1|  hypothetical protein Y032_0190g1259                     132   1e-33    
gb|EYB92775.1|  hypothetical protein Y032_0190g1259                     132   1e-33    
ref|XP_011399935.1|  WD repeat-containing protein LWD1                  131   2e-33    
ref|XP_009066885.1|  hypothetical protein LOTGIDRAFT_223290             133   2e-33    
gb|EWM28258.1|  ddb1 and cul4-associated factor 7                       133   2e-33    
gb|EMC78395.1|  WD repeat-containing protein 68                         132   3e-33    
ref|XP_005513614.1|  PREDICTED: LOW QUALITY PROTEIN: DDB1- and CU...    132   3e-33    
ref|XP_002182056.1|  predicted protein                                  132   3e-33    
gb|EGT42537.1|  hypothetical protein CAEBREN_30690                      134   3e-33    
ref|XP_001695930.1|  hypothetical protein CHLREDRAFT_130509             132   3e-33    
ref|XP_003458791.1|  PREDICTED: DDB1- and CUL4-associated factor ...    132   4e-33    
gb|ELW67514.1|  DDB1- and CUL4-associated factor 7                      131   4e-33    
dbj|GAA49618.1|  WD repeat-containing protein 68                        132   4e-33    
ref|XP_009079048.1|  PREDICTED: DDB1- and CUL4-associated factor 7      132   4e-33    
ref|XP_643620.2|  WD40 repeat-containing protein                        131   4e-33    
gb|KDD75065.1|  hypothetical protein H632_c893p0                        131   5e-33    
gb|ELU01587.1|  hypothetical protein CAPTEDRAFT_158276                  132   5e-33    
ref|XP_002950453.1|  hypothetical protein VOLCADRAFT_81071              132   6e-33    
ref|XP_003110630.1|  CRE-SWAN-2 protein                                 133   6e-33    
gb|KFP71137.1|  DDB1- and CUL4-associated factor 7                      125   7e-33    
ref|XP_009163668.1|  hypothetical protein T265_01378                    131   8e-33    
ref|XP_010059511.1|  PREDICTED: WD repeat-containing protein LWD2...    131   9e-33    
ref|XP_004993214.1|  prov protein                                       131   1e-32    
emb|CDS26702.1|  WD repeat containing protein 68                        134   2e-32    
ref|NP_506417.1|  Protein SWAN-2                                        132   2e-32    
ref|XP_002322814.1|  hypothetical protein POPTR_0016s07660g             130   2e-32    
ref|XP_005429968.1|  PREDICTED: DDB1- and CUL4-associated factor 7      129   2e-32    
emb|CAI44720.1|  transparent testa glabra 1 protein                     128   2e-32    
ref|XP_001901920.1|  hypothetical protein Bm1_52260                     130   2e-32    
ref|NP_001169326.1|  WD40 repeat protein                                131   2e-32    
ref|XP_004350824.1|  WD40 repeat-containing protein                     130   2e-32    
emb|CDP96352.1|  Protein BM-SWAN-2, isoform b                           130   2e-32    
gb|AAW25636.1|  SJCHGC09369 protein                                     130   2e-32    
ref|XP_011004696.1|  PREDICTED: WD repeat-containing protein LWD1...    129   3e-32    
emb|CCD78129.1|  putative wd-repeat protein                             130   3e-32    
emb|CAI44719.1|  transparent testa glabra 1 protein                     127   4e-32    
ref|XP_002635236.1|  C. briggsae CBR-SWAN-2 protein                     130   4e-32    
gb|KHJ40747.1|  WD repeat-containing protein LWD1 family protein        129   5e-32    
gb|KGB34308.1|  DDB1- and CUL4-associated factor 7                      129   8e-32    
ref|XP_002413052.1|  WD-repeat protein, putative                        128   1e-31    
gb|EJD76495.1|  WD domain-containing protein                            128   1e-31    
gb|EJW82872.1|  hypothetical protein WUBG_06217                         129   1e-31    
gb|KIH64199.1|  WD domain, G-beta repeat protein                        132   1e-31    
ref|XP_007162927.1|  hypothetical protein PHAVU_001G192200g             127   2e-31    
ref|XP_003379241.1|  WD repeat-containing protein 68                    127   2e-31    
gb|AIF70438.1|  WD40-repeat protein                                     126   4e-31    
ref|XP_003575047.1|  PREDICTED: WD repeat-containing protein LWD1       127   5e-31    
ref|XP_002453914.1|  hypothetical protein SORBIDRAFT_04g021350          127   5e-31    
ref|XP_002668349.1|  predicted protein                                  123   2e-30    
gb|ETN82271.1|  WD domain, G-beta repeat protein                        128   2e-30    
emb|CEF63060.1|  LD15927p                                               125   3e-30    
gb|EJK74659.1|  hypothetical protein THAOC_03653                        125   3e-30    
gb|EJY86751.1|  hypothetical protein OXYTRI_09948                       123   4e-30    
dbj|BAD25387.1|  putative WD40 repeat protein                           124   5e-30    
gb|KDO70497.1|  hypothetical protein CISIN_1g040307mg                   123   6e-30    
ref|XP_006430142.1|  hypothetical protein CICLE_v10013531mg             123   6e-30    
ref|NP_001046989.2|  Os02g0524600                                       124   8e-30    
gb|EMS50433.1|  WD repeat-containing protein LWD1                       125   1e-29    
gb|KHN82871.1|  DDB1- and CUL4-associated factor 7                      123   2e-29    
ref|XP_005717623.1|  WD repeat-containing protein                       122   3e-29    
ref|XP_002293429.1|  hypothetical protein THAPSDRAFT_42258              121   5e-29    
ref|XP_006481730.1|  PREDICTED: WD repeat-containing protein LWD1...    120   6e-29    
gb|ERG80199.1|  ddb1- and cul4-associated factor 7                      124   8e-29    
ref|XP_002668339.1|  predicted protein                                  120   1e-28    
emb|CDW52031.1|  DDB1 and CUL4 associated factor 7                      117   1e-27    
gb|KFW04821.1|  DDB1- and CUL4-associated factor 7                      113   1e-27    
ref|XP_009908843.1|  PREDICTED: DDB1- and CUL4-associated factor 7      116   2e-27    
ref|XP_001115603.2|  PREDICTED: DDB1- and CUL4-associated factor ...    111   4e-27    
emb|CBY41912.1|  unnamed protein product                                112   6e-27    
ref|XP_005496203.1|  PREDICTED: DDB1- and CUL4-associated factor 7      113   2e-26    
ref|XP_010190696.1|  PREDICTED: DDB1- and CUL4-associated factor 7      113   2e-26    
ref|XP_009808856.1|  PREDICTED: DDB1- and CUL4-associated factor 7      114   2e-26    
ref|XP_003768537.1|  PREDICTED: DDB1- and CUL4-associated factor 7      114   2e-26    
gb|EYU45320.1|  hypothetical protein MIMGU_mgv1a0215351mg               107   4e-26    
gb|EAR95251.2|  DDB1- and CUL4-associated factor 7                      112   5e-26    
ref|XP_008052539.1|  PREDICTED: LOW QUALITY PROTEIN: DDB1- and CU...    112   5e-26    
emb|CBY21700.1|  unnamed protein product                                112   6e-26    
ref|XP_005439534.1|  PREDICTED: DDB1- and CUL4-associated factor 7      112   6e-26    
emb|CBI30333.3|  unnamed protein product                                112   7e-26    
ref|XP_010412340.1|  PREDICTED: DDB1- and CUL4-associated factor 7      112   7e-26    
ref|XP_009318730.1|  PREDICTED: DDB1- and CUL4-associated factor 7      112   7e-26    
ref|XP_005029368.1|  PREDICTED: DDB1- and CUL4-associated factor 7      111   8e-26    
gb|KFO18056.1|  DDB1- and CUL4-associated factor 7                      111   8e-26    
gb|EFB27251.1|  hypothetical protein PANDA_013944                       111   8e-26    
ref|XP_011229736.1|  PREDICTED: DDB1- and CUL4-associated factor 7      111   8e-26    
ref|XP_008941256.1|  PREDICTED: DDB1- and CUL4-associated factor 7      111   8e-26    
ref|XP_009286218.1|  PREDICTED: DDB1- and CUL4-associated factor 7      111   8e-26    
ref|XP_007088313.1|  PREDICTED: DDB1- and CUL4-associated factor ...    111   8e-26    
ref|XP_007062055.1|  PREDICTED: DDB1- and CUL4-associated factor 7      111   8e-26    
ref|XP_010022964.1|  PREDICTED: DDB1- and CUL4-associated factor 7      111   8e-26    
ref|XP_009943080.1|  PREDICTED: DDB1- and CUL4-associated factor 7      111   9e-26    
ref|XP_009460267.1|  PREDICTED: DDB1- and CUL4-associated factor 7      112   9e-26    
ref|XP_006125852.1|  PREDICTED: DDB1- and CUL4-associated factor 7      112   1e-25    
ref|XP_009674249.1|  PREDICTED: DDB1- and CUL4-associated factor 7      111   1e-25    
ref|XP_006648680.1|  PREDICTED: WD repeat-containing protein LWD1...    110   3e-25    
ref|XP_005140807.1|  PREDICTED: DDB1- and CUL4-associated factor 7      110   4e-25    
emb|CDJ95107.1|  WD40 repeat domain containing protein                  110   4e-25    
ref|XP_008780756.1|  PREDICTED: WD repeat-containing protein LWD1...    106   4e-25    
gb|KIX07549.1|  hypothetical protein Z518_02202                         112   5e-25    
gb|ERE69252.1|  potassium voltage-gated channel subfamily H membe...    113   7e-25    
ref|XP_008516540.1|  PREDICTED: DDB1- and CUL4-associated factor 7      108   1e-24    
gb|KFP49020.1|  DDB1- and CUL4-associated factor 7                      103   1e-24    
ref|XP_001821221.2|  WD repeat protein                                  110   1e-24    
gb|KFP44694.1|  DDB1- and CUL4-associated factor 7                      103   1e-24    
gb|KFO04689.1|  DDB1- and CUL4-associated factor 7                      103   1e-24    
ref|XP_007296614.1|  WD domain-containing protein                       110   3e-24    
gb|KDO27661.1|  hypothetical protein SPRG_07291                         107   3e-24    
gb|EZF28713.1|  hypothetical protein H101_07607                         108   3e-24    
gb|EQL29508.1|  hypothetical protein BDFG_07879                         109   4e-24    
gb|EYB92772.1|  hypothetical protein Y032_0190g1257                     107   4e-24    
gb|KIN02287.1|  hypothetical protein OIDMADRAFT_197403                  110   4e-24    
gb|KEF63049.1|  hypothetical protein A1O9_01025                         110   4e-24    
ref|XP_005463944.1|  PREDICTED: DDB1- and CUL4-associated factor ...    106   4e-24    
ref|XP_002629256.1|  WD repeat protein                                  109   6e-24    
ref|XP_002999263.1|  WD domain-containing protein, putative             106   7e-24    
gb|EEQ85715.1|  WD repeat protein                                       109   7e-24    
gb|EGE83144.1|  WD repeat protein                                       109   8e-24    
ref|XP_004032250.1|  WD repeat protein                                  109   8e-24    
ref|XP_003021631.1|  hypothetical protein TRV_04261                     108   9e-24    
ref|XP_003015626.1|  hypothetical protein ARB_05937                     108   9e-24    
gb|KIW71873.1|  hypothetical protein PV04_00102                         108   9e-24    
ref|XP_003233626.1|  WD repeat protein                                  108   1e-23    
ref|XP_010758727.1|  hypothetical protein PADG_03091                    108   1e-23    
gb|EEH18093.1|  hypothetical protein PABG_00656                         108   1e-23    
ref|XP_008608133.1|  hypothetical protein SDRG_04247                    106   1e-23    
ref|XP_002794664.1|  transparent testa glabra 1                         108   1e-23    
gb|EGD94188.1|  WD repeat protein                                       108   1e-23    
gb|EEH41646.2|  transparent testa glabra 1                              108   1e-23    
gb|EZF75707.1|  hypothetical protein H105_02887                         108   1e-23    
gb|KDB26071.1|  hypothetical protein H109_02078                         108   1e-23    
gb|EZG07931.1|  hypothetical protein H106_02710                         108   1e-23    
gb|KIV77572.1|  hypothetical protein PV11_09362                         108   1e-23    
ref|XP_003774978.1|  PREDICTED: DDB1- and CUL4-associated factor ...    106   1e-23    
ref|XP_003169498.1|  WD repeat-containing protein                       108   1e-23    
ref|XP_002849740.1|  WD repeat protein                                  108   1e-23    
ref|XP_008724218.1|  hypothetical protein G647_10004                    108   1e-23    
gb|EEH07086.1|  WD domain-containing protein                            107   2e-23    
ref|XP_001015496.1|  conserved hypothetical protein                     105   2e-23    
gb|EER45225.1|  WD40 domain-containing protein                          107   2e-23    



>dbj|BAE94407.1| WD40 repeat protein [Ipomoea nil]
Length=246

 Score =   340 bits (871),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 163/163 (100%), Positives = 163/163 (100%), Gaps = 0/163 (0%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL
Sbjct  1    MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  60

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  477
            SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE
Sbjct  61   SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  120

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD
Sbjct  121  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  163



>dbj|BAE94398.1| WD40 repeat protein [Ipomoea nil]
 dbj|BAE94401.1| WD40 repeat protein [Ipomoea nil]
 dbj|BAE94404.1| WD40 repeat protein [Ipomoea nil]
Length=343

 Score =   340 bits (873),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 163/163 (100%), Positives = 163/163 (100%), Gaps = 0/163 (0%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL
Sbjct  1    MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  60

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  477
            SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE
Sbjct  61   SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  120

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD
Sbjct  121  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  163



>gb|ADZ24798.1| WD40 repeat protein [Ipomoea muricata]
Length=343

 Score =   340 bits (872),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 162/163 (99%), Positives = 163/163 (100%), Gaps = 0/163 (0%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL
Sbjct  1    MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  60

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  477
            SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE
Sbjct  61   SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  120

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            P+STLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD
Sbjct  121  PISTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  163



>gb|ADZ24794.1| WD40 repeat protein [Ipomoea alba]
Length=343

 Score =   339 bits (870),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 162/163 (99%), Positives = 163/163 (100%), Gaps = 0/163 (0%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MENSTQGSNLRSENSV+YESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL
Sbjct  1    MENSTQGSNLRSENSVSYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  60

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  477
            SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE
Sbjct  61   SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  120

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD
Sbjct  121  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  163



>gb|ADZ24792.1| WD40 repeat protein [Ipomoea tricolor]
Length=343

 Score =   338 bits (868),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 162/163 (99%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL
Sbjct  1    MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  60

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  477
            SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKS DLLVSSGDYLRLWEVREASIE
Sbjct  61   SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSTDLLVSSGDYLRLWEVREASIE  120

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD
Sbjct  121  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  163



>gb|ADZ24799.1| WD40 repeat protein [Ipomoea violacea]
Length=343

 Score =   338 bits (866),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 162/163 (99%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            M NSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL
Sbjct  1    MVNSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  60

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  477
            SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE
Sbjct  61   SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  120

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD
Sbjct  121  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  163



>gb|ADZ24791.1| WD40 repeat protein [Ipomoea hochstetteri]
Length=343

 Score =   338 bits (866),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 161/163 (99%), Positives = 163/163 (100%), Gaps = 0/163 (0%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL
Sbjct  1    MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  60

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  477
            SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNP+ASMKS+DLLVSSGDYLRLWEVREASIE
Sbjct  61   SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPSASMKSSDLLVSSGDYLRLWEVREASIE  120

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD
Sbjct  121  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  163



>gb|ADZ24796.1| WD40 repeat protein [Ipomoea trifida]
 gb|AFV33953.1| WD40 repeat protein [Ipomoea batatas]
Length=343

 Score =   337 bits (864),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 161/163 (99%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MENSTQGSNLRSENSVTYESPYPIFAMAVSSFA AHHGLRRRSVAVGSFLEEYKNRVEIL
Sbjct  1    MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAGAHHGLRRRSVAVGSFLEEYKNRVEIL  60

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  477
            SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKS DLLVSSGDYLRLWEVREASIE
Sbjct  61   SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSTDLLVSSGDYLRLWEVREASIE  120

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD
Sbjct  121  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  163



>gb|ADZ24790.1| WD40 repeat protein [Ipomoea horsfalliae]
Length=343

 Score =   336 bits (862),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 161/163 (99%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            M NSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSF EEYKNRVEIL
Sbjct  1    MVNSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFFEEYKNRVEIL  60

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  477
            SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE
Sbjct  61   SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  120

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD
Sbjct  121  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  163



>gb|ABW69689.1| anthocyanin synthesis WDR regulatory protein [Ipomoea purpurea]
 gb|ABW69690.1| anthocyanin synthesis WDR regulatory protein [Ipomoea purpurea]
Length=343

 Score =   335 bits (860),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 161/163 (99%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            M NSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEY NRVEIL
Sbjct  1    MVNSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYNNRVEIL  60

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  477
            SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE
Sbjct  61   SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  120

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD
Sbjct  121  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  163



>gb|ADZ24801.1| WD40 repeat protein [Ipomoea obscura]
Length=343

 Score =   335 bits (858),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 159/163 (98%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            M NSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL
Sbjct  1    MVNSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  60

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  477
            SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTA+MK+ADLLVSSGDYLRLW+VREASIE
Sbjct  61   SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTAAMKAADLLVSSGDYLRLWDVREASIE  120

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD
Sbjct  121  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  163



>gb|ADZ24797.1| WD40 repeat protein [Stictocardia tiliifolia]
Length=343

 Score =   334 bits (857),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 159/163 (98%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            M NSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL
Sbjct  1    MVNSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  60

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  477
            SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTA+MKSADLL+SSGDYLRLWEVREASIE
Sbjct  61   SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTAAMKSADLLLSSGDYLRLWEVREASIE  120

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            P+STLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD
Sbjct  121  PLSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  163



>dbj|BAE94396.1| WD40 repeat protein [Ipomoea purpurea]
Length=343

 Score =   334 bits (856),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 160/163 (98%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            M NSTQGSNLRSENSVTYESPYPIFAMAVSSFAA+HHGLRRRSVAVGSFLEEY NRVEIL
Sbjct  1    MVNSTQGSNLRSENSVTYESPYPIFAMAVSSFAASHHGLRRRSVAVGSFLEEYNNRVEIL  60

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  477
            SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE
Sbjct  61   SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  120

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD
Sbjct  121  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  163



>gb|ADZ24795.1| WD40 repeat protein [Ipomoea urbinei]
Length=344

 Score =   334 bits (856),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 162/164 (99%), Positives = 162/164 (99%), Gaps = 1/164 (1%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFA-AAHHGLRRRSVAVGSFLEEYKNRVEI  294
            MENSTQGSNLRSENSVTYESPYPIFAMAVSSFA AAHHGLRRRSVAVGSFLEEYKNRVEI
Sbjct  1    MENSTQGSNLRSENSVTYESPYPIFAMAVSSFASAAHHGLRRRSVAVGSFLEEYKNRVEI  60

Query  295  LSFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASI  474
            LSFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKS DLLVSSGDYLRLWEVREASI
Sbjct  61   LSFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSTDLLVSSGDYLRLWEVREASI  120

Query  475  EPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            EPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD
Sbjct  121  EPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  164



>gb|ADZ24800.1| WD40 repeat protein [Ipomoea quamoclit]
Length=344

 Score =   332 bits (852),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 161/164 (98%), Positives = 161/164 (98%), Gaps = 1/164 (1%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAA-HHGLRRRSVAVGSFLEEYKNRVEI  294
            MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAA HHGLRRRSVAVGSFLEEYKNRVEI
Sbjct  1    MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAAHHGLRRRSVAVGSFLEEYKNRVEI  60

Query  295  LSFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASI  474
            LSFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNP ASMKS DLLVSSGDYLRLWEVREASI
Sbjct  61   LSFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPAASMKSTDLLVSSGDYLRLWEVREASI  120

Query  475  EPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            EPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD
Sbjct  121  EPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  164



>gb|ADZ24793.1| WD40 repeat protein [Ipomoea coccinea]
Length=344

 Score =   326 bits (835),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 158/164 (96%), Positives = 159/164 (97%), Gaps = 1/164 (1%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAA-HHGLRRRSVAVGSFLEEYKNRVEI  294
            M NSTQGSNLRSENSVTYESPYPIFAMAVSSFAAA HHGLRRRSVAVGSFLEEYKNRVEI
Sbjct  1    MVNSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAAHHGLRRRSVAVGSFLEEYKNRVEI  60

Query  295  LSFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASI  474
            LSFEEDTVTLK NPGL FDHPYPPTKLMFHPNPTASMKS DLLVSSGDYLRLWE+REASI
Sbjct  61   LSFEEDTVTLKPNPGLVFDHPYPPTKLMFHPNPTASMKSTDLLVSSGDYLRLWELREASI  120

Query  475  EPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            EPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD
Sbjct  121  EPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  164



>gb|AFP53225.1| WDR1, partial [Ipomoea purpurea]
 gb|AFP53226.1| WDR1, partial [Ipomoea purpurea]
Length=337

 Score =   325 bits (834),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 156/157 (99%), Positives = 156/157 (99%), Gaps = 0/157 (0%)
 Frame = +1

Query  136  GSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDT  315
            GSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEY NRVEILSFEEDT
Sbjct  1    GSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYNNRVEILSFEEDT  60

Query  316  VTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEPVSTLN  495
            VTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEPVSTLN
Sbjct  61   VTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEPVSTLN  120

Query  496  NSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            NSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD
Sbjct  121  NSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  157



>gb|AFP53019.1| WDR1, partial [Ipomoea purpurea]
 gb|AFP53020.1| WDR1, partial [Ipomoea purpurea]
 gb|AFP53021.1| WDR1, partial [Ipomoea purpurea]
 gb|AFP53022.1| WDR1, partial [Ipomoea purpurea]
 gb|AFP53023.1| WDR1, partial [Ipomoea purpurea]
 gb|AFP53024.1| WDR1, partial [Ipomoea purpurea]
 gb|AFP53025.1| WDR1, partial [Ipomoea purpurea]
 gb|AFP53026.1| WDR1, partial [Ipomoea purpurea]
 gb|AFP53212.1| WDR1, partial [Ipomoea purpurea]
 gb|AFP53213.1| WDR1, partial [Ipomoea purpurea]
 gb|AFP53214.1| WDR1, partial [Ipomoea purpurea]
 gb|AFP53215.1| WDR1, partial [Ipomoea purpurea]
 gb|AFP53216.1| WDR1, partial [Ipomoea purpurea]
 gb|AFP53217.1| WDR1, partial [Ipomoea purpurea]
 gb|AFP53218.1| WDR1, partial [Ipomoea purpurea]
 gb|AFP53219.1| WDR1, partial [Ipomoea purpurea]
 gb|AFP53220.1| WDR1, partial [Ipomoea purpurea]
 gb|AFP53221.1| WDR1, partial [Ipomoea purpurea]
 gb|AFP53222.1| WDR1, partial [Ipomoea purpurea]
 gb|AFP53224.1| WDR1, partial [Ipomoea purpurea]
 gb|AFP53227.1| WDR1, partial [Ipomoea purpurea]
 gb|AFP53229.1| WDR1, partial [Ipomoea purpurea]
 gb|AFP53230.1| WDR1, partial [Ipomoea purpurea]
 gb|AFP53232.1| WDR1, partial [Ipomoea purpurea]
 gb|AFP53233.1| WDR1, partial [Ipomoea purpurea]
 gb|AFP53234.1| WDR1, partial [Ipomoea purpurea]
 gb|AFP53235.1| WDR1, partial [Ipomoea purpurea]
 gb|AFP53236.1| WDR1, partial [Ipomoea purpurea]
 gb|AFP53237.1| WDR1, partial [Ipomoea purpurea]
 gb|AFP53238.1| WDR1, partial [Ipomoea purpurea]
 gb|AFP53239.1| WDR1, partial [Ipomoea purpurea]
 gb|AFP53240.1| WDR1, partial [Ipomoea purpurea]
 gb|AFP53241.1| WDR1, partial [Ipomoea purpurea]
 gb|AFP53242.1| WDR1, partial [Ipomoea purpurea]
 gb|AFP53243.1| WDR1, partial [Ipomoea purpurea]
 gb|AFP53244.1| WDR1, partial [Ipomoea purpurea]
 gb|AFP53246.1| WDR1, partial [Ipomoea purpurea]
 gb|AFP53247.1| WDR1, partial [Ipomoea purpurea]
Length=337

 Score =   325 bits (834),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 156/157 (99%), Positives = 156/157 (99%), Gaps = 0/157 (0%)
 Frame = +1

Query  136  GSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDT  315
            GSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEY NRVEILSFEEDT
Sbjct  1    GSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYNNRVEILSFEEDT  60

Query  316  VTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEPVSTLN  495
            VTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEPVSTLN
Sbjct  61   VTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEPVSTLN  120

Query  496  NSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            NSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD
Sbjct  121  NSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  157



>gb|AFP53231.1| WDR1, partial [Ipomoea purpurea]
Length=337

 Score =   325 bits (832),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 155/157 (99%), Positives = 156/157 (99%), Gaps = 0/157 (0%)
 Frame = +1

Query  136  GSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDT  315
            GSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEY NRVEILSFEEDT
Sbjct  1    GSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYNNRVEILSFEEDT  60

Query  316  VTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEPVSTLN  495
            VTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEP+STLN
Sbjct  61   VTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEPISTLN  120

Query  496  NSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            NSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD
Sbjct  121  NSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  157



>gb|AFP53223.1| WDR1, partial [Ipomoea purpurea]
 gb|AFP53245.1| WDR1, partial [Ipomoea purpurea]
Length=337

 Score =   324 bits (830),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 155/157 (99%), Positives = 156/157 (99%), Gaps = 0/157 (0%)
 Frame = +1

Query  136  GSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDT  315
            GSNLRSENSVTYESPYPIFAMAVSSF+AAHHGLRRRSVAVGSFLEEY NRVEILSFEEDT
Sbjct  1    GSNLRSENSVTYESPYPIFAMAVSSFSAAHHGLRRRSVAVGSFLEEYNNRVEILSFEEDT  60

Query  316  VTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEPVSTLN  495
            VTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEPVSTLN
Sbjct  61   VTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEPVSTLN  120

Query  496  NSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            NSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD
Sbjct  121  NSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  157



>gb|AFP53228.1| WDR1, partial [Ipomoea purpurea]
Length=337

 Score =   323 bits (828),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 154/157 (98%), Positives = 155/157 (99%), Gaps = 0/157 (0%)
 Frame = +1

Query  136  GSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDT  315
            GSNLRSENSVTYESPYPIFAMAVSSFAA HHGLRRRSVAVGSFLEEY NRVEILSFEEDT
Sbjct  1    GSNLRSENSVTYESPYPIFAMAVSSFAATHHGLRRRSVAVGSFLEEYNNRVEILSFEEDT  60

Query  316  VTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEPVSTLN  495
            VTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEP+STLN
Sbjct  61   VTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEPISTLN  120

Query  496  NSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            NSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD
Sbjct  121  NSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  157



>gb|AFK09335.1| WDR1, partial [Ipomoea alba]
Length=315

 Score =   283 bits (724),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/135 (100%), Positives = 135/135 (100%), Gaps = 0/135 (0%)
 Frame = +1

Query  202  VSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDTVTLKTNPGLAFDHPYPPTKLMF  381
            VSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDTVTLKTNPGLAFDHPYPPTKLMF
Sbjct  1    VSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDTVTLKTNPGLAFDHPYPPTKLMF  60

Query  382  HPNPTASMKSADLLVSSGDYLRLWEVREASIEPVSTLNNSKTSEYCAPLTSFDWNEVEPR  561
            HPNPTASMKSADLLVSSGDYLRLWEVREASIEPVSTLNNSKTSEYCAPLTSFDWNEVEPR
Sbjct  61   HPNPTASMKSADLLVSSGDYLRLWEVREASIEPVSTLNNSKTSEYCAPLTSFDWNEVEPR  120

Query  562  RIGTSSIDTTCTIWD  606
            RIGTSSIDTTCTIWD
Sbjct  121  RIGTSSIDTTCTIWD  135



>ref|XP_009600651.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1 [Nicotiana tomentosiformis]
 gb|ACN87316.1| transparent testa glabra 2 [Nicotiana tabacum]
Length=342

 Score =   270 bits (689),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 128/163 (79%), Positives = 146/163 (90%), Gaps = 1/163 (1%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MENS+Q S+LRSENSVTY+S YPI+AMA SSF +  H  RRR +AVGSF+EE+ NRV+IL
Sbjct  1    MENSSQESHLRSENSVTYDSSYPIYAMAFSSFTSPLHN-RRRRIAVGSFIEEFNNRVDIL  59

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  477
            SF+E+T+TL   P L+FDHPYPPTKLMFHPNP+AS+KS D+L SSGDYLRLWEVRE+SIE
Sbjct  60   SFDEETLTLNPIPNLSFDHPYPPTKLMFHPNPSASLKSNDILASSGDYLRLWEVRESSIE  119

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            P+ TLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD
Sbjct  120  PLFTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  162



>ref|XP_009782290.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1 [Nicotiana sylvestris]
Length=342

 Score =   267 bits (683),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 145/163 (89%), Gaps = 1/163 (1%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MENS+Q S LRSENSVTY+S YPI+AMA SSF +  H  RRR +AVGSF+EE+ NRV+IL
Sbjct  1    MENSSQESRLRSENSVTYDSSYPIYAMAFSSFTSPLHN-RRRRIAVGSFIEEFNNRVDIL  59

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  477
            SF+E+T+TL   P L+FDHPYPPTKLMFHPNP+AS+KS D+L SSGDYLRLWEVRE+SIE
Sbjct  60   SFDEETLTLNPIPNLSFDHPYPPTKLMFHPNPSASLKSNDILASSGDYLRLWEVRESSIE  119

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            P+ TLNNSKTSEYCAPLTSFDWNE+EP+RIGTSSIDTTCTIWD
Sbjct  120  PLFTLNNSKTSEYCAPLTSFDWNEIEPKRIGTSSIDTTCTIWD  162



>gb|ACT35693.1| WD-repeat protein [Nicotiana tabacum]
Length=342

 Score =   267 bits (682),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 145/163 (89%), Gaps = 1/163 (1%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MENS+Q S LRSENSVTY+S YPI+AMA SSF +  H  RRR +AVGSF+EE+ NRV+IL
Sbjct  1    MENSSQESRLRSENSVTYDSSYPIYAMAFSSFTSPLHN-RRRRIAVGSFIEEFNNRVDIL  59

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  477
            SF+E+T+TL   P L+FDHPYPPTKLMFHPNP+AS+KS D+L SSGDYLRLWEVRE+SIE
Sbjct  60   SFDEETLTLNPIPNLSFDHPYPPTKLMFHPNPSASLKSNDILASSGDYLRLWEVRESSIE  119

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            P+ TLNNSKTSEYCAPLTSFDWNE+EP+RIGTSSIDTTCTIWD
Sbjct  120  PLFTLNNSKTSEYCAPLTSFDWNEIEPKRIGTSSIDTTCTIWD  162



>ref|XP_006347519.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1-like isoform X1 
[Solanum tuberosum]
 ref|XP_006347520.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1-like isoform X2 
[Solanum tuberosum]
Length=342

 Score =   261 bits (667),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 146/163 (90%), Gaps = 1/163 (1%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MENS+Q S+LRSENSVTY+S YPI+AMA SSF ++    RRR +AVGSF+EE+ NRV+IL
Sbjct  1    MENSSQESHLRSENSVTYDSSYPIYAMAFSSFTSSLPS-RRRRLAVGSFIEEFNNRVDIL  59

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  477
            SF+EDT+TLK  P L+F+HPYPPTKLMFHPNP+AS+K+ D+L SSGDYLRLW+VRE SIE
Sbjct  60   SFDEDTLTLKPVPNLSFEHPYPPTKLMFHPNPSASLKTNDILASSGDYLRLWDVRETSIE  119

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            P+ TL+N+KTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD
Sbjct  120  PLFTLSNNKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  162



>ref|XP_004235332.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1-like [Solanum lycopersicum]
Length=342

 Score =   258 bits (658),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 145/163 (89%), Gaps = 1/163 (1%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MENS+Q S+LRSENSVTY+S YPI+AMA SSF ++    RRR +AVGSF+EE+ NRV+IL
Sbjct  1    MENSSQESHLRSENSVTYDSSYPIYAMAFSSFTSSLTN-RRRRLAVGSFIEEFNNRVDIL  59

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  477
            SF+EDT+TLK  P L+F+HPYPPTKLMFHPNP+AS+K+ D+L SSGDYLRLW+V + SIE
Sbjct  60   SFDEDTLTLKPVPNLSFEHPYPPTKLMFHPNPSASLKTNDILASSGDYLRLWDVTDTSIE  119

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            P+ TL+N+KTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD
Sbjct  120  PLFTLSNNKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  162



>gb|AEF01097.1| AN11 [Solanum tuberosum]
Length=342

 Score =   254 bits (648),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 143/163 (88%), Gaps = 1/163 (1%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MENS+Q S+LRSE SVTY+S YPI AMA SSF ++    RRR +AVGSF+EE+ NRV+IL
Sbjct  1    MENSSQESHLRSEKSVTYDSSYPIHAMAFSSFTSSLTN-RRRRLAVGSFIEEFNNRVDIL  59

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  477
            SF+EDT+TLK  P L+F+HPYPPTKLMFHPNP+AS+K+ D+L SSGDYLRLW+V + SIE
Sbjct  60   SFDEDTLTLKPVPNLSFEHPYPPTKLMFHPNPSASLKTNDILASSGDYLRLWDVTDTSIE  119

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            P+ TL+N+KTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD
Sbjct  120  PLFTLSNNKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  162



>ref|XP_006347612.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1-like [Solanum tuberosum]
Length=342

 Score =   254 bits (648),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 144/163 (88%), Gaps = 1/163 (1%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MENS+Q S+LRSENSVTY+S YPI+AMA SSF ++    R R +AVGSF+EE+ NRV+IL
Sbjct  1    MENSSQESHLRSENSVTYDSSYPIYAMAFSSFNSSLTN-RCRRLAVGSFIEEFNNRVDIL  59

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  477
            SF+EDT+TLK  P L+F+HPYPPTKLMFHPNP+AS+K+ D+L SSGDYLRLW+V + SIE
Sbjct  60   SFDEDTLTLKPVPNLSFEHPYPPTKLMFHPNPSASLKTNDILASSGDYLRLWDVTDTSIE  119

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            P+ TL+N+KTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD
Sbjct  120  PLFTLSNNKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  162



>gb|AIP93870.1| anthocyanin WD40 protein [Solanum melongena]
Length=342

 Score =   253 bits (645),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 143/163 (88%), Gaps = 1/163 (1%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MENS+Q S+LRSENSVTY+S YPI+AMAVSS   +    RRR +AVGSF+EE+ NRV+IL
Sbjct  1    MENSSQESHLRSENSVTYDSSYPIYAMAVSS-FPSSVPSRRRRIAVGSFIEEFNNRVDIL  59

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  477
             F+EDT+TLK  P L+F+HPYPPTKLMFHPNP+AS+KS D+L SSGDYLRLWEV + SIE
Sbjct  60   CFDEDTLTLKPVPNLSFEHPYPPTKLMFHPNPSASLKSKDILASSGDYLRLWEVGDTSIE  119

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            P+ TL+N+KTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD
Sbjct  120  PLFTLSNNKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  162



>gb|AGC31678.1| WD40 repeat protein [Solanum tuberosum]
Length=342

 Score =   251 bits (642),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 143/163 (88%), Gaps = 1/163 (1%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MENS+Q S+LRS NSVTY+S YPI+AMA SSF ++    R R +AVGSF+EE+ NRV+IL
Sbjct  1    MENSSQESHLRSANSVTYDSSYPIYAMAFSSFNSSLTN-RCRRLAVGSFIEEFNNRVDIL  59

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  477
            SF+EDT+TLK  P L+F+HPYPPTKLMFHPNP+AS+K+ D+L SSGDYLRLW+V + SIE
Sbjct  60   SFDEDTLTLKPVPNLSFEHPYPPTKLMFHPNPSASLKTNDILASSGDYLRLWDVTDTSIE  119

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            P+ TL+N+KTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD
Sbjct  120  PLFTLSNNKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  162



>gb|AJN91103.1| anthocyanin-related transcription factor TTG1 [Solanum melongena]
Length=342

 Score =   251 bits (642),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 143/163 (88%), Gaps = 1/163 (1%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            M+NS+Q S+LRSENSVTY+S YPI+AMAVSS   +    RRR +AVGSF+EE+ NRV+IL
Sbjct  1    MDNSSQESHLRSENSVTYDSSYPIYAMAVSS-FPSSVPSRRRRIAVGSFIEEFNNRVDIL  59

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  477
             F+EDT+TLK  P L+F+HPYPPTKLMFHPNP+AS+KS D+L SSGDYLRLWEV + SIE
Sbjct  60   CFDEDTLTLKPVPNLSFEHPYPPTKLMFHPNPSASLKSKDILASSGDYLRLWEVGDTSIE  119

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            P+ TL+N+KTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD
Sbjct  120  PLFTLSNNKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  162



>ref|XP_008376821.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1 [Malus domestica]
 ref|XP_008376822.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1 [Malus domestica]
Length=342

 Score =   249 bits (636),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 117/163 (72%), Positives = 136/163 (83%), Gaps = 1/163 (1%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MENSTQ S+LR ENSVTYESPYP++AMA  S          R +AVGSF+EEY NRV+IL
Sbjct  1    MENSTQESHLRQENSVTYESPYPLYAMAFPSPQTRTRHQHHR-IAVGSFIEEYSNRVDIL  59

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  477
            SF+ DT+++K NP L+FDHPYPPTKLMFHPNP A  K+ DLL SSGDYLRLWEV ++S+E
Sbjct  60   SFDPDTLSIKLNPTLSFDHPYPPTKLMFHPNPNALHKTNDLLASSGDYLRLWEVGDSSVE  119

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            P+  LNNSKTSE+CAPLTSFDWN++EPRRIGTSSIDTTCTIWD
Sbjct  120  PIQVLNNSKTSEFCAPLTSFDWNDIEPRRIGTSSIDTTCTIWD  162



>gb|AHM88209.1| TTG1 protein [Malus hybrid cultivar]
Length=342

 Score =   249 bits (635),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 115/163 (71%), Positives = 139/163 (85%), Gaps = 1/163 (1%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MENSTQ S+LR+ENSVTYESPYP++AMA++S          R +AVGSF+EEY NRV+IL
Sbjct  1    MENSTQESHLRAENSVTYESPYPLYAMALASPQTRTRHQHHR-IAVGSFIEEYSNRVDIL  59

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  477
            SF+ DT+++K NP L+FDHPYPPTKLMFHPNP A  K+ D+L SSGDYLRLWEV ++++E
Sbjct  60   SFDPDTLSIKPNPTLSFDHPYPPTKLMFHPNPNALHKTNDVLASSGDYLRLWEVGDSTVE  119

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            P+  LNNSKTSE+CAPLTSFDWN++EPRRIGTSSIDTTCTIWD
Sbjct  120  PIQVLNNSKTSEFCAPLTSFDWNDIEPRRIGTSSIDTTCTIWD  162



>gb|AJB28501.1| WD40 [Prunus avium]
Length=342

 Score =   248 bits (634),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 137/163 (84%), Gaps = 1/163 (1%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MENS Q S+L  ENSVTYESPYP++AMA SS    +     R +AVGSF+EEY NRV+IL
Sbjct  1    MENSAQESHLGQENSVTYESPYPLYAMAFSSPQTRNRHQHHR-IAVGSFIEEYTNRVDIL  59

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  477
            SF+ DT+++K NP L+FDHPYPPTKLMFHPNP +  KS D+L SSGDYLRLWEVR++S+E
Sbjct  60   SFDPDTLSVKPNPTLSFDHPYPPTKLMFHPNPNSLHKSNDVLASSGDYLRLWEVRDSSVE  119

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            P+  LNNSKTSE+CAPLTSFDWN++EPRRIGTSSIDTTCTIWD
Sbjct  120  PIQVLNNSKTSEFCAPLTSFDWNDIEPRRIGTSSIDTTCTIWD  162



>ref|XP_008343816.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1-like [Malus domestica]
 gb|AAF27919.1|AF220203_1 Ttg1-like protein [Malus domestica]
 gb|ADI58759.1| TTG1 [Malus domestica]
 gb|ADI58760.1| TTG1 [Malus domestica]
Length=342

 Score =   248 bits (632),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 115/163 (71%), Positives = 138/163 (85%), Gaps = 1/163 (1%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MENSTQ S+LR+ENSVTYESPYP++AMA +S          R +AVGSF+EEY NRV+IL
Sbjct  1    MENSTQESHLRAENSVTYESPYPLYAMAFASPQTRTRHQHHR-IAVGSFIEEYSNRVDIL  59

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  477
            SF+ DT+++K NP L+FDHPYPPTKLMFHPNP A  K+ D+L SSGDYLRLWEV ++++E
Sbjct  60   SFDPDTLSIKPNPTLSFDHPYPPTKLMFHPNPNALHKTNDVLASSGDYLRLWEVGDSTVE  119

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            P+  LNNSKTSE+CAPLTSFDWN++EPRRIGTSSIDTTCTIWD
Sbjct  120  PIQVLNNSKTSEFCAPLTSFDWNDIEPRRIGTSSIDTTCTIWD  162



>gb|AHZ56765.1| transcription factor WD40 [Malus hybrid cultivar]
Length=342

 Score =   248 bits (632),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 115/163 (71%), Positives = 138/163 (85%), Gaps = 1/163 (1%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MENSTQ S+LR+ENSVTYESPYP++AMA +S          R +AVGSF+EEY NRV+IL
Sbjct  1    MENSTQESHLRAENSVTYESPYPLYAMAFASPQTRTRHQHHR-IAVGSFIEEYSNRVDIL  59

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  477
            SF+ DT+++K NP L+FDHPYPPTKLMFHPNP A  K+ D+L SSGDYLRLWEV ++++E
Sbjct  60   SFDPDTLSIKPNPTLSFDHPYPPTKLMFHPNPNALHKTNDVLASSGDYLRLWEVGDSTVE  119

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            P+  LNNSKTSE+CAPLTSFDWN++EPRRIGTSSIDTTCTIWD
Sbjct  120  PIQVLNNSKTSEFCAPLTSFDWNDIEPRRIGTSSIDTTCTIWD  162



>ref|XP_007218262.1| hypothetical protein PRUPE_ppa008187mg [Prunus persica]
 gb|EMJ19461.1| hypothetical protein PRUPE_ppa008187mg [Prunus persica]
Length=342

 Score =   247 bits (630),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 115/163 (71%), Positives = 136/163 (83%), Gaps = 1/163 (1%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MENS Q S+L  ENSVTYESPYP++AMA S     +     R +AVGSF+EEY NRV+IL
Sbjct  1    MENSAQESHLGQENSVTYESPYPLYAMAFSPSQTRNRHQHHR-IAVGSFIEEYSNRVDIL  59

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  477
            SF+ DT+++K NP L+FDHPYPPTKLMFHPNP +  KS D+L SSGDYLRLWEVR++S+E
Sbjct  60   SFDPDTLSVKPNPTLSFDHPYPPTKLMFHPNPNSLHKSNDVLASSGDYLRLWEVRDSSVE  119

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            P+  LNNSKTSE+CAPLTSFDWN++EPRRIGTSSIDTTCTIWD
Sbjct  120  PIQVLNNSKTSEFCAPLTSFDWNDIEPRRIGTSSIDTTCTIWD  162



>gb|AFY23208.1| transparent testa glabra 1 [Rosa rugosa]
Length=346

 Score =   246 bits (629),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 138/166 (83%), Gaps = 3/166 (2%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MENSTQ S+L  ENSVTY+SPYP++AMA S  A          +AVGSF+EE+ NRV+IL
Sbjct  1    MENSTQESHLGPENSVTYDSPYPLYAMAFSPAAPTRTRHNHPRIAVGSFIEEFSNRVDIL  60

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASI-  474
            SF+ DT+TLK NP L+FDHPYPPTKLMFHPNP +  KS+D+L SSGDYLRLWEV+++S+ 
Sbjct  61   SFDPDTLTLKPNPSLSFDHPYPPTKLMFHPNPNSLHKSSDILASSGDYLRLWEVKDSSVD  120

Query  475  --EPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
              EP+S LNNSKTSE+CAPLTSFDWNE+EPRRIGTSSIDTTCTIWD
Sbjct  121  RLEPISVLNNSKTSEFCAPLTSFDWNEIEPRRIGTSSIDTTCTIWD  166



>ref|XP_008234637.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1 isoform X2 [Prunus 
mume]
Length=342

 Score =   246 bits (628),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 115/163 (71%), Positives = 136/163 (83%), Gaps = 1/163 (1%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MENS Q S+L  ENSVTYESPYP++AMA S     +     R +AVGSF+EEY NRV+IL
Sbjct  1    MENSAQESHLGQENSVTYESPYPLYAMAFSPPQTRNRHQHHR-IAVGSFIEEYSNRVDIL  59

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  477
            SF+ DT+++K NP L+FDHPYPPTKLMFHPNP +  KS D+L SSGDYLRLWEVR++S+E
Sbjct  60   SFDPDTLSVKPNPTLSFDHPYPPTKLMFHPNPNSLHKSNDVLASSGDYLRLWEVRDSSVE  119

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            P+  LNNSKTSE+CAPLTSFDWN++EPRRIGTSSIDTTCTIWD
Sbjct  120  PIQVLNNSKTSEFCAPLTSFDWNDIEPRRIGTSSIDTTCTIWD  162



>ref|XP_008234636.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1 isoform X1 [Prunus 
mume]
Length=343

 Score =   246 bits (628),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 115/163 (71%), Positives = 136/163 (83%), Gaps = 1/163 (1%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MENS Q S+L  ENSVTYESPYP++AMA S     +     R +AVGSF+EEY NRV+IL
Sbjct  1    MENSAQESHLGQENSVTYESPYPLYAMAFSPPQTRNRHQHHR-IAVGSFIEEYSNRVDIL  59

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  477
            SF+ DT+++K NP L+FDHPYPPTKLMFHPNP +  KS D+L SSGDYLRLWEVR++S+E
Sbjct  60   SFDPDTLSVKPNPTLSFDHPYPPTKLMFHPNPNSLHKSNDVLASSGDYLRLWEVRDSSVE  119

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            P+  LNNSKTSE+CAPLTSFDWN++EPRRIGTSSIDTTCTIWD
Sbjct  120  PIQVLNNSKTSEFCAPLTSFDWNDIEPRRIGTSSIDTTCTIWD  162



>gb|AJB28502.1| WD40, partial [Prunus cerasus]
Length=309

 Score =   245 bits (626),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 115/163 (71%), Positives = 136/163 (83%), Gaps = 1/163 (1%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MENS Q S+L  ENSVTYESPYP++AMA SS    +     R +AVGSF+EEY NRV+IL
Sbjct  1    MENSAQESHLGQENSVTYESPYPLYAMAFSSPQTRNRHQHHR-IAVGSFIEEYSNRVDIL  59

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  477
            SF+ DT+++K NP L+FDHPYPPTKLMFHPNP +  KS D+  SSGDYLRLWEVR++S+E
Sbjct  60   SFDPDTLSVKPNPTLSFDHPYPPTKLMFHPNPNSLHKSNDVSASSGDYLRLWEVRDSSVE  119

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            P+  LNNSKTSE+CAPLTSFDWN++EPRRIGTSSIDTTCTIWD
Sbjct  120  PIQVLNNSKTSEFCAPLTSFDWNDIEPRRIGTSSIDTTCTIWD  162



>gb|AIU98520.1| WD40 protein [Paeonia suffruticosa]
Length=343

 Score =   246 bits (627),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 142/164 (87%), Gaps = 2/164 (1%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MENSTQ S+L SEN VTY+SP+P++AMA SS  +  H L    +AVGSF+EE+ NRV+I+
Sbjct  1    MENSTQESHLGSENLVTYDSPHPLYAMAFSSSPSRTH-LHHHRIAVGSFIEEFNNRVDIV  59

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASM-KSADLLVSSGDYLRLWEVREASI  474
            SF+++T+T+KTNP L+F+HPYPPTKLMF PN  +S+ KS+DLL SSGDYLRLWEVR+ SI
Sbjct  60   SFDDETLTIKTNPNLSFEHPYPPTKLMFQPNSASSLRKSSDLLASSGDYLRLWEVRDNSI  119

Query  475  EPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            EP+S LNNSKTSE+CAPLTSFDWNEVEPRRIGTSSIDTTCTIWD
Sbjct  120  EPLSVLNNSKTSEFCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  163



>gb|ADU25044.1| WD40 protein [Pyrus pyrifolia]
Length=342

 Score =   245 bits (626),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 139/164 (85%), Gaps = 3/164 (2%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMA-VSSFAAAHHGLRRRSVAVGSFLEEYKNRVEI  294
            MENSTQ S+L++ENSVTYESPYP++A+A VS      H   R  +AVGSF+EEY NRV+I
Sbjct  1    MENSTQESHLKAENSVTYESPYPLYALAFVSPQTRTRHQHHR--IAVGSFIEEYSNRVDI  58

Query  295  LSFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASI  474
            LSF+ DT+++K NP L+FDHPYPPTKLMFHPNP A  K+ D+L SSGDYLRLWEV ++++
Sbjct  59   LSFDPDTLSIKPNPTLSFDHPYPPTKLMFHPNPNALHKTNDVLASSGDYLRLWEVGDSTV  118

Query  475  EPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            EP+  LNNSKTSE+CAPLTSFDWN++EPRRIGTSSIDTTCTIWD
Sbjct  119  EPIQVLNNSKTSEFCAPLTSFDWNDIEPRRIGTSSIDTTCTIWD  162



>ref|XP_009351914.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1-like [Pyrus x bretschneideri]
Length=342

 Score =   245 bits (626),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 138/163 (85%), Gaps = 1/163 (1%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MENSTQ S+L++ENSVTYESPYP++A+A +S          R +AVGSF+EEY NRV+IL
Sbjct  1    MENSTQESHLKAENSVTYESPYPLYALAFASPQTRTRHQHHR-IAVGSFIEEYSNRVDIL  59

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  477
            SF+ DT+++K NP L+FDHPYPPTKLMFHPNP A  K+ D+L SSGDYLRLWEV ++++E
Sbjct  60   SFDPDTLSIKPNPTLSFDHPYPPTKLMFHPNPNALHKTNDVLASSGDYLRLWEVGDSTVE  119

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            P+  LNNSKTSE+CAPLTSFDWN++EPRRIGTSSIDTTCTIWD
Sbjct  120  PIQVLNNSKTSEFCAPLTSFDWNDIEPRRIGTSSIDTTCTIWD  162



>gb|AGL81358.1| WD40 repeat protein [Pyrus communis]
Length=342

 Score =   245 bits (626),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 138/163 (85%), Gaps = 1/163 (1%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MENSTQ S+L++ENSVTYESPYP++A+A +S          R +AVGSF+EEY NRV+IL
Sbjct  1    MENSTQESHLKAENSVTYESPYPLYALAFASPQTRTRHQHHR-IAVGSFIEEYSNRVDIL  59

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  477
            SF+ DT+++K NP L+FDHPYPPTKLMFHPNP A  K+ D+L SSGDYLRLWEV ++++E
Sbjct  60   SFDPDTLSIKPNPTLSFDHPYPPTKLMFHPNPNALHKTNDVLASSGDYLRLWEVGDSTVE  119

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            P+  LNNSKTSE+CAPLTSFDWN++EPRRIGTSSIDTTCTIWD
Sbjct  120  PIQVLNNSKTSEFCAPLTSFDWNDIEPRRIGTSSIDTTCTIWD  162



>ref|XP_004307911.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1 [Fragaria vesca 
subsp. vesca]
Length=344

 Score =   245 bits (625),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 137/166 (83%), Gaps = 5/166 (3%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MENST  S+L  ENSVTY+SPYP++AMA S  A A H      +AVGSF+EE+ NRV+IL
Sbjct  1    MENSTLESHLGPENSVTYDSPYPLYAMAFSPAARARH--HHPKIAVGSFIEEFSNRVDIL  58

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASI-  474
            SF+ DT+TLK NP L+FDHPYPPTKLMFHPNP    KS D+L SSGDYLRLWEV+++S+ 
Sbjct  59   SFDPDTLTLKPNPSLSFDHPYPPTKLMFHPNPNTLHKSHDILASSGDYLRLWEVKDSSVD  118

Query  475  --EPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
              EP+S LNNSKTSE+CAPLTSFDWNE+EPRRIGTSSIDTTCTIWD
Sbjct  119  RLEPISVLNNSKTSEFCAPLTSFDWNEIEPRRIGTSSIDTTCTIWD  164



>gb|ACQ65867.1| transparent testa glabra 1 [Prunus persica]
Length=342

 Score =   242 bits (617),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/163 (70%), Positives = 135/163 (83%), Gaps = 1/163 (1%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MENS Q S+L  ENSVTYESPYP++AMA S     +     R +AVGSF+EEY NRV+IL
Sbjct  1    MENSAQESHLGQENSVTYESPYPLYAMAFSPSQTRNRHQHHR-IAVGSFIEEYSNRVDIL  59

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  477
            SF+ DT+++K NP L+FDHPYPPTKLMFHPNP +  KS D+L SSGDYLRL EVR++S+E
Sbjct  60   SFDPDTLSVKPNPTLSFDHPYPPTKLMFHPNPNSLHKSNDVLASSGDYLRLREVRDSSVE  119

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            P+  LNNSKTSE+CAPLTSFDWN++EPRRIGTSSIDTTCTIWD
Sbjct  120  PIQVLNNSKTSEFCAPLTSFDWNDIEPRRIGTSSIDTTCTIWD  162



>gb|AEI55401.1| TTG1 [Rubus idaeus]
Length=344

 Score =   241 bits (616),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 136/166 (82%), Gaps = 5/166 (3%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            M+NSTQ S+L  ENSVTYESPYP++AMA SS            +AVGSF+EE+ NRV+IL
Sbjct  1    MDNSTQESHLGPENSVTYESPYPLYAMAFSS--PRTRHHHHHRIAVGSFIEEFSNRVDIL  58

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASI-  474
            SF+ DT+TLK NP L+FDHPYPPTKLMFHPNP    K+ D+L SSGDYLRLWEV+++S+ 
Sbjct  59   SFDPDTLTLKPNPALSFDHPYPPTKLMFHPNPNTLHKTNDILASSGDYLRLWEVKDSSVD  118

Query  475  --EPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
              EP+S LNNSKTSE+CAPLTSFDWNE+EPRRIGTSSIDTTCTIWD
Sbjct  119  RLEPISVLNNSKTSEFCAPLTSFDWNEIEPRRIGTSSIDTTCTIWD  164



>ref|XP_010251384.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1 [Nelumbo nucifera]
Length=339

 Score =   240 bits (613),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 138/164 (84%), Gaps = 6/164 (4%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            M+NSTQ S+LRSEN  T++SPYPI+AMA SS +   H      +AVGSFLEEY N+V+I+
Sbjct  1    MDNSTQESHLRSENFFTHDSPYPIYAMAFSSSSDRIH-----RIAVGSFLEEYNNKVDII  55

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASM-KSADLLVSSGDYLRLWEVREASI  474
            SF+E+T+T KT+P L+FDHPYPPTKLMFHPN   S+ KS++LL SSGDYLRLWEVRE SI
Sbjct  56   SFDEETLTFKTDPNLSFDHPYPPTKLMFHPNGAKSLRKSSNLLASSGDYLRLWEVRENSI  115

Query  475  EPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            EP + LNNSKTSE+CAPLTSFDWN+ EPRRIGTSSIDTTCTIWD
Sbjct  116  EPRALLNNSKTSEFCAPLTSFDWNDAEPRRIGTSSIDTTCTIWD  159



>gb|AAC18914.1| AN11 [Petunia x hybrida]
Length=337

 Score =   240 bits (612),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 137/164 (84%), Gaps = 8/164 (5%)
 Frame = +1

Query  118  MENSTQGS-NLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEI  294
            MENS+Q S +LRSENSVTY+S YPI++MA SSF        RR +AVGSF+EE  NRVE+
Sbjct  1    MENSSQESQHLRSENSVTYDSTYPIYSMAFSSFPTP-----RRRIAVGSFIEELNNRVEL  55

Query  295  LSFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASI  474
            LSF E+T+TL   P L+FDHPYPPTKLMFHPNP  S  + D+L SSGDYLRLWEV+E+SI
Sbjct  56   LSFNEETLTLNPIPNLSFDHPYPPTKLMFHPNPIKS--NNDILASSGDYLRLWEVKESSI  113

Query  475  EPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            EP+ TLNNSKTSEYCAPLTSFDWNEVEP+RIGTSSIDTTCTIWD
Sbjct  114  EPLFTLNNSKTSEYCAPLTSFDWNEVEPKRIGTSSIDTTCTIWD  157



>emb|CBK62755.1| WD-repeat protein [Humulus lupulus]
Length=338

 Score =   239 bits (609),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 137/163 (84%), Gaps = 5/163 (3%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MENSTQ S+LR +NSVTY+SPYP++AMA+SS    +   R   +AVGS +EE+ NRV++L
Sbjct  1    MENSTQESHLRPDNSVTYDSPYPMYAMALSSTQTRN---RHHRIAVGSLIEEFSNRVDLL  57

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  477
            SF+ +T+TL + P L+FDHPYPPTKLMFHP  +   KS+D+L SSGDYLRLWEVR+ SIE
Sbjct  58   SFDPETLTLNSQPSLSFDHPYPPTKLMFHP--STLQKSSDVLASSGDYLRLWEVRDNSIE  115

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            P+S LNNSKTSE+CAPLTSFDWNE+EPRRIGTSSIDTTCTIWD
Sbjct  116  PISVLNNSKTSEFCAPLTSFDWNEIEPRRIGTSSIDTTCTIWD  158



>emb|CBI23093.3| unnamed protein product [Vitis vinifera]
Length=276

 Score =   237 bits (604),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 135/163 (83%), Gaps = 7/163 (4%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            ME S+Q S+LRSEN VTYESPYP+++MA+SS    HH      +A+GSF+EE  NRV+I+
Sbjct  1    MERSSQESHLRSENCVTYESPYPLYSMAISSSTQHHHP----RIAIGSFIEELSNRVDIV  56

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  477
            SF+ED + ++T+P L+FDHPYPPTKLMFHPN   S  S D L SSG+YLRLWEVR+ SI+
Sbjct  57   SFDEDALAIRTHPSLSFDHPYPPTKLMFHPN---SRTSPDHLASSGEYLRLWEVRDNSIQ  113

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            P+S LNNSKTSE+CAPLTSFDWNEVEPRRIGTSSIDTTCTIWD
Sbjct  114  PLSVLNNSKTSEFCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  156



>ref|XP_010099415.1| Protein TRANSPARENT TESTA GLABRA 1 [Morus notabilis]
 gb|EXB78377.1| Protein TRANSPARENT TESTA GLABRA 1 [Morus notabilis]
Length=340

 Score =   238 bits (608),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 114/163 (70%), Positives = 140/163 (86%), Gaps = 3/163 (2%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MEN+TQ S+LRSENSVTYESPYP+++MA+SS ++     R   +AVGSF+EEY NRV++L
Sbjct  1    MENTTQESHLRSENSVTYESPYPLYSMALSSSSSQSRT-RNHRIAVGSFIEEYANRVDLL  59

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  477
            SF+ +T+TL  +P L+FDHPYPPTKLMFHP  ++  KS D+L SSGDYLRLWEVR+ SIE
Sbjct  60   SFDAETLTLTAHPELSFDHPYPPTKLMFHP--SSVQKSFDVLASSGDYLRLWEVRDTSIE  117

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            P+S LNNSKTSE+CAPLTSFDWN+VEP+RIGTSSIDTTCT+WD
Sbjct  118  PISVLNNSKTSEFCAPLTSFDWNDVEPKRIGTSSIDTTCTVWD  160



>ref|XP_010048437.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1 [Eucalyptus grandis]
 ref|XP_010048445.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1 [Eucalyptus grandis]
 gb|KCW89071.1| hypothetical protein EUGRSUZ_A01400 [Eucalyptus grandis]
 gb|KCW89072.1| hypothetical protein EUGRSUZ_A01400 [Eucalyptus grandis]
Length=341

 Score =   238 bits (608),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 140/164 (85%), Gaps = 4/164 (2%)
 Frame = +1

Query  118  MENSTQGSN-LRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEI  294
            MENSTQ S+ LRSENSVT+ESPYP++AMAVSS  A         +AVGSFLEEY NRV++
Sbjct  1    MENSTQESHHLRSENSVTHESPYPLYAMAVSSSPAR--HHHHHRIAVGSFLEEYTNRVDV  58

Query  295  LSFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASI  474
            +SF+ D++++KT+ GL+FDHPYPPTKLMFHP P+++   +DLL SSGDYLRLWEVRE+SI
Sbjct  59   VSFDPDSLSIKTHQGLSFDHPYPPTKLMFHP-PSSNPSKSDLLASSGDYLRLWEVRESSI  117

Query  475  EPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            EPV+  NNSKTSE+CAPLTSFDWNE+EP+R+GT SIDTTCTIWD
Sbjct  118  EPVAVFNNSKTSEFCAPLTSFDWNEIEPKRVGTCSIDTTCTIWD  161



>gb|AFL02466.1| transcription factor TTG1 [Fragaria x ananassa]
Length=344

 Score =   238 bits (608),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 134/166 (81%), Gaps = 5/166 (3%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MENST  S+L  ENSVTY+SPYP++AMA S  A   H      +AVGSF+EE+ NRV+IL
Sbjct  1    MENSTLESHLGPENSVTYDSPYPLYAMAFSPAARTRH--HHPKIAVGSFIEEFSNRVDIL  58

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASI-  474
            SF+ DT+TLK NP L+FDHPYPPTKLMFHPNP    KS D+L SSGDYLRLWEV+++S+ 
Sbjct  59   SFDPDTLTLKPNPSLSFDHPYPPTKLMFHPNPNTLHKSHDILASSGDYLRLWEVKDSSVD  118

Query  475  --EPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
              EP+S LNNSKTSE+CAP TSFDWNE+EPR IGTSSIDTTCTIWD
Sbjct  119  RLEPISVLNNSKTSEFCAPXTSFDWNEIEPRXIGTSSIDTTCTIWD  164



>ref|NP_001268101.1| WD-repeat 1 [Vitis vinifera]
 ref|XP_010662853.1| PREDICTED: WD-repeat 1 isoform X1 [Vitis vinifera]
 gb|ABF66625.2| WD-repeat 1 [Vitis vinifera]
Length=336

 Score =   238 bits (607),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 135/163 (83%), Gaps = 7/163 (4%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            ME S+Q S+LRSEN VTYESPYP+++MA+SS    HH      +A+GSF+EE  NRV+I+
Sbjct  1    MERSSQESHLRSENCVTYESPYPLYSMAISSSTQHHHP----RIAIGSFIEELSNRVDIV  56

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  477
            SF+ED + ++T+P L+FDHPYPPTKLMFHPN   S  S D L SSG+YLRLWEVR+ SI+
Sbjct  57   SFDEDALAIRTHPSLSFDHPYPPTKLMFHPN---SRTSPDHLASSGEYLRLWEVRDNSIQ  113

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            P+S LNNSKTSE+CAPLTSFDWNEVEPRRIGTSSIDTTCTIWD
Sbjct  114  PLSVLNNSKTSEFCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  156



>ref|XP_004502764.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1-like isoform X1 
[Cicer arietinum]
 ref|XP_004502765.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1-like isoform X2 
[Cicer arietinum]
Length=342

 Score =   238 bits (607),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 140/165 (85%), Gaps = 5/165 (3%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MENSTQ SNLRS+NSVTY+SPYP++AMA   F++  +  +++ +AVGSF+EEY NR++IL
Sbjct  1    MENSTQESNLRSDNSVTYDSPYPLYAMA---FSSNPNSQQQQRIAVGSFIEEYTNRIDIL  57

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASM--KSADLLVSSGDYLRLWEVREAS  471
            SF  DT+++K  P L+FDHPYPPTKLMFHP+  +S+   S+DLL +SGDYLRLWEVRE S
Sbjct  58   SFNPDTLSIKPQPSLSFDHPYPPTKLMFHPSTHSSLLKTSSDLLATSGDYLRLWEVRENS  117

Query  472  IEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            +E +S  NNSKTSE+CAPLTSFDWN++EP+RIGTSSIDTTCTIWD
Sbjct  118  VEALSLFNNSKTSEFCAPLTSFDWNDIEPKRIGTSSIDTTCTIWD  162



>gb|ADQ27315.1| truncated A2 protein [Pisum sativum]
Length=213

 Score =   232 bits (591),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 137/166 (83%), Gaps = 6/166 (4%)
 Frame = +1

Query  118  MENSTQGSNLRSEN-SVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEI  294
            M+NSTQ S+LRS+N SVTY+SP+P++AMA SS     H  R   +AVGSF+EEY NRV+I
Sbjct  1    MDNSTQESHLRSDNNSVTYDSPHPLYAMAFSSNPNPQHHQR---IAVGSFIEEYTNRVDI  57

Query  295  LSFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMK--SADLLVSSGDYLRLWEVREA  468
            LSF  DT+++K  P L+FDHPYPPTKLMFHP   +S++  S+DLL +SGDYLRLWEVRE 
Sbjct  58   LSFNPDTLSIKPQPSLSFDHPYPPTKLMFHPATHSSLQKTSSDLLATSGDYLRLWEVREN  117

Query  469  SIEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            S+E +S  NNSKTSE+CAPLTSFDWNE+EP+RIGTSSIDTTCTIWD
Sbjct  118  SVEALSLFNNSKTSEFCAPLTSFDWNEIEPKRIGTSSIDTTCTIWD  163



>gb|AJB28508.1| WD40, partial [Prunus avium]
Length=330

 Score =   236 bits (601),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 129/151 (85%), Gaps = 1/151 (1%)
 Frame = +1

Query  154  ENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDTVTLKTN  333
            ENSVTYESPYP++AMA SS    +     R +AVGSF+EEY NRV+ILSF+ DT+++K N
Sbjct  1    ENSVTYESPYPLYAMAFSSPQTRNRHQHHR-IAVGSFIEEYTNRVDILSFDPDTLSVKPN  59

Query  334  PGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEPVSTLNNSKTSE  513
            P L+FDHPYPPTKLMFHPNP +  KS D+L SSGDYLRLWEVR++S+EP+  LNNSKTSE
Sbjct  60   PTLSFDHPYPPTKLMFHPNPNSLHKSNDVLASSGDYLRLWEVRDSSVEPIQVLNNSKTSE  119

Query  514  YCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            +CAPLTSFDWN++EPRRIGTSSIDTTCTIWD
Sbjct  120  FCAPLTSFDWNDIEPRRIGTSSIDTTCTIWD  150



>emb|CDP04984.1| unnamed protein product [Coffea canephora]
Length=342

 Score =   235 bits (599),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 143/166 (86%), Gaps = 7/166 (4%)
 Frame = +1

Query  118  MEN--STQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVE  291
            M+N  S Q  +LRSENSV+++ PYPI+AMAVSS AA+HH  RRR++AVGSF+E+  NRV+
Sbjct  1    MDNPSSAQEPHLRSENSVSHDCPYPIYAMAVSS-AASHHNRRRRNIAVGSFVEDPGNRVD  59

Query  292  ILSFEEDTVTLKTNPGLAFDHPYPPTKLMFHP-NPTASMKSADLLVSSGDYLRLWEVREA  468
            I SF+E+T +LK  P L+F+HPYPPTKLMF P NP ++   A+LL SSGDYLR+WEVR++
Sbjct  60   IFSFDEETTSLKPIPTLSFEHPYPPTKLMFQPPNPRSA---AELLASSGDYLRIWEVRDS  116

Query  469  SIEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            SIEP+STLNNSKTSE+CAPLTSFDWN++EPRRIGTSSIDTTCTIWD
Sbjct  117  SIEPLSTLNNSKTSEFCAPLTSFDWNDLEPRRIGTSSIDTTCTIWD  162



>gb|ADQ27311.1| truncated A2 protein [Pisum sativum]
Length=197

 Score =   230 bits (586),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 137/166 (83%), Gaps = 6/166 (4%)
 Frame = +1

Query  118  MENSTQGSNLRSEN-SVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEI  294
            M+NSTQ S+LRS+N SVTY+SP+P++AMA SS     H  R   +AVGSF+EEY NRV+I
Sbjct  1    MDNSTQESHLRSDNNSVTYDSPHPLYAMAFSSNPNPQHHQR---IAVGSFIEEYTNRVDI  57

Query  295  LSFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMK--SADLLVSSGDYLRLWEVREA  468
            LSF  DT+++K  P L+FDHPYPPTKLMFHP   +S++  S+DLL +SGDYLRLWEVRE 
Sbjct  58   LSFNPDTLSIKPQPSLSFDHPYPPTKLMFHPATHSSLQKTSSDLLATSGDYLRLWEVREN  117

Query  469  SIEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            S+E +S  NNSKTSE+CAPLTSFDWNE+EP+RIGTSSIDTTCTIW+
Sbjct  118  SVEALSLFNNSKTSEFCAPLTSFDWNEIEPKRIGTSSIDTTCTIWE  163



>gb|ADV40946.1| WD40-repeat protein [Punica granatum]
 gb|AHB18401.1| WD40-repeat protein, partial [Punica granatum]
Length=334

 Score =   234 bits (596),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 137/164 (84%), Gaps = 11/164 (7%)
 Frame = +1

Query  118  MENSTQGSN-LRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEI  294
            M+NSTQ S+ LRS++S TYESPYP++AMAVS   + HHG   R +AVGSF+EEY NRV++
Sbjct  1    MDNSTQESHHLRSDHSATYESPYPLYAMAVS--PSRHHGHNHR-IAVGSFIEEYTNRVDV  57

Query  295  LSFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASI  474
            +SF+ DT+TLK  P L+FDHPYPPTKLMFHP        +DLL SSGD+LRLWEVR++S+
Sbjct  58   VSFDPDTLTLKPIPSLSFDHPYPPTKLMFHPK-------SDLLASSGDFLRLWEVRDSSV  110

Query  475  EPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            EPVS LNNSKTSE+CAPLTSFDWNE+EP+RIGT SIDTTCT+WD
Sbjct  111  EPVSVLNNSKTSEFCAPLTSFDWNEIEPKRIGTCSIDTTCTVWD  154



>gb|KDP45023.1| hypothetical protein JCGZ_01523 [Jatropha curcas]
Length=344

 Score =   234 bits (597),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 140/169 (83%), Gaps = 11/169 (7%)
 Frame = +1

Query  118  MENSTQGSNLRSE-NSVTYESPYPIFAMAVSSF----AAAHHGLRRRSVAVGSFLEEYKN  282
            MENSTQ S+LRS+ NS+TYES YPI+AMA SS      A HH      +AVGSF+E+Y N
Sbjct  1    MENSTQESHLRSDYNSITYESLYPIYAMAFSSSPSRSVANHH-----RIAVGSFIEDYNN  55

Query  283  RVEILSFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASM-KSADLLVSSGDYLRLWEV  459
            RV+++SF+ +T++ KT+P ++ DHPYPPTKLMFHP   +S+ K++DLL SSGDYLRLWEV
Sbjct  56   RVDVISFDTETLSFKTSPTISLDHPYPPTKLMFHPAAASSLRKTSDLLASSGDYLRLWEV  115

Query  460  REASIEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            RE+S+EPVS LNNSKTSE+CAPLTSFDWNE+EP+RIGT SIDTTCTIWD
Sbjct  116  RESSVEPVSVLNNSKTSEFCAPLTSFDWNEIEPKRIGTCSIDTTCTIWD  164



>gb|AIT76564.1| WDR protein [Trifolium repens]
Length=342

 Score =   233 bits (594),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 136/165 (82%), Gaps = 5/165 (3%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MENSTQ S++RSENSVTY+SPYP++AMA+S    +H   R   +AVGSF+EEY NR++IL
Sbjct  1    MENSTQESHIRSENSVTYDSPYPLYAMALSPNTNSHPQQR---IAVGSFIEEYTNRIDIL  57

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMK--SADLLVSSGDYLRLWEVREAS  471
            +F  +  ++K  P L+FDHPYPPTKLMFHP   +S++  S+DLL +SGDYLRLWEVRE S
Sbjct  58   NFNPENFSIKPQPSLSFDHPYPPTKLMFHPATNSSLQKTSSDLLATSGDYLRLWEVRENS  117

Query  472  IEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            +E +S  NNSKTSE+CAPLTSFDWNE+EP+RIGTSSIDTTCTIWD
Sbjct  118  VEALSLFNNSKTSEFCAPLTSFDWNEIEPKRIGTSSIDTTCTIWD  162



>gb|ADQ27310.1| A2 protein [Pisum sativum]
 gb|ADQ27312.1| A2 protein [Pisum sativum]
 gb|ADQ27314.1| A2 protein [Pisum sativum]
 gb|ADQ27316.1| A2 protein [Pisum sativum]
 gb|ADQ27317.1| A2 protein [Pisum sativum]
 gb|ADQ27318.1| A2 protein [Pisum sativum]
Length=343

 Score =   231 bits (590),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 137/166 (83%), Gaps = 6/166 (4%)
 Frame = +1

Query  118  MENSTQGSNLRSEN-SVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEI  294
            M+NSTQ S+LRS+N SVTY+SP+P++AMA SS     H  R   +AVGSF+EEY NRV+I
Sbjct  1    MDNSTQESHLRSDNNSVTYDSPHPLYAMAFSSNPNPQHHQR---IAVGSFIEEYTNRVDI  57

Query  295  LSFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMK--SADLLVSSGDYLRLWEVREA  468
            LSF  DT+++K  P L+FDHPYPPTKLMFHP   +S++  S+DLL +SGDYLRLWEVRE 
Sbjct  58   LSFNPDTLSIKPQPSLSFDHPYPPTKLMFHPATHSSLQKTSSDLLATSGDYLRLWEVREN  117

Query  469  SIEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            S+E +S  NNSKTSE+CAPLTSFDWNE+EP+RIGTSSIDTTCTIWD
Sbjct  118  SVEALSLFNNSKTSEFCAPLTSFDWNEIEPKRIGTSSIDTTCTIWD  163



>gb|AFS65006.1| transparent testa [Salvia miltiorrhiza]
Length=333

 Score =   230 bits (587),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 114/163 (70%), Positives = 135/163 (83%), Gaps = 10/163 (6%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            M+NSTQ S+ R EN VTY+SPYPI+AMA+S+       + RR VAVGSF+EE KNRV+IL
Sbjct  1    MDNSTQESHPRPENVVTYDSPYPIYAMAISA-------VNRRRVAVGSFIEELKNRVDIL  53

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  477
            SF ED+ +LK  P L+FDHPYPPTKL+FHP+ +A    ++LL SSGD+LRLWEV+++SI 
Sbjct  54   SFSEDSSSLKPVPSLSFDHPYPPTKLLFHPSVSAP---SNLLASSGDFLRLWEVKDSSIA  110

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
             VSTLNNSKTSEY APLTSFDWNEVEPRRIGTSSIDTTCTIWD
Sbjct  111  AVSTLNNSKTSEYSAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  153



>ref|XP_002530884.1| WD-repeat protein, putative [Ricinus communis]
 gb|EEF31490.1| WD-repeat protein, putative [Ricinus communis]
Length=342

 Score =   229 bits (584),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/163 (66%), Positives = 134/163 (82%), Gaps = 1/163 (1%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MENSTQ S+L+SENS+TY+SPYP++AMA SS  ++      R +AVGSF+E+Y NRV+IL
Sbjct  1    MENSTQESHLKSENSITYDSPYPLYAMAFSSSPSSSSTHHHR-IAVGSFIEDYSNRVDIL  59

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  477
            S   +T++ KT+P ++FDHPYPPTKLMFHP  +    S+DLL SSGDYLRLWE+R   +E
Sbjct  60   SLNTETLSFKTHPSVSFDHPYPPTKLMFHPASSLRKSSSDLLASSGDYLRLWEIRGDVVE  119

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            P+S LNNSK+SE+CAPLTSFDWNE+EP+RIGT SIDTTCTIWD
Sbjct  120  PLSVLNNSKSSEFCAPLTSFDWNEIEPKRIGTCSIDTTCTIWD  162



>dbj|BAH28880.1| WD40 repeats protein LjTTG1 [Lotus japonicus]
Length=349

 Score =   229 bits (584),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 135/172 (78%), Gaps = 12/172 (7%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVS------SFAAAHHGLRRRSVAVGSFLEEYK  279
            M+NSTQ S+LRSENSVTY+SPYP++AMA S      S +AA    R   +AVGSFLEEY 
Sbjct  1    MDNSTQDSHLRSENSVTYDSPYPLYAMAFSPNNNNNSHSAATTTQR---LAVGSFLEEYT  57

Query  280  NRVEILSFEEDTVTLKTNPGLAFDHPYPPTKLMFHPN---PTASMKSADLLVSSGDYLRL  450
            NRV+ILSF  DT +++  P L+FDHPYPPTKLMFHP+   P     + DLL +SGDYLRL
Sbjct  58   NRVDILSFNPDTPSIRPQPSLSFDHPYPPTKLMFHPSTHSPLLKSSAVDLLATSGDYLRL  117

Query  451  WEVREASIEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            WEVRE S+E +S  NNSKTSE+CAPLTSFDWNE+EP+RIGTSSIDTTCTIWD
Sbjct  118  WEVRENSVEALSLFNNSKTSEFCAPLTSFDWNEIEPKRIGTSSIDTTCTIWD  169



>dbj|BAB58883.1| putative regulatory protein in anthocyanin biosynthesis [Perilla 
frutescens]
Length=333

 Score =   228 bits (581),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 114/163 (70%), Positives = 134/163 (82%), Gaps = 10/163 (6%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MENSTQ S+ R EN VTY+SPYPI+AMA+S+       + RR VAVGSF+EE KN V+IL
Sbjct  1    MENSTQESHPRPENVVTYDSPYPIYAMAISA-------VNRRRVAVGSFVEELKNHVDIL  53

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  477
            SF ED+ +LK  P L+FDHPYPPTKL+FHP+ +A    ++LL SSGD+LRLWEV+++SI 
Sbjct  54   SFSEDSSSLKPVPSLSFDHPYPPTKLLFHPSVSAP---SNLLASSGDFLRLWEVKDSSIV  110

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
             VSTLNNSKTSEY APLTSFDWNEVEPRRIGTSSIDTTCTIWD
Sbjct  111  AVSTLNNSKTSEYSAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  153



>gb|ABQ18246.1| transcription factor WD-repeat protein 1 [Caragana jubata]
Length=337

 Score =   227 bits (579),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 133/165 (81%), Gaps = 10/165 (6%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            M+NSTQ S+LRSENSVTY+SPYP++AM+ S           + +AVGSF+EEY NRV+IL
Sbjct  1    MDNSTQESHLRSENSVTYDSPYPLYAMSFSP--------NSQRIAVGSFIEEYTNRVDIL  52

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMK--SADLLVSSGDYLRLWEVREAS  471
            SF  +T+++K  P L+FDHPYPPTK+MFHP   +S+   S+DLL +SGDYLRLWEVRE S
Sbjct  53   SFNPETLSIKPQPSLSFDHPYPPTKVMFHPATNSSLHKTSSDLLATSGDYLRLWEVRENS  112

Query  472  IEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            +EP+S  NNSKTSE+CAPLTSFDWN++EP+RIGTS ID TCTIWD
Sbjct  113  VEPISLFNNSKTSEFCAPLTSFDWNDIEPKRIGTSCIDATCTIWD  157



>ref|XP_002318500.2| TRANSPARENT TESTA GLABRA 1 family protein [Populus trichocarpa]
 gb|EEE96720.2| TRANSPARENT TESTA GLABRA 1 family protein [Populus trichocarpa]
Length=340

 Score =   227 bits (578),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 141/164 (86%), Gaps = 5/164 (3%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MENSTQ S+LRSEN+VTYESPYP++AMA+SS A+  +  +R  +A+GSF+E+Y NR++I+
Sbjct  1    MENSTQESHLRSENTVTYESPYPLYAMAISSTASRTNQYQR--IALGSFIEDYNNRIDIV  58

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVRE-ASI  474
            SF+ +T+++KT+  L+ +HPYPPTKLMF  +P++  KS DLL SSGDYLRLWEVR+ AS+
Sbjct  59   SFDPETLSIKTHQNLSVEHPYPPTKLMF--SPSSLHKSNDLLASSGDYLRLWEVRDSASV  116

Query  475  EPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            EP+  LNNSKTSE+CAPLTSFDWN++EP+RIGT SIDTTCTIWD
Sbjct  117  EPLLVLNNSKTSEFCAPLTSFDWNDIEPKRIGTCSIDTTCTIWD  160



>ref|XP_003602392.1| Protein TRANSPARENT TESTA GLABRA [Medicago truncatula]
 gb|ABW08112.1| WD40-1 protein [Medicago truncatula]
 gb|AES72643.1| transparent testa glabra protein [Medicago truncatula]
Length=342

 Score =   227 bits (578),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 138/166 (83%), Gaps = 7/166 (4%)
 Frame = +1

Query  118  MENSTQGSNLRSEN-SVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEI  294
            M+NSTQ S+LRS+N SVTY+SPYP++AM++S     +    ++ +AVGSF+EEY NR++I
Sbjct  1    MDNSTQESHLRSDNNSVTYDSPYPLYAMSIS----PNTNSPQQRIAVGSFIEEYTNRIDI  56

Query  295  LSFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMK--SADLLVSSGDYLRLWEVREA  468
            L+F  DT++LK  P L+FDHPYPPTKLMFHP   +S++  S+DLL +SGDYLRLWEVRE 
Sbjct  57   LNFNPDTLSLKPQPSLSFDHPYPPTKLMFHPATHSSLQKTSSDLLATSGDYLRLWEVREN  116

Query  469  SIEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            S+E +S  NNSKTSE+CAPLTSFDWNE+EP+RIGTSSIDTTCTIWD
Sbjct  117  SVEALSLFNNSKTSEFCAPLTSFDWNEIEPKRIGTSSIDTTCTIWD  162



>ref|XP_011005345.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1-like [Populus euphratica]
 ref|XP_011005346.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1-like [Populus euphratica]
 ref|XP_011005347.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1-like [Populus euphratica]
Length=340

 Score =   226 bits (576),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 140/164 (85%), Gaps = 5/164 (3%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MENSTQ S+LRSEN+VTYESPYP++AMA+SS A+  +  +R  +A+GSF+E+Y NR++I+
Sbjct  1    MENSTQESHLRSENTVTYESPYPLYAMAISSTASRANQYQR--IALGSFIEDYNNRIDIV  58

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVRE-ASI  474
            SF+ +T+++K +  L+ +HPYPPTKLMF  +P++  KS DLL SSGDYLRLWEVR+ AS+
Sbjct  59   SFDPETLSIKLHQNLSVEHPYPPTKLMF--SPSSLHKSNDLLASSGDYLRLWEVRDSASV  116

Query  475  EPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            EPV  LNNSKTSE+CAPLTSFDWN++EP+RIGT SIDTTCTIWD
Sbjct  117  EPVLVLNNSKTSEFCAPLTSFDWNDIEPKRIGTCSIDTTCTIWD  160



>ref|XP_011005348.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1-like [Populus euphratica]
 ref|XP_011005349.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1-like [Populus euphratica]
 ref|XP_011005350.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1-like [Populus euphratica]
Length=340

 Score =   226 bits (575),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 140/164 (85%), Gaps = 5/164 (3%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MENSTQ S+LRSEN+VTYESPYP++AMA+SS A+  +  +R  +A+GSF+E+Y NR++I+
Sbjct  1    MENSTQESHLRSENTVTYESPYPLYAMAISSTASRANQYQR--IALGSFIEDYNNRIDIV  58

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVRE-ASI  474
            SF+ +T+++K +  L+ +HPYPPTKLMF  +P++  KS DLL SSGDYLRLWEVR+ AS+
Sbjct  59   SFDPETLSIKPHQNLSVEHPYPPTKLMF--SPSSLHKSNDLLASSGDYLRLWEVRDSASV  116

Query  475  EPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            EPV  LNNSKTSE+CAPLTSFDWN++EP+RIGT SIDTTCTIWD
Sbjct  117  EPVLVLNNSKTSEFCAPLTSFDWNDIEPKRIGTCSIDTTCTIWD  160



>ref|XP_011075888.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1 [Sesamum indicum]
Length=333

 Score =   225 bits (574),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 109/163 (67%), Positives = 133/163 (82%), Gaps = 10/163 (6%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            M+NSTQ S+ R EN VT++SPY I+AMA+S+         RR +AVGSF+EE  NRV+IL
Sbjct  1    MDNSTQESHPRPENVVTFDSPYQIYAMAISA-------ANRRRIAVGSFIEELNNRVDIL  53

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  477
            SF ED+ +L + P L+FDHPYPPTKL+FHP+P+A     +LL SSGD+LRLWE+++ASI+
Sbjct  54   SFSEDSSSLNSIPSLSFDHPYPPTKLLFHPSPSAPR---NLLASSGDFLRLWEIKDASID  110

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            PVSTLNNSK+SEY APLTSFDWNE EPRRIGTSSIDTTCTIWD
Sbjct  111  PVSTLNNSKSSEYSAPLTSFDWNEAEPRRIGTSSIDTTCTIWD  153



>emb|CAN67365.1| hypothetical protein VITISV_033304 [Vitis vinifera]
Length=336

 Score =   225 bits (574),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 127/153 (83%), Gaps = 7/153 (5%)
 Frame = +1

Query  148  RSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDTVTLK  327
            RSEN VTYESPYP+++MA+SS    HH      +A+GSF+EE  NRV+I+SF+ED + ++
Sbjct  11   RSENCVTYESPYPLYSMAISSSTQHHHP----RIAIGSFIEEXXNRVDIVSFDEDALAIR  66

Query  328  TNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEPVSTLNNSKT  507
            T+P L+FDHPYPPTKLMFHPN   S  S D L SSG+YLRLWEVR+ SI+P+S LNNSKT
Sbjct  67   THPXLSFDHPYPPTKLMFHPN---SRTSPDHLASSGEYLRLWEVRDNSIQPLSVLNNSKT  123

Query  508  SEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            SE+CAPLTSFDWNEVEPRRIGTSSIDTTCTIWD
Sbjct  124  SEFCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  156



>ref|XP_003523314.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1-like [Glycine max]
Length=335

 Score =   225 bits (574),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 111/163 (68%), Positives = 131/163 (80%), Gaps = 8/163 (5%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MENSTQ S+LRSENSV+YESPYPI+ M   SF+ +H       +A+GSF+EEY NRV+IL
Sbjct  1    MENSTQESHLRSENSVSYESPYPIYGM---SFSPSH----PHRLALGSFIEEYTNRVDIL  53

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  477
            SF  DT++L  NP L+FDHPYPPTKLMFHP    S  S+DLL +SGDYLRLWEVR+ S+E
Sbjct  54   SFHPDTLSLTPNPSLSFDHPYPPTKLMFHPRKPPS-SSSDLLATSGDYLRLWEVRDNSVE  112

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
             VS  NNSKTSE+CAPLTSFDWN+++P RI TSSIDTTCTIWD
Sbjct  113  AVSLFNNSKTSEFCAPLTSFDWNDIDPNRIATSSIDTTCTIWD  155



>ref|XP_007039211.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
 ref|XP_007039212.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
 ref|XP_007039213.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY23712.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY23713.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY23714.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
Length=343

 Score =   225 bits (573),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 140/164 (85%), Gaps = 2/164 (1%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MENSTQ S+LRS+NS+TYESP P++AMA SS A +   L  + +A+GSF+E+Y NRV+I+
Sbjct  1    MENSTQESHLRSDNSITYESPCPVYAMAFSS-APSRTSLNHQRIALGSFIEDYANRVDII  59

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPN-PTASMKSADLLVSSGDYLRLWEVREASI  474
            SF+ +T++ KT+P L+FDHPYPPTKLMF PN  + S  S+DLL SSGDYLRLWEVRE+SI
Sbjct  60   SFDPETLSFKTHPTLSFDHPYPPTKLMFQPNRKSPSSSSSDLLASSGDYLRLWEVRESSI  119

Query  475  EPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            EP S LNNSKTSE+CAPLTSFDWN+V+P+RIGTSSIDTTCTIWD
Sbjct  120  EPFSVLNNSKTSEFCAPLTSFDWNDVDPKRIGTSSIDTTCTIWD  163



>ref|XP_007136431.1| hypothetical protein PHAVU_009G044700g [Phaseolus vulgaris]
 gb|ESW08425.1| hypothetical protein PHAVU_009G044700g [Phaseolus vulgaris]
Length=336

 Score =   224 bits (570),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/163 (66%), Positives = 132/163 (81%), Gaps = 7/163 (4%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            M+NSTQ S+LRSENSVT+ESPYPI+AMA   F+ +H       +A+GSF+E+Y NR+ IL
Sbjct  1    MDNSTQDSHLRSENSVTHESPYPIYAMA---FSPSH----PHRLALGSFIEKYTNRIHIL  53

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  477
            SF  DT++L  +P L+FDHPYPPTKLMFHP   +   S+DLL +SGDYLRLW+VRE S+E
Sbjct  54   SFHPDTLSLTPHPSLSFDHPYPPTKLMFHPRKPSPSSSSDLLATSGDYLRLWDVRENSVE  113

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            P+S  NNSKTSE+CAPLTSFDWN+++  RIGTSSIDTTCTIWD
Sbjct  114  PLSLFNNSKTSEFCAPLTSFDWNDIDHNRIGTSSIDTTCTIWD  156



>gb|AFD20562.1| transparent testa glabra 3, partial [Gossypium arboreum]
Length=345

 Score =   224 bits (571),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 142/166 (86%), Gaps = 4/166 (2%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MENSTQ S+LRS+NSVTYES Y ++AMA+SS  ++ + +  + +A+GSFLE+Y NRV+I+
Sbjct  1    MENSTQESHLRSDNSVTYESAYTVYAMALSSTPSSTN-INHQRIALGSFLEDYTNRVDII  59

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPN---PTASMKSADLLVSSGDYLRLWEVREA  468
            SF+ +T++ KT+P LAFDHPYPPTKLMF PN    ++S   +DLL SSGD+LRLWEVRE+
Sbjct  60   SFDPETLSFKTHPQLAFDHPYPPTKLMFQPNRKSASSSSSCSDLLASSGDFLRLWEVRES  119

Query  469  SIEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            SIEPV+ LNNSKTSE+CAPLTSFDWN+VEPRRIGTSSIDTTCTIWD
Sbjct  120  SIEPVTVLNNSKTSEFCAPLTSFDWNDVEPRRIGTSSIDTTCTIWD  165



>gb|AAM95645.1| WD-repeat protein GhTTG3 [Gossypium hirsutum]
 gb|KJB74661.1| hypothetical protein B456_012G001200 [Gossypium raimondii]
 gb|KJB74662.1| hypothetical protein B456_012G001200 [Gossypium raimondii]
Length=345

 Score =   223 bits (569),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 142/166 (86%), Gaps = 4/166 (2%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MENSTQ S+LRS+NSVTYES Y ++AMA+SS  ++ + +  + +A+GSFLE+Y NRV+I+
Sbjct  1    MENSTQESHLRSDNSVTYESAYTVYAMALSSTPSSTN-INHQRIALGSFLEDYTNRVDII  59

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPN---PTASMKSADLLVSSGDYLRLWEVREA  468
            SF+ +T++ KT+P LAFDHPYPPTKLMF PN    ++S   +DLL S+GD+LRLWEVRE+
Sbjct  60   SFDPETLSFKTHPKLAFDHPYPPTKLMFQPNRKSASSSSSCSDLLASTGDFLRLWEVRES  119

Query  469  SIEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            SIEPV+ LNNSKTSE+CAPLTSFDWN+VEP+RIGTSSIDTTCTIWD
Sbjct  120  SIEPVTVLNNSKTSEFCAPLTSFDWNDVEPKRIGTSSIDTTCTIWD  165



>gb|AAK19614.1|AF336281_1 GHTTG1 [Gossypium hirsutum]
Length=345

 Score =   223 bits (569),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 142/166 (86%), Gaps = 4/166 (2%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MENSTQ S+LRS+NSVTYES Y ++AMA+SS  ++ + +  + +A+GSFLE+Y NRV+I+
Sbjct  1    MENSTQESHLRSDNSVTYESAYTVYAMALSSTPSSTN-INHQRIALGSFLEDYTNRVDII  59

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPN---PTASMKSADLLVSSGDYLRLWEVREA  468
            SF+ +T++ KT+P LAFDHPYPPTKLMF PN    ++S   +DLL S+GD+LRLWEVRE+
Sbjct  60   SFDPETLSFKTHPKLAFDHPYPPTKLMFQPNRKSASSSSSCSDLLASTGDFLRLWEVRES  119

Query  469  SIEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            SIEPV+ LNNSKTSE+CAPLTSFDWN+VEP+RIGTSSIDTTCTIWD
Sbjct  120  SIEPVTVLNNSKTSEFCAPLTSFDWNDVEPKRIGTSSIDTTCTIWD  165



>ref|XP_011003289.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1-like [Populus euphratica]
 ref|XP_011003290.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1-like [Populus euphratica]
 ref|XP_011003292.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1-like [Populus euphratica]
Length=340

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 136/164 (83%), Gaps = 5/164 (3%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MENS Q S+LRSEN++TYESPYPI+AMA+SS  +  +  +R  +A+GSF E+Y NR++I+
Sbjct  1    MENSAQESHLRSENTITYESPYPIYAMAISSTPSRTNQYQR--IALGSFTEDYNNRIDIV  58

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVRE-ASI  474
            SF+ +T ++KT+  L+ +HPYPPTKLMF  +P++  KS DLL SSGDYLRLWEVRE ASI
Sbjct  59   SFDPETRSVKTHQNLSLEHPYPPTKLMF--SPSSLHKSNDLLASSGDYLRLWEVRESASI  116

Query  475  EPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            EPV  LNNSKT E+CAPLTSFDWN++EP+RIGT SIDTTCTIWD
Sbjct  117  EPVFVLNNSKTGEFCAPLTSFDWNDIEPKRIGTCSIDTTCTIWD  160



>ref|XP_003526764.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1-like [Glycine max]
Length=336

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 131/163 (80%), Gaps = 7/163 (4%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MENST+ S+LRSENSVTYESPYPI+ M   SF+ +H       +A+GSF+EEY NRV+IL
Sbjct  1    MENSTEESHLRSENSVTYESPYPIYGM---SFSPSH----PHRLALGSFIEEYNNRVDIL  53

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  477
            SF  DT+++  +P L+FDHPYPPTKLMFHP   +   S+DLL +SGDYLRLWE+R+ S++
Sbjct  54   SFHPDTLSVTPHPSLSFDHPYPPTKLMFHPRKPSPSSSSDLLATSGDYLRLWEIRDNSVD  113

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
             VS  NNSKTSE+CAPLTSFDWN+++P RI TSSIDTTCTIWD
Sbjct  114  AVSLFNNSKTSEFCAPLTSFDWNDIDPNRIATSSIDTTCTIWD  156



>ref|XP_010519573.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1 [Tarenaya hassleriana]
 ref|XP_010519574.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1 [Tarenaya hassleriana]
Length=346

 Score =   219 bits (557),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 131/169 (78%), Gaps = 9/169 (5%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSS----FAAAHHGLRRRSVAVGSFLEEYKNR  285
            MENS Q S  RSE +VTY+SPYP++AMA SS     AAA +  R   +AVGSF+E+Y NR
Sbjct  1    MENSAQDSRSRSETAVTYDSPYPLYAMAFSSSRGGGAAATNSHR---IAVGSFVEDYNNR  57

Query  286  VEILSFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVRE  465
            V+ILSF+ D +T+   P L+F+HPYPPTKLMF P       + DLL SSGD+LRLWE+RE
Sbjct  58   VDILSFDSDALTVTAFPNLSFEHPYPPTKLMFSPPSLRRSSAGDLLASSGDFLRLWEIRE  117

Query  466  --ASIEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
              +S+EPVS LNNSKTSE+CAPLTSFDWNEVEP+R+GT SIDTTCTIWD
Sbjct  118  DSSSVEPVSVLNNSKTSEFCAPLTSFDWNEVEPKRLGTCSIDTTCTIWD  166



>ref|XP_006288106.1| hypothetical protein CARUB_v10001339mg [Capsella rubella]
 gb|EOA21004.1| hypothetical protein CARUB_v10001339mg [Capsella rubella]
Length=344

 Score =   218 bits (556),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 130/165 (79%), Gaps = 3/165 (2%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            M+NS   S  RSE +VTY+SPYP++AMA SS +AA+     R +AVGSFLE+Y NR++IL
Sbjct  1    MDNSAPDSLSRSETAVTYDSPYPLYAMAFSSLSAANTSSGHR-IAVGSFLEDYNNRIDIL  59

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREAS--  471
            SF+ D++T+K  P L+F+HPYPPTKLMF P       + DLL SSGD+LRLWEV E S  
Sbjct  60   SFDSDSMTVKALPNLSFEHPYPPTKLMFSPASLRRPSAGDLLASSGDFLRLWEVNEDSST  119

Query  472  IEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            +EP+S LNNSKTSE+CAPLTSFDWN+VEP+R+GT SIDTTCTIWD
Sbjct  120  VEPISVLNNSKTSEFCAPLTSFDWNDVEPKRLGTCSIDTTCTIWD  164



>gb|KDO75095.1| hypothetical protein CISIN_1g038533mg [Citrus sinensis]
Length=337

 Score =   218 bits (554),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 136/165 (82%), Gaps = 12/165 (7%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MENS+Q S+LRSENSVT+ESPYP++AMAV            + +AVGSF+E+Y NRV+++
Sbjct  1    MENSSQESHLRSENSVTHESPYPLYAMAVCG----------QRIAVGSFIEDYTNRVDVV  50

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSA--DLLVSSGDYLRLWEVREAS  471
            SFE +++++KT+P L+FDHPYPPTKLMF PN ++   S+   LL SSGD+LRLW+V ++S
Sbjct  51   SFEPESLSIKTHPSLSFDHPYPPTKLMFDPNSSSRKSSSNRHLLASSGDFLRLWDVGDSS  110

Query  472  IEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            IEPV+ LNNSK+SE+CAPLTSFDWNE+EP+RIGT SIDTTCTIWD
Sbjct  111  IEPVAVLNNSKSSEFCAPLTSFDWNEIEPKRIGTCSIDTTCTIWD  155



>gb|AHJ80982.1| WD-repeat containing protein [Erythranthe lewisii]
Length=333

 Score =   217 bits (553),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 133/163 (82%), Gaps = 10/163 (6%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            M+NSTQ S+ R+EN  TY+ P+PI+AMA+S+         RR +AVGS++EE KNRV+I+
Sbjct  1    MDNSTQDSHPRAENVATYDFPHPIYAMAISA-------ADRRRIAVGSYIEELKNRVDIV  53

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  477
            +F ED+ +LK NP L+F+HPYPPTKL+FHP+ +A     ++L SSGD+LRLW+V ++SI+
Sbjct  54   TFSEDSPSLKPNPSLSFEHPYPPTKLLFHPSASAP---TNILASSGDFLRLWKVNDSSID  110

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            P+STLNNS TSEY APLTSFDWNE+EPRRIGTSSIDTTCTIWD
Sbjct  111  PISTLNNSNTSEYSAPLTSFDWNELEPRRIGTSSIDTTCTIWD  153



>ref|XP_006419648.1| hypothetical protein CICLE_v10005375mg [Citrus clementina]
 ref|XP_006489138.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1-like [Citrus sinensis]
 gb|ESR32888.1| hypothetical protein CICLE_v10005375mg [Citrus clementina]
Length=337

 Score =   217 bits (552),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 136/165 (82%), Gaps = 12/165 (7%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MENS+Q S+LRSENSVT+ESPYP++AMAV            + +A+GSF+E+Y NRV+++
Sbjct  1    MENSSQESHLRSENSVTHESPYPLYAMAVCG----------QRIAIGSFIEDYTNRVDVV  50

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSA--DLLVSSGDYLRLWEVREAS  471
            SFE +++++KT+P L+FDHPYPPTKLMF PN ++   S+   LL SSGD+LRLW+V ++S
Sbjct  51   SFEPESLSIKTHPSLSFDHPYPPTKLMFDPNSSSRKSSSNRHLLASSGDFLRLWDVGDSS  110

Query  472  IEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            IEPV+ LNNSK+SE+CAPLTSFDWNE+EP+RIGT SIDTTCTIWD
Sbjct  111  IEPVAVLNNSKSSEFCAPLTSFDWNEIEPKRIGTCSIDTTCTIWD  155



>ref|XP_006347640.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1-like [Solanum tuberosum]
Length=343

 Score =   217 bits (552),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 127/162 (78%), Gaps = 1/162 (1%)
 Frame = +1

Query  121  ENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILS  300
            + S +  +LRS NSVTY+S YPI+AMA SSF ++    R   +A+GSF+EE  N V+ILS
Sbjct  3    KKSGKKFHLRSGNSVTYDSSYPIYAMAFSSFTSSLPN-RHPRIAIGSFIEEINNCVDILS  61

Query  301  FEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEP  480
            F+ D +TLK  P L F+HPYPPTKLMFHPNP  S+KS D+L S  DYLRLWEV + SIEP
Sbjct  62   FDADNLTLKPIPNLCFEHPYPPTKLMFHPNPFDSLKSNDILASCSDYLRLWEVGDTSIEP  121

Query  481  VSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            + TL+ +KTSEY APLTSFDWNEVEPRRIGTSSIDTTCTIWD
Sbjct  122  LFTLSKNKTSEYVAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  163



>dbj|BAJ33517.1| WD-repeats transcriptional factor [Dahlia pinnata]
Length=344

 Score =   217 bits (552),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 111/163 (68%), Positives = 138/163 (85%), Gaps = 1/163 (1%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            M+ ST  S +RS+N VTYESPY +++MA+SS AAA     RR +A+GSF+EEY NRV+I+
Sbjct  1    MDTSTLESQIRSDNFVTYESPYTLYSMAISSSAAASSRSSRRRIALGSFIEEYANRVDIV  60

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  477
            +F+EDT+++K NP L+FDHPYPPTKLMF+PNP     SAD+L SSGD+LRL+ VR+ SIE
Sbjct  61   TFDEDTLSIKPNPNLSFDHPYPPTKLMFNPNPNPK-PSADILASSGDFLRLYGVRDTSIE  119

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            P+S LNNSK+SE+CAPLTSFDWNE+EPRRIGTSSIDTTCTIWD
Sbjct  120  PLSVLNNSKSSEFCAPLTSFDWNELEPRRIGTSSIDTTCTIWD  162



>ref|XP_010421276.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1 [Camelina sativa]
 ref|XP_010421277.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1 [Camelina sativa]
 ref|XP_010454769.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1 isoform X1 [Camelina 
sativa]
 ref|XP_010454770.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1 isoform X2 [Camelina 
sativa]
 ref|XP_010454771.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1 isoform X1 [Camelina 
sativa]
 ref|XP_010493613.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1 [Camelina sativa]
 ref|XP_010493614.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1 [Camelina sativa]
Length=344

 Score =   216 bits (551),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 129/165 (78%), Gaps = 3/165 (2%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            M+NS   S  RSE +VTY+SPYP++AMA SS  AA+     R +AVGSFLE+Y NR++IL
Sbjct  1    MDNSAPDSLSRSETAVTYDSPYPLYAMAFSSLRAANTSSGHR-IAVGSFLEDYNNRIDIL  59

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREAS--  471
            SF+ D++T+K  P L+F+HPYPPTKLMF P       S DLL SSGD+LRLWE+ E S  
Sbjct  60   SFDSDSMTVKPLPNLSFEHPYPPTKLMFSPPSLRRPSSGDLLASSGDFLRLWEINEDSST  119

Query  472  IEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            +EP+S LNNSKTSE+CAPLTSFDWN+VEP+R+GT SIDTTCTIWD
Sbjct  120  VEPISVLNNSKTSEFCAPLTSFDWNDVEPKRLGTCSIDTTCTIWD  164



>gb|AEC11089.1| WD40 transcription factor [Diospyros kaki]
Length=337

 Score =   215 bits (548),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 108/165 (65%), Positives = 137/165 (83%), Gaps = 10/165 (6%)
 Frame = +1

Query  118  MENST-QGSNLRS-ENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVE  291
            MENST +  +LRS E+ VTY+SPYP++A+A+S  +AAHH      +AVGSF+EEY N V+
Sbjct  1    MENSTLESHHLRSSEHFVTYDSPYPLYAVALSP-SAAHH-----RIAVGSFIEEYANHVD  54

Query  292  ILSFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREAS  471
            ILSF++DT+ ++ NP L+FDH +P TKLMF   P+++ KSAD+L SSG+YLRLWEVR++S
Sbjct  55   ILSFDDDTLAIRPNPALSFDHTFPATKLMF--RPSSAGKSADVLASSGEYLRLWEVRDSS  112

Query  472  IEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            +E +  LNNSKTSE+CAPLTSFDWNEVEPRRIGTSSIDTTCTIWD
Sbjct  113  VEQLLVLNNSKTSEFCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  157



>gb|AFM74035.1| WD repeat family protein [Acer palmatum]
Length=337

 Score =   214 bits (546),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 140/163 (86%), Gaps = 6/163 (4%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            ME+S   S+LRSEN VTYESPY ++AMA+SS +A+ H    + +A+GSF+E++ NRV+I+
Sbjct  1    MESSRTESHLRSENYVTYESPYQLYAMALSSSSASRH----QRIALGSFIEDFNNRVDIV  56

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  477
            SF+ +T+++KT+P L+FDHPYPPTKLMF P  T+  KS+DLL SSGD LRLWEVR++S+E
Sbjct  57   SFDPETLSIKTHPSLSFDHPYPPTKLMFQP--TSLRKSSDLLASSGDLLRLWEVRDSSVE  114

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            P++ LNNSK+SE+CAPLTSFDWNE+EP+R+GTSSIDTTCTIWD
Sbjct  115  PLTVLNNSKSSEFCAPLTSFDWNEIEPKRLGTSSIDTTCTIWD  157



>gb|KJB24019.1| hypothetical protein B456_004G125200 [Gossypium raimondii]
Length=343

 Score =   214 bits (545),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 135/164 (82%), Gaps = 2/164 (1%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MENSTQ S+LRS+N+VTYESPYP++AMA+SS  A  H L  + +A+GSF+E+Y NRV I+
Sbjct  1    MENSTQESHLRSDNAVTYESPYPLYAMALSSTPAVTH-LNHQRIALGSFIEDYANRVHII  59

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSS-GDYLRLWEVREASI  474
            SF+ +++TL T+P L+FDHPYPPTKLMF P+  +   S+  L++S GDYLRLWEV  +SI
Sbjct  60   SFDPESLTLTTHPSLSFDHPYPPTKLMFQPHRKSPFSSSSDLLASSGDYLRLWEVGHSSI  119

Query  475  EPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            E +S L+NSKTSE+ APLTSFDWN+VEP RIGTSSIDTTCTIWD
Sbjct  120  ELISILDNSKTSEFSAPLTSFDWNDVEPNRIGTSSIDTTCTIWD  163



>gb|KFK27728.1| protein transparent testa glabra 1 [Arabis alpina]
Length=343

 Score =   213 bits (543),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 127/165 (77%), Gaps = 4/165 (2%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            M+NS   S  RSE +VTYESPYP++AMA SS  A      R  +AVGSFLE+Y NR++IL
Sbjct  1    MDNSAPDSLSRSETAVTYESPYPLYAMAFSSSRAGTSSGHR--IAVGSFLEDYNNRIDIL  58

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREAS--  471
            +F+ D++T+K+ P L+ DHPYPPTKLMF P       + DLL SSGD+LRLWEV E S  
Sbjct  59   TFDSDSMTIKSLPNLSVDHPYPPTKLMFSPPSLRRPSAGDLLASSGDFLRLWEVNEDSST  118

Query  472  IEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            +EPV+ LNNSKTSE+CAPLTSFDWN+VEP+R+GT SIDTTCTIWD
Sbjct  119  VEPVAVLNNSKTSEFCAPLTSFDWNDVEPKRLGTCSIDTTCTIWD  163



>ref|XP_006394707.1| hypothetical protein EUTSA_v10004515mg [Eutrema salsugineum]
 gb|ESQ31993.1| hypothetical protein EUTSA_v10004515mg [Eutrema salsugineum]
Length=343

 Score =   213 bits (542),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 127/165 (77%), Gaps = 4/165 (2%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            M+NS   S  RSE +VTY+SPYP++AMA SS  A      R  +AVGSFLE+Y NR++IL
Sbjct  1    MDNSAPDSFSRSETAVTYDSPYPLYAMAFSSIRAGTPSGHR--IAVGSFLEDYNNRIDIL  58

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREAS--  471
            SF+ D++T+K  P L+F+HPYPPTKLMF P       S DLL SSGD+LRLWE+ + S  
Sbjct  59   SFDSDSMTVKPLPNLSFEHPYPPTKLMFSPPSLRRPSSGDLLASSGDFLRLWEISDDSTT  118

Query  472  IEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            +EPVS LNNSKTSE+CAPLTSFDWN+VEP+R+GT SIDTTCTIWD
Sbjct  119  VEPVSVLNNSKTSEFCAPLTSFDWNDVEPKRLGTCSIDTTCTIWD  163



>gb|AAM95641.1| WD-repeat protein GhTTG1 [Gossypium hirsutum]
Length=343

 Score =   213 bits (542),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 135/164 (82%), Gaps = 2/164 (1%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MENSTQ S+LRS+N+VTYESPYP++AMA+SS  A  H L  + +A+GSF+E+Y NRV I+
Sbjct  1    MENSTQESHLRSDNAVTYESPYPLYAMALSSTPAVTH-LNYQRIALGSFIEDYTNRVHII  59

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSS-GDYLRLWEVREASI  474
            SF+ +++TL T+P L+FDHPYPPTKLMF P+  +   S+  L++S GDYLRLWEV  +SI
Sbjct  60   SFDPESLTLITHPSLSFDHPYPPTKLMFQPHRKSPFSSSSDLLASSGDYLRLWEVGHSSI  119

Query  475  EPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            E +S L+NSKTSE+ APLTSFDWN+VEP RIGTSSIDTTCTIWD
Sbjct  120  ELISVLDNSKTSEFSAPLTSFDWNDVEPNRIGTSSIDTTCTIWD  163



>gb|AFD20561.1| transparent testa glabra 1, partial [Gossypium arboreum]
Length=343

 Score =   212 bits (540),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 134/164 (82%), Gaps = 2/164 (1%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MENSTQ S+LRS+N+VTYESPYP++AMA+SS  A  H L  + +A+GSF+E Y NRV I+
Sbjct  1    MENSTQESHLRSDNAVTYESPYPLYAMALSSTPAVTH-LNYQRIALGSFIEGYTNRVHII  59

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSS-GDYLRLWEVREASI  474
            SF+ +++TL T+P L+FDHPYPPTKLMF P+  +   S+  L++S GDYLRLWEV  +SI
Sbjct  60   SFDPESLTLTTHPSLSFDHPYPPTKLMFQPHRKSPFSSSSDLLASSGDYLRLWEVGHSSI  119

Query  475  EPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            E +S L+NSKTSE+ APLTSFDWN+VEP RIGTSSIDTTCTIWD
Sbjct  120  ELISVLDNSKTSEFSAPLTSFDWNDVEPNRIGTSSIDTTCTIWD  163



>ref|NP_197840.1| protein TRANSPARENT TESTA GLABRA 1 [Arabidopsis thaliana]
 ref|NP_851069.1| protein TRANSPARENT TESTA GLABRA 1 [Arabidopsis thaliana]
 ref|NP_851070.1| protein TRANSPARENT TESTA GLABRA 1 [Arabidopsis thaliana]
 sp|Q9XGN1.1|TTG1_ARATH RecName: Full=Protein TRANSPARENT TESTA GLABRA 1 [Arabidopsis 
thaliana]
 emb|CAB45372.1| Ttg1 protein [Arabidopsis thaliana]
 dbj|BAB11204.1| Ttg1 protein [Arabidopsis thaliana]
 emb|CAC10523.1| transparent testa glabra 1 protein [Arabidopsis thaliana]
 gb|AAV74225.1| At5g24520 [Arabidopsis thaliana]
 gb|AAW39014.1| At5g24520 [Arabidopsis thaliana]
 dbj|BAE99249.1| Ttg1 protein [Arabidopsis thaliana]
 gb|AED93319.1| protein TRANSPARENT TESTA GLABRA 1 [Arabidopsis thaliana]
 gb|AED93320.1| protein TRANSPARENT TESTA GLABRA 1 [Arabidopsis thaliana]
 gb|AED93321.1| protein TRANSPARENT TESTA GLABRA 1 [Arabidopsis thaliana]
Length=341

 Score =   212 bits (539),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 129/165 (78%), Gaps = 6/165 (4%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            M+NS   S  RSE +VTY+SPYP++AMA SS  ++  G R   +AVGSFLE+Y NR++IL
Sbjct  1    MDNSAPDSLSRSETAVTYDSPYPLYAMAFSSLRSSS-GHR---IAVGSFLEDYNNRIDIL  56

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREAS--  471
            SF+ D++T+K  P L+F+HPYPPTKLMF P       S DLL SSGD+LRLWE+ E S  
Sbjct  57   SFDSDSMTVKPLPNLSFEHPYPPTKLMFSPPSLRRPSSGDLLASSGDFLRLWEINEDSST  116

Query  472  IEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            +EP+S LNNSKTSE+CAPLTSFDWN+VEP+R+GT SIDTTCTIWD
Sbjct  117  VEPISVLNNSKTSEFCAPLTSFDWNDVEPKRLGTCSIDTTCTIWD  161



>ref|XP_002874204.1| hypothetical protein ARALYDRAFT_489315 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50463.1| hypothetical protein ARALYDRAFT_489315 [Arabidopsis lyrata subsp. 
lyrata]
Length=341

 Score =   212 bits (539),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 130/165 (79%), Gaps = 6/165 (4%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            M+NS   S  RSE +VTY+SPYP++AMA SS  ++  G R   +AVGSFLE+Y NR++IL
Sbjct  1    MDNSAPDSLSRSETAVTYDSPYPLYAMAFSSLRSSP-GHR---IAVGSFLEDYNNRIDIL  56

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREAS--  471
            SF+ D++T+K +P L+F+HPYPPTKLMF P       + DLL SSGD+LRLWE+ E S  
Sbjct  57   SFDSDSMTVKPHPNLSFEHPYPPTKLMFSPPSLRRPSAGDLLASSGDFLRLWEINEDSST  116

Query  472  IEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            +EP+S LNNSKTSE+CAPLTSFDWN+VEP+R+GT SIDTTCTIWD
Sbjct  117  VEPISVLNNSKTSEFCAPLTSFDWNDVEPKRLGTCSIDTTCTIWD  161



>gb|ACJ06978.1| transparent testa glabra 1 [Nicotiana tabacum]
Length=341

 Score =   212 bits (539),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 129/165 (78%), Gaps = 6/165 (4%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            M+NS   S  RSE +VTY+SPYP++AMA SS  ++  G R   +AVGSFLE+Y NR++IL
Sbjct  1    MDNSAPDSLSRSETAVTYDSPYPLYAMAFSSLRSSS-GHR---IAVGSFLEDYNNRIDIL  56

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREAS--  471
            SF+ D++T+K  P L+F+HPYPPTKLMF P       S DLL SSGD+LRLWE+ E S  
Sbjct  57   SFDSDSMTVKPLPNLSFEHPYPPTKLMFSPPSLRRPSSGDLLASSGDFLRLWEINEDSST  116

Query  472  IEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            +EP+S LNNSKTSE+CAPLTSFDWN+VEP+R+GT SIDTTCTIWD
Sbjct  117  VEPISILNNSKTSEFCAPLTSFDWNDVEPKRLGTCSIDTTCTIWD  161



>ref|XP_004235027.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1-like [Solanum lycopersicum]
Length=342

 Score =   212 bits (539),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = +1

Query  121  ENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILS  300
            + S + S+LRS NSVTY+S YPI+AMA SSF ++      R +A+GSF+EE  N V+ILS
Sbjct  3    KKSGKKSHLRSGNSVTYDSSYPIYAMAFSSFTSSLPNCHPR-IAIGSFIEEINNCVDILS  61

Query  301  FEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEP  480
            F+   +TLK  P L F+HPYPPTKLMFHPNP  S+KS D+L S  DYLRLWEVR+ SI+ 
Sbjct  62   FDAYNLTLKPIPNLCFEHPYPPTKLMFHPNPFDSLKSNDILASCSDYLRLWEVRDTSIKD  121

Query  481  VSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            + T N +K+ EY APLTSFDWN+VEPRRIGTSSIDTTCTIWD
Sbjct  122  LVTFNKNKSGEYVAPLTSFDWNDVEPRRIGTSSIDTTCTIWD  163



>dbj|BAD89974.1| mutant protein of TTG1 [Arabidopsis thaliana]
Length=332

 Score =   211 bits (538),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 129/165 (78%), Gaps = 6/165 (4%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            M+NS   S  RSE +VTY+SPYP++AMA SS  ++  G R   +AVGSFLE+Y NR++IL
Sbjct  1    MDNSAPDSLSRSETAVTYDSPYPLYAMAFSSLRSSS-GHR---IAVGSFLEDYNNRIDIL  56

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREAS--  471
            SF+ D++T+K  P L+F+HPYPPTKLMF P       S DLL SSGD+LRLWE+ E S  
Sbjct  57   SFDSDSMTVKPLPNLSFEHPYPPTKLMFSPPSLRRPSSGDLLASSGDFLRLWEINEDSST  116

Query  472  IEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            +EP+S LNNSKTSE+CAPLTSFDWN+VEP+R+GT SIDTTCTIWD
Sbjct  117  VEPISVLNNSKTSEFCAPLTSFDWNDVEPKRLGTCSIDTTCTIWD  161



>gb|AAM95642.1| WD-repeat protein GhTTG1 [Gossypium hirsutum]
Length=341

 Score =   209 bits (533),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 133/162 (82%), Gaps = 2/162 (1%)
 Frame = +1

Query  124  NSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSF  303
            NSTQ S+LRS+N+VTYESPYP++AMA+SS  A  H L  + +A+GSF+E+Y NRV I+SF
Sbjct  1    NSTQESHLRSDNAVTYESPYPLYAMALSSTPAVTH-LNHQRIALGSFIEDYANRVHIISF  59

Query  304  EEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSS-GDYLRLWEVREASIEP  480
            + +++TL T+P L+FDHPYPPTKLMF P+  +   S+  L++S GDYLRLWEV  +SIE 
Sbjct  60   DPESLTLTTHPSLSFDHPYPPTKLMFQPHRKSPFSSSSDLLASSGDYLRLWEVGHSSIEL  119

Query  481  VSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            +S L+NSKTSE+ APLTSFDWN+VEP RIGTSSIDTTCTIWD
Sbjct  120  ISILDNSKTSEFSAPLTSFDWNDVEPNRIGTSSIDTTCTIWD  161



>emb|CAC10524.1| transparent testa glabra 1 [Arabidopsis thaliana]
Length=341

 Score =   209 bits (533),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 128/165 (78%), Gaps = 6/165 (4%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            M+NS   S  RSE +VTY+SPYP++AMA SS  ++  G R   +AVGSFLE+Y NR++IL
Sbjct  1    MDNSAPDSLSRSETAVTYDSPYPLYAMAFSSLRSSS-GHR---IAVGSFLEDYNNRIDIL  56

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREAS--  471
            SF+ D++T+K  P L+F+HPYPPTKLMF P       S DLL S GD+LRLWE+ E S  
Sbjct  57   SFDSDSMTVKPLPNLSFEHPYPPTKLMFSPPSLRRPSSGDLLASFGDFLRLWEINEDSST  116

Query  472  IEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            +EP+S LNNSKTSE+CAPLTSFDWN+VEP+R+GT SIDTTCTIWD
Sbjct  117  VEPISVLNNSKTSEFCAPLTSFDWNDVEPKRLGTCSIDTTCTIWD  161



>gb|ACN58396.1| WD40 protein [Saussurea medusa]
Length=337

 Score =   209 bits (532),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/163 (62%), Positives = 128/163 (79%), Gaps = 6/163 (4%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            M+ ST  S +RS+N VTYE PY +++MA+SS A +    RR  +AVGSF+EEY N ++I+
Sbjct  1    MDTSTLESQIRSDNYVTYEFPYTLYSMAISS-ATSRSSHRR--IAVGSFIEEYTNHIDIV  57

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  477
            +F E+T+++K NP  + +HPYPPTKLMF PNP  S    + L SSGD+LRLW V + SIE
Sbjct  58   TFHEETLSIKPNPNFSINHPYPPTKLMFQPNPDLS---GETLASSGDFLRLWRVSDDSIE  114

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            P+S LNNSK+SE+CAPLTSFDW+EVEPRRIGTSSIDTTCTIWD
Sbjct  115  PISVLNNSKSSEFCAPLTSFDWSEVEPRRIGTSSIDTTCTIWD  157



>gb|ADP38078.1| WD40 transcription regulator [Brassica oleracea var. botrytis]
Length=337

 Score =   208 bits (530),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 127/165 (77%), Gaps = 10/165 (6%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            M+NS   S  RSE +VTY+SPYP++AM   SF+++ H      +AVGSFLE+Y NR++IL
Sbjct  1    MDNSAPDSLPRSETAVTYDSPYPLYAM---SFSSSTH-----RIAVGSFLEDYNNRIDIL  52

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVRE--AS  471
            SF+ D+++LK  P L+F+HPYPPTKLMF P         DLL SSGD+LRLWEV E  +S
Sbjct  53   SFDSDSMSLKPLPSLSFEHPYPPTKLMFSPPSLRRSSGGDLLASSGDFLRLWEVNEDSSS  112

Query  472  IEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
             EPVS LNNSKTSE+CAPLTSFDWN+VEP+R+GT SIDTTCTIWD
Sbjct  113  AEPVSVLNNSKTSEFCAPLTSFDWNDVEPKRLGTCSIDTTCTIWD  157



>gb|ADV03945.1| WD40 regulatory factor BolC.TTG1 [Brassica oleracea]
Length=337

 Score =   208 bits (530),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 127/165 (77%), Gaps = 10/165 (6%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            M+NS   S  RSE +VTY+SPYP++AM   SF+++ H      +AVGSFLE+Y NR++IL
Sbjct  1    MDNSAPDSLPRSETAVTYDSPYPLYAM---SFSSSTH-----RIAVGSFLEDYNNRIDIL  52

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVRE--AS  471
            SF+ D+++LK  P L+F+HPYPPTKLMF P         DLL SSGD+LRLWEV E  +S
Sbjct  53   SFDSDSMSLKPLPSLSFEHPYPPTKLMFSPPSLRRSSGGDLLASSGDFLRLWEVNEDSSS  112

Query  472  IEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
             EPVS LNNSKTSE+CAPLTSFDWN+VEP+R+GT SIDTTCTIWD
Sbjct  113  AEPVSVLNNSKTSEFCAPLTSFDWNDVEPKRLGTCSIDTTCTIWD  157



>gb|ABY59776.1| WD-repeat regulatory factor [Brassica napus]
Length=337

 Score =   208 bits (530),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 127/165 (77%), Gaps = 10/165 (6%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            M+NS   S  RSE +VTY+SPYP++AM   SF+++ H      +AVGSFLE+Y NR++IL
Sbjct  1    MDNSAPDSLPRSETAVTYDSPYPLYAM---SFSSSTH-----RIAVGSFLEDYNNRIDIL  52

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVRE--AS  471
            SF+ D+++LK  P L+F+HPYPPTKLMF P         DLL SSGD+LRLWEV E  +S
Sbjct  53   SFDSDSMSLKPLPSLSFEHPYPPTKLMFSPPSLRRSGGGDLLASSGDFLRLWEVNEDSSS  112

Query  472  IEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
             EPVS LNNSKTSE+CAPLTSFDWN+VEP+R+GT SIDTTCTIWD
Sbjct  113  AEPVSVLNNSKTSEFCAPLTSFDWNDVEPKRLGTCSIDTTCTIWD  157



>ref|XP_009150977.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1 [Brassica rapa]
 ref|XP_009150978.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1 [Brassica rapa]
 gb|ABP04011.1| transparent testa glabra 1 isoform 1 [Brassica napus]
 gb|ABP04012.1| transparent testa glabra 1 isoform 1 [Brassica napus]
 gb|ABP04013.1| transparent testa glabra 1 isoform 1 [Brassica napus]
 gb|ABQ10570.1| WD-like protein [Brassica rapa subsp. pekinensis]
 gb|ABQ10571.1| WD-like protein [Brassica rapa subsp. pekinensis]
Length=337

 Score =   208 bits (529),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 127/165 (77%), Gaps = 10/165 (6%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            M+NS   S  RSE +VTY+SPYP++AM   SF+++ H      +AVGSFLE+Y NR++IL
Sbjct  1    MDNSAPDSLPRSETAVTYDSPYPLYAM---SFSSSTH-----RIAVGSFLEDYNNRIDIL  52

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVRE--AS  471
            SF+ D+++LK  P L+F+HPYPPTKLMF P         DLL SSGD+LRLWEV E  +S
Sbjct  53   SFDSDSMSLKPLPSLSFEHPYPPTKLMFSPPSLRRSGGGDLLASSGDFLRLWEVNEDSSS  112

Query  472  IEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
             EPVS LNNSKTSE+CAPLTSFDWN+VEP+R+GT SIDTTCTIWD
Sbjct  113  AEPVSVLNNSKTSEFCAPLTSFDWNDVEPKRLGTCSIDTTCTIWD  157



>gb|ABY59775.1| WD-repeat regulatory factor [Brassica napus]
Length=337

 Score =   208 bits (529),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 127/165 (77%), Gaps = 10/165 (6%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            M+NS   S  RSE +VTY+SPYP++AM   SF+++ H      +AVGSFLE+Y NR++IL
Sbjct  1    MDNSAPDSLPRSETAVTYDSPYPLYAM---SFSSSTH-----RIAVGSFLEDYNNRIDIL  52

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVRE--AS  471
            SF+ D+++LK  P L+F+HPYPPTKLMF P         DLL SSGD+LRLWEV E  +S
Sbjct  53   SFDSDSMSLKPLPSLSFEHPYPPTKLMFSPPSLRRSGGGDLLASSGDFLRLWEVNEDSSS  112

Query  472  IEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
             EPVS LNNSKTSE+CAPLTSFDWN+VEP+R+GT SIDTTCTIWD
Sbjct  113  AEPVSVLNNSKTSEFCAPLTSFDWNDVEPKRLGTCSIDTTCTIWD  157



>gb|ABP04014.1| transparent testa glabra 1 isoform 2 [Brassica napus]
 gb|ABP04015.1| transparent testa glabra 1 isoform 2 [Brassica napus]
Length=337

 Score =   208 bits (529),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 127/165 (77%), Gaps = 10/165 (6%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            M+NS   S  RSE +VTY+SPYP++AM   SF+++ H      +AVGSFLE+Y NR++IL
Sbjct  1    MDNSAPDSLPRSETAVTYDSPYPLYAM---SFSSSTH-----RIAVGSFLEDYNNRIDIL  52

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVRE--AS  471
            SF+ D+++LK  P L+F+HPYPPTKLMF P         DLL SSGD+LRLWEV E  +S
Sbjct  53   SFDSDSMSLKPLPSLSFEHPYPPTKLMFSPPSLRRSGGGDLLASSGDFLRLWEVNEDSSS  112

Query  472  IEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
             EPVS LNNSKTSE+CAPLTSFDWN+VEP+R+GT SIDTTCTIWD
Sbjct  113  AEPVSVLNNSKTSEFCAPLTSFDWNDVEPKRLGTCSIDTTCTIWD  157



>gb|AGW45475.1| BVTTG1 [Brassica villosa]
Length=337

 Score =   207 bits (527),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 127/165 (77%), Gaps = 10/165 (6%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            M+N+   S  RSE +VTY+SPYP++AM   SF+++ H      +AVGSFLE+Y NR++IL
Sbjct  1    MDNAAPDSLPRSETAVTYDSPYPLYAM---SFSSSTH-----RIAVGSFLEDYNNRIDIL  52

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVRE--AS  471
            SF+ D+++LK  P L+F+HPYPPTKLMF P         DLL SSGD+LRLWEV E  +S
Sbjct  53   SFDSDSMSLKPLPSLSFEHPYPPTKLMFSPPSLRRSSGGDLLASSGDFLRLWEVNEDSSS  112

Query  472  IEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
             EPVS LNNSKTSE+CAPLTSFDWN+VEP+R+GT SIDTTCTIWD
Sbjct  113  AEPVSVLNNSKTSEFCAPLTSFDWNDVEPKRLGTCSIDTTCTIWD  157



>gb|ADK11704.1| transparent testa glabra 1 [Brassica rapa subsp. rapa]
Length=337

 Score =   207 bits (527),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 127/165 (77%), Gaps = 10/165 (6%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            M+N+   S  RSE +VTY+SPYP++AM   SF+++ H      +AVGSFLE+Y NR++IL
Sbjct  1    MDNAAPDSLPRSETAVTYDSPYPLYAM---SFSSSTH-----RIAVGSFLEDYNNRIDIL  52

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVRE--AS  471
            SF+ D+++LK  P L+F+HPYPPTKLMF P         DLL SSGD+LRLWEV E  +S
Sbjct  53   SFDSDSMSLKPLPSLSFEHPYPPTKLMFSPPSLRRSGGGDLLASSGDFLRLWEVNEDSSS  112

Query  472  IEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
             EPVS LNNSKTSE+CAPLTSFDWN+VEP+R+GT SIDTTCTIWD
Sbjct  113  AEPVSVLNNSKTSEFCAPLTSFDWNDVEPKRLGTCSIDTTCTIWD  157



>ref|XP_002321353.2| hypothetical protein POPTR_0015s00470g [Populus trichocarpa]
 gb|EEF05480.2| hypothetical protein POPTR_0015s00470g [Populus trichocarpa]
Length=346

 Score =   206 bits (524),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 129/154 (84%), Gaps = 5/154 (3%)
 Frame = +1

Query  148  RSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDTVTLK  327
            +SEN+VTYESPYP++AMA+SS  +  +  +R  +A+GSF E+Y NR++I+SF+ +T+++K
Sbjct  17   QSENTVTYESPYPLYAMAISSTPSRTNQYQR--IALGSFTEDYNNRIDIVSFDPETLSVK  74

Query  328  TNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVRE-ASIEPVSTLNNSK  504
            T+  L+ +HPYPPTKLMF  +P++  KS DLL SSGDYLRLWEVR+ ASIEPV  LNNSK
Sbjct  75   THQNLSLEHPYPPTKLMF--SPSSLHKSNDLLASSGDYLRLWEVRDSASIEPVFVLNNSK  132

Query  505  TSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            T E+CAPLTSFDWN++EP+RIGT S+DTTCTIWD
Sbjct  133  TGEFCAPLTSFDWNDIEPKRIGTCSVDTTCTIWD  166



>emb|CAE53274.1| transparenta testa glabra 1 protein [Matthiola incana]
Length=329

 Score =   205 bits (521),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 120/155 (77%), Gaps = 8/155 (5%)
 Frame = +1

Query  148  RSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDTVTLK  327
            RSE +VTY+SPYP++AMA SS  A         +AVGSFLE+Y NR++ILSF+ D++T+K
Sbjct  1    RSEAAVTYDSPYPLYAMAFSSSRAGQR------IAVGSFLEDYNNRIDILSFDSDSMTVK  54

Query  328  TNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREAS--IEPVSTLNNS  501
              P L+F+HPYPPTKL+F P         DLL SSGD+LRLWEV E S  +EPVS LNNS
Sbjct  55   PLPNLSFEHPYPPTKLLFSPPSLRRPSGGDLLASSGDFLRLWEVSEDSSTVEPVSVLNNS  114

Query  502  KTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            KTSE+CAPLTSFDWN+VEP+R+GT SIDTTCTIWD
Sbjct  115  KTSEFCAPLTSFDWNDVEPKRLGTCSIDTTCTIWD  149



>emb|CEL26643.1| WD40, partial [Ribes uva-crispa]
Length=294

 Score =   198 bits (504),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 112/131 (85%), Gaps = 5/131 (4%)
 Frame = +1

Query  220  AHHGLRRRSVAVGSFLEEYKNRVEILSFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTA  399
            +HH  R   +AVGSF+EEY NRV+I+SF+++T+++KT+P L+FDHPYPPTKLMF PN + 
Sbjct  10   SHHHHR---IAVGSFVEEYSNRVDIVSFDDETLSIKTHPTLSFDHPYPPTKLMFQPNSST  66

Query  400  SMKSA--DLLVSSGDYLRLWEVREASIEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGT  573
            S      DLL SSGDYLRLWEVRE SIEPVS LNNSK+SE+CAPLTSFDWNEVEPRRIGT
Sbjct  67   SSLRKSSDLLASSGDYLRLWEVRENSIEPVSILNNSKSSEFCAPLTSFDWNEVEPRRIGT  126

Query  574  SSIDTTCTIWD  606
            SSIDTTCT+WD
Sbjct  127  SSIDTTCTVWD  137



>emb|CEL26644.1| WD40, partial [Ribes nigrum]
Length=259

 Score =   197 bits (500),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 111/131 (85%), Gaps = 5/131 (4%)
 Frame = +1

Query  220  AHHGLRRRSVAVGSFLEEYKNRVEILSFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTA  399
            +HH  R   +AVGSF+EEY NRV+I+SF+++T+++KT+P L+FDHPYPPTKLMF PN + 
Sbjct  10   SHHHHR---IAVGSFVEEYSNRVDIVSFDDETLSIKTHPTLSFDHPYPPTKLMFQPNSST  66

Query  400  SMKSA--DLLVSSGDYLRLWEVREASIEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGT  573
            S      DLL SSGDYLRLWEVRE SIEPVS LNNSK+SE+CAPLTSFDWNEVEPRRIGT
Sbjct  67   SSLRKSSDLLASSGDYLRLWEVRENSIEPVSILNNSKSSEFCAPLTSFDWNEVEPRRIGT  126

Query  574  SSIDTTCTIWD  606
            SSIDT CT+WD
Sbjct  127  SSIDTACTVWD  137



>gb|EPS57104.1| hypothetical protein M569_17720 [Genlisea aurea]
Length=336

 Score =   199 bits (505),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 121/152 (80%), Gaps = 10/152 (7%)
 Frame = +1

Query  151  SENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDTVTLKT  330
            +E  V+Y+ PY I+AMA   F+AA  G     +AVGSFLEE+ NRVE LSF +++ +L  
Sbjct  14   AECVVSYDFPYTIYAMA---FSAAERG----RIAVGSFLEEHNNRVEFLSFSDESSSLNP  66

Query  331  NPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEPVSTLNNSKTS  510
            NP L FDHPYPPTKL FHP+P+     A+L+ SSGD+LRLW++++ASI+ VSTLNNSK+S
Sbjct  67   NPSLFFDHPYPPTKLQFHPSPS---PPANLIASSGDFLRLWQIKDASIDSVSTLNNSKSS  123

Query  511  EYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            EY APLTSFDWNE+EPRRIGTSSIDTTCTIWD
Sbjct  124  EYSAPLTSFDWNEIEPRRIGTSSIDTTCTIWD  155



>ref|NP_001267687.1| protein TRANSPARENT TESTA GLABRA 1-like [Cucumis sativus]
 gb|ABY64743.1| WD-repeat protein [Cucumis sativus]
 gb|KGN53658.1| WD-repeat protein [Cucumis sativus]
Length=333

 Score =   187 bits (475),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 128/154 (83%), Gaps = 8/154 (5%)
 Frame = +1

Query  148  RSENSVTYESPYPIFAMAVSSFAAAHHGLRRRS-VAVGSFLEEYKNRVEILSFEEDTVTL  324
            RSE   TYESP+P++AMA+SS  A  H L   S +A+GSF+EEY NRV+I+SF+ D++++
Sbjct  7    RSEFLATYESPHPLYAMAISSPHA--HSLNFSSRIALGSFVEEYNNRVDIVSFDPDSISI  64

Query  325  KTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEPVSTLNNSK  504
            K NP L+F+HPYPPTKLMF+P+P +S+ ++     SGD LRLW++ ++SIEP+S LNNSK
Sbjct  65   KANPSLSFEHPYPPTKLMFNPSPLSSLLAS-----SGDSLRLWKLGDSSIEPLSLLNNSK  119

Query  505  TSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            TSE+CAPLTSFDWNEVEP+RIGTSSIDTTCTIWD
Sbjct  120  TSEFCAPLTSFDWNEVEPKRIGTSSIDTTCTIWD  153



>ref|XP_008455615.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1 [Cucumis melo]
Length=333

 Score =   187 bits (475),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 101/163 (62%), Positives = 130/163 (80%), Gaps = 10/163 (6%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            MEN+      RSE   TY+SP+P++AMA+SS  A       R +A+GSF+EEY NRV+I+
Sbjct  1    MENAAS----RSEFLATYDSPHPLYAMAISSPHAHSLNFSSR-IALGSFVEEYNNRVDIV  55

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  477
            SF+ D+V++KTNP L+F+HPYPPTKLMF+P+P +S+ ++     SGD LRLW+V ++SIE
Sbjct  56   SFDPDSVSIKTNPSLSFEHPYPPTKLMFNPSPLSSLLAS-----SGDSLRLWKVGDSSIE  110

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            P+S LNNSKTSE+CAPLTSFDWNEVE +RIGTSSIDTTCTIWD
Sbjct  111  PLSLLNNSKTSEFCAPLTSFDWNEVELKRIGTSSIDTTCTIWD  153



>ref|XP_010671335.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1 [Beta vulgaris 
subsp. vulgaris]
Length=349

 Score =   177 bits (448),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 129/168 (77%), Gaps = 8/168 (5%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRS----VAVGSFLEEYKNR  285
            +E S Q SN  + N VTY+SPYP++AM   SF+ +  G+ RRS    +AVGSF+EEY NR
Sbjct  5    IEESHQFSNNNNNNLVTYDSPYPLYAM---SFSLSSAGICRRSSDQIIAVGSFIEEYNNR  61

Query  286  VEILSFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSG-DYLRLWEVR  462
            V++L+F+++T+TL   P L+F HPYP TKLMF P+ ++S  S+  L++S  DYLRL+ V+
Sbjct  62   VDLLTFDKETLTLNLTPNLSFSHPYPSTKLMFQPSSSSSSSSSPPLLASSADYLRLYSVK  121

Query  463  EASIEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
              SIE VS LNNSK+S++CAPLTSFDWN+V P+RIGTSSIDTTCTIWD
Sbjct  122  NDSIELVSLLNNSKSSDFCAPLTSFDWNDVVPQRIGTSSIDTTCTIWD  169



>gb|AFY06991.1| TTG1 [Beta vulgaris]
Length=350

 Score =   176 bits (447),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 127/169 (75%), Gaps = 9/169 (5%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRS----VAVGSFLEEYKNR  285
            +E S Q SN  + N VTY+SPYP++AM   SF+ +  G+ RRS    +AVGSF+EEY NR
Sbjct  5    IEESHQFSNNNNNNLVTYDSPYPLYAM---SFSLSSAGICRRSSDQIIAVGSFIEEYNNR  61

Query  286  VEILSFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSG--DYLRLWEV  459
            V++L+F+++T+TL   P L+F HPYP TKLMF P+ ++S  S+   + +   DYLRL+ V
Sbjct  62   VDLLTFDKETLTLNLTPNLSFSHPYPSTKLMFQPSSSSSSSSSSPPLLASSADYLRLYSV  121

Query  460  REASIEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            +  SIE VS LNNSK+S++CAPLTSFDWN+V P+RIGTSSIDTTCTIWD
Sbjct  122  KNDSIELVSLLNNSKSSDFCAPLTSFDWNDVVPQRIGTSSIDTTCTIWD  170



>ref|XP_001767313.1| predicted protein [Physcomitrella patens]
 gb|EDQ67804.1| predicted protein [Physcomitrella patens]
Length=335

 Score =   176 bits (445),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 108/153 (71%), Gaps = 7/153 (5%)
 Frame = +1

Query  148  RSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDTVTLK  327
            R     TYE+P+PI+ M  S     H  L     A+GSFLE+++N+VEI+  +++T   K
Sbjct  8    RRSEIYTYEAPWPIYGMNWSVRKDKHMRL-----AIGSFLEDHRNKVEIVQLDDETCDFK  62

Query  328  TNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEPVSTLNNSKT  507
             +P L+FDHPYP TK+MF P+     +  DLL ++GDYLR+W++ +  +E  S LNN+K 
Sbjct  63   ADPKLSFDHPYPTTKIMFIPD--KECQKPDLLATTGDYLRIWQIHDDKVESKSLLNNNKY  120

Query  508  SEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            SEYCAPLTSFDWNE EP+R+GTSSIDTTCTIWD
Sbjct  121  SEYCAPLTSFDWNEAEPKRLGTSSIDTTCTIWD  153



>gb|ABR16505.1| unknown [Picea sitchensis]
Length=339

 Score =   176 bits (445),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 115/163 (71%), Gaps = 8/163 (5%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            ME  +Q +  +SE   TYE+P+ I+ M  S         ++  + +GSFLEEY NRV+I+
Sbjct  1    MERYSQDTQKKSE-IYTYEAPWQIYGMNWSV-----RKDKKFRLGIGSFLEEYNNRVKII  54

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  477
              +E++   K++P LAFDHPYP TK+MF P+     +  DLL ++GDYLR+W++ E  +E
Sbjct  55   ELDEESGEFKSDPRLAFDHPYPTTKIMFIPD--KECQRPDLLATTGDYLRIWQICEDRVE  112

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            P S LNN+K SE+CAPLTSFDWN+ +P+RIGTSSIDTTCTIWD
Sbjct  113  PKSLLNNNKNSEFCAPLTSFDWNDADPKRIGTSSIDTTCTIWD  155



>ref|XP_009400480.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1-like [Musa acuminata 
subsp. malaccensis]
Length=378

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 119/169 (70%), Gaps = 12/169 (7%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVS------SFAAAHHGLRRRSVAVGSFLEEYK  279
            ME+STQ S L + N+ T++ P+P++AMA S      + + +        +A+GSF+EEY 
Sbjct  24   MESSTQESPL-NPNAFTFDLPHPVYAMAFSPSPFAVASSCSAVAAASPRLALGSFVEEYG  82

Query  280  NRVEILSFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEV  459
            NRV++++F+ED +  + +P L+FDHPYPPTKLMFHP+P        LL S+ D LRLW +
Sbjct  83   NRVDVVAFDEDALAFRPDPALSFDHPYPPTKLMFHPSPLPP-----LLASASDSLRLWHL  137

Query  460  REASIEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
               + E  S L+NSK+S YCAPLTSFDWN+ EPRRIGTSSIDTTCTIWD
Sbjct  138  GPETAELRSVLDNSKSSGYCAPLTSFDWNDEEPRRIGTSSIDTTCTIWD  186



>ref|XP_008783532.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1-like [Phoenix dactylifera]
 ref|XP_008783533.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1-like [Phoenix dactylifera]
 ref|XP_008783534.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1-like [Phoenix dactylifera]
Length=360

 Score =   174 bits (442),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 125/182 (69%), Gaps = 24/182 (13%)
 Frame = +1

Query  118  MENSTQGS--------------NLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAV  255
            ME STQ S              N  S N+ T++SP+P++AMA SS  A    LR   +A+
Sbjct  1    MERSTQESPLTTTTTTTTTTTTNPNSANTYTFDSPHPVYAMAFSSLPAPS-PLR---LAL  56

Query  256  GSFLEEYKNRVEILSFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSG  435
            GSF+E+Y NRV++++F+ED    + +P L+FDHPYPPTKLMFHP P  +  S+ LL SSG
Sbjct  57   GSFIEDYANRVDVVTFDEDARAFRPDPSLSFDHPYPPTKLMFHPKPLPNSSSS-LLASSG  115

Query  436  DYLRLWEVRE-----ASIEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTI  600
            ++LRLW++         +E  + LNNSK+SE+CAPLTSFDWN+ EPRRIGTSSIDTTCT+
Sbjct  116  EFLRLWQLHHHGDSSPKVELRAILNNSKSSEFCAPLTSFDWNDAEPRRIGTSSIDTTCTV  175

Query  601  WD  606
            WD
Sbjct  176  WD  177



>ref|XP_009397632.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1-like [Musa acuminata 
subsp. malaccensis]
Length=356

 Score =   173 bits (438),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 121/164 (74%), Gaps = 8/164 (5%)
 Frame = +1

Query  115  KMENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEI  294
            +ME+STQ S L S N+ T++SP+P++AMA S  +AA     R  +A+GSF+EEY NRV++
Sbjct  16   EMESSTQESPLNS-NAFTFDSPHPVYAMAFSPSSAAAAASPR--LALGSFIEEYGNRVDV  72

Query  295  LSFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASI  474
            +SF+ED ++ +  P ++FDHPYP TKLMFHP+P +      LL S+ D LRLW +     
Sbjct  73   VSFDEDALSFRAEPAVSFDHPYPSTKLMFHPHPNSP-----LLASASDCLRLWLLGPDGA  127

Query  475  EPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            +  S L+NSK+S YCAPLTSFDWN+ EPRRIGTSSIDTTCTIWD
Sbjct  128  KIRSVLDNSKSSGYCAPLTSFDWNDTEPRRIGTSSIDTTCTIWD  171



>ref|XP_008797643.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1-like [Phoenix dactylifera]
 ref|XP_008797644.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1-like [Phoenix dactylifera]
Length=342

 Score =   172 bits (436),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 119/166 (72%), Gaps = 10/166 (6%)
 Frame = +1

Query  118  MENSTQGS-NLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEI  294
            ME+STQ S    ++N+ T++SP+P++AMA SS  A         +A+GSF+E Y NRV++
Sbjct  1    MESSTQESPATATKNTYTFDSPHPVYAMAFSSLPAPSPP----RLALGSFIEGYANRVDV  56

Query  295  LSFEEDTVTLKTNPGLAFDHPYPPTKLMFHP--NPTASMKSADLLVSSGDYLRLWEVREA  468
            ++ +E+  +L+  P  +FDHPYPPTKLMFHP   P +      LL SS ++LRLW +  +
Sbjct  57   VTLDEEARSLRPEPSSSFDHPYPPTKLMFHPWSLPNSPFS---LLASSSEFLRLWRLDSS  113

Query  469  SIEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            S+E  S L NSK+SE+CAP+TSFDWN+ EPRRIGTSSIDTTCT+WD
Sbjct  114  SVELRSILGNSKSSEFCAPITSFDWNDAEPRRIGTSSIDTTCTVWD  159



>ref|XP_001780909.1| predicted protein [Physcomitrella patens]
 gb|EDQ54247.1| predicted protein [Physcomitrella patens]
Length=335

 Score =   169 bits (429),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 107/153 (70%), Gaps = 7/153 (5%)
 Frame = +1

Query  148  RSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDTVTLK  327
            R     TYE+P+PI+ M  S     H  L     A+GSF+E+++N+VEI+  +++T   K
Sbjct  8    RRSEIYTYEAPWPIYGMNWSVRKDKHMRL-----AIGSFIEDHRNKVEIVQLDDETCDFK  62

Query  328  TNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEPVSTLNNSKT  507
             +P L+F+H YP TK+MF P+     +  DLL ++GDYLR+W++ +  +E  S LNN+K 
Sbjct  63   ADPKLSFEHTYPTTKIMFIPD--KECQKPDLLATTGDYLRIWQIHDDKVERKSILNNNKY  120

Query  508  SEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            SEYCAPLTSFDWNE EP+R+GTSSIDTTCTIWD
Sbjct  121  SEYCAPLTSFDWNEAEPKRLGTSSIDTTCTIWD  153



>ref|XP_010934016.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1-like [Elaeis guineensis]
Length=358

 Score =   169 bits (427),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 115/155 (74%), Gaps = 10/155 (6%)
 Frame = +1

Query  157  NSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDTVTLKTNP  336
            N+ T++SP+P++AMA SS  A         +A+GSF+E+Y NRV++++F+ED    + +P
Sbjct  26   NTYTFDSPHPVYAMAFSSLPAPSPP----RLALGSFIEDYANRVDVVTFDEDARAFRPDP  81

Query  337  GLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREAS-----IEPVSTLNNS  501
             L+FDHPYPPTKLMFHP P  +  S+ LL SSG++LRLW++   +      E  + LNNS
Sbjct  82   SLSFDHPYPPTKLMFHPKPLPNSSSS-LLASSGEFLRLWQLDHHADSSPKAELRAILNNS  140

Query  502  KTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            K+SE+CAPLTSFDWN+ EPRRIGTSSIDTTCT+WD
Sbjct  141  KSSEFCAPLTSFDWNDAEPRRIGTSSIDTTCTVWD  175



>ref|XP_006829207.1| hypothetical protein AMTR_s00001p00271900 [Amborella trichopoda]
 gb|ERM96623.1| hypothetical protein AMTR_s00001p00271900 [Amborella trichopoda]
Length=339

 Score =   168 bits (425),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 103/147 (70%), Gaps = 7/147 (5%)
 Frame = +1

Query  166  TYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDTVTLKTNPGLA  345
            TYE+P+PI+ +A SS +     L      +GSF+EEY NRVEI+  +E+   ++  P L 
Sbjct  16   TYEAPWPIYGLAWSSRSDKPFRL-----GIGSFMEEYSNRVEIVQLDEEHQEIRKLPNLV  70

Query  346  FDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEPVSTLNNSKTSEYCAP  525
             DHPYPPTKLMF P+     +  DL  +S D+LRLWE+RE   +  S  NN+K+SE+CAP
Sbjct  71   MDHPYPPTKLMFLPDKDP--QKPDLFATSCDFLRLWEIREDKFQLKSQFNNTKSSEFCAP  128

Query  526  LTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            LTSFDWNE +P+RIGTSSIDTTCTIWD
Sbjct  129  LTSFDWNEADPKRIGTSSIDTTCTIWD  155



>gb|AIC79628.1| WD40-repeat protein [Ginkgo biloba]
Length=339

 Score =   167 bits (424),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 109/163 (67%), Gaps = 8/163 (5%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            ME   Q S  +SE   TY++P+ I+ M  S         ++  + +GSFLEEY N+VEI+
Sbjct  1    MEGYAQDSQKKSE-IYTYDAPWQIYGMNWSV-----RKDKKFRLGIGSFLEEYNNKVEII  54

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIE  477
              +E+T   K +  L FDHPYP TK+MF P+     +  DLL ++GDYLR+W+V E  +E
Sbjct  55   ELDEETGEFKNDLRLVFDHPYPTTKIMFIPDKEC--QKPDLLATTGDYLRIWQVGEDRVE  112

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
              S LNN+K  E+CAPLTSFDWN+ +P+RIGTSSIDTTCTIWD
Sbjct  113  LKSLLNNNKNCEFCAPLTSFDWNDADPKRIGTSSIDTTCTIWD  155



>ref|XP_010919075.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1-like [Elaeis guineensis]
 ref|XP_010919077.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1-like [Elaeis guineensis]
 ref|XP_010919078.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1-like [Elaeis guineensis]
Length=346

 Score =   161 bits (408),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 122/168 (73%), Gaps = 10/168 (6%)
 Frame = +1

Query  118  MENSTQGS-----NLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKN  282
            ME+STQ S        + N+ T++SP+P++AMA SS  A    L    +A+GSF+E Y N
Sbjct  1    MEDSTQESPATATATATANTYTFDSPHPVYAMAFSSLPAPTPPL----LALGSFIEGYAN  56

Query  283  RVEILSFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVR  462
            RV++++ +ED  +L+  P L+FDHPYPPTKLMFHP P  +  ++ LL SS ++LRLW+V 
Sbjct  57   RVDVVTLDEDARSLRPEPSLSFDHPYPPTKLMFHPRPLPNSSTS-LLASSAEFLRLWQVN  115

Query  463  EASIEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
             +S+   S L+NSK+S++CAPLTSFDWN+ EPRRI TSSIDTTCT+WD
Sbjct  116  SSSVVVRSILSNSKSSDFCAPLTSFDWNDAEPRRIVTSSIDTTCTVWD  163



>gb|EYU43248.1| hypothetical protein MIMGU_mgv1a009118mg [Erythranthe guttata]
Length=352

 Score =   160 bits (406),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 105/157 (67%), Gaps = 7/157 (4%)
 Frame = +1

Query  136  GSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDT  315
            G   R     TYESP+ I+AM  S  +   + L     AV S LE+Y NRV+I+  +  T
Sbjct  13   GEQQRRTEIFTYESPWDIYAMNWSVRSDKKYRL-----AVASLLEQYSNRVQIVQLDNST  67

Query  316  VTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEPVSTLN  495
              ++ +P L+FDHPYPPTKL+F P+     +  DLL +S D+LRLW++ ++ +E  S LN
Sbjct  68   GEIRPDPALSFDHPYPPTKLVFIPD--KECQRPDLLATSSDFLRLWQISDSGMELKSLLN  125

Query  496  NSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            N++++E+  PLTSFDWNE EPRRIGT SIDTTCTIWD
Sbjct  126  NNRSTEFSGPLTSFDWNEAEPRRIGTCSIDTTCTIWD  162



>ref|XP_006844718.1| hypothetical protein AMTR_s00016p00252480 [Amborella trichopoda]
 gb|ERN06393.1| hypothetical protein AMTR_s00016p00252480 [Amborella trichopoda]
Length=342

 Score =   160 bits (404),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 112/161 (70%), Gaps = 8/161 (5%)
 Frame = +1

Query  124  NSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSF  303
            ++++    RSE   TYE+P+ ++AM  S         ++  +A+ S LE+Y N+V+I+  
Sbjct  8    DASEDQQKRSE-IYTYEAPWHVYAMNWSV-----RKDKKYRLAIASLLEQYSNQVQIVQL  61

Query  304  EEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEPV  483
            ++ T  +K++P L+FDHPYPPTKLMF P+     +  DLL +S D+LR+++V +  +E  
Sbjct  62   DDSTGEIKSDPNLSFDHPYPPTKLMFVPD--RDCQKPDLLATSADHLRIFQVSQDRVELK  119

Query  484  STLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            S LN++K SE+C PLTSFDWNE EPRRIGTSSIDTTCTIWD
Sbjct  120  SFLNSNKNSEFCGPLTSFDWNEAEPRRIGTSSIDTTCTIWD  160



>gb|AHJ80983.1| WD-repeat containing protein [Erythranthe lewisii]
Length=351

 Score =   160 bits (404),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/166 (49%), Positives = 109/166 (66%), Gaps = 11/166 (7%)
 Frame = +1

Query  121  ENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILS  300
            +N +     R     TYE+P+ I+AM  S      + L     AVGS LE+Y NRV+I+ 
Sbjct  9    KNGSDVQQQRRSEIYTYEAPFDIYAMNWSVRRDKKYRL-----AVGSLLEQYSNRVQIVQ  63

Query  301  FEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREAS---  471
             ++ T  ++ +P L+FDHPYPPTKL+F P+     +  DLL SS D+LRLW++ ++    
Sbjct  64   LDDSTGEIRPDPNLSFDHPYPPTKLVFVPD--KECQRPDLLASSSDFLRLWQISDSGDGQ  121

Query  472  -IEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
             +E  S LNN+++SE+  PLTSFDWNE EPRRIGTSSIDTTCTIWD
Sbjct  122  RMELKSLLNNNRSSEFSGPLTSFDWNEAEPRRIGTSSIDTTCTIWD  167



>gb|KHN46371.1| WD repeat-containing protein LWD1 [Glycine soja]
Length=343

 Score =   159 bits (402),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 108/162 (67%), Gaps = 9/162 (6%)
 Frame = +1

Query  127  STQGSNLRSENS--VTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILS  300
            +  GS+ + + S   TYE+P+ I+AM  S      + L     A+ S LE+Y NRVEI+ 
Sbjct  8    TQDGSDEQQKRSEIYTYEAPWHIYAMNWSVRRDKKYRL-----AIASLLEQYPNRVEIVQ  62

Query  301  FEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEP  480
             ++    ++++P L+F+HPYPPTK +F P+        DLL +S D+LR+W + E+S+E 
Sbjct  63   LDDSNGEIRSDPSLSFEHPYPPTKAIFIPD--KDCHRPDLLATSSDFLRVWHISESSVEL  120

Query  481  VSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
             S LN +K SEYC PLTSFDWNE EPRRIGTSSIDTTCTIWD
Sbjct  121  KSLLNGNKNSEYCGPLTSFDWNEAEPRRIGTSSIDTTCTIWD  162



>ref|XP_001774625.1| predicted protein [Physcomitrella patens]
 gb|EDQ60559.1| predicted protein [Physcomitrella patens]
Length=338

 Score =   159 bits (402),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 105/150 (70%), Gaps = 13/150 (9%)
 Frame = +1

Query  166  TYESPYPIFAMAVSSFAAAHHGLRRRS---VAVGSFLEEYKNRVEILSFEEDTVTLKTNP  336
            TYE+P+ ++ M  S        +R+ S   +AVGSF+E+Y+N+VEI+  ++D+V    +P
Sbjct  18   TYEAPWAVYGMNWS--------VRKNSKFRLAVGSFIEDYRNKVEIVQLDDDSVNFSADP  69

Query  337  GLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEPVSTLNNSKTSEY  516
             L+FDHPYP TK+MF P+  +  +  DLL ++GD LR+W + E  +E  S LNN + S+Y
Sbjct  70   KLSFDHPYPATKIMFIPDKES--EKPDLLATTGDNLRIWRIEEDKVELKSLLNNRQNSDY  127

Query  517  CAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            C+PLTS DWNE + RR+GTSSIDTTCTIWD
Sbjct  128  CSPLTSLDWNESDLRRLGTSSIDTTCTIWD  157



>ref|XP_003553993.1| PREDICTED: WD repeat-containing protein LWD1-like [Glycine max]
Length=344

 Score =   159 bits (402),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 79/162 (49%), Positives = 109/162 (67%), Gaps = 9/162 (6%)
 Frame = +1

Query  127  STQGSNLRSENS--VTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILS  300
            +  GS+ + + S   TYE+P+ I+AM  S         ++  +A+ S LE+Y NRVEI+ 
Sbjct  8    TQDGSDEQQKRSEIYTYEAPWHIYAMNWSVRRD-----KKYRLAIASLLEQYPNRVEIVQ  62

Query  301  FEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEP  480
             ++    ++++P L+F+HPYPPTK +F P+        DLL +S D+LR+W + E+S+E 
Sbjct  63   LDDSNGEIRSDPSLSFEHPYPPTKSIFIPD--KDCHRPDLLATSSDFLRVWHISESSVEL  120

Query  481  VSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
             S LN +K SEYC PLTSFDWNE EPRRIGTSSIDTTCTIWD
Sbjct  121  KSLLNGNKNSEYCGPLTSFDWNEAEPRRIGTSSIDTTCTIWD  162



>gb|AIU39032.1| WD40 protein [Narcissus tazetta var. chinensis]
Length=354

 Score =   159 bits (401),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 100/147 (68%), Gaps = 7/147 (5%)
 Frame = +1

Query  166  TYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDTVTLKTNPGLA  345
            TYE+P+ I+AM  S      + L     A+ S LE+Y NRVEI+  ++ T  ++++P L+
Sbjct  22   TYEAPWHIYAMNWSVRRDKKYRL-----AIASLLEQYPNRVEIIQLDDSTGEIRSDPALS  76

Query  346  FDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEPVSTLNNSKTSEYCAP  525
            F+HPYPPTK MF P+        DLL +S D+LRLW V    +EP S LN +K SE+C P
Sbjct  77   FEHPYPPTKAMFVPD--RDCLRPDLLATSADFLRLWLVGPDRVEPRSLLNGNKNSEFCGP  134

Query  526  LTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            LTSFDWNE +PRRIGTSSIDTTCTIWD
Sbjct  135  LTSFDWNEADPRRIGTSSIDTTCTIWD  161



>ref|XP_010250423.1| PREDICTED: WD repeat-containing protein LWD1 [Nelumbo nucifera]
Length=344

 Score =   158 bits (399),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 102/147 (69%), Gaps = 7/147 (5%)
 Frame = +1

Query  166  TYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDTVTLKTNPGLA  345
            TYE+P+ I+AM  S      + L     A+ S LE+Y NRVEI+  ++ T  ++++P L+
Sbjct  23   TYEAPWHIYAMNWSVRRDKKYRL-----AIASLLEQYPNRVEIVQLDDSTGEIRSDPNLS  77

Query  346  FDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEPVSTLNNSKTSEYCAP  525
            F+HPYPPTK +F P+     +  DLL +SGD+LR+W + +  +E  S LN +K SE+C P
Sbjct  78   FEHPYPPTKTIFIPD--KECQKPDLLATSGDFLRVWRIADDRVELNSLLNGNKNSEFCGP  135

Query  526  LTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            LTSFDWNE EP+RIGTSSIDTTCTIWD
Sbjct  136  LTSFDWNEAEPKRIGTSSIDTTCTIWD  162



>gb|EYU19155.1| hypothetical protein MIMGU_mgv1a027016mg [Erythranthe guttata]
Length=344

 Score =   157 bits (397),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/169 (48%), Positives = 113/169 (67%), Gaps = 13/169 (8%)
 Frame = +1

Query  118  MENSTQGSNLRSENS--VTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVE  291
            M+ + +GS+ +   S   TYE+P+ I+AM  S      + L     A+ S LE+Y NRVE
Sbjct  1    MDPNLEGSDEQQRRSEIYTYEAPWHIYAMNWSVRKDKKYRL-----AISSLLEQYPNRVE  55

Query  292  ILSFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREAS  471
            I+  ++ T  ++++P L+FDHPYPPTKL+F P+     +  DLL SS D++RLW++ ++ 
Sbjct  56   IVQLDDSTGEIRSDPPLSFDHPYPPTKLIFIPD--KECQRPDLLASSSDFIRLWQISDSD  113

Query  472  ----IEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
                +E  S LNN++ SE+  PLTSFDWNE EPRRIGTSSIDTTCTIWD
Sbjct  114  NGRRVELKSLLNNNRNSEFSGPLTSFDWNEAEPRRIGTSSIDTTCTIWD  162



>ref|XP_002969454.1| hypothetical protein SELMODRAFT_146202 [Selaginella moellendorffii]
 gb|EFJ29542.1| hypothetical protein SELMODRAFT_146202 [Selaginella moellendorffii]
Length=337

 Score =   157 bits (396),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 102/147 (69%), Gaps = 7/147 (5%)
 Frame = +1

Query  166  TYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDTVTLKTNPGLA  345
            TY++ +PI+AM  S    +   L      +GSFLE+Y+N V+I+  +++      +  L 
Sbjct  16   TYDANWPIYAMNWSVRKDSQFRL-----GIGSFLEDYRNMVQIVQLDDEKNKFVADSRLC  70

Query  346  FDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEPVSTLNNSKTSEYCAP  525
            F+HPYP TKLMF P+     +  DL+ +SGD+LR+W+V E  +E  S LNN+K SE+CAP
Sbjct  71   FEHPYPTTKLMFIPDKEC--QRPDLVATSGDFLRIWQVGEDKVELKSLLNNNKNSEFCAP  128

Query  526  LTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            LTSFDWNE+EP+R+GTSSIDTTCTIWD
Sbjct  129  LTSFDWNELEPKRVGTSSIDTTCTIWD  155



>ref|XP_011096638.1| PREDICTED: WD repeat-containing protein LWD1 [Sesamum indicum]
Length=349

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 104/151 (69%), Gaps = 11/151 (7%)
 Frame = +1

Query  166  TYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDTVTLKTNPGLA  345
            TYE+P+ I+AM  S      + L     A+ S LE+Y NRVEI+  ++ T  ++++P L+
Sbjct  23   TYEAPWHIYAMNWSVRKDKKYRL-----AIASLLEQYPNRVEIVQLDDSTGEIRSDPTLS  77

Query  346  FDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREAS----IEPVSTLNNSKTSE  513
            FDHPYPPTKL+F P+     +  DLL SS D+LRLW++ ++     +E  S LNN++ SE
Sbjct  78   FDHPYPPTKLIFIPDKEC--QRPDLLASSSDFLRLWQISDSDSGRRVELKSLLNNNRNSE  135

Query  514  YCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            +  PLTSFDWNE EPRRIGTSSIDTTCTIWD
Sbjct  136  FSGPLTSFDWNEAEPRRIGTSSIDTTCTIWD  166



>gb|AIU98519.1| WD40 protein [Paeonia suffruticosa]
Length=344

 Score =   156 bits (395),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 108/162 (67%), Gaps = 9/162 (6%)
 Frame = +1

Query  127  STQGSNLRSENS--VTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILS  300
            +  GS+ + + S   TYE+P+ I+AM  S      + L     A+ S LE+Y NRVEI+ 
Sbjct  8    TQDGSDEQQKRSEIYTYEAPWHIYAMNWSVRRDKKYRL-----AIASLLEQYPNRVEIVQ  62

Query  301  FEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEP  480
             ++    ++++P L+F+HPYPPTK +F P+     +  DLL +S D+LR+W++ +  +E 
Sbjct  63   LDDSNGEIRSDPNLSFEHPYPPTKTIFIPD--KDCQKPDLLATSSDFLRIWQISDDRVEL  120

Query  481  VSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
             S LN +K SE+C PLTSFDWNE EP+RIGTSSIDTTCTIWD
Sbjct  121  KSVLNGNKNSEFCGPLTSFDWNEAEPKRIGTSSIDTTCTIWD  162



>gb|AHJ80984.1| WD-repeat containing protein [Erythranthe lewisii]
Length=350

 Score =   156 bits (394),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 104/153 (68%), Gaps = 13/153 (8%)
 Frame = +1

Query  166  TYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDTVTLKTNPGLA  345
            TYE+P+ I+AM  S      + L     A+ S LE+Y NRVEI+  ++ T  ++++P L+
Sbjct  23   TYEAPWHIYAMNWSVRKDKKYRL-----AIASLLEQYPNRVEIVQLDDSTGEIRSDPTLS  77

Query  346  FDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREAS------IEPVSTLNNSKT  507
            FDHPYPPTKL+F P+     +  DLL SS D+LRLW++ ++       +E  S LNN++ 
Sbjct  78   FDHPYPPTKLIFIPDKEC--QRPDLLASSSDFLRLWQISDSDSDGGRRVELKSLLNNNRN  135

Query  508  SEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            SE+  PLTSFDWNE EPRRIGTSSIDTTCTIWD
Sbjct  136  SEFSGPLTSFDWNEAEPRRIGTSSIDTTCTIWD  168



>ref|XP_002960560.1| hypothetical protein SELMODRAFT_270223 [Selaginella moellendorffii]
 gb|EFJ38099.1| hypothetical protein SELMODRAFT_270223 [Selaginella moellendorffii]
Length=337

 Score =   155 bits (393),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 73/147 (50%), Positives = 102/147 (69%), Gaps = 7/147 (5%)
 Frame = +1

Query  166  TYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDTVTLKTNPGLA  345
            TY++ +PI+AM  S    +   L      +GSF+E+Y+N V+I+  +++      +  L 
Sbjct  16   TYDANWPIYAMNWSVRKDSQFRL-----GIGSFVEDYRNTVQIVQLDDEKNKFVADSRLC  70

Query  346  FDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEPVSTLNNSKTSEYCAP  525
            F+HPYP TKLMF P+     +  DL+ +SGD+LR+W+V E  +E  S LNN+K SE+CAP
Sbjct  71   FEHPYPTTKLMFIPDKEC--QRPDLVATSGDFLRIWQVGEDKVELKSLLNNNKNSEFCAP  128

Query  526  LTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            LTSFDWNE+EP+R+GTSSIDTTCTIWD
Sbjct  129  LTSFDWNELEPKRVGTSSIDTTCTIWD  155



>gb|EPS65480.1| hypothetical protein M569_09298, partial [Genlisea aurea]
Length=343

 Score =   155 bits (393),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 111/166 (67%), Gaps = 13/166 (8%)
 Frame = +1

Query  127  STQGSNLRSENS--VTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILS  300
            + +GS+ +   S   TYE+P+ ++AM  S     ++ L     A+ S LE++ NRVEI+ 
Sbjct  3    NQEGSDEQQRRSEIYTYEAPWHVYAMNWSVRKDKNYRL-----AIASLLEQFPNRVEIVQ  57

Query  301  FEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREAS---  471
             ++ T  ++++P L+F+HPYPPTKLMF P+     +  DLL SS DYLR+W++ +     
Sbjct  58   LDDSTGEIRSDPALSFEHPYPPTKLMFIPD--KECQRPDLLASSSDYLRIWQIADEDSGR  115

Query  472  -IEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
             +E  S LNN++ SE+  PLTSFDWNE EPRRIGTSSIDTTCTIWD
Sbjct  116  RVELKSLLNNNRNSEFSGPLTSFDWNEAEPRRIGTSSIDTTCTIWD  161



>ref|XP_005642574.1| WD40 repeat-like protein [Coccomyxa subellipsoidea C-169]
 gb|EIE18030.1| WD40 repeat-like protein [Coccomyxa subellipsoidea C-169]
Length=335

 Score =   155 bits (391),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 74/155 (48%), Positives = 104/155 (67%), Gaps = 7/155 (5%)
 Frame = +1

Query  142  NLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDTVT  321
            N R     TY+S   ++ ++ S     +   ++  +AVGSF+EEY N VEI++ ++ T  
Sbjct  6    NDRRAEIYTYDSENIVYGLSWS-----NRRDKKFRLAVGSFIEEYDNYVEIITLDDATCK  60

Query  322  LKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEPVSTLNNS  501
              ++  LAF HPYPPTK+MF P+   +    DLL ++GDYLR+W+++E   + V  LNN+
Sbjct  61   FTSDAQLAFQHPYPPTKIMFMPDKEGA--QPDLLATTGDYLRIWQLKEDGTQLVKLLNNN  118

Query  502  KTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            K SE+CAPLTSFDWNE +  R+GTSSIDTTCTIWD
Sbjct  119  KNSEFCAPLTSFDWNETDLNRLGTSSIDTTCTIWD  153



>ref|XP_006446863.1| hypothetical protein CICLE_v10015815mg [Citrus clementina]
 gb|ESR60103.1| hypothetical protein CICLE_v10015815mg [Citrus clementina]
Length=346

 Score =   155 bits (391),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 106/161 (66%), Gaps = 11/161 (7%)
 Frame = +1

Query  136  GSNLRSENS--VTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEE  309
            GS+ + + S   TYESP+ I+AM  S      + L     A+ S LE+Y NRVEI+  ++
Sbjct  11   GSDEQQKRSEIYTYESPWHIYAMNWSVRRDKKYRL-----AIASLLEQYPNRVEIVQLDD  65

Query  310  DTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREAS--IEPV  483
             T  ++ +P L+F+HPYPPTK +F P+     +  DLL +S D+LR+W + +    +E  
Sbjct  66   STGEIRADPNLSFEHPYPPTKTIFIPD--KECQKPDLLATSSDFLRVWRISDEDRRVELK  123

Query  484  STLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            S LN +K SEYC PLTSFDWNE EPRRIGTSSIDTTCTIWD
Sbjct  124  SLLNGNKNSEYCGPLTSFDWNEAEPRRIGTSSIDTTCTIWD  164



>ref|XP_006851474.1| hypothetical protein AMTR_s00040p00131380 [Amborella trichopoda]
 gb|ERN13055.1| hypothetical protein AMTR_s00040p00131380 [Amborella trichopoda]
Length=339

 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/147 (50%), Positives = 101/147 (69%), Gaps = 7/147 (5%)
 Frame = +1

Query  166  TYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDTVTLKTNPGLA  345
            TYE+P+ I+ +  S         ++  + +GSFLE+Y N+VE++   E++   +++P L 
Sbjct  18   TYEAPWQIYGLNWSV-----RNDKKFRLGIGSFLEDYGNKVELVDLNEESGEFQSDPRLV  72

Query  346  FDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEPVSTLNNSKTSEYCAP  525
            FDHPYP TK+MF P+        DL+ +SGDYLR+W++ +  IE  S LN +K SEY AP
Sbjct  73   FDHPYPATKIMFLPDKECV--KPDLMATSGDYLRIWQIYDDRIELKSLLNGNKNSEYSAP  130

Query  526  LTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            LTSFDWNE++ RRIGTSSIDTTCTIWD
Sbjct  131  LTSFDWNELDNRRIGTSSIDTTCTIWD  157



>ref|XP_006468950.1| PREDICTED: WD repeat-containing protein LWD1-like [Citrus sinensis]
Length=346

 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 100/149 (67%), Gaps = 9/149 (6%)
 Frame = +1

Query  166  TYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDTVTLKTNPGLA  345
            TYESP+ I+AM  S      + L     A+ S LE+Y NRVEI+  ++ T  ++ +P L+
Sbjct  23   TYESPWHIYAMNWSVRRDKKYRL-----AIASLLEQYPNRVEIVQLDDSTGEIRADPNLS  77

Query  346  FDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREAS--IEPVSTLNNSKTSEYC  519
            F+HPYPPTK +F P+     +  DLL +S D+LR+W + +    +E  S LN +K SEYC
Sbjct  78   FEHPYPPTKTIFIPD--KECQKPDLLATSSDFLRVWRISDEDRRVELKSLLNGNKNSEYC  135

Query  520  APLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
             PLTSFDWNE EPRRIGTSSIDTTCTIWD
Sbjct  136  GPLTSFDWNEAEPRRIGTSSIDTTCTIWD  164



>ref|XP_002512788.1| WD-repeat protein, putative [Ricinus communis]
 gb|EEF49291.1| WD-repeat protein, putative [Ricinus communis]
Length=346

 Score =   154 bits (389),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 108/161 (67%), Gaps = 11/161 (7%)
 Frame = +1

Query  136  GSNLRSENS--VTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEE  309
            GS+ + + S   TYE+P+ I+AM  S      + L     A+ S LE+Y NRVEI+  ++
Sbjct  11   GSDEQQKRSEIYTYEAPWHIYAMNWSVRRDKKYRL-----AIASLLEQYPNRVEIVQLDD  65

Query  310  DTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVR--EASIEPV  483
                ++++P L+F+HPYPPTK MF P+     + ADLL +S D+LR+W +    + +E  
Sbjct  66   SNGEIRSDPNLSFEHPYPPTKTMFIPD--KECQKADLLATSSDFLRVWRIDNDHSRVELK  123

Query  484  STLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            S LN +K+SE+C PLTSFDWNE EP+RIGTSSIDTTCTIWD
Sbjct  124  SVLNGNKSSEFCGPLTSFDWNEAEPKRIGTSSIDTTCTIWD  164



>ref|XP_009118046.1| PREDICTED: WD repeat-containing protein LWD1 [Brassica rapa]
Length=346

 Score =   154 bits (388),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 79/165 (48%), Positives = 108/165 (65%), Gaps = 10/165 (6%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            +++ +     RSE   TYE+P+ I+AM  S      + L     A+ S LE+Y NRVEI+
Sbjct  8    IQDGSDEQQKRSE-IYTYEAPWQIYAMNWSVRRDKKYRL-----AITSLLEQYPNRVEIV  61

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVRE--AS  471
              +E    ++++P LAF+HPYPPTK +F P+     +  DLL +S D+LRLW + +  + 
Sbjct  62   QLDESNGEIRSDPNLAFEHPYPPTKTIFIPD--KECQRPDLLATSSDFLRLWRIADDHSR  119

Query  472  IEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            +E  S LN++K SE+C PLTSFDWNE EPRRIGTSS DTTCTIWD
Sbjct  120  VELKSCLNSNKNSEFCGPLTSFDWNEAEPRRIGTSSTDTTCTIWD  164



>gb|KDP41899.1| hypothetical protein JCGZ_26917 [Jatropha curcas]
Length=346

 Score =   153 bits (387),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 109/161 (68%), Gaps = 11/161 (7%)
 Frame = +1

Query  136  GSNLRSENS--VTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEE  309
            GS+ + + S   TYE+P+ I+AM  S      + L     A+ S LE+Y NRVEI+  ++
Sbjct  11   GSDEQQKRSEIYTYEAPWHIYAMNWSVRRDKKYRL-----AIASLLEQYPNRVEIVQLDD  65

Query  310  DTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVRE--ASIEPV  483
                ++++P L+F+HPYPPTK+MF P+     +  DLL +S D+LR+W + E  + +E  
Sbjct  66   SNGEIRSDPNLSFEHPYPPTKIMFIPD--KECQKPDLLATSSDFLRVWRIGEDQSRVELK  123

Query  484  STLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            + LN +K+SE+C PLTSFDWNE EP+RIGTSSIDTTCTIWD
Sbjct  124  TLLNGNKSSEFCGPLTSFDWNEAEPKRIGTSSIDTTCTIWD  164



>ref|XP_009404200.1| PREDICTED: WD repeat-containing protein LWD1-like [Musa acuminata 
subsp. malaccensis]
Length=377

 Score =   154 bits (389),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 105/160 (66%), Gaps = 10/160 (6%)
 Frame = +1

Query  133  QGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEED  312
            Q    RSE   TYE+P+ I+AM  S      + L     A+GS LE Y NRVEI+  +E 
Sbjct  30   QQKQQRSE-IYTYEAPWHIYAMNWSVRRDKKYRL-----AIGSLLEGYGNRVEIVQLDEA  83

Query  313  TVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREAS--IEPVS  486
            T  ++++P L+F+HPYPPTK MF P+        DLL +S D+LR+W V + S  +E  +
Sbjct  84   TGEIRSDPALSFEHPYPPTKAMFVPD--RDCLRPDLLATSADFLRIWRVADDSSRVELRA  141

Query  487  TLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
             LN ++ SE+C PLTSFDWNE EPRRIGTSSIDTTCT+WD
Sbjct  142  FLNGNRNSEFCGPLTSFDWNEAEPRRIGTSSIDTTCTVWD  181



>gb|AIS35935.1| WD40 repeat protein [Phalaenopsis equestris]
Length=351

 Score =   153 bits (387),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 106/165 (64%), Gaps = 11/165 (7%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            ME S +    RSE   TYE+P+ I+AM  S      + L     A+ S LE+Y NRVEI+
Sbjct  1    MEESEEQQK-RSE-IYTYEAPWHIYAMNWSVRRDKKYRL-----AIASLLEQYTNRVEIV  53

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREAS--  471
              ++ T  ++++P L FDH YPPTK MF P+        DLL +S D+LR+W + + S  
Sbjct  54   QLDDSTGEIRSDPNLCFDHSYPPTKTMFVPD--RDCLRPDLLATSADFLRIWRIADDSSC  111

Query  472  IEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            +E  S LN +K SE+C PLTSFDWNE EPRRIGTSSIDTTCTIWD
Sbjct  112  VELKSILNGNKNSEFCGPLTSFDWNETEPRRIGTSSIDTTCTIWD  156



>ref|XP_001774264.1| predicted protein [Physcomitrella patens]
 gb|EDQ60900.1| predicted protein [Physcomitrella patens]
Length=334

 Score =   153 bits (386),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 103/150 (69%), Gaps = 13/150 (9%)
 Frame = +1

Query  166  TYESPYPIFAMAVSSFAAAHHGLRRRS---VAVGSFLEEYKNRVEILSFEEDTVTLKTNP  336
            TY++ + I+ M  S        +RR S   +AVGSF+EEY+N VEI+  E++T   + +P
Sbjct  15   TYDAAWTIYGMNWS--------VRRDSKFRLAVGSFIEEYRNMVEIVQLEDETGKFQVDP  66

Query  337  GLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEPVSTLNNSKTSEY  516
             L+FDHPYP TK+MF P+  ++    DL+ ++ D LR+W++ E  +E  S LNN +  +Y
Sbjct  67   KLSFDHPYPATKIMFIPDKESA--KPDLMATTSDNLRIWQIHEDKVELKSLLNNRQNRDY  124

Query  517  CAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            C+PLTSFDWNE + RR+GTSSIDTTCTIWD
Sbjct  125  CSPLTSFDWNEFDMRRLGTSSIDTTCTIWD  154



>ref|XP_010528111.1| PREDICTED: WD repeat-containing protein LWD1 [Tarenaya hassleriana]
Length=346

 Score =   153 bits (386),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 108/165 (65%), Gaps = 10/165 (6%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            +++ +     RSE   TYE+P+ I+AM  S      + L     A+ S LE+Y NRVEI+
Sbjct  8    IQDGSDEQQKRSE-IYTYEAPWHIYAMNWSVRRDKKYRL-----AIASLLEQYPNRVEIV  61

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVRE--AS  471
              ++    ++++P L F+HPYPPTK +F P+     +  DLL +S D+LRLW + +  + 
Sbjct  62   QLDDSNGEIRSDPNLCFEHPYPPTKTIFIPD--KECQRPDLLATSSDFLRLWRIADDHSR  119

Query  472  IEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            +E  S LN++K SE+C PLTSFDWNE EPRRIGTSSIDTTCTIWD
Sbjct  120  VELKSLLNSNKNSEFCGPLTSFDWNEAEPRRIGTSSIDTTCTIWD  164



>emb|CDY16039.1| BnaC08g40840D [Brassica napus]
Length=346

 Score =   153 bits (386),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 79/161 (49%), Positives = 107/161 (66%), Gaps = 11/161 (7%)
 Frame = +1

Query  136  GSNLRSENS--VTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEE  309
            GS+ + + S   TYE+P+ I+AM  S      + L     A+ S LE+Y NRVEI+  +E
Sbjct  11   GSDEQQKRSEIYTYEAPWQIYAMNWSVRRDKKYRL-----AITSLLEQYPNRVEIVQLDE  65

Query  310  DTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVRE--ASIEPV  483
                ++++P LAF+HPYPPTK +F P+     +  DLL +S D+LRLW + +  + +E  
Sbjct  66   SNGEIRSDPNLAFEHPYPPTKTIFIPD--KECQRPDLLATSSDFLRLWRIADDHSRVELK  123

Query  484  STLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            S LN++K SE+C PLTSFDWNE EPRRIGTSS DTTCTIWD
Sbjct  124  SCLNSNKNSEFCGPLTSFDWNEAEPRRIGTSSTDTTCTIWD  164



>ref|XP_011003601.1| PREDICTED: WD repeat-containing protein LWD1 [Populus euphratica]
 ref|XP_011003602.1| PREDICTED: WD repeat-containing protein LWD1 [Populus euphratica]
Length=346

 Score =   152 bits (385),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 107/161 (66%), Gaps = 11/161 (7%)
 Frame = +1

Query  136  GSNLRSENS--VTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEE  309
            GS+ + + S   TYE+P+ I+AM  S      + L     A+ SFLE+Y NRVEI+  +E
Sbjct  11   GSDEQQKRSEIYTYEAPWHIYAMNWSVRRDKKYRL-----AIASFLEQYPNRVEIVQLDE  65

Query  310  DTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREAS--IEPV  483
                ++++P L+F+HP+P TK +F P+     +  DLL +SGD+LR+W + +    +E  
Sbjct  66   SNGEIRSDPKLSFEHPFPATKTIFIPD--KECQKPDLLATSGDFLRVWRINDEQPRVELK  123

Query  484  STLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            S LN +K SE+C PLTSFDWNE EPRRIGTSSIDTTCTIWD
Sbjct  124  SLLNGNKNSEFCGPLTSFDWNEAEPRRIGTSSIDTTCTIWD  164



>ref|XP_002301564.1| transducin family protein [Populus trichocarpa]
 gb|EEE80837.1| transducin family protein [Populus trichocarpa]
Length=346

 Score =   152 bits (385),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 106/161 (66%), Gaps = 11/161 (7%)
 Frame = +1

Query  136  GSNLRSENS--VTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEE  309
            GS+ + + S   TYE+P+ I+AM  S      + L     A+ S LE+Y NRVEI+  +E
Sbjct  11   GSDEQQKRSEIYTYEAPWHIYAMNWSVRRDKKYRL-----AIASLLEQYPNRVEIVQLDE  65

Query  310  DTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREAS--IEPV  483
                ++++P L+F+HPYPPTK +F P+     +  DLL +S D+LR+W + +    +E  
Sbjct  66   SNGEIRSDPNLSFEHPYPPTKTIFIPD--KECQKPDLLATSSDFLRVWRINDEQPRVELK  123

Query  484  STLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            S LN +K SE+C PLTSFDWNE EPRRIGTSSIDTTCTIWD
Sbjct  124  SLLNGNKNSEFCGPLTSFDWNEAEPRRIGTSSIDTTCTIWD  164



>ref|XP_004304579.1| PREDICTED: WD repeat-containing protein LWD1 [Fragaria vesca 
subsp. vesca]
Length=348

 Score =   152 bits (385),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 107/161 (66%), Gaps = 11/161 (7%)
 Frame = +1

Query  136  GSNLRSENS--VTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEE  309
            GS+ + + S   TYE+P+ I+AM  S      + L     A+ S LE+Y NRVEI+  ++
Sbjct  13   GSDEQQKRSEIYTYEAPWHIYAMNWSVRRDKKYRL-----AIASLLEQYPNRVEIVQLDD  67

Query  310  DTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREAS--IEPV  483
                ++++P L+F+HPYPPTK +F P+     +  DLL +S D+LR+W + E S  +E  
Sbjct  68   SNGEIRSDPNLSFEHPYPPTKTIFIPD--KECQKPDLLATSSDFLRVWSIAEDSSAVELK  125

Query  484  STLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            S LN +K SE+C PLTSFDWNE EP+RIGTSSIDTTCTIWD
Sbjct  126  SVLNGNKNSEFCGPLTSFDWNEAEPKRIGTSSIDTTCTIWD  166



>ref|XP_004238433.1| PREDICTED: WD repeat-containing protein LWD1 [Solanum lycopersicum]
Length=347

 Score =   152 bits (385),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 108/165 (65%), Gaps = 11/165 (7%)
 Frame = +1

Query  124  NSTQGSNLRSENS--VTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            N   GS+ +   S   TYE+P+ I+AM  S      + L     A+ S LE+Y+NRVEI+
Sbjct  8    NQQDGSDEQQRRSEIYTYEAPWHIYAMNWSVRKDKKYRL-----AIASLLEQYQNRVEIV  62

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVRE--AS  471
              ++    ++++P L+F+HPYPPTK++F P+     +  DL+ +S DYLR+W V    + 
Sbjct  63   QLDDSNGEIRSDPKLSFEHPYPPTKVIFIPD--KECQKPDLIATSSDYLRIWRVSNDNSR  120

Query  472  IEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            ++  S LNN++ SE+  PLTSFDWNE EPRRIGTSSIDTTCTIWD
Sbjct  121  VDMKSLLNNNRNSEFSGPLTSFDWNEAEPRRIGTSSIDTTCTIWD  165



>ref|XP_004493117.1| PREDICTED: WD repeat-containing protein LWD1-like [Cicer arietinum]
Length=349

 Score =   152 bits (384),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 78/164 (48%), Positives = 107/164 (65%), Gaps = 14/164 (9%)
 Frame = +1

Query  136  GSNLRSENS--VTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEE  309
            GS+ + + S   TYE+P+ I+AM  S      + L     A+ S LE+Y NRVEI+  ++
Sbjct  11   GSDEQQKRSEIYTYEAPWHIYAMNWSVRRDKKYRL-----AIASLLEQYPNRVEIVQLDD  65

Query  310  DTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREAS-----I  474
                +K++P L+F+HPYPPTK +F P+     +  DLL +S D+LR+W + ++      +
Sbjct  66   TNGQIKSDPNLSFEHPYPPTKAIFIPD--KDCQRPDLLATSSDFLRIWRISDSDESQSRV  123

Query  475  EPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            E  S LN +K SEYC PLTSFDWNE EP+RIGTSSIDTTCTIWD
Sbjct  124  ELKSLLNGNKNSEYCGPLTSFDWNEAEPKRIGTSSIDTTCTIWD  167



>ref|XP_006342135.1| PREDICTED: WD repeat-containing protein LWD1-like [Solanum tuberosum]
Length=347

 Score =   152 bits (384),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 107/165 (65%), Gaps = 11/165 (7%)
 Frame = +1

Query  124  NSTQGSNLRSENS--VTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            N   GS+ +   S   TYE+P+ I+AM  S      + L     A+ S LE+Y NRVEI+
Sbjct  8    NQQDGSDEQQRRSEIYTYEAPWHIYAMNWSVRKDKKYRL-----AIASLLEQYPNRVEIV  62

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEV--REAS  471
              ++    ++++P L+F+HPYPPTK++F P+     +  DL+ +S DYLR+W V    + 
Sbjct  63   QLDDSNGEIRSDPKLSFEHPYPPTKVIFIPD--KECQKPDLIATSSDYLRIWRVASDNSR  120

Query  472  IEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            +E  S LNN++ SE+  PLTSFDWNE EPRRIGTSSIDTTCTIWD
Sbjct  121  VEIKSLLNNNRNSEFSGPLTSFDWNEAEPRRIGTSSIDTTCTIWD  165



>ref|XP_006417175.1| hypothetical protein EUTSA_v10008091mg [Eutrema salsugineum]
 gb|ESQ35528.1| hypothetical protein EUTSA_v10008091mg [Eutrema salsugineum]
Length=346

 Score =   152 bits (383),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 108/165 (65%), Gaps = 10/165 (6%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            +++ +     RSE   TYE+P+ I+AM  S      + L     A+ S LE+Y NRVEI+
Sbjct  8    IQDGSDEQQKRSE-IYTYEAPWHIYAMNWSVRRDKKYRL-----AITSLLEQYPNRVEIV  61

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEV--REAS  471
              +E    ++++P L+F+HPYPPTK +F P+     +  DLL +S D+LRLW +   ++ 
Sbjct  62   QLDESNGEIRSDPNLSFEHPYPPTKTIFIPD--KECQRPDLLATSSDFLRLWRIADDQSR  119

Query  472  IEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            +E  S LN++K SE+C PLTSFDWNE EPRRIGTSS DTTCTIWD
Sbjct  120  VELKSCLNSNKNSEFCGPLTSFDWNEAEPRRIGTSSTDTTCTIWD  164



>ref|XP_010682212.1| PREDICTED: WD repeat-containing protein LWD1 [Beta vulgaris subsp. 
vulgaris]
Length=354

 Score =   152 bits (383),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 101/152 (66%), Gaps = 12/152 (8%)
 Frame = +1

Query  166  TYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDTVTLKTNPGLA  345
            TYE+P+ I+AM  S         ++  +A+ S LE+  N+VEI+  ++ T  +K++P L+
Sbjct  28   TYEAPWHIYAMNWSV-----RRDKKYRLAIASLLEQTPNKVEIVQLDDSTGEIKSDPSLS  82

Query  346  FDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREAS-----IEPVSTLNNSKTS  510
            FDHPYPPTK +F P+   S    DLL +S D+LRLW +   S     +E  S LN +K S
Sbjct  83   FDHPYPPTKAIFIPDKDCS--KPDLLATSSDFLRLWHINPDSLSSTRVELKSFLNGNKNS  140

Query  511  EYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            EYC PLTSFDWNE EPRRIGTSSIDTTCTIWD
Sbjct  141  EYCGPLTSFDWNEAEPRRIGTSSIDTTCTIWD  172



>ref|XP_011033708.1| PREDICTED: WD repeat-containing protein LWD1 [Populus euphratica]
Length=346

 Score =   152 bits (383),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 101/149 (68%), Gaps = 9/149 (6%)
 Frame = +1

Query  166  TYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDTVTLKTNPGLA  345
            TYE+P+ IFAM  S      + L     A+ SFLE+Y NRVEI+  ++    ++++P L+
Sbjct  23   TYEAPWHIFAMNWSVRRDKKYRL-----AIASFLEQYPNRVEIVQLDDSNGEIRSDPNLS  77

Query  346  FDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREAS--IEPVSTLNNSKTSEYC  519
            F+HPY PTK++F P+     +  DLL +S D+LR+W + +    +E  S LN +K SE+C
Sbjct  78   FEHPYTPTKIIFIPD--KECQKPDLLATSSDFLRVWRINDEQPRVELRSLLNGNKNSEFC  135

Query  520  APLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
             PLTSFDWNE EP+RIGTSSIDTTCTIWD
Sbjct  136  GPLTSFDWNEAEPKRIGTSSIDTTCTIWD  164



>ref|XP_007032099.1| Transducin/WD40 repeat-like superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOY03025.1| Transducin/WD40 repeat-like superfamily protein isoform 2 [Theobroma 
cacao]
Length=346

 Score =   152 bits (383),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 108/162 (67%), Gaps = 11/162 (7%)
 Frame = +1

Query  133  QGSNLRSENS--VTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFE  306
            +GS+ + + S   TYE+P+ I+AM  S      + L     A+ S LE+Y NR+EI+  +
Sbjct  10   EGSDEQQKRSEIYTYEAPWHIYAMNWSVRRDKKYRL-----AIASLLEQYPNRLEIVQLD  64

Query  307  EDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVRE--ASIEP  480
            +    ++++P L+FDHPYPPTK +F P+     +  DLL +S D+LR+W + +  + +E 
Sbjct  65   DSNGEIRSDPNLSFDHPYPPTKTIFIPD--KECQKPDLLATSSDFLRIWRISDDHSRVEL  122

Query  481  VSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
             S LN +K SE+C PLTSFDWNE EP+RIGTSSIDTTCTIWD
Sbjct  123  KSLLNGNKNSEFCGPLTSFDWNEAEPKRIGTSSIDTTCTIWD  164



>gb|AAC18912.1| ATAN11 [Arabidopsis thaliana]
Length=346

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 108/165 (65%), Gaps = 10/165 (6%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            +++ +     RSE   TYE+P+ I+AM  S      + L     A+ S LE+Y NRVEI+
Sbjct  8    IQDGSDEQQKRSE-IYTYEAPWHIYAMNWSVRRDKKYRL-----AITSLLEQYPNRVEIV  61

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVRE--AS  471
              +E    ++++P L+F+HPYPPTK +F P+     +  DLL +S D+LRLW + +  + 
Sbjct  62   QLDESNGEIRSDPNLSFEHPYPPTKTIFIPD--KECQRPDLLATSSDFLRLWRIADDHSR  119

Query  472  IEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            +E  S LN++K SE+C PLTSFDWNE EPRRIGTSS DTTCTIWD
Sbjct  120  VELKSCLNSNKNSEFCGPLTSFDWNEAEPRRIGTSSTDTTCTIWD  164



>ref|XP_007032098.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY03024.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
Length=346

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 108/162 (67%), Gaps = 11/162 (7%)
 Frame = +1

Query  133  QGSNLRSENS--VTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFE  306
            +GS+ + + S   TYE+P+ I+AM  S      + L     A+ S LE+Y NR+EI+  +
Sbjct  10   EGSDEQQKRSEIYTYEAPWHIYAMNWSVRRDKKYRL-----AIASLLEQYPNRLEIVQLD  64

Query  307  EDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVRE--ASIEP  480
            +    ++++P L+FDHPYPPTK +F P+     +  DLL +S D+LR+W + +  + +E 
Sbjct  65   DSNGEIRSDPNLSFDHPYPPTKTIFIPD--KECQKPDLLATSSDFLRIWRISDDHSRVEL  122

Query  481  VSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
             S LN +K SE+C PLTSFDWNE EP+RIGTSSIDTTCTIWD
Sbjct  123  KSLLNGNKNSEFCGPLTSFDWNEAEPKRIGTSSIDTTCTIWD  164



>ref|XP_006304591.1| hypothetical protein CARUB_v10011643mg [Capsella rubella]
 gb|EOA37489.1| hypothetical protein CARUB_v10011643mg [Capsella rubella]
Length=346

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 108/165 (65%), Gaps = 10/165 (6%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            +++ +     RSE   TYE+P+ I+AM  S      + L     A+ S LE+Y NRVEI+
Sbjct  8    IQDGSDEQQKRSE-IYTYEAPWHIYAMNWSVRRDKKYRL-----AITSLLEQYPNRVEIV  61

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVRE--AS  471
              +E    ++++P L+F+HPYPPTK +F P+     +  DLL +S D+LRLW + +  + 
Sbjct  62   QLDESNGEIRSDPNLSFEHPYPPTKTIFIPDKEG--QRPDLLATSSDFLRLWRIADDHSR  119

Query  472  IEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            +E  S LN++K SE+C PLTSFDWNE EPRRIGTSS DTTCTIWD
Sbjct  120  VELKSCLNSNKNSEFCGPLTSFDWNEAEPRRIGTSSTDTTCTIWD  164



>ref|NP_172751.1| protein LIGHT-REGULATED WD1  [Arabidopsis thaliana]
 sp|Q9LPV9.1|LWD1_ARATH RecName: Full=WD repeat-containing protein LWD1; AltName: Full=Protein 
ANTHOCYANIN 11-A; Short=AtAN11-A; AltName: Full=Protein 
LIGHT-REGULATED WD1; AltName: Full=WD repeat-containing 
protein AN11-A [Arabidopsis thaliana]
 gb|AAF78495.1|AC012187_15 Identical to WD repeat protein ATAN11 from Arabidopsis thaliana 
gb|U94746 and contains multiple WD domain PF|00400 repeats. 
ESTs gb|H35958, gb|AA712360, gb|R90717, gb|AW004301 come 
from this gene [Arabidopsis thaliana]
 gb|AAM13100.1| WD repeat protein ATAN11 [Arabidopsis thaliana]
 gb|AAM91176.1| WD repeat protein ATAN11 [Arabidopsis thaliana]
 gb|AEE28948.1| protein LIGHT-REGULATED WD1 [Arabidopsis thaliana]
Length=346

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 108/165 (65%), Gaps = 10/165 (6%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            +++ +     RSE   TYE+P+ I+AM  S      + L     A+ S LE+Y NRVEI+
Sbjct  8    IQDGSDEQQKRSE-IYTYEAPWHIYAMNWSVRRDKKYRL-----AITSLLEQYPNRVEIV  61

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVRE--AS  471
              +E    ++++P L+F+HPYPPTK +F P+     +  DLL +S D+LRLW + +  + 
Sbjct  62   QLDESNGEIRSDPNLSFEHPYPPTKTIFIPD--KECQRPDLLATSSDFLRLWRIADDHSR  119

Query  472  IEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            +E  S LN++K SE+C PLTSFDWNE EPRRIGTSS DTTCTIWD
Sbjct  120  VELKSCLNSNKNSEFCGPLTSFDWNEAEPRRIGTSSTDTTCTIWD  164



>gb|AAM65213.1| flower pigmentation protein ATAN11 [Arabidopsis thaliana]
Length=346

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 108/165 (65%), Gaps = 10/165 (6%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            +++ +     RSE   TYE+P+ I+AM  S      + L     A+ S LE+Y NRVEI+
Sbjct  8    IQDGSDEQQKRSE-IYTYEAPWHIYAMNWSVRRDKKYRL-----AITSLLEQYPNRVEIV  61

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVRE--AS  471
              +E    ++++P L+F+HPYPPTK +F P+     +  DLL +S D+LRLW + +  + 
Sbjct  62   QLDESNGEIRSDPNLSFEHPYPPTKTIFIPD--KECQRPDLLATSSDFLRLWRIADDHSR  119

Query  472  IEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            +E  S LN++K SE+C PLTSFDWNE EPRRIGTSS DTTCTIWD
Sbjct  120  VELKSCLNSNKNSEFCGPLTSFDWNEAEPRRIGTSSTDTTCTIWD  164



>ref|XP_010494757.1| PREDICTED: WD repeat-containing protein LWD1 [Camelina sativa]
Length=346

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 108/165 (65%), Gaps = 10/165 (6%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            +++ +     RSE   TYE+P+ I+AM  S      + L     A+ S LE+Y NRVEI+
Sbjct  8    IQDGSDEQQKRSE-IYTYEAPWHIYAMNWSVRRDKKYRL-----AITSLLEQYPNRVEIV  61

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVRE--AS  471
              +E    ++++P L+F+HPYPPTK +F P+     +  DLL +S D+LRLW + +  + 
Sbjct  62   QLDESNGEIRSDPNLSFEHPYPPTKTIFIPD--KECQRPDLLATSSDFLRLWRIADDHSR  119

Query  472  IEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            +E  S LN++K SE+C PLTSFDWNE EPRRIGTSS DTTCTIWD
Sbjct  120  VELKSCLNSNKNSEFCGPLTSFDWNEAEPRRIGTSSTDTTCTIWD  164



>ref|XP_002321066.1| hypothetical protein POPTR_0014s13680g [Populus trichocarpa]
 gb|EEE99381.1| hypothetical protein POPTR_0014s13680g [Populus trichocarpa]
Length=346

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 106/161 (66%), Gaps = 11/161 (7%)
 Frame = +1

Query  136  GSNLRSENS--VTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEE  309
            GS+ + + S   TYE+P+ I+AM  S      + L     A+ S LE+Y NRVEI+  ++
Sbjct  11   GSDEQQKRSEIYTYEAPWHIYAMNWSVRRDKKYRL-----AIASLLEQYPNRVEIVQLDD  65

Query  310  DTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREAS--IEPV  483
                ++++P L+F+HPYPPTK +F P+     +  DLL +S D+LR+W + +    +E  
Sbjct  66   SNGEIRSDPNLSFEHPYPPTKTIFIPD--KECQKPDLLATSSDFLRVWRINDEQPRVELK  123

Query  484  STLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            S LN +K SE+C PLTSFDWNE EPRRIGTSSIDTTCTIWD
Sbjct  124  SLLNGNKNSEFCGPLTSFDWNEAEPRRIGTSSIDTTCTIWD  164



>ref|XP_004145624.1| PREDICTED: WD repeat-containing protein LWD1-like [Cucumis sativus]
 ref|XP_004161333.1| PREDICTED: WD repeat-containing protein LWD1-like [Cucumis sativus]
 ref|XP_008449964.1| PREDICTED: WD repeat-containing protein LWD1 [Cucumis melo]
 gb|KGN57691.1| hypothetical protein Csa_3G253490 [Cucumis sativus]
Length=346

 Score =   150 bits (380),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 110/164 (67%), Gaps = 10/164 (6%)
 Frame = +1

Query  121  ENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILS  300
            ++++     RSE   TYE+P+ I+AM  S      + L     A+ S LE+Y NRVEI+ 
Sbjct  9    QDASDEQQKRSE-IYTYEAPWHIYAMNWSVRRDKKYRL-----AIASLLEQYPNRVEIVQ  62

Query  301  FEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVRE--ASI  474
             ++ +  ++++P L+F+HPYPPTK +F P+     +  DLL +S D+LR+W + +  +S+
Sbjct  63   LDDSSGEIRSDPNLSFEHPYPPTKTIFIPD--KECQRPDLLATSSDFLRVWRISDDPSSV  120

Query  475  EPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            E  S LN +K SE+C PLTSFDWN+ EP+RIGTSSIDTTCTIWD
Sbjct  121  ELKSLLNGNKNSEFCGPLTSFDWNDAEPKRIGTSSIDTTCTIWD  164



>emb|CAE76645.1| WD 40 protein [Matthiola incana]
Length=331

 Score =   150 bits (379),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 101/149 (68%), Gaps = 9/149 (6%)
 Frame = +1

Query  166  TYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDTVTLKTNPGLA  345
            TYE+P+ I+AM  S      + L     A+ S LE+Y NRVEI+  +E    ++++P L+
Sbjct  8    TYEAPWHIYAMNWSVRRDKKYRL-----AITSLLEQYPNRVEIVQLDESNGEIRSDPNLS  62

Query  346  FDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVRE--ASIEPVSTLNNSKTSEYC  519
            F+HPYPPTK +F P+     +  DLL +S D+LRLW + +  + +E  S LN++K SE+C
Sbjct  63   FEHPYPPTKTIFIPD--KECQRPDLLATSSDFLRLWRIADDHSRVELKSCLNSNKNSEFC  120

Query  520  APLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
             PLTSFDWNE EPRRIGTSS DTTCTIWD
Sbjct  121  GPLTSFDWNEAEPRRIGTSSTDTTCTIWD  149



>ref|XP_002892720.1| ATAN11 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68979.1| ATAN11 [Arabidopsis lyrata subsp. lyrata]
Length=346

 Score =   150 bits (379),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 108/165 (65%), Gaps = 10/165 (6%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            +++ +     RSE   TYE+P+ I+AM  S      + L     A+ S LE+Y NRVEI+
Sbjct  8    IQDGSDEQQKRSE-IYTYEAPWHIYAMNWSVRRDKKYRL-----AITSLLEQYPNRVEIV  61

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVRE--AS  471
              +E    ++++P L+F+HPYPPTK +F P+     +  DLL +S D+LRLW + +  + 
Sbjct  62   QLDESNGEIRSDPNLSFEHPYPPTKTIFIPD--KECQRPDLLATSSDFLRLWRIADDHSR  119

Query  472  IEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            +E  S LN++K S++C PLTSFDWNE EPRRIGTSS DTTCTIWD
Sbjct  120  VELKSCLNSNKNSDFCGPLTSFDWNEAEPRRIGTSSTDTTCTIWD  164



>gb|KJB72048.1| hypothetical protein B456_011G155800 [Gossypium raimondii]
Length=346

 Score =   150 bits (379),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 107/162 (66%), Gaps = 11/162 (7%)
 Frame = +1

Query  133  QGSNLRSENS--VTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFE  306
            +GS+ + + S   TYE+P+ I+AM  S      + L     A+ S LE Y NR+EI+  +
Sbjct  10   EGSDEQQKRSEIYTYEAPWHIYAMNWSVRRDKKYRL-----AIASLLEHYNNRLEIVQLD  64

Query  307  EDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVRE--ASIEP  480
            +    ++++P L+FDHPYPPTK +F P+     +  DLL +S D+LR+W + +  + ++ 
Sbjct  65   DSNGEIRSDPNLSFDHPYPPTKTIFIPD--KECQKPDLLATSSDFLRIWRISDDHSRVDL  122

Query  481  VSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
             S LN +K SE+C PLTSFDWNE EP+RIGTSSIDTTCTIWD
Sbjct  123  KSLLNGNKNSEFCGPLTSFDWNEAEPKRIGTSSIDTTCTIWD  164



>gb|AAM95643.1| WD-repeat protein GhTTG2 [Gossypium hirsutum]
 gb|AAM95644.1| WD-repeat protein GhTTG2 [Gossypium hirsutum]
Length=346

 Score =   150 bits (379),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 107/162 (66%), Gaps = 11/162 (7%)
 Frame = +1

Query  133  QGSNLRSENS--VTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFE  306
            +GS+ + + S   TYE+P+ I+AM  S      + L     A+ S LE Y NR+EI+  +
Sbjct  10   EGSDEQQKRSEIYTYEAPWHIYAMNWSVRRDKKYRL-----AIASLLEHYNNRLEIVQLD  64

Query  307  EDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVRE--ASIEP  480
            +    ++++P L+FDHPYPPTK +F P+     +  DLL +S D+LR+W + +  + ++ 
Sbjct  65   DSNGEIRSDPNLSFDHPYPPTKTIFIPD--KECQKPDLLATSSDFLRIWRISDDHSRVDL  122

Query  481  VSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
             S LN +K SE+C PLTSFDWNE EP+RIGTSSIDTTCTIWD
Sbjct  123  KSLLNGNKNSEFCGPLTSFDWNEAEPKRIGTSSIDTTCTIWD  164



>ref|XP_010476271.1| PREDICTED: WD repeat-containing protein LWD1-like [Camelina sativa]
Length=346

 Score =   150 bits (379),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 108/165 (65%), Gaps = 10/165 (6%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            +++ +     RSE   TYE+P+ I+AM  S      + L     A+ S LE+Y NRVEI+
Sbjct  8    IQDGSDEQQKRSE-IYTYEAPWHIYAMNWSVRRDKKYRL-----AITSLLEQYPNRVEIV  61

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVRE--AS  471
              +E    ++++P L+F+HPYPPTK +F P+     +  DLL +S D+LRLW + +  + 
Sbjct  62   QLDESNGEIRSDPNLSFEHPYPPTKTIFIPD--KECQRPDLLATSSDFLRLWRIADDHSR  119

Query  472  IEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            +E  S LN++K S++C PLTSFDWNE EPRRIGTSS DTTCTIWD
Sbjct  120  VELKSCLNSNKNSDFCGPLTSFDWNEAEPRRIGTSSTDTTCTIWD  164



>gb|AES80772.2| transducin/WD-like repeat-protein [Medicago truncatula]
Length=352

 Score =   150 bits (379),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 110/170 (65%), Gaps = 16/170 (9%)
 Frame = +1

Query  121  ENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILS  300
            ++++     RSE   TYE+P+ I+AM  S      + L     A+ S LE+Y NRVEI+ 
Sbjct  9    QDTSDEQQKRSE-IYTYEAPWHIYAMNWSVRRDKKYRL-----AIASLLEQYPNRVEIVQ  62

Query  301  FEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREA----  468
             ++ T  +K++P L+F+HPYPPTK +F P+     +  DLL +S D+LR+W + ++    
Sbjct  63   LDDTTGEIKSDPNLSFEHPYPPTKSIFIPD--KDCQRPDLLATSSDFLRIWRISDSDESA  120

Query  469  ----SIEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
                ++E  + LN +K SEYC P+TSFDWNE EPRRIGTSSIDTTCTIWD
Sbjct  121  SDSRAVELKTLLNGNKNSEYCGPITSFDWNEAEPRRIGTSSIDTTCTIWD  170



>ref|XP_006395537.1| hypothetical protein EUTSA_v10005280mg [Eutrema salsugineum]
 gb|ESQ32823.1| hypothetical protein EUTSA_v10005280mg [Eutrema salsugineum]
Length=346

 Score =   150 bits (378),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 106/166 (64%), Gaps = 10/166 (6%)
 Frame = +1

Query  115  KMENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEI  294
            ++++ +     RSE   TYE+P+ I+AM  S      + L     A+ S +E+Y NRVEI
Sbjct  7    QIQDVSDDQQKRSE-IYTYEAPWQIYAMNWSVRRDKKYRL-----AITSLIEQYPNRVEI  60

Query  295  LSFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVR--EA  468
            +  +E    ++++P L F+HPYPPTK  F P+     +  DLL +S D+LRLW +   E+
Sbjct  61   VQLDESNGEIRSDPNLCFEHPYPPTKTSFIPDKEC--QRPDLLATSSDFLRLWRISDDES  118

Query  469  SIEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
             +E  S LN+ K SEY  PLTSFDWNE EPRRIGTSSIDTTCTIWD
Sbjct  119  RVELKSFLNSDKNSEYSGPLTSFDWNEAEPRRIGTSSIDTTCTIWD  164



>emb|CDY26600.1| BnaA09g46770D [Brassica napus]
Length=346

 Score =   150 bits (378),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 107/165 (65%), Gaps = 10/165 (6%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            +++ +     RSE   TYE+P+ I+AM  S      + L     A+ S LE+Y NRVEI+
Sbjct  8    IQDGSDEQQKRSE-IYTYEAPWQIYAMNWSVRRDKKYRL-----AITSLLEQYPNRVEIV  61

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVRE--AS  471
              +E    ++++P LAF+HPYP TK +F P+     +  DLL +S D+LRLW + +  + 
Sbjct  62   QLDESNGEIRSDPNLAFEHPYPHTKTIFIPD--KECQRPDLLATSSDFLRLWRIADDHSR  119

Query  472  IEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            +E  S LN++K SE+C PLTSFDWNE EPRRIGTSS DTTCTIWD
Sbjct  120  VELKSCLNSNKNSEFCGPLTSFDWNEAEPRRIGTSSTDTTCTIWD  164



>gb|ACA04014.1| WD40 repeat protein, partial [Diplacus aurantiacus]
Length=157

 Score =   144 bits (364),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 77/86 (90%), Gaps = 3/86 (3%)
 Frame = +1

Query  349  DHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEPVSTLNNSKTSEYCAPL  528
            DHPYPPTKL+FHP+P+A     ++L SSGD+LRLWEV++ S+EP+STLNNS TSEY APL
Sbjct  1    DHPYPPTKLLFHPSPSAP---KNILASSGDFLRLWEVKDGSVEPLSTLNNSNTSEYSAPL  57

Query  529  TSFDWNEVEPRRIGTSSIDTTCTIWD  606
            TSFDWNE+EPRRIGTSSIDTTCTIWD
Sbjct  58   TSFDWNELEPRRIGTSSIDTTCTIWD  83



>ref|NP_001268006.1| WD repeat 2 [Vitis vinifera]
 ref|XP_010660590.1| PREDICTED: WD repeat 2 isoform X1 [Vitis vinifera]
 ref|XP_010660591.1| PREDICTED: WD repeat 2 isoform X1 [Vitis vinifera]
 ref|XP_010660592.1| PREDICTED: WD repeat 2 isoform X1 [Vitis vinifera]
 gb|ABF66626.2| WD repeat 2 [Vitis vinifera]
Length=344

 Score =   150 bits (378),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 106/162 (65%), Gaps = 8/162 (5%)
 Frame = +1

Query  121  ENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILS  300
            ++++     RSE   TYE+P+ I+AM  S      + L     A+ S LE+Y NRVEI+ 
Sbjct  9    QDASDEQQKRSE-IYTYEAPWHIYAMNWSVRRDKKYRL-----AIASLLEQYPNRVEIVQ  62

Query  301  FEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEP  480
             ++ T  ++++P L+F+H YPPTK +F P+     +  DLL +S D+LR+W + +  +E 
Sbjct  63   LDDSTGEIRSDPNLSFEHHYPPTKTIFIPD--KDCQKPDLLATSSDFLRVWNISDDRVEL  120

Query  481  VSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
               LN ++ SE+C PLTSFDWNE EP+RIGTSSIDTTCTIWD
Sbjct  121  KCLLNGNRNSEFCGPLTSFDWNEAEPKRIGTSSIDTTCTIWD  162



>ref|XP_003078700.1| WD-repeat protein GhTTG2 (ISS) [Ostreococcus tauri]
 emb|CAL51580.1| WD40 repeat [Ostreococcus tauri]
Length=332

 Score =   149 bits (377),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 105/148 (71%), Gaps = 8/148 (5%)
 Frame = +1

Query  166  TYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDTVTLKTNPGLA  345
            TYE+P+ ++A   S         +R  +A+GSF+EEY N+VEI++ +E+T         +
Sbjct  11   TYEAPWMVYACNWSV-----RQDKRFRLALGSFVEEYSNKVEIITLDEETGEFPKEAKCS  65

Query  346  FDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVR-EASIEPVSTLNNSKTSEYCA  522
            F HPYP TK+MF P+   + +  DLL ++GDYLR+W+V+ E +++  S LNN+K+SE+CA
Sbjct  66   FTHPYPCTKIMFIPDKECTKE--DLLATTGDYLRIWQVKDEDTVQMKSLLNNNKSSEFCA  123

Query  523  PLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            PLTSFDWNE + +R+GTSSIDTTCTIWD
Sbjct  124  PLTSFDWNETKLQRVGTSSIDTTCTIWD  151



>ref|XP_009622678.1| PREDICTED: WD repeat-containing protein LWD1 [Nicotiana tomentosiformis]
 ref|XP_009759074.1| PREDICTED: WD repeat-containing protein LWD1 [Nicotiana sylvestris]
Length=346

 Score =   150 bits (378),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 101/149 (68%), Gaps = 9/149 (6%)
 Frame = +1

Query  166  TYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDTVTLKTNPGLA  345
            TYE+P+ I+AM  S      + L     A+ S LE+Y NRVEI+  ++    ++++P L+
Sbjct  23   TYEAPWHIYAMNWSVRKDKKYRL-----AISSLLEQYPNRVEIVQLDDSNGEIRSDPKLS  77

Query  346  FDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEV--REASIEPVSTLNNSKTSEYC  519
            F+HPYPPTK++F P+     +  DLL +S DYLR+W V    + +E  S LNN++ SE+ 
Sbjct  78   FEHPYPPTKVIFIPD--KECQKPDLLATSSDYLRIWRVASDNSRVEMKSLLNNNRNSEFS  135

Query  520  APLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
             PLTSFDWNE EP+RIGTSSIDTTCTIWD
Sbjct  136  GPLTSFDWNEAEPKRIGTSSIDTTCTIWD  164



>dbj|BAE94397.1| WD40 repeat protein [Ipomoea purpurea]
 dbj|BAE94399.1| WD40 repeat protein [Ipomoea nil]
Length=346

 Score =   149 bits (377),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 103/149 (69%), Gaps = 9/149 (6%)
 Frame = +1

Query  166  TYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDTVTLKTNPGLA  345
            TYE+P+ I+AM  S         +R  +A+ S LE+Y NRVEI+  ++    ++++P L+
Sbjct  23   TYEAPWHIYAMNWSVRKD-----KRYRLAIASLLEQYPNRVEIVQLDDSNGEIRSDPNLS  77

Query  346  FDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVRE--ASIEPVSTLNNSKTSEYC  519
            F+HPYPPTK++F P+     +  DL+ +S DYLR+W V +  + +E  + LNN++ SE+ 
Sbjct  78   FEHPYPPTKVIFIPD--KECQKPDLIATSSDYLRVWRVADDNSRVEIKTLLNNNRNSEFS  135

Query  520  APLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
             PLTSFDWNE EP+RIGTSSIDTTCTIWD
Sbjct  136  GPLTSFDWNEAEPKRIGTSSIDTTCTIWD  164



>ref|XP_007161787.1| hypothetical protein PHAVU_001G098000g [Phaseolus vulgaris]
 gb|ESW33781.1| hypothetical protein PHAVU_001G098000g [Phaseolus vulgaris]
Length=351

 Score =   149 bits (377),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 106/169 (63%), Gaps = 16/169 (9%)
 Frame = +1

Query  127  STQGSNLRSENS--VTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILS  300
            +  GS+ + + S   TYE+P+ I+AM  S      + L     A+ S LE+Y NRVEI+ 
Sbjct  8    TQDGSDEQQKRSEIYTYEAPWHIYAMNWSVRRDKKYRL-----AIASLLEQYPNRVEIVQ  62

Query  301  FEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREA----  468
             ++    ++++P L+F+HPYPPTK +F P+        DLL +S D+LR+W + +     
Sbjct  63   LDDSNGEIRSDPNLSFEHPYPPTKAIFIPD--KDCHRPDLLATSSDFLRVWRIADTDAES  120

Query  469  ---SIEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
                +E  S LN +K SEYC PLTSFDWNE EPRRIGTSSIDTTCTIWD
Sbjct  121  SPRGVELKSLLNGNKNSEYCGPLTSFDWNEAEPRRIGTSSIDTTCTIWD  169



>ref|XP_010514320.1| PREDICTED: WD repeat-containing protein LWD2 [Camelina sativa]
Length=348

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/172 (47%), Positives = 109/172 (63%), Gaps = 17/172 (10%)
 Frame = +1

Query  112  TKMENSTQGSNLRSENS--VTYESPYPIFAMAVSSFAAAHHGLRRRS---VAVGSFLEEY  276
            T  +    GS+ +S+ S   TYE+P+ I+AM  S        +RR     +A+ S +E+Y
Sbjct  4    TSSDQIQDGSDEQSKRSEIYTYEAPWQIYAMNWS--------IRRDKKYRLAITSLIEQY  55

Query  277  KNRVEILSFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWE  456
             NRVEI+  +E    ++++P L F+HPYPPTK  F P+     +  DLL +S D+LRLW 
Sbjct  56   PNRVEIVQLDESNGEIRSDPNLCFEHPYPPTKTSFIPDKEC--QRPDLLATSSDFLRLWR  113

Query  457  VR--EASIEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            +   E+ +E  S LN+ K SE+  P+TSFDWNE EPRRIGTSSIDTTCTIWD
Sbjct  114  ISDDESRVELKSCLNSDKNSEFSGPITSFDWNEAEPRRIGTSSIDTTCTIWD  165



>gb|KFK33589.1| wd repeat-containing protein lwd2 [Arabis alpina]
Length=343

 Score =   149 bits (375),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 103/163 (63%), Gaps = 9/163 (6%)
 Frame = +1

Query  124  NSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSF  303
            N  Q    +     TYE+P+ I+AM  S F   H    +  +A+ S +E++ NRVEI+  
Sbjct  6    NQIQEEEQKRSEIYTYEAPWQIYAMNWS-FRKDH----KYRLAITSLIEQFPNRVEIVQL  60

Query  304  EEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREAS--IE  477
            +E    + +NP L+F+HPYPPTK  F P+     +  DLL +S D+LRLW + + S  +E
Sbjct  61   DESNGEILSNPNLSFEHPYPPTKTSFIPDKEC--QKPDLLATSSDFLRLWRISDDSSRVE  118

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
              S LN+ K SE+  P+TSFDWNE EPRRIGTSSIDTTCTIWD
Sbjct  119  LKSCLNSDKNSEFSGPITSFDWNEAEPRRIGTSSIDTTCTIWD  161



>ref|NP_189298.1| protein LIGHT-REGULATED WD 2 [Arabidopsis thaliana]
 sp|Q38960.1|LWD2_ARATH RecName: Full=WD repeat-containing protein LWD2; AltName: Full=Protein 
ANTHOCYANIN 11-B; Short=AtAN11-B; AltName: Full=Protein 
LIGHT-REGULATED WD2; AltName: Full=WD repeat-containing 
protein AN11-B [Arabidopsis thaliana]
 emb|CAA66815.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAA66120.1| beta-transducin like protein [Arabidopsis thaliana]
 dbj|BAB01729.1| beta-transducin like protein [Arabidopsis thaliana]
 gb|AAM63346.1| transcriptional regulator protein, putative [Arabidopsis thaliana]
 gb|AAV85716.1| At3g26640 [Arabidopsis thaliana]
 gb|AEE77190.1| WD repeat-containing protein LWD2 [Arabidopsis thaliana]
Length=346

 Score =   149 bits (375),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 110/169 (65%), Gaps = 16/169 (9%)
 Frame = +1

Query  115  KMENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRS---VAVGSFLEEYKNR  285
            +++N ++  + RSE   TYE+P+ I+AM  S        +RR     +A+ S +E+Y NR
Sbjct  7    QIQNGSEEQSKRSE-IYTYEAPWQIYAMNWS--------IRRDKKYRLAITSLIEQYPNR  57

Query  286  VEILSFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVR-  462
            VEI+  +E    ++++P L F+HPYPPTK  F P+     +  DLL +S D+LRLW +  
Sbjct  58   VEIVQLDESNGEIRSDPNLCFEHPYPPTKTSFIPDKEC--QRPDLLATSSDFLRLWRISD  115

Query  463  -EASIEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
             E+ +E  S L++ K SE+  P+TSFDWNE EPRRIGTSSIDTTCTIWD
Sbjct  116  DESRVELKSCLSSDKNSEFSGPITSFDWNEAEPRRIGTSSIDTTCTIWD  164



>ref|XP_009380013.1| PREDICTED: WD repeat-containing protein LWD1-like [Musa acuminata 
subsp. malaccensis]
Length=373

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 104/160 (65%), Gaps = 10/160 (6%)
 Frame = +1

Query  133  QGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEED  312
            Q    RSE   TYE+P+ I+AM  S      + L     A+GS LE Y N +EI+  +E 
Sbjct  30   QQKQQRSE-IYTYEAPWHIYAMNWSVRRDKKYRL-----AIGSLLEGYGNLMEIVQLDEA  83

Query  313  TVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREAS--IEPVS  486
            T  ++++P L+F+HPYPPTK MF P+        DLL +S D+LR+W V + S  +E  +
Sbjct  84   TGEIRSDPALSFEHPYPPTKAMFVPD--RDCLRPDLLATSADFLRIWRVADDSSRVELRA  141

Query  487  TLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
             LN ++ SE+C PLTSFDWN+ EPRRIGTSSIDTTCT+WD
Sbjct  142  LLNGNRNSEFCGPLTSFDWNDAEPRRIGTSSIDTTCTVWD  181



>ref|XP_010425377.1| PREDICTED: WD repeat-containing protein LWD2-like [Camelina sativa]
Length=350

 Score =   149 bits (375),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 109/174 (63%), Gaps = 19/174 (11%)
 Frame = +1

Query  112  TKMENSTQGSNLRSENS--VTYESPYPIFAMAVSSFAAAHHGLRRRS---VAVGSFLEEY  276
            T  +    GS+ +S+ S   TYE+P+ I+AM  S        +RR     +A+ S +E+Y
Sbjct  4    TSSDQIQDGSDEQSKRSEIYTYEAPWQIYAMNWS--------IRRDKKYRLAITSLIEQY  55

Query  277  KNRVEILSFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWE  456
             NRVEI+  +E    ++++P L F+HPYPPTK  F P+     +  DLL +S D+LRLW 
Sbjct  56   PNRVEIVQLDESNGEIRSDPNLCFEHPYPPTKTSFIPDKEC--QRPDLLATSSDFLRLWR  113

Query  457  VR----EASIEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            +     E+ +E  S LN+ K SE+  P+TSFDWNE EPRRIGTSSIDTTCTIWD
Sbjct  114  ISDSDDESRVELKSCLNSDKNSEFSGPITSFDWNEAEPRRIGTSSIDTTCTIWD  167



>gb|AAO42231.1| putative transcriptional regulator protein [Arabidopsis thaliana]
Length=346

 Score =   148 bits (374),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 110/169 (65%), Gaps = 16/169 (9%)
 Frame = +1

Query  115  KMENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRS---VAVGSFLEEYKNR  285
            +++N ++  + RSE   TYE+P+ I+AM  S        +RR     +A+ S +E+Y NR
Sbjct  7    QIQNGSEEQSKRSE-IYTYEAPWQIYAMNWS--------IRRDKKYRLAITSLIEQYPNR  57

Query  286  VEILSFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVR-  462
            VEI+  +E    ++++P L F+HPYPPTK  F P+     +  DLL +S D+LRLW +  
Sbjct  58   VEIVQLDESNGEVRSDPNLCFEHPYPPTKTSFIPDKEC--QRPDLLATSSDFLRLWRISD  115

Query  463  -EASIEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
             E+ +E  S L++ K SE+  P+TSFDWNE EPRRIGTSSIDTTCTIWD
Sbjct  116  DESRVELKSCLSSDKNSEFSGPITSFDWNEAEPRRIGTSSIDTTCTIWD  164



>ref|XP_002875329.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51588.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
Length=346

 Score =   148 bits (373),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 110/169 (65%), Gaps = 16/169 (9%)
 Frame = +1

Query  115  KMENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRS---VAVGSFLEEYKNR  285
            +++N +   + RSE   TYE+P+ I+AM  S        +RR     +A+ S +E+Y NR
Sbjct  7    QIQNGSDEQSKRSE-IYTYEAPWQIYAMNWS--------IRRDKKYRLAITSLIEQYPNR  57

Query  286  VEILSFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVR-  462
            VEI+  +E    ++++P L F+HPYPPTK  F P+     +S DLL +S D+LRLW +  
Sbjct  58   VEIVQLDESNGEIQSDPNLCFEHPYPPTKTSFIPDKEC--QSPDLLATSSDFLRLWRISD  115

Query  463  -EASIEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
             E+ +E  S L++ K +E+  P+TSFDWNE EPRRIGTSSIDTTCTIWD
Sbjct  116  DESRVELRSCLSSDKNNEFSGPITSFDWNEAEPRRIGTSSIDTTCTIWD  164



>ref|XP_003624554.1| WD repeat protein [Medicago truncatula]
Length=513

 Score =   150 bits (380),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 75/155 (48%), Positives = 103/155 (66%), Gaps = 15/155 (10%)
 Frame = +1

Query  166  TYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDTVTLKTNPGLA  345
            TYE+P+ I+AM  S      + L     A+ S LE+Y NRVEI+  ++ T  +K++P L+
Sbjct  23   TYEAPWHIYAMNWSVRRDKKYRL-----AIASLLEQYPNRVEIVQLDDTTGEIKSDPNLS  77

Query  346  FDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREA--------SIEPVSTLNNS  501
            F+HPYPPTK +F P+     +  DLL +S D+LR+W + ++        ++E  + LN +
Sbjct  78   FEHPYPPTKSIFIPDK--DCQRPDLLATSSDFLRIWRISDSDESASDSRAVELKTLLNGN  135

Query  502  KTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            K SEYC P+TSFDWNE EPRRIGTSSIDTTCTIWD
Sbjct  136  KNSEYCGPITSFDWNEAEPRRIGTSSIDTTCTIWD  170



>ref|XP_006291421.1| hypothetical protein CARUB_v10017559mg [Capsella rubella]
 gb|EOA24319.1| hypothetical protein CARUB_v10017559mg [Capsella rubella]
Length=346

 Score =   148 bits (373),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 110/172 (64%), Gaps = 17/172 (10%)
 Frame = +1

Query  112  TKMENSTQGSNLRSENS--VTYESPYPIFAMAVSSFAAAHHGLRRRS---VAVGSFLEEY  276
            T  +    GS+ +S+ S   TYE+P+ I+AM  S        +RR     +A+ S +E+Y
Sbjct  3    TSNDQIQDGSDEQSKRSEIYTYEAPWQIYAMNWS--------IRRDKKYRLAITSLIEQY  54

Query  277  KNRVEILSFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWE  456
             NRVEI+  +E    ++++P L+F+HPYPPTK  F P+     +  DLL +S D+LRLW 
Sbjct  55   PNRVEIVQLDESNGEIRSDPNLSFEHPYPPTKTSFIPDKEC--QRPDLLATSSDFLRLWR  112

Query  457  V--REASIEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            +   ++ +E  S LN+ K SE+  P+TSFDWNE EPRRIGTSSIDTTCTIWD
Sbjct  113  IADDDSRVELKSCLNSDKNSEFSGPITSFDWNEAEPRRIGTSSIDTTCTIWD  164



>gb|KFK43561.1| wd repeat-containing protein lwd1 [Arabis alpina]
Length=346

 Score =   148 bits (373),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 107/165 (65%), Gaps = 10/165 (6%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            +++ +     RSE   TYE+P+  +AM  S      + L     A+ S LE++ NRVEI+
Sbjct  8    IQDGSDEQQKRSE-IYTYEAPWHFYAMNWSVRRDKKYRL-----AITSLLEQHPNRVEIV  61

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVRE--AS  471
              +E    ++++P L+F+HPYPPTK +F P+     +  DLL +S D+LRLW + +  + 
Sbjct  62   QLDESNGEIRSDPNLSFEHPYPPTKTIFIPD--KECQKPDLLATSSDFLRLWRIADDHSR  119

Query  472  IEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            +E  S LN++K SE+C PLTSFDWNE EPRRIGTSS DTTCTIWD
Sbjct  120  VELKSCLNSNKNSEFCGPLTSFDWNEAEPRRIGTSSTDTTCTIWD  164



>gb|AHM25607.1| WD40 repeat protein [Ipomoea batatas]
Length=346

 Score =   147 bits (372),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 102/149 (68%), Gaps = 9/149 (6%)
 Frame = +1

Query  166  TYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDTVTLKTNPGLA  345
            TYE+P+ I+AM  S         +R  +A+ S LE+Y NRVEI+  ++    ++++  L+
Sbjct  23   TYEAPWHIYAMNWSV-----RKDKRYRLAIASLLEQYPNRVEIVQLDDSNGEVRSDSNLS  77

Query  346  FDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVRE--ASIEPVSTLNNSKTSEYC  519
            F+HPYPPTK++F P+     +  DLL +S DYLR+W V +  + +E  + LNN++ SE+ 
Sbjct  78   FEHPYPPTKVIFIPD--KECQKPDLLATSSDYLRVWRVADDNSRVEIKTVLNNNRNSEFS  135

Query  520  APLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
             PLTSFDWNE EP+RIGTSSIDTTCTIWD
Sbjct  136  GPLTSFDWNEAEPKRIGTSSIDTTCTIWD  164



>ref|XP_002507884.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO69142.1| predicted protein [Micromonas sp. RCC299]
Length=336

 Score =   147 bits (371),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 100/160 (63%), Gaps = 7/160 (4%)
 Frame = +1

Query  127  STQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFE  306
            +  GS        TYE+P+ ++AM  S         +R  +A+GSF+EEY N+VEI++ +
Sbjct  2    AAMGSGQSGAEIYTYEAPWLVYAMNWSVRQD-----KRFRLALGSFVEEYSNKVEIITLD  56

Query  307  EDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEPVS  486
            E        P   FDHPYP TK+MF P+  A   S DLL +SGDYLR+W + +  +   S
Sbjct  57   EQRREFPAEPTHRFDHPYPCTKIMFVPD--AEGTSEDLLATSGDYLRVWRIGDDGVHLRS  114

Query  487  TLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
             LNN+K S++CAPLTSFDW+     R+GTSS+DTTCTIWD
Sbjct  115  LLNNNKNSDFCAPLTSFDWSTTNLARVGTSSLDTTCTIWD  154



>ref|XP_001417471.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95764.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=332

 Score =   147 bits (371),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 105/148 (71%), Gaps = 8/148 (5%)
 Frame = +1

Query  166  TYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDTVTLKTNPGLA  345
            TYE+P+ I+A   S         +R  +A+GSF+EEY N+VEI++ +E+T         +
Sbjct  11   TYEAPWMIYACNWSV-----RQDKRFRLALGSFVEEYSNKVEIITLDEETGEFPKEAQCS  65

Query  346  FDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVRE-ASIEPVSTLNNSKTSEYCA  522
            F HPYP TK++F P+   + +  DLL ++GDYLR+W+V++  +++  S LNN+K+SE+CA
Sbjct  66   FTHPYPCTKILFIPDKECTKE--DLLATTGDYLRIWQVQDDNTVQMKSLLNNNKSSEFCA  123

Query  523  PLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            PLTSFDWNE + +R+GTSSIDTTCTIWD
Sbjct  124  PLTSFDWNETKLQRVGTSSIDTTCTIWD  151



>ref|XP_010458730.1| PREDICTED: WD repeat-containing protein LWD1-like [Camelina sativa]
Length=346

 Score =   147 bits (371),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 107/165 (65%), Gaps = 10/165 (6%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            +++ +     RSE   TYE+P+ I+AM  S      + L     A+ S LE+Y NRVEI+
Sbjct  8    IQDGSDEQQKRSE-IYTYEAPWHIYAMNWSVRRDKKYRL-----AITSLLEQYPNRVEIV  61

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVRE--AS  471
              +E    ++++  L+F+HPYPPTK +F P+     +  DLL +S D+LRLW + +  + 
Sbjct  62   QLDESNGEIRSDLNLSFEHPYPPTKTIFIPDKEC--QRPDLLATSSDFLRLWRIADDHSR  119

Query  472  IEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            +E  S LN++K SE+C PLTSFDWNE EPRRIGTSS DTTCTIWD
Sbjct  120  VELKSCLNSNKNSEFCGPLTSFDWNEAEPRRIGTSSTDTTCTIWD  164



>ref|XP_003058080.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58031.1| predicted protein [Micromonas pusilla CCMP1545]
Length=334

 Score =   146 bits (369),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 100/150 (67%), Gaps = 13/150 (9%)
 Frame = +1

Query  166  TYESPYPIFAMAVSSFAAAHHGLRRRS---VAVGSFLEEYKNRVEILSFEEDTVTLKTNP  336
            TYE+P+ I+A        A+  +RR     +AVGSF+EEY NRVEI++ +E+     + P
Sbjct  13   TYEAPWLIYA--------ANWSVRRDKRFRLAVGSFVEEYGNRVEIITLDEERGAFPSTP  64

Query  337  GLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEPVSTLNNSKTSEY  516
              +F HPYP TKL F P+     +  DL+ +SGDYLR+W + +  +     LNNSK SE+
Sbjct  65   THSFAHPYPCTKLAFIPDVECGKE--DLVATSGDYLRVWNITDDGVAMRCLLNNSKKSEF  122

Query  517  CAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            CAPLTSFDWNE + +RIGTSS+DTTCTIWD
Sbjct  123  CAPLTSFDWNEQKLQRIGTSSLDTTCTIWD  152



>emb|CDP16753.1| unnamed protein product [Coffea canephora]
Length=346

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 100/149 (67%), Gaps = 9/149 (6%)
 Frame = +1

Query  166  TYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDTVTLKTNPGLA  345
            TYE+P+ I+AM  S      + L     A+ S +E+Y NR+EI+  ++    ++++P L 
Sbjct  23   TYEAPWHIYAMNWSVRRDKKYRL-----AIASLMEQYPNRLEIVQLDDSNGEIRSDPNLC  77

Query  346  FDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREAS--IEPVSTLNNSKTSEYC  519
            F+HPYPPTK++F P+     +  DLL +S DYLR+W V +    ++  S LNN++ SE+ 
Sbjct  78   FEHPYPPTKVIFIPD--KECQKPDLLATSSDYLRVWRVADDGTRVDMKSLLNNNRNSEFS  135

Query  520  APLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
             PLTSFDWNE EP+RIGTSSIDTTCTIWD
Sbjct  136  GPLTSFDWNEAEPKRIGTSSIDTTCTIWD  164



>ref|XP_007215608.1| hypothetical protein PRUPE_ppa007783mg [Prunus persica]
 gb|EMJ16807.1| hypothetical protein PRUPE_ppa007783mg [Prunus persica]
Length=356

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/169 (45%), Positives = 106/169 (63%), Gaps = 19/169 (11%)
 Frame = +1

Query  136  GSNLRSENS--VTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEE  309
            GS+ + + S   TYE+P+ I+AM  S      + L     A+ S LE+Y NRVEI+  ++
Sbjct  13   GSDEQQKRSEIYTYEAPWHIYAMNWSVRRDKKYRL-----AIASLLEQYPNRVEIVQLDD  67

Query  310  DTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREAS------  471
                ++++P L+F+HPYPPTK +F P+     +  DLL +S D+LR+W +          
Sbjct  68   SNGEIRSDPNLSFEHPYPPTKTIFIPD--KECQKPDLLATSSDFLRVWRISGEDEESDSS  125

Query  472  ----IEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
                +E  S LN +K+SE+C PLTSFDWNE EP+RIGTSSIDTTCTIWD
Sbjct  126  SSSSVELKSLLNGNKSSEFCGPLTSFDWNEAEPKRIGTSSIDTTCTIWD  174



>ref|XP_010271596.1| PREDICTED: WD repeat-containing protein LWD1-like [Nelumbo nucifera]
 ref|XP_010271597.1| PREDICTED: WD repeat-containing protein LWD1-like [Nelumbo nucifera]
 ref|XP_010271598.1| PREDICTED: WD repeat-containing protein LWD1-like [Nelumbo nucifera]
 ref|XP_010271599.1| PREDICTED: WD repeat-containing protein LWD1-like [Nelumbo nucifera]
Length=332

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/147 (48%), Positives = 97/147 (66%), Gaps = 7/147 (5%)
 Frame = +1

Query  166  TYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDTVTLKTNPGLA  345
            TY++ +P+ A++ S      H L     A+GSFLEEY N+VE++ F +DT     +  L 
Sbjct  9    TYDAQWPVCAVSWSVRRDKKHRL-----AIGSFLEEYSNKVELVQFNQDTADFSNDSRLV  63

Query  346  FDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEPVSTLNNSKTSEYCAP  525
            FDHPY PTKLMF P  +    + D++ +SGDYLRLWE+ +  IE  + LN +K+S + +P
Sbjct  64   FDHPYSPTKLMFFP--SEDTLNPDIIATSGDYLRLWEIHDDRIELRALLNGNKSSGFNSP  121

Query  526  LTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            +TSFDW E +PRR+   SIDTTCTIWD
Sbjct  122  VTSFDWAEFDPRRVAACSIDTTCTIWD  148



>ref|XP_010507001.1| PREDICTED: WD repeat-containing protein LWD2-like [Camelina sativa]
Length=404

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 98/149 (66%), Gaps = 9/149 (6%)
 Frame = +1

Query  166  TYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDTVTLKTNPGLA  345
            TYE+P+ I+AM  S      + L     A+ S +E+Y NRVEI+  +E    ++++P L 
Sbjct  80   TYEAPWQIYAMNWSIRRDKKYRL-----AITSLIEQYPNRVEIVQLDESNGEIRSDPNLC  134

Query  346  FDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVR--EASIEPVSTLNNSKTSEYC  519
            F+HPYPPTK  F P+     +  DLL +S D+LRLW +   E+ +E  S LN+ K SE+ 
Sbjct  135  FEHPYPPTKTSFIPDKEC--QRPDLLATSSDFLRLWRISDDESRVELKSCLNSDKNSEFS  192

Query  520  APLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
             P+TSFDWNE EPRRIGTSSIDTTCTIWD
Sbjct  193  GPITSFDWNEAEPRRIGTSSIDTTCTIWD  221



>gb|AAM95646.1| WD-repeat protein GhTTG4 [Gossypium hirsutum]
Length=346

 Score =   145 bits (367),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 100/149 (67%), Gaps = 9/149 (6%)
 Frame = +1

Query  166  TYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDTVTLKTNPGLA  345
            TYE+P+ I+AM  S      + L     A+ S LE+Y NR++I+  ++    ++++P L+
Sbjct  23   TYEAPWYIYAMNWSVRRDKKYRL-----AIASLLEQYPNRLQIVQLDDSNGEIRSDPNLS  77

Query  346  FDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVRE--ASIEPVSTLNNSKTSEYC  519
            FDHPYP TK +F P+     +  DLL +S D+LR+W + +  + ++  S LN +K SE+C
Sbjct  78   FDHPYPATKTIFIPD--KDCQKPDLLATSSDFLRIWRISDDGSRVDLKSLLNGNKNSEFC  135

Query  520  APLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
             PLTSFDWNE EP+RIGTSSIDTTCTIWD
Sbjct  136  GPLTSFDWNEAEPKRIGTSSIDTTCTIWD  164



>gb|KJB30089.1| hypothetical protein B456_005G129400 [Gossypium raimondii]
Length=346

 Score =   145 bits (367),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 100/149 (67%), Gaps = 9/149 (6%)
 Frame = +1

Query  166  TYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDTVTLKTNPGLA  345
            TYE+P+ I+AM  S      + L     A+ S LE+Y NR++I+  ++    ++++P L+
Sbjct  23   TYEAPWYIYAMNWSVRRDKKYRL-----AIASLLEQYPNRLQIVQLDDSNGEIRSDPNLS  77

Query  346  FDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVRE--ASIEPVSTLNNSKTSEYC  519
            FDHPYP TK +F P+     +  DLL +S D+LR+W + +  + ++  S LN +K SE+C
Sbjct  78   FDHPYPATKTIFIPD--KDCQKPDLLATSSDFLRIWRISDDGSRVDLKSLLNGNKNSEFC  135

Query  520  APLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
             PLTSFDWNE EP+RIGTSSIDTTCTIWD
Sbjct  136  GPLTSFDWNEAEPKRIGTSSIDTTCTIWD  164



>ref|XP_009378073.1| PREDICTED: WD repeat-containing protein LWD1 [Pyrus x bretschneideri]
Length=354

 Score =   145 bits (366),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 75/167 (45%), Positives = 106/167 (63%), Gaps = 17/167 (10%)
 Frame = +1

Query  136  GSNLRSENS--VTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEE  309
            GS+ + + S   TYE+P+ I+AM  S      + L     A+ S LE+Y NRVEI+  ++
Sbjct  13   GSDEQQKRSEIYTYEAPWHIYAMNWSVRRDKKYRL-----AISSLLEQYPNRVEIVQLDD  67

Query  310  DTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREAS------  471
                ++++P L+F+HPYPPTK +F P+     +  DLL +S D+LR+W +          
Sbjct  68   SNGEIRSDPNLSFEHPYPPTKTIFIPD--KECQKPDLLATSSDFLRVWRISGDEDDSDSS  125

Query  472  --IEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
              +E  S LN++K SE+C P+TSFDWNE EP+RIGTSSIDTTCTIWD
Sbjct  126  SSVELKSLLNSNKNSEFCGPITSFDWNEAEPKRIGTSSIDTTCTIWD  172



>ref|XP_005847572.1| hypothetical protein CHLNCDRAFT_56155 [Chlorella variabilis]
 gb|EFN55470.1| hypothetical protein CHLNCDRAFT_56155 [Chlorella variabilis]
Length=355

 Score =   145 bits (365),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 103/168 (61%), Gaps = 13/168 (8%)
 Frame = +1

Query  118  MENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEIL  297
            M++  Q    R+E   TY S   ++A   SS       L     AVGSF+++Y N+VEI+
Sbjct  1    MQDQQQQGEGRAE-IYTYSSSASVYACGFSSRPDKPFRL-----AVGSFIDDYANKVEII  54

Query  298  SFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVR-----  462
              +E    ++ NP L F HPYPPTK+ F P+ + +    DLL +SGD+LRLW V      
Sbjct  55   QLDEAAGVVRNNPALTFQHPYPPTKVAFIPDKSGT--RPDLLATSGDFLRLWRVSDEPGA  112

Query  463  EASIEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            +  +     LNN+K  ++ APLTSFDWNE++PRR+GT+SIDTTCT+WD
Sbjct  113  QQGVRLEKLLNNNKGGDFAAPLTSFDWNELDPRRVGTASIDTTCTVWD  160



>ref|XP_010929534.1| PREDICTED: WD repeat-containing protein LWD1 [Elaeis guineensis]
Length=379

 Score =   145 bits (366),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 108/186 (58%), Gaps = 31/186 (17%)
 Frame = +1

Query  121  ENSTQGSNLRSENS--VTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEI  294
            E + +GS  + + S   TYE+P+ I+AM  S      + L     A+ S LE+Y NRVEI
Sbjct  8    ERTPEGSEEQQKRSEIYTYEAPWHIYAMNWSVRRDKKYRL-----AIASLLEQYPNRVEI  62

Query  295  LSFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEV-----  459
            +  ++ T  ++++P L+F+HPYPPTK MF P+        DLL +S D+LRLW +     
Sbjct  63   VQLDDSTGEIRSDPALSFEHPYPPTKTMFVPD--RDCIRPDLLATSADFLRLWRISSDDE  120

Query  460  -----------------REASIEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDT  588
                               + +E  S LN ++ SE+C PLTSFDWNE EPRR+GTSSIDT
Sbjct  121  GGGGDDDRKHNSSSKSPSSSRVELRSLLNGNRNSEFCGPLTSFDWNEAEPRRVGTSSIDT  180

Query  589  TCTIWD  606
            TCTIWD
Sbjct  181  TCTIWD  186



>ref|XP_008387037.1| PREDICTED: WD repeat-containing protein LWD1-like [Malus domestica]
Length=336

 Score =   144 bits (363),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 70/147 (48%), Positives = 102/147 (69%), Gaps = 7/147 (5%)
 Frame = +1

Query  166  TYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDTVTLKTNPGLA  345
            TY S +PI+++A   ++  H    R  +A+GSF+E+Y N+VE++ F +DT    T+  L 
Sbjct  13   TYISQWPIYSLA---WSVRHDKPSR--LAIGSFIEDYGNKVELVQFNQDTSDFATDNRLT  67

Query  346  FDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEPVSTLNNSKTSEYCAP  525
            FDHPY PT LMF P+   +  + DL+ +SGDYLRLWE+ +  IE  S LN++++SE+ + 
Sbjct  68   FDHPYAPTNLMFFPSEDTT--NPDLIATSGDYLRLWEIHDDRIELKSLLNSNRSSEFNSA  125

Query  526  LTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            +TSFDW E + RR+ TSS+DTTCTIWD
Sbjct  126  ITSFDWVECDTRRVATSSVDTTCTIWD  152



>gb|AFK49516.1| unknown [Medicago truncatula]
Length=352

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/170 (45%), Positives = 108/170 (64%), Gaps = 16/170 (9%)
 Frame = +1

Query  121  ENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILS  300
            ++++     RSE   TYE+P+ I+AM  S      + L     A+ S LE+Y NRVEI+ 
Sbjct  9    QDTSDEQQKRSE-IYTYEAPWHIYAMNWSVRRDKKYRL-----AIASLLEQYPNRVEIVQ  62

Query  301  FEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREA----  468
             ++ T  +K++P L+ +HPYPPTK +F P+     +  DLL +S D+L +W + ++    
Sbjct  63   LDDTTGEIKSDPNLSLEHPYPPTKSIFIPD--KDCQRPDLLATSSDFLCIWRISDSDESA  120

Query  469  ----SIEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
                ++E  + LN +K SEYC P+TSFDWNE EPRRIGTSSIDTTCTIWD
Sbjct  121  SDSRAVELKTLLNGNKNSEYCGPITSFDWNEAEPRRIGTSSIDTTCTIWD  170



>ref|XP_005833209.1| hypothetical protein GUITHDRAFT_86758 [Guillardia theta CCMP2712]
 gb|EKX46229.1| hypothetical protein GUITHDRAFT_86758 [Guillardia theta CCMP2712]
Length=337

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 102/163 (63%), Gaps = 15/163 (9%)
 Frame = +1

Query  136  GSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDT  315
            G   + +   TYE+P+ I+ M+ S         +R  +AVGSF+EEY N+V+I+   E+ 
Sbjct  2    GEASKKKEIFTYEAPWEIYGMSWSVRPD-----KRFRIAVGSFIEEYSNKVQIIQLNENK  56

Query  316  VTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREAS------IE  477
               +      FDHPYP TK+M+ P+   + K  DLL ++GDYLRLWEV+  +      + 
Sbjct  57   GQFQETA--IFDHPYPTTKIMWIPDKVGTQK--DLLATTGDYLRLWEVQSGASSSNSSVA  112

Query  478  PVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
                LNN+K SE+CAPLTSFDWN+ +P  IGTSSIDTTCTIW+
Sbjct  113  MKKLLNNNKNSEFCAPLTSFDWNDTDPSIIGTSSIDTTCTIWN  155



>ref|XP_009350670.1| PREDICTED: WD repeat-containing protein LWD1-like [Pyrus x bretschneideri]
Length=354

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/167 (44%), Positives = 106/167 (63%), Gaps = 17/167 (10%)
 Frame = +1

Query  136  GSNLRSENS--VTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEE  309
            GS+ + + S   TY++P+ I++M  S      + L     A+ S LE+Y NRVEI+  ++
Sbjct  13   GSDEQQKRSEIYTYDAPWHIYSMNWSVRRDKKYRL-----AIASLLEQYPNRVEIVQLDD  67

Query  310  DTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREAS------  471
                ++++P L+F+HPYPPTK++F P+     +  DLL +S D+LR+W +          
Sbjct  68   SNGEIRSDPNLSFEHPYPPTKIIFIPD--KECQKPDLLATSSDFLRVWRISGDEDDSDSS  125

Query  472  --IEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
              +E  S LN +K SE+C P+TSFDWNE EP+RIGTSSIDTTCTIWD
Sbjct  126  SSVELKSLLNGNKNSEFCGPITSFDWNEAEPKRIGTSSIDTTCTIWD  172



>ref|XP_008379028.1| PREDICTED: WD repeat-containing protein LWD1 [Malus domestica]
 ref|XP_008379029.1| PREDICTED: WD repeat-containing protein LWD1 [Malus domestica]
 ref|XP_008357691.1| PREDICTED: WD repeat-containing protein LWD1-like [Malus domestica]
 ref|XP_008357692.1| PREDICTED: WD repeat-containing protein LWD1-like [Malus domestica]
Length=354

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 105/167 (63%), Gaps = 17/167 (10%)
 Frame = +1

Query  136  GSNLRSENS--VTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEE  309
            GS+ + + S   TY++P+ I+AM  S      + L     A+ S LE+Y NRVEI+  ++
Sbjct  13   GSDEQQKRSEIYTYDAPWHIYAMNWSVRRDKKYRL-----AIASLLEQYPNRVEIVQLDD  67

Query  310  DTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREAS------  471
                ++++P L+F+HPYPPTK +F P+     +  DLL +S D+LR+W +          
Sbjct  68   SNGEIRSDPNLSFEHPYPPTKTIFIPD--KECQKPDLLATSSDFLRVWRISGDEDDSDSS  125

Query  472  --IEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
              +E  S LN +K SE+C P+TSFDWNE EP+RIGTSSIDTTCTIWD
Sbjct  126  SSVELKSLLNGNKNSEFCGPITSFDWNEAEPKRIGTSSIDTTCTIWD  172



>ref|XP_008178829.1| PREDICTED: DDB1- and CUL4-associated factor 7 [Acyrthosiphon 
pisum]
Length=346

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 101/159 (64%), Gaps = 9/159 (6%)
 Frame = +1

Query  127  STQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFE  306
            +  GS  + +    +E+P+P+++M  S         +R  +A+GSF+EEY N+V+I+S +
Sbjct  2    AVHGSTPKRKEIYKHEAPWPLYSMNWSVRPD-----KRFRLAIGSFVEEYNNKVQIVSLD  56

Query  307  EDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEPVS  486
            E+      +P   FDHPYP TK+M+ P+        DLL +SGDYLR+W   E       
Sbjct  57   EEVSEF--SPKSTFDHPYPTTKIMWIPDSKGVFP--DLLATSGDYLRIWRAGEPETRLEC  112

Query  487  TLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIW  603
             LNN+K S++CAPLTSFDWNEV+P  IGTSSIDTTCTIW
Sbjct  113  ILNNNKNSDFCAPLTSFDWNEVDPNLIGTSSIDTTCTIW  151



>gb|ADQ27313.1| truncated A2 protein [Pisum sativum]
Length=111

 Score =   137 bits (346),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 89/114 (78%), Gaps = 6/114 (5%)
 Frame = +1

Query  118  MENSTQGSNLRSEN-SVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEI  294
            M+NSTQ S+LRS+N SVTY+SP+P++AMA SS     H  R   +AVGSF+EEY NRV+I
Sbjct  1    MDNSTQESHLRSDNNSVTYDSPHPLYAMAFSSNPNPQHHQR---IAVGSFIEEYTNRVDI  57

Query  295  LSFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMK--SADLLVSSGDYLRL  450
            LSF  DT+++K  P L+FDHPYPPTKLMFHP   +S++  S+DLL +SGDYLRL
Sbjct  58   LSFNPDTLSIKPQPSLSFDHPYPPTKLMFHPATHSSLQKTSSDLLATSGDYLRL  111



>gb|KDR15607.1| WD repeat-containing protein 68 [Zootermopsis nevadensis]
Length=346

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 99/159 (62%), Gaps = 9/159 (6%)
 Frame = +1

Query  127  STQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFE  306
            +  G+  + +    YE+P+P+++M  S         +R  +A+GSF+EEY N+ +I+S +
Sbjct  2    AVHGATPKRKEIYKYEAPWPLYSMNWSVRPD-----KRFRLALGSFVEEYNNKAQIVSLD  56

Query  307  EDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEPVS  486
            EDT          FDHPYP TK+M+ P+        DLL +SGDYLR+W   E       
Sbjct  57   EDTSEFSAKS--TFDHPYPTTKIMWIPDSKGIFP--DLLATSGDYLRVWRAGEPETRLEC  112

Query  487  TLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIW  603
             LNN+K S++CAPLTSFDWNEV+P  IGTSSIDTTCTIW
Sbjct  113  VLNNNKNSDFCAPLTSFDWNEVDPNLIGTSSIDTTCTIW  151



>dbj|BAJ33518.1| WD-repeats transcriptional factor [Dahlia pinnata]
Length=369

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 102/168 (61%), Gaps = 28/168 (17%)
 Frame = +1

Query  166  TYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDTVTLKTNPGLA  345
            TYE+P+ I+AM  S         ++  +A+ S LE+Y NRVEI+  ++    ++++P L+
Sbjct  27   TYEAPWHIYAMNWSVRRD-----KKYRLAIASLLEQYPNRVEIVQLDDSNGEIRSDPTLS  81

Query  346  FDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEV---------------------R  462
            F+HPYPPTKL+F P+     +  DLL SS D+LR+W +                      
Sbjct  82   FEHPYPPTKLIFIPD--KECQKPDLLASSSDFLRIWRIPDDDDITEDDGGNNNNNNNNNN  139

Query  463  EASIEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
               +E  S LNN++ SE+C P+TSFDWNE EP+RIGTSSIDTTCTIWD
Sbjct  140  SRKVEMKSLLNNNRNSEFCGPVTSFDWNEAEPKRIGTSSIDTTCTIWD  187



>ref|XP_010942310.1| PREDICTED: WD repeat-containing protein LWD1-like [Elaeis guineensis]
Length=382

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 107/184 (58%), Gaps = 29/184 (16%)
 Frame = +1

Query  121  ENSTQGSNLRSENS--VTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEI  294
            E + +GS  + + S   TYE+P+ I+AM  S      + L     A+ S LE+Y NRVEI
Sbjct  8    ERTPEGSEEQQKRSEIYTYEAPWHIYAMNWSVRRDKKYRL-----AIASLLEQYPNRVEI  62

Query  295  LSFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEV-----  459
            +  ++ T  ++ +P L+F+HPYPPTK MF P+        DLL +S D+LR+W +     
Sbjct  63   VQLDDSTGEIRCDPALSFEHPYPPTKTMFVPD--RECLRPDLLATSADFLRIWRISSDDE  120

Query  460  ---------------REASIEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTC  594
                             + +E  S LN ++ SE+C PLTSFDWNE EPRR+GTSSIDTTC
Sbjct  121  GDDENNKKSNSSSKSSSSRVELRSLLNGNRNSEFCGPLTSFDWNEAEPRRVGTSSIDTTC  180

Query  595  TIWD  606
            TIWD
Sbjct  181  TIWD  184



>ref|XP_011049094.1| PREDICTED: DDB1- and CUL4-associated factor 7 [Acromyrmex echinatior]
 ref|XP_011049095.1| PREDICTED: DDB1- and CUL4-associated factor 7 [Acromyrmex echinatior]
Length=347

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 96/145 (66%), Gaps = 9/145 (6%)
 Frame = +1

Query  169  YESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDTVTLKTNPGLAF  348
            YE+P+P+++M  S         +R  +A+GSF+EEY N+V+I+S +E+T          F
Sbjct  16   YEAPWPLYSMNWSVRPD-----KRFRLALGSFVEEYNNKVQIVSLDEETSEFSAKS--TF  68

Query  349  DHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEPVSTLNNSKTSEYCAPL  528
            DHPYP TK+M+ P+    +   DLL +SGDYLR+W   E        LNN+K S++CAPL
Sbjct  69   DHPYPTTKIMWIPDSKGQLP--DLLATSGDYLRVWRAAEPETRLECVLNNNKNSDFCAPL  126

Query  529  TSFDWNEVEPRRIGTSSIDTTCTIW  603
            TSFDWNEV+P  IGTSSIDTTCTIW
Sbjct  127  TSFDWNEVDPNLIGTSSIDTTCTIW  151



>gb|EGI68826.1| WD repeat-containing protein 68 [Acromyrmex echinatior]
Length=360

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 96/145 (66%), Gaps = 9/145 (6%)
 Frame = +1

Query  169  YESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDTVTLKTNPGLAF  348
            YE+P+P+++M  S         +R  +A+GSF+EEY N+V+I+S +E+T          F
Sbjct  29   YEAPWPLYSMNWSVRPD-----KRFRLALGSFVEEYNNKVQIVSLDEETSEFSAKS--TF  81

Query  349  DHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEPVSTLNNSKTSEYCAPL  528
            DHPYP TK+M+ P+    +   DLL +SGDYLR+W   E        LNN+K S++CAPL
Sbjct  82   DHPYPTTKIMWIPDSKGQL--PDLLATSGDYLRVWRAAEPETRLECVLNNNKNSDFCAPL  139

Query  529  TSFDWNEVEPRRIGTSSIDTTCTIW  603
            TSFDWNEV+P  IGTSSIDTTCTIW
Sbjct  140  TSFDWNEVDPNLIGTSSIDTTCTIW  164



>ref|XP_010090944.1| WD repeat-containing protein LWD1 [Morus notabilis]
 gb|EXB41429.1| WD repeat-containing protein LWD1 [Morus notabilis]
Length=369

 Score =   144 bits (362),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/187 (41%), Positives = 110/187 (59%), Gaps = 32/187 (17%)
 Frame = +1

Query  121  ENSTQGSNLRSENS--VTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEI  294
            E   +GS+ + + S   TYE+P+ I+AM  S         ++  +A+ S LE+  NR+EI
Sbjct  8    EVKQEGSDEQQKRSEIYTYEAPWHIYAMNWSVRRD-----KKYRLAIASLLEQLPNRLEI  62

Query  295  LSFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVRE---  465
            +  ++ T  ++++P L+F+HPYPPTK +F P+     +  DLL +S D+LRLW + +   
Sbjct  63   VQLDDSTGEIRSDPALSFEHPYPPTKTIFIPD--KECQKPDLLATSSDFLRLWRIHDDDS  120

Query  466  --------------------ASIEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSID  585
                                + +  +S LN +K SE+C PLTSFDWNE EPRRIGTSSID
Sbjct  121  DAHLGNGNGDEYNTNTNSGGSRVRLLSLLNGNKNSEFCGPLTSFDWNEAEPRRIGTSSID  180

Query  586  TTCTIWD  606
            TTCTIWD
Sbjct  181  TTCTIWD  187



>ref|XP_002025332.1| GL13429 [Drosophila persimilis]
 gb|EDW30831.1| GL13429 [Drosophila persimilis]
Length=420

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 103/165 (62%), Gaps = 12/165 (7%)
 Frame = +1

Query  109  PTKMENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRV  288
            P K+ +ST G   + +    Y +P+P+++M  S         +R  +A+GSF+EEY N+V
Sbjct  74   PYKIMSSTAG---KRKEIYKYLAPWPLYSMNWSVRPD-----KRFRLALGSFIEEYNNKV  125

Query  289  EILSFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREA  468
            +I+S +EDT          FDHPYP TK+M+ P+        DLL +SGDYLR+W   E 
Sbjct  126  QIISLDEDTSEFSAKS--TFDHPYPTTKIMWIPDSKGVYP--DLLATSGDYLRVWRAGEP  181

Query  469  SIEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIW  603
                   LNN+K S++CAPLTSFDWNEV+P  +GTSSIDTTCTIW
Sbjct  182  DTRLECVLNNNKNSDFCAPLTSFDWNEVDPNLVGTSSIDTTCTIW  226



>ref|XP_001355291.2| GA13113 [Drosophila pseudoobscura pseudoobscura]
 gb|EAL32348.2| GA13113 [Drosophila pseudoobscura pseudoobscura]
Length=420

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 103/165 (62%), Gaps = 12/165 (7%)
 Frame = +1

Query  109  PTKMENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRV  288
            P K+ +ST G   + +    Y +P+P+++M  S         +R  +A+GSF+EEY N+V
Sbjct  74   PYKIMSSTAG---KRKEIYKYLAPWPLYSMNWSVRPD-----KRFRLALGSFIEEYNNKV  125

Query  289  EILSFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREA  468
            +I+S +EDT          FDHPYP TK+M+ P+        DLL +SGDYLR+W   E 
Sbjct  126  QIISLDEDTSEFSAKS--TFDHPYPTTKIMWIPDSKGVYP--DLLATSGDYLRVWRAGEP  181

Query  469  SIEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIW  603
                   LNN+K S++CAPLTSFDWNEV+P  +GTSSIDTTCTIW
Sbjct  182  DTRLECVLNNNKNSDFCAPLTSFDWNEVDPNLVGTSSIDTTCTIW  226



>gb|AAK19620.1|AF336287_1 WD1521 [Gossypium hirsutum]
Length=314

 Score =   142 bits (358),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 90/126 (71%), Gaps = 4/126 (3%)
 Frame = +1

Query  235  RRRSVAVGSFLEEYKNRVEILSFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSA  414
            ++  +A+ S LE Y NR+EI+  ++    ++++P L+FDHPYPPTK +F P+     +  
Sbjct  9    KKYRLAIASLLEHYNNRLEIVQLDDSNGEIRSDPNLSFDHPYPPTKTIFIPDKEC--QKP  66

Query  415  DLLVSSGDYLRLWEVRE--ASIEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDT  588
            DLL +S D+LR+W + +  + ++  S LN +K SE+C PLTSFDWNE EP+RIGTSSIDT
Sbjct  67   DLLATSSDFLRIWRISDDHSRVDLKSLLNGNKNSEFCGPLTSFDWNEAEPKRIGTSSIDT  126

Query  589  TCTIWD  606
            TCTIWD
Sbjct  127  TCTIWD  132



>ref|XP_007204870.1| hypothetical protein PRUPE_ppa017145mg, partial [Prunus persica]
 gb|EMJ06069.1| hypothetical protein PRUPE_ppa017145mg, partial [Prunus persica]
Length=294

 Score =   142 bits (357),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/147 (48%), Positives = 99/147 (67%), Gaps = 7/147 (5%)
 Frame = +1

Query  166  TYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDTVTLKTNPGLA  345
            TY S +PI+++A   ++  H    R  +A+GSF+E+Y N+VE++ F  DT    T+  L 
Sbjct  13   TYISQWPIYSLA---WSVRHDKPSR--LAIGSFIEDYSNKVELVQFNRDTSDFATDNRLI  67

Query  346  FDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEPVSTLNNSKTSEYCAP  525
            FDHPY PT LMF P+   S  + DL+ +SGDYLRLWE+ +  IE  S LN + +SE+ + 
Sbjct  68   FDHPYAPTNLMFFPSKDPS--NPDLIATSGDYLRLWEIHDDRIELKSLLNGNSSSEFNSA  125

Query  526  LTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            +TSFDW E + +R+ TSS+DTTCTIWD
Sbjct  126  ITSFDWAECDTKRVATSSVDTTCTIWD  152



>emb|CAN66600.1| hypothetical protein VITISV_035207 [Vitis vinifera]
Length=335

 Score =   142 bits (358),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 70/147 (48%), Positives = 101/147 (69%), Gaps = 8/147 (5%)
 Frame = +1

Query  166  TYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDTVTLKTNPGLA  345
            TY + +PI+++A S         ++  +AVGSFLE+Y N+VE++ F ++T+   T+  L 
Sbjct  13   TYMAQWPIYSLAWSV-----RRDKKSRLAVGSFLEDYSNKVEVVQFSQETLDFSTDSRLV  67

Query  346  FDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEPVSTLNNSKTSEYCAP  525
            FDHPY PTKLMF P+  A   + DL+ +SGDYLRLWE+ +  IE  + LN +K SE+ + 
Sbjct  68   FDHPYAPTKLMFFPSEEA--MNPDLIATSGDYLRLWEIHDDRIELKALLNGNK-SEFNSA  124

Query  526  LTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            +TSFDW +++ RRI T S+DTTCTIWD
Sbjct  125  ITSFDWAQLDARRIATCSVDTTCTIWD  151



>ref|XP_004929529.1| PREDICTED: DDB1- and CUL4-associated factor 7-like [Bombyx mori]
Length=338

 Score =   142 bits (358),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 95/145 (66%), Gaps = 9/145 (6%)
 Frame = +1

Query  169  YESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDTVTLKTNPGLAF  348
            Y++P+P+++M  S         +R  +A+GSF+EEY N+V+I+S +EDT          F
Sbjct  22   YQAPWPLYSMNWSVRPD-----KRFRLALGSFVEEYNNKVQIISLDEDTSEFTAKS--TF  74

Query  349  DHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEPVSTLNNSKTSEYCAPL  528
            DHPYP TK+M+ P+        DLL +SGDYLR+W   E        LNN+K S++CAPL
Sbjct  75   DHPYPTTKIMWIPDSKGVYP--DLLATSGDYLRIWRAGEPYTLFACVLNNNKNSDFCAPL  132

Query  529  TSFDWNEVEPRRIGTSSIDTTCTIW  603
            TSFDWNEV+P  IGTSSIDTTCTIW
Sbjct  133  TSFDWNEVDPNLIGTSSIDTTCTIW  157



>ref|XP_009345155.1| PREDICTED: WD repeat-containing protein LWD1 [Pyrus x bretschneideri]
Length=354

 Score =   142 bits (359),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 104/167 (62%), Gaps = 17/167 (10%)
 Frame = +1

Query  136  GSNLRSENS--VTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEE  309
            GS+ + + S   TY++P+ I+AM  S      + L     A+ S LE+Y NRVEI+  ++
Sbjct  13   GSDEQQKRSEIYTYDAPWDIYAMNWSVRRDKKYRL-----AIASHLEQYPNRVEIVQLDD  67

Query  310  DTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREAS------  471
                ++++P L+F+HPY PTK +F P+     +  DLL +S D+LR+W +          
Sbjct  68   SNGEIRSDPNLSFEHPYTPTKTIFIPD--KECQKPDLLATSSDFLRVWRISGDEDDSDSS  125

Query  472  --IEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
              +E  S LN +K SEYC P+TSFDWNE EP+RIGTSSIDTTCTIWD
Sbjct  126  SSVELKSLLNGNKNSEYCGPITSFDWNEAEPKRIGTSSIDTTCTIWD  172



>ref|XP_001655183.1| AAEL011196-PA [Aedes aegypti]
 gb|EAT36743.1| AAEL011196-PA [Aedes aegypti]
Length=399

 Score =   143 bits (361),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 78/181 (43%), Positives = 107/181 (59%), Gaps = 17/181 (9%)
 Frame = +1

Query  61   KKPAGDSTLRGKIKF*PTKMENSTQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRR  240
            + P G     G + F  T+  + T G   + +    Y +P+P+++M  S         +R
Sbjct  41   RSPGG-----GIVGFRDTRRMSGTTG---KRKEIYKYLAPWPLYSMNWSVRPD-----KR  87

Query  241  RSVAVGSFLEEYKNRVEILSFEEDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADL  420
              +A+GSF+EEY N+V+I+S +EDT          FDHPYP TK+M+ P+        DL
Sbjct  88   FRLALGSFVEEYNNKVQIISLDEDTSEFSAKS--TFDHPYPTTKIMWIPDSKGVF--PDL  143

Query  421  LVSSGDYLRLWEVREASIEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTI  600
            L +SGDYLR+W   E        LNN+K S++CAPLTSFDWNEV+P  +GTSSIDTTCTI
Sbjct  144  LATSGDYLRVWRAGEPDTRLECVLNNNKNSDFCAPLTSFDWNEVDPNLVGTSSIDTTCTI  203

Query  601  W  603
            W
Sbjct  204  W  204



>ref|XP_004303529.1| PREDICTED: WD repeat-containing protein LWD1-like [Fragaria vesca 
subsp. vesca]
Length=335

 Score =   142 bits (358),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 70/147 (48%), Positives = 100/147 (68%), Gaps = 7/147 (5%)
 Frame = +1

Query  166  TYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDTVTLKTNPGLA  345
            TY S +PI+++A   ++A H    R  +A+GSF+E+Y N+VE++ F   T    T+  L 
Sbjct  13   TYVSQWPIYSLA---WSARHDKPSR--LAIGSFIEDYSNKVELVQFNSSTSDFTTDNRLI  67

Query  346  FDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEPVSTLNNSKTSEYCAP  525
            FDHPY PT LMF P+  A+  + DL+ +SGDYLR+WE+ +  IE  S LN + +SE+ + 
Sbjct  68   FDHPYAPTNLMFFPSDAAT--NPDLIATSGDYLRIWEIHDDRIELKSLLNGNMSSEFNSA  125

Query  526  LTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            +TSFDW E + RR+ TSS+DTTCTIWD
Sbjct  126  ITSFDWAEFDTRRVATSSVDTTCTIWD  152



>gb|EFX69222.1| hypothetical protein DAPPUDRAFT_301020 [Daphnia pulex]
Length=348

 Score =   142 bits (358),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 95/145 (66%), Gaps = 9/145 (6%)
 Frame = +1

Query  169  YESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDTVTLKTNPGLAF  348
            YE+P+ +++M  S         +R  +A+GSF+EEY N+V+++S +ED+          F
Sbjct  16   YEAPWTLYSMNWSVRPD-----KRFRLAIGSFVEEYNNKVQVISLDEDSAEFSAKS--TF  68

Query  349  DHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEPVSTLNNSKTSEYCAPL  528
            DHPYP TK+M+ P+        DLL +SGDYLR+W+  E        LNN+K S++CAPL
Sbjct  69   DHPYPTTKIMWIPDAKGVFP--DLLATSGDYLRIWKAGEPDTRLECLLNNNKNSDFCAPL  126

Query  529  TSFDWNEVEPRRIGTSSIDTTCTIW  603
            TSFDWNEVEP  IGTSSIDTTCTIW
Sbjct  127  TSFDWNEVEPNLIGTSSIDTTCTIW  151



>ref|XP_008341194.1| PREDICTED: WD repeat-containing protein LWD1-like [Malus domestica]
 ref|XP_008353359.1| PREDICTED: WD repeat-containing protein LWD1 [Malus domestica]
Length=354

 Score =   142 bits (359),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 104/167 (62%), Gaps = 17/167 (10%)
 Frame = +1

Query  136  GSNLRSENS--VTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEE  309
            GS+ + + S   TYE+P+ I+AM  S      + L     A+ S LE+  NRVEI+  ++
Sbjct  13   GSDEQQKRSEIYTYEAPWHIYAMNWSVRRDKKYRL-----AIASLLEQAPNRVEIVQLDD  67

Query  310  DTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREAS------  471
                ++++P L+F+HPYPPTK +F P+     +  DLL +S D+LR+W +          
Sbjct  68   SNGEIRSDPNLSFEHPYPPTKTIFIPD--KECQKPDLLATSSDFLRVWRISGDEDNSDSS  125

Query  472  --IEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
              +E  S LN +K SE+C P+TSFDWNE EP+RIGTSSIDTTCTIWD
Sbjct  126  SSVELKSLLNGNKNSEFCGPITSFDWNEAEPKRIGTSSIDTTCTIWD  172



>ref|XP_002281909.1| PREDICTED: WD repeat-containing protein LWD1 [Vitis vinifera]
 ref|XP_010654117.1| PREDICTED: WD repeat-containing protein LWD1 [Vitis vinifera]
 ref|XP_010654118.1| PREDICTED: WD repeat-containing protein LWD1 [Vitis vinifera]
Length=335

 Score =   142 bits (357),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 70/147 (48%), Positives = 101/147 (69%), Gaps = 8/147 (5%)
 Frame = +1

Query  166  TYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDTVTLKTNPGLA  345
            TY + +PI+++A S         ++  +AVGSFLE+Y N+VE++ F ++T+   T+  L 
Sbjct  13   TYMAQWPIYSLAWSV-----RRDKKSRLAVGSFLEDYSNKVEVVQFSQETLDFSTDSRLV  67

Query  346  FDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEPVSTLNNSKTSEYCAP  525
            FDHPY PTKLMF P+  A   + DL+ +SGDYLRLWE+ +  IE  + LN +K SE+ + 
Sbjct  68   FDHPYAPTKLMFFPSEEA--MNPDLIATSGDYLRLWEIHDDRIELKALLNGNK-SEFNSA  124

Query  526  LTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            +TSFDW +++ RRI T S+DTTCTIWD
Sbjct  125  ITSFDWAQLDARRIATCSVDTTCTIWD  151



>ref|XP_003570109.1| PREDICTED: protein TRANSPARENT TESTA GLABRA 1 [Brachypodium distachyon]
Length=351

 Score =   142 bits (358),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 105/176 (60%), Gaps = 26/176 (15%)
 Frame = +1

Query  121  ENSTQGSNLRSEN--SVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEI  294
            + S  G++  + N  + T E P+ IFA+A S  A          +A GSFLE+  NRV +
Sbjct  7    QPSAAGADTTANNPHAFTCELPHSIFALAFSPSAPV--------LAAGSFLEDLHNRVSL  58

Query  295  LSFEE---DTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVRE  465
            L+F+       + +T P L+FDHPYPPTKL F+P   A+     LL SS D LRLW    
Sbjct  59   LAFDSVHPSATSFRTIPALSFDHPYPPTKLQFNPRAAAT----PLLASSSDVLRLWHTPL  114

Query  466  ASIEPV-------STLNNSKTS--EYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
              + P        S L+N K S  E+CAPLTSFDWNE+EPRRIGT+SIDTTCTIWD
Sbjct  115  DDLSPSAPAPELRSVLDNRKASASEFCAPLTSFDWNEIEPRRIGTASIDTTCTIWD  170



>ref|XP_009372526.1| PREDICTED: WD repeat-containing protein LWD2-like [Pyrus x bretschneideri]
Length=336

 Score =   142 bits (357),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 69/147 (47%), Positives = 100/147 (68%), Gaps = 7/147 (5%)
 Frame = +1

Query  166  TYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDTVTLKTNPGLA  345
            TY S +PI+++A   ++  H    R  +A+GSF+E+Y N+VE++ F +DT    T+  L 
Sbjct  13   TYISQWPIYSLA---WSVRHDKPSR--LAIGSFIEDYSNKVELVQFNQDTSDFTTDNRLI  67

Query  346  FDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEPVSTLNNSKTSEYCAP  525
            FDHPY PT LMF P+   +  + DL+ +SGDYLRLWE+ +  IE  S LN++ +SE+ + 
Sbjct  68   FDHPYAPTNLMFFPSEDTT--NPDLIATSGDYLRLWEIHDDRIELKSLLNSNMSSEFNSA  125

Query  526  LTSFDWNEVEPRRIGTSSIDTTCTIWD  606
            +TSFDW E + RR+  SS+DTTCTIWD
Sbjct  126  ITSFDWAECDTRRVAMSSVDTTCTIWD  152



>gb|EKC36908.1| WD repeat-containing protein 68 [Crassostrea gigas]
Length=960

 Score =   147 bits (371),  Expect = 7e-37, Method: Composition-based stats.
 Identities = 72/145 (50%), Positives = 97/145 (67%), Gaps = 9/145 (6%)
 Frame = +1

Query  169  YESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDTVTLKTNPGLAF  348
            YE+P+ +++M  S         +R  +A+GSF+EEY N+V+I+S +E+T    +     F
Sbjct  631  YEAPWTVYSMNWSIRPD-----KRFRLALGSFVEEYNNKVQIVSLDEETSEFTSKS--TF  683

Query  349  DHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEPVSTLNNSKTSEYCAPL  528
            DHPYP TK+M+ P+  A     DLL +SGDYLR+W V E        LNN+K S++CAPL
Sbjct  684  DHPYPTTKIMWIPD--AKGGYPDLLATSGDYLRVWRVSENESRLECLLNNNKNSDFCAPL  741

Query  529  TSFDWNEVEPRRIGTSSIDTTCTIW  603
            TSFDWNEV+P  +GTSSIDTTCTIW
Sbjct  742  TSFDWNEVDPNLLGTSSIDTTCTIW  766



>ref|XP_002044542.1| GM11725 [Drosophila sechellia]
 gb|EDW53791.1| GM11725 [Drosophila sechellia]
Length=294

 Score =   140 bits (354),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 94/145 (65%), Gaps = 9/145 (6%)
 Frame = +1

Query  169  YESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEEDTVTLKTNPGLAF  348
            Y +P+P+++M  S         +R  +A+GSF+EEY N+V+I+S +EDT          F
Sbjct  14   YLAPWPLYSMNWSVRPD-----KRFRLALGSFIEEYNNKVQIISLDEDTSEFSAKS--TF  66

Query  349  DHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEPVSTLNNSKTSEYCAPL  528
            DHPYP TK+M+ P+        DLL +SGDYLR+W   E        LNN+K S++CAPL
Sbjct  67   DHPYPTTKIMWIPDSKGVY--PDLLATSGDYLRVWRAGEPDTRLECVLNNNKNSDFCAPL  124

Query  529  TSFDWNEVEPRRIGTSSIDTTCTIW  603
            TSFDWNEV+P  +GTSSIDTTCTIW
Sbjct  125  TSFDWNEVDPNLVGTSSIDTTCTIW  149



>ref|XP_002599459.1| hypothetical protein BRAFLDRAFT_58976 [Branchiostoma floridae]
 gb|EEN55471.1| hypothetical protein BRAFLDRAFT_58976 [Branchiostoma floridae]
Length=345

 Score =   142 bits (357),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 101/159 (64%), Gaps = 10/159 (6%)
 Frame = +1

Query  127  STQGSNLRSENSVTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFE  306
            S+ G+  R E    YE+P+ +++M  S         +R  +A+GSF+EEY N+V+++S +
Sbjct  3    SSTGTGKRKE-IYKYEAPWTVYSMNWSVRPD-----KRFRLALGSFVEEYNNKVQVVSLD  56

Query  307  EDTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREASIEPVS  486
            EDT          FDHPYP TK+M+ P+        DL+ +SGDYLR+W V E       
Sbjct  57   EDTSDFVVRS--TFDHPYPTTKIMWIPDAKGVF--PDLVATSGDYLRVWRVNENDTRLEC  112

Query  487  TLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIW  603
             LNN+K S++CAPLTSFDWNEV+P  +GTSSIDTTCTIW
Sbjct  113  LLNNNKNSDFCAPLTSFDWNEVDPNLLGTSSIDTTCTIW  151



>gb|ADN52336.1| WD40-1 protein [Pyrus pyrifolia]
Length=356

 Score =   142 bits (358),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 104/167 (62%), Gaps = 17/167 (10%)
 Frame = +1

Query  136  GSNLRSENS--VTYESPYPIFAMAVSSFAAAHHGLRRRSVAVGSFLEEYKNRVEILSFEE  309
            GS+ + + S   TY++P+ I+AM  S      + L     A+ S LE+Y NRVEI+  ++
Sbjct  11   GSDEQQKRSEIYTYDAPWDIYAMNWSVRRDKKYRL-----AIASHLEQYPNRVEIVQLDD  65

Query  310  DTVTLKTNPGLAFDHPYPPTKLMFHPNPTASMKSADLLVSSGDYLRLWEVREAS------  471
                ++++P L+F+HPY PTK +F P+     +  DLL +S D+LR+W +          
Sbjct  66   SNGEIRSDPNLSFEHPYTPTKTIFIPD--KECQKPDLLATSSDFLRVWRISGDEDDSDSS  123

Query  472  --IEPVSTLNNSKTSEYCAPLTSFDWNEVEPRRIGTSSIDTTCTIWD  606
              +E  S LN +K SEYC P+TSFDWNE EP+RIGTSSIDTTCTIWD
Sbjct  124  SSVELKSLLNGNKNSEYCGPITSFDWNEAEPKRIGTSSIDTTCTIWD  170



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 815770585800