BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001D07

Length=530
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP17953.1|  unnamed protein product                                197   2e-57   Coffea canephora [robusta coffee]
ref|XP_010665155.1|  PREDICTED: polypyrimidine tract-binding prot...    191   8e-57   
ref|XP_008345274.1|  PREDICTED: polypyrimidine tract-binding prot...    184   5e-56   
gb|KCW69168.1|  hypothetical protein EUGRSUZ_F02695                     190   7e-56   Eucalyptus grandis [rose gum]
ref|XP_009621582.1|  PREDICTED: polypyrimidine tract-binding prot...    192   1e-55   Nicotiana tomentosiformis
gb|KCW69167.1|  hypothetical protein EUGRSUZ_F02695                     190   1e-55   Eucalyptus grandis [rose gum]
ref|XP_009597471.1|  PREDICTED: polypyrimidine tract-binding prot...    192   1e-55   Nicotiana tomentosiformis
ref|XP_002302167.2|  polypyrimidine tract-binding family protein        191   3e-55   Populus trichocarpa [western balsam poplar]
gb|KJB28978.1|  hypothetical protein B456_005G078200                    191   3e-55   Gossypium raimondii
ref|XP_006386305.1|  hypothetical protein POPTR_0002s06660g             191   3e-55   Populus trichocarpa [western balsam poplar]
ref|XP_011042880.1|  PREDICTED: polypyrimidine tract-binding prot...    191   3e-55   Populus euphratica
ref|XP_011042879.1|  PREDICTED: polypyrimidine tract-binding prot...    191   3e-55   Populus euphratica
ref|XP_006473080.1|  PREDICTED: polypyrimidine tract-binding prot...    191   3e-55   Citrus sinensis [apfelsine]
ref|XP_006434492.1|  hypothetical protein CICLE_v10001148mg             191   4e-55   Citrus clementina [clementine]
ref|XP_006434490.1|  hypothetical protein CICLE_v10001148mg             191   4e-55   
ref|XP_006473079.1|  PREDICTED: polypyrimidine tract-binding prot...    191   4e-55   Citrus sinensis [apfelsine]
ref|XP_002524303.1|  polypyrimidine tract binding protein, putative     191   4e-55   
ref|XP_002306709.2|  hypothetical protein POPTR_0005s21660g             193   4e-55   
ref|XP_010665151.1|  PREDICTED: polypyrimidine tract-binding prot...    191   5e-55   Vitis vinifera
ref|XP_010062097.1|  PREDICTED: polypyrimidine tract-binding prot...    191   6e-55   
ref|XP_009768478.1|  PREDICTED: polypyrimidine tract-binding prot...    193   7e-55   Nicotiana sylvestris
ref|XP_009765394.1|  PREDICTED: polypyrimidine tract-binding prot...    191   8e-55   Nicotiana sylvestris
ref|XP_011044257.1|  PREDICTED: polypyrimidine tract-binding prot...    190   1e-54   Populus euphratica
ref|XP_011044254.1|  PREDICTED: polypyrimidine tract-binding prot...    190   1e-54   Populus euphratica
ref|XP_011044253.1|  PREDICTED: polypyrimidine tract-binding prot...    190   1e-54   Populus euphratica
ref|XP_011044256.1|  PREDICTED: polypyrimidine tract-binding prot...    189   1e-54   Populus euphratica
ref|XP_007019550.1|  Polypyrimidine tract-binding protein 3             192   5e-54   
ref|NP_001274797.1|  polypyrimidine tract-binding protein homolog...    188   7e-54   Solanum tuberosum [potatoes]
gb|ACI43571.1|  RBP50                                                   188   8e-54   Cucurbita maxima [Boston marrow]
ref|XP_004162168.1|  PREDICTED: polypyrimidine tract-binding prot...    187   2e-53   
gb|KHG00385.1|  hypothetical protein F383_17340                         187   2e-53   Gossypium arboreum [tree cotton]
ref|XP_008463064.1|  PREDICTED: polypyrimidine tract-binding prot...    187   2e-53   Cucumis melo [Oriental melon]
gb|KJB28976.1|  hypothetical protein B456_005G078200                    186   2e-53   Gossypium raimondii
gb|KHG00384.1|  hypothetical protein F383_17340                         187   2e-53   Gossypium arboreum [tree cotton]
ref|XP_004252004.1|  PREDICTED: polypyrimidine tract-binding prot...    186   3e-53   Solanum lycopersicum
ref|XP_011078771.1|  PREDICTED: polypyrimidine tract-binding prot...    186   5e-53   Sesamum indicum [beniseed]
ref|XP_003536416.1|  PREDICTED: polypyrimidine tract-binding prot...    186   5e-53   Glycine max [soybeans]
ref|XP_007143560.1|  hypothetical protein PHAVU_007G081900g             186   6e-53   Phaseolus vulgaris [French bean]
gb|KCW71107.1|  hypothetical protein EUGRSUZ_F04205                     182   1e-52   Eucalyptus grandis [rose gum]
gb|EYU20662.1|  hypothetical protein MIMGU_mgv1a006642mg                184   2e-52   Erythranthe guttata [common monkey flower]
ref|XP_006605400.1|  PREDICTED: uncharacterized protein LOC100819...    184   2e-52   
ref|XP_007151988.1|  hypothetical protein PHAVU_004G092400g             184   3e-52   Phaseolus vulgaris [French bean]
gb|KHN46405.1|  Polypyrimidine tract-binding protein like 3             184   3e-52   Glycine soja [wild soybean]
ref|NP_001242751.1|  uncharacterized protein LOC100819672               184   3e-52   
ref|XP_003518587.1|  PREDICTED: polypyrimidine tract-binding prot...    183   5e-52   Glycine max [soybeans]
ref|XP_003548101.1|  PREDICTED: polypyrimidine tract-binding prot...    183   5e-52   
ref|XP_010063840.1|  PREDICTED: polypyrimidine tract-binding prot...    183   7e-52   Eucalyptus grandis [rose gum]
ref|XP_007201036.1|  hypothetical protein PRUPE_ppa005775mg             182   1e-51   Prunus persica
ref|XP_010681101.1|  PREDICTED: polypyrimidine tract-binding prot...    182   1e-51   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008237510.1|  PREDICTED: polypyrimidine tract-binding prot...    182   1e-51   Prunus mume [ume]
gb|KHN00751.1|  Polypyrimidine tract-binding protein like 3             182   2e-51   Glycine soja [wild soybean]
ref|XP_010527313.1|  PREDICTED: polypyrimidine tract-binding prot...    181   3e-51   Tarenaya hassleriana [spider flower]
ref|XP_010527312.1|  PREDICTED: polypyrimidine tract-binding prot...    181   3e-51   Tarenaya hassleriana [spider flower]
ref|XP_006351367.1|  PREDICTED: polypyrimidine tract-binding prot...    181   5e-51   
ref|XP_008369222.1|  PREDICTED: polypyrimidine tract-binding prot...    181   7e-51   
gb|AEG89704.1|  polypyrimidine tract-binding protein 6                  180   7e-51   Solanum tuberosum [potatoes]
ref|XP_009336734.1|  PREDICTED: polypyrimidine tract-binding prot...    180   8e-51   Pyrus x bretschneideri [bai li]
ref|XP_009336732.1|  PREDICTED: polypyrimidine tract-binding prot...    180   8e-51   Pyrus x bretschneideri [bai li]
ref|XP_004290497.1|  PREDICTED: polypyrimidine tract-binding prot...    179   2e-50   Fragaria vesca subsp. vesca
gb|AFW68316.1|  hypothetical protein ZEAMMB73_143783                    169   3e-50   
ref|XP_004249306.1|  PREDICTED: polypyrimidine tract-binding prot...    178   5e-50   Solanum lycopersicum
ref|XP_010533404.1|  PREDICTED: polypyrimidine tract-binding prot...    177   8e-50   Tarenaya hassleriana [spider flower]
ref|XP_010533403.1|  PREDICTED: polypyrimidine tract-binding prot...    177   8e-50   Tarenaya hassleriana [spider flower]
ref|XP_010246265.1|  PREDICTED: polypyrimidine tract-binding prot...    177   1e-49   Nelumbo nucifera [Indian lotus]
ref|XP_010533405.1|  PREDICTED: polypyrimidine tract-binding prot...    177   1e-49   Tarenaya hassleriana [spider flower]
ref|XP_010533402.1|  PREDICTED: polypyrimidine tract-binding prot...    177   1e-49   Tarenaya hassleriana [spider flower]
ref|XP_010533406.1|  PREDICTED: polypyrimidine tract-binding prot...    177   1e-49   Tarenaya hassleriana [spider flower]
ref|XP_010260993.1|  PREDICTED: polypyrimidine tract-binding prot...    177   1e-49   Nelumbo nucifera [Indian lotus]
ref|XP_010260994.1|  PREDICTED: polypyrimidine tract-binding prot...    177   1e-49   Nelumbo nucifera [Indian lotus]
ref|XP_003592082.1|  Polypyrimidine tract-binding protein-like pr...    176   3e-49   Medicago truncatula
ref|XP_010479003.1|  PREDICTED: polypyrimidine tract-binding prot...    176   3e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010479002.1|  PREDICTED: polypyrimidine tract-binding prot...    176   3e-49   
ref|XP_010500100.1|  PREDICTED: polypyrimidine tract-binding prot...    176   3e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010461394.1|  PREDICTED: polypyrimidine tract-binding prot...    176   3e-49   Camelina sativa [gold-of-pleasure]
ref|XP_006303776.1|  hypothetical protein CARUB_v10012016mg             173   3e-48   
ref|XP_008384421.1|  PREDICTED: LOW QUALITY PROTEIN: polypyrimidi...    173   3e-48   
ref|XP_004138369.1|  PREDICTED: polypyrimidine tract-binding prot...    173   3e-48   
ref|XP_006395995.1|  hypothetical protein EUTSA_v10004261mg             172   4e-48   Eutrema salsugineum [saltwater cress]
ref|XP_002893943.1|  predicted protein                                  172   6e-48   Arabidopsis lyrata subsp. lyrata
ref|NP_175010.2|  polypyrimidine tract-binding protein 3                172   6e-48   Arabidopsis thaliana [mouse-ear cress]
emb|CBI21552.3|  unnamed protein product                                171   8e-48   Vitis vinifera
emb|CDY36013.1|  BnaA08g04480D                                          171   1e-47   Brassica napus [oilseed rape]
ref|XP_009107488.1|  PREDICTED: polypyrimidine tract-binding prot...    171   1e-47   Brassica rapa
ref|XP_009385102.1|  PREDICTED: polypyrimidine tract-binding prot...    171   1e-47   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY47859.1|  BnaCnng15550D                                          171   1e-47   Brassica napus [oilseed rape]
ref|XP_002277938.2|  PREDICTED: polypyrimidine tract-binding prot...    171   2e-47   Vitis vinifera
ref|XP_010927403.1|  PREDICTED: polypyrimidine tract-binding prot...    171   2e-47   
ref|XP_006854512.1|  hypothetical protein AMTR_s00175p00061780          172   2e-47   
ref|XP_010927400.1|  PREDICTED: polypyrimidine tract-binding prot...    171   3e-47   Elaeis guineensis
emb|CAN82466.1|  hypothetical protein VITISV_002663                     171   3e-47   Vitis vinifera
ref|XP_010912015.1|  PREDICTED: polypyrimidine tract-binding prot...    171   3e-47   Elaeis guineensis
ref|XP_008785843.1|  PREDICTED: polypyrimidine tract-binding prot...    171   3e-47   
ref|XP_010912014.1|  PREDICTED: polypyrimidine tract-binding prot...    171   3e-47   Elaeis guineensis
ref|XP_009393413.1|  PREDICTED: polypyrimidine tract-binding prot...    170   4e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001266083.1|  polypyrimidine tract-binding protein homolog...    169   7e-47   Cicer arietinum [garbanzo]
ref|XP_004496454.1|  PREDICTED: polypyrimidine tract-binding prot...    167   3e-46   
ref|XP_004496452.1|  PREDICTED: polypyrimidine tract-binding prot...    168   4e-46   
gb|EPS74228.1|  hypothetical protein M569_00523                         167   7e-46   Genlisea aurea
ref|XP_008793925.1|  PREDICTED: polypyrimidine tract-binding prot...    167   8e-46   Phoenix dactylifera
ref|XP_003619162.1|  Polypyrimidine tract-binding protein-like pr...    163   3e-45   
gb|AES75380.2|  polypyrimidine tract-binding-like protein               164   1e-44   Medicago truncatula
ref|NP_001077673.1|  polypyrimidine tract-binding protein 3             162   3e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006842980.1|  hypothetical protein AMTR_s00076p00078090          161   1e-43   Amborella trichopoda
ref|XP_009411927.1|  PREDICTED: polypyrimidine tract-binding prot...    160   2e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009411926.1|  PREDICTED: polypyrimidine tract-binding prot...    160   3e-43   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEE55726.1|  hypothetical protein OsJ_04208                          155   1e-42   Oryza sativa Japonica Group [Japonica rice]
gb|AFW81821.1|  hypothetical protein ZEAMMB73_476847                    154   9e-42   
ref|XP_001761356.1|  predicted protein                                  155   2e-41   
gb|KDP30748.1|  hypothetical protein JCGZ_15177                         155   2e-41   Jatropha curcas
gb|EMS57308.1|  Polypyrimidine tract-binding protein-like protein 3     152   2e-41   Triticum urartu
ref|XP_002441164.1|  hypothetical protein SORBIDRAFT_09g021560          154   3e-41   Sorghum bicolor [broomcorn]
gb|AFW68313.1|  hypothetical protein ZEAMMB73_143783                    149   6e-41   
ref|XP_008655270.1|  PREDICTED: uncharacterized protein LOC100383...    154   9e-41   
ref|XP_008644686.1|  PREDICTED: polypyrimidine tract-binding prot...    153   1e-40   
ref|XP_008644687.1|  PREDICTED: polypyrimidine tract-binding prot...    153   1e-40   
gb|AFW78165.1|  hypothetical protein ZEAMMB73_011466                    153   1e-40   
ref|NP_001169470.1|  uncharacterized protein LOC100383343               152   1e-40   Zea mays [maize]
gb|KGN45884.1|  hypothetical protein Csa_6G017000                       152   2e-40   Cucumis sativus [cucumbers]
ref|XP_002973098.1|  hypothetical protein SELMODRAFT_173175             151   4e-40   
ref|XP_004961956.1|  PREDICTED: polypyrimidine tract-binding prot...    150   8e-40   Setaria italica
ref|NP_001055652.1|  Os05g0437300                                       150   1e-39   
ref|XP_003568375.1|  PREDICTED: polypyrimidine tract-binding prot...    149   3e-39   Brachypodium distachyon [annual false brome]
gb|ADE75620.1|  unknown                                                 149   3e-39   Picea sitchensis
ref|XP_010680298.1|  PREDICTED: polypyrimidine tract-binding prot...    149   4e-39   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010106865.1|  Polypyrimidine tract-binding protein-3-like ...    149   5e-39   
gb|ADE76165.1|  unknown                                                 149   6e-39   Picea sitchensis
ref|XP_006654460.1|  PREDICTED: polypyrimidine tract-binding prot...    147   1e-38   Oryza brachyantha
ref|XP_006654459.1|  PREDICTED: polypyrimidine tract-binding prot...    147   1e-38   Oryza brachyantha
emb|CBH32581.1|  RNA recognition domain containing protein              143   4e-38   Triticum aestivum [Canadian hard winter wheat]
gb|EEC71864.1|  hypothetical protein OsI_04570                          145   6e-38   Oryza sativa Indica Group [Indian rice]
ref|XP_006665040.1|  PREDICTED: polypyrimidine tract-binding prot...    145   7e-38   Oryza brachyantha
gb|AIZ74340.1|  polypyrimidine tract-binding protein                    145   1e-37   Pinus massoniana [Chinese red pine]
ref|XP_003564696.1|  PREDICTED: polypyrimidine tract-binding prot...    144   2e-37   Brachypodium distachyon [annual false brome]
gb|EMT30091.1|  Polypyrimidine tract-binding protein-3-like protein     144   3e-37   
emb|CBH32582.1|  RNA recognition domain containing protein,expressed    144   3e-37   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010232611.1|  PREDICTED: polypyrimidine tract-binding prot...    144   4e-37   Brachypodium distachyon [annual false brome]
gb|EMS55211.1|  Polypyrimidine tract-binding protein-like protein 3     144   6e-37   Triticum urartu
ref|NP_001044916.1|  Os01g0867800                                       134   8e-34   
gb|KEH25911.1|  polypyrimidine tract-binding-like protein               132   2e-33   Medicago truncatula
gb|AAV59307.1|  putative polypyrimidine track-binding protein           129   5e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009621583.1|  PREDICTED: polypyrimidine tract-binding prot...    120   7e-29   Nicotiana tomentosiformis
ref|XP_004138370.1|  PREDICTED: polypyrimidine tract-binding prot...    113   2e-26   
ref|XP_003632518.1|  PREDICTED: polypyrimidine tract-binding prot...    107   4e-24   
ref|XP_001759167.1|  predicted protein                                  106   8e-24   
ref|XP_003592083.1|  Polypyrimidine tract-binding protein-like pr...    105   2e-23   
ref|XP_004337140.1|  protein kinase domain containing protein         98.6    1e-20   Acanthamoeba castellanii str. Neff
ref|XP_003619163.1|  Polypyrimidine tract-binding protein-like pr...  96.3    1e-20   
ref|XP_002433623.1|  polypyrimidine tract binding protein, putative   92.4    1e-18   Ixodes scapularis [blacklegged tick]
pdb|1SJQ|A  Chain A, Nmr Structure Of Rrm1 From Human Polypyrimid...  86.7    2e-18   Homo sapiens [man]
ref|XP_001663911.1|  AAEL013723-PA                                    92.0    2e-18   
pdb|2AD9|A  Chain A, Solution Structure Of Polypyrimidine Tract B...  86.7    3e-18   Homo sapiens [man]
ref|XP_001848742.1|  polypyrimidine tract binding protein             91.7    3e-18   Culex quinquefasciatus
ref|XP_001636058.1|  predicted protein                                89.7    1e-17   Nematostella vectensis
ref|XP_001842351.1|  polypyrimidine tract binding protein             90.1    1e-17   Culex quinquefasciatus
gb|KFM66418.1|  Polypyrimidine tract-binding protein 2                89.7    1e-17   Stegodyphus mimosarum
ref|XP_010753398.1|  PREDICTED: polypyrimidine tract-binding prot...  89.0    2e-17   
gb|EDL31649.1|  mCG13402, isoform CRA_f                               86.7    3e-17   Mus musculus [mouse]
ref|XP_010753397.1|  PREDICTED: polypyrimidine tract-binding prot...  89.0    3e-17   
ref|XP_010753396.1|  PREDICTED: polypyrimidine tract-binding prot...  89.0    3e-17   
ref|XP_004479297.1|  PREDICTED: polypyrimidine tract-binding prot...  86.3    3e-17   
ref|XP_008560051.1|  PREDICTED: polypyrimidine tract-binding prot...  89.0    3e-17   Microplitis demolitor
ref|XP_004711004.1|  PREDICTED: polypyrimidine tract-binding prot...  88.6    3e-17   Echinops telfairi [lesser hedgehog tenrec]
gb|ADN84938.1|  hephaestus                                            85.1    4e-17   Biston betularia [peppered moth]
ref|XP_004711005.1|  PREDICTED: polypyrimidine tract-binding prot...  88.6    4e-17   Echinops telfairi [lesser hedgehog tenrec]
dbj|BAC40161.1|  unnamed protein product                              86.3    4e-17   Mus musculus [mouse]
ref|XP_008560049.1|  PREDICTED: polypyrimidine tract-binding prot...  88.6    4e-17   Microplitis demolitor
ref|XP_008560046.1|  PREDICTED: polypyrimidine tract-binding prot...  88.6    4e-17   
ref|XP_008560048.1|  PREDICTED: polypyrimidine tract-binding prot...  88.6    4e-17   
ref|XP_008560050.1|  PREDICTED: polypyrimidine tract-binding prot...  88.6    4e-17   
ref|XP_008509748.1|  PREDICTED: polypyrimidine tract-binding prot...  86.3    5e-17   Equus przewalskii [Przewalski horse]
ref|XP_002156158.1|  PREDICTED: polypyrimidine tract-binding prot...  87.8    6e-17   Hydra vulgaris
ref|XP_004524390.1|  PREDICTED: polypyrimidine tract-binding prot...  88.2    6e-17   
gb|EDL31650.1|  mCG13402, isoform CRA_g                               86.3    7e-17   Mus musculus [mouse]
ref|XP_004524381.1|  PREDICTED: polypyrimidine tract-binding prot...  88.2    7e-17   
ref|XP_004524387.1|  PREDICTED: polypyrimidine tract-binding prot...  88.2    7e-17   
ref|XP_004524386.1|  PREDICTED: polypyrimidine tract-binding prot...  88.2    7e-17   
gb|ELV09317.1|  Polypyrimidine tract-binding protein 1                87.8    8e-17   Tupaia chinensis
ref|XP_007075804.1|  PREDICTED: polypyrimidine tract-binding prot...  85.9    9e-17   
gb|EDL32215.1|  mCG50057                                              85.1    9e-17   Mus musculus [mouse]
ref|XP_011330848.1|  PREDICTED: polypyrimidine tract-binding prot...  87.8    9e-17   
ref|XP_011330847.1|  PREDICTED: polypyrimidine tract-binding prot...  87.8    9e-17   
ref|XP_011330851.1|  PREDICTED: polypyrimidine tract-binding prot...  87.8    9e-17   
ref|XP_011330849.1|  PREDICTED: polypyrimidine tract-binding prot...  87.8    9e-17   
ref|XP_011293652.1|  PREDICTED: polypyrimidine tract-binding prot...  87.8    9e-17   Musca domestica
ref|XP_011330846.1|  PREDICTED: polypyrimidine tract-binding prot...  87.8    9e-17   
ref|XP_008212875.1|  PREDICTED: polypyrimidine tract-binding prot...  87.4    1e-16   Nasonia vitripennis
ref|XP_011330850.1|  PREDICTED: polypyrimidine tract-binding prot...  87.8    1e-16   
ref|XP_008212882.1|  PREDICTED: polypyrimidine tract-binding prot...  87.4    1e-16   
ref|XP_011330853.1|  PREDICTED: polypyrimidine tract-binding prot...  87.4    1e-16   
ref|XP_008212879.1|  PREDICTED: polypyrimidine tract-binding prot...  87.4    1e-16   Nasonia vitripennis
ref|XP_008401682.1|  PREDICTED: polypyrimidine tract-binding prot...  86.7    1e-16   
ref|XP_008212884.1|  PREDICTED: polypyrimidine tract-binding prot...  87.4    1e-16   
ref|XP_008212880.1|  PREDICTED: polypyrimidine tract-binding prot...  87.4    1e-16   
ref|XP_008212881.1|  PREDICTED: polypyrimidine tract-binding prot...  87.4    1e-16   
ref|XP_008212883.1|  PREDICTED: polypyrimidine tract-binding prot...  87.4    1e-16   
ref|XP_008212874.1|  PREDICTED: polypyrimidine tract-binding prot...  87.4    1e-16   
ref|XP_001603240.2|  PREDICTED: polypyrimidine tract-binding prot...  87.4    1e-16   
ref|XP_003977560.1|  PREDICTED: polypyrimidine tract-binding prot...  87.4    1e-16   
ref|XP_008212870.1|  PREDICTED: polypyrimidine tract-binding prot...  87.4    1e-16   Nasonia vitripennis
ref|XP_011330841.1|  PREDICTED: polypyrimidine tract-binding prot...  87.8    1e-16   
ref|XP_011194947.1|  PREDICTED: polypyrimidine tract-binding prot...  87.4    1e-16   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_011194921.1|  PREDICTED: polypyrimidine tract-binding prot...  87.4    1e-16   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_011194909.1|  PREDICTED: polypyrimidine tract-binding prot...  87.4    1e-16   
ref|XP_011194913.1|  PREDICTED: polypyrimidine tract-binding prot...  87.4    1e-16   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_008212871.1|  PREDICTED: polypyrimidine tract-binding prot...  87.4    1e-16   Nasonia vitripennis
ref|XP_008283570.1|  PREDICTED: polypyrimidine tract-binding prot...  87.0    1e-16   Stegastes partitus
ref|XP_011330840.1|  PREDICTED: polypyrimidine tract-binding prot...  87.4    1e-16   
ref|XP_005470623.1|  PREDICTED: polypyrimidine tract-binding prot...  87.0    1e-16   Oreochromis niloticus
ref|XP_011194929.1|  PREDICTED: polypyrimidine tract-binding prot...  87.4    1e-16   
ref|XP_011330842.1|  PREDICTED: polypyrimidine tract-binding prot...  87.4    1e-16   
ref|XP_011330839.1|  PREDICTED: polypyrimidine tract-binding prot...  87.4    1e-16   
ref|XP_011330837.1|  PREDICTED: polypyrimidine tract-binding prot...  87.4    1e-16   
ref|XP_007904702.1|  PREDICTED: polypyrimidine tract-binding prot...  87.0    1e-16   Callorhinchus milii [Australian ghost shark]
ref|XP_007904703.1|  PREDICTED: polypyrimidine tract-binding prot...  87.0    1e-16   Callorhinchus milii [Australian ghost shark]
ref|XP_007904705.1|  PREDICTED: polypyrimidine tract-binding prot...  87.0    1e-16   Callorhinchus milii [Australian ghost shark]
ref|XP_007904700.1|  PREDICTED: polypyrimidine tract-binding prot...  87.0    1e-16   Callorhinchus milii [Australian ghost shark]
ref|XP_011330838.1|  PREDICTED: polypyrimidine tract-binding prot...  87.4    1e-16   
ref|XP_008283569.1|  PREDICTED: polypyrimidine tract-binding prot...  87.0    1e-16   Stegastes partitus
ref|XP_007904701.1|  PREDICTED: polypyrimidine tract-binding prot...  87.0    1e-16   Callorhinchus milii [Australian ghost shark]
ref|XP_007904698.1|  PREDICTED: polypyrimidine tract-binding prot...  87.0    1e-16   Callorhinchus milii [Australian ghost shark]
ref|XP_006182607.1|  PREDICTED: polypyrimidine tract-binding prot...  85.9    1e-16   
ref|XP_008283568.1|  PREDICTED: polypyrimidine tract-binding prot...  87.0    1e-16   Stegastes partitus
gb|AAC94999.1|  putative polypyrimidine tract-binding protein         83.2    2e-16   Carassius auratus
ref|XP_010723221.1|  PREDICTED: polypyrimidine tract-binding prot...  82.4    2e-16   
ref|XP_008283567.1|  PREDICTED: polypyrimidine tract-binding prot...  87.0    2e-16   Stegastes partitus
sp|P17225.2|PTBP1_MOUSE  RecName: Full=Polypyrimidine tract-bindi...  86.7    2e-16   Mus musculus [mouse]
dbj|BAD92147.1|  polypyrimidine tract-binding protein 1 isoform c...  84.7    2e-16   Homo sapiens [man]
ref|XP_007569508.1|  PREDICTED: LOW QUALITY PROTEIN: polypyrimidi...  86.7    2e-16   
gb|EDL31648.1|  mCG13402, isoform CRA_e                               85.9    2e-16   Mus musculus [mouse]
gb|EHB09794.1|  Polypyrimidine tract-binding protein 1                86.3    2e-16   Heterocephalus glaber [naked mole rat]
ref|XP_010723219.1|  PREDICTED: polypyrimidine tract-binding prot...  82.4    2e-16   Meleagris gallopavo [common turkey]
gb|EMP33475.1|  Regulator of differentiation 1                        87.4    3e-16   Chelonia mydas [green seaturtle]
ref|XP_007635822.1|  PREDICTED: polypyrimidine tract-binding prot...  83.6    3e-16   
ref|XP_005359184.1|  PREDICTED: polypyrimidine tract-binding prot...  85.9    3e-16   
ref|XP_011495872.1|  PREDICTED: polypyrimidine tract-binding prot...  86.3    3e-16   Ceratosolen solmsi marchali
ref|XP_011310461.1|  PREDICTED: polypyrimidine tract-binding prot...  86.3    3e-16   Fopius arisanus
dbj|BAO03403.1|  polypyrimidine tract binding protein 1b splicing...  84.3    3e-16   Oryzias latipes [Japanese rice fish]
ref|XP_011495869.1|  PREDICTED: polypyrimidine tract-binding prot...  86.3    3e-16   Ceratosolen solmsi marchali
gb|AAI03384.1|  PTBP1 protein                                         85.5    3e-16   Bos taurus [bovine]
gb|EDL89387.1|  polypyrimidine tract binding protein 1, isoform C...  85.9    3e-16   Rattus norvegicus [brown rat]
ref|XP_011310460.1|  PREDICTED: polypyrimidine tract-binding prot...  86.3    3e-16   Fopius arisanus
ref|XP_011495870.1|  PREDICTED: polypyrimidine tract-binding prot...  86.3    3e-16   Ceratosolen solmsi marchali
emb|CAA43202.1|  pyrimidine binding protein 1                         85.9    3e-16   Rattus norvegicus [brown rat]
ref|XP_011495871.1|  PREDICTED: polypyrimidine tract-binding prot...  86.3    3e-16   Ceratosolen solmsi marchali
dbj|BAE37269.1|  unnamed protein product                              85.9    3e-16   Mus musculus [mouse]
ref|XP_011265176.1|  PREDICTED: polypyrimidine tract-binding prot...  86.3    3e-16   
ref|NP_001257986.1|  polypyrimidine tract-binding protein 1 isofo...  85.9    3e-16   Rattus norvegicus [brown rat]
sp|Q00438.1|PTBP1_RAT  RecName: Full=Polypyrimidine tract-binding...  85.9    3e-16   Rattus norvegicus [brown rat]
ref|XP_011310459.1|  PREDICTED: polypyrimidine tract-binding prot...  86.3    3e-16   Fopius arisanus
ref|NP_071961.2|  polypyrimidine tract-binding protein 1 isoform b    85.9    3e-16   Rattus norvegicus [brown rat]
ref|XP_006978285.1|  PREDICTED: polypyrimidine tract-binding prot...  85.9    3e-16   
ref|XP_004448197.1|  PREDICTED: polypyrimidine tract-binding prot...  85.9    3e-16   Dasypus novemcinctus
gb|EDL31644.1|  mCG13402, isoform CRA_b                               85.9    3e-16   Mus musculus [mouse]
ref|XP_011310457.1|  PREDICTED: polypyrimidine tract-binding prot...  86.3    3e-16   Fopius arisanus
gb|AAH28848.1|  Polypyrimidine tract binding protein 1                85.9    3e-16   Mus musculus [mouse]
ref|XP_005083397.1|  PREDICTED: polypyrimidine tract-binding prot...  85.9    3e-16   
dbj|BAE29899.1|  unnamed protein product                              85.9    3e-16   Mus musculus [mouse]
ref|NP_032982.2|  polypyrimidine tract-binding protein 1 isoform 2    85.9    3e-16   Mus musculus [mouse]
ref|XP_004448195.1|  PREDICTED: polypyrimidine tract-binding prot...  85.9    3e-16   
ref|XP_006610361.1|  PREDICTED: polypyrimidine tract-binding prot...  85.9    3e-16   Apis dorsata [rock honeybee]
dbj|BAE43140.1|  unnamed protein product                              85.9    3e-16   Mus musculus [mouse]
ref|XP_011310456.1|  PREDICTED: polypyrimidine tract-binding prot...  85.9    3e-16   Fopius arisanus
ref|XP_006610365.1|  PREDICTED: polypyrimidine tract-binding prot...  85.9    3e-16   Apis dorsata [rock honeybee]
gb|AAH66210.1|  Polypyrimidine tract binding protein 1                85.9    3e-16   Mus musculus [mouse]
ref|XP_004448196.1|  PREDICTED: polypyrimidine tract-binding prot...  85.9    3e-16   
ref|XP_011310458.1|  PREDICTED: polypyrimidine tract-binding prot...  85.9    3e-16   Fopius arisanus
ref|XP_005083395.1|  PREDICTED: polypyrimidine tract-binding prot...  85.9    3e-16   Mesocricetus auratus [Syrian golden hamster]
ref|XP_006978284.1|  PREDICTED: polypyrimidine tract-binding prot...  85.9    3e-16   
dbj|BAC65159.1|  polypirimidine tract binding protein                 85.9    3e-16   Mus musculus [mouse]
ref|XP_011265167.1|  PREDICTED: polypyrimidine tract-binding prot...  85.9    4e-16   Camponotus floridanus
ref|XP_008183516.1|  PREDICTED: polypyrimidine tract-binding prot...  86.3    4e-16   
gb|AAH86489.1|  Polypyrimidine tract binding protein 1                85.9    4e-16   Mus musculus [mouse]
ref|NP_001070831.1|  polypyrimidine tract-binding protein 1 isofo...  85.9    4e-16   Mus musculus [mouse]
ref|XP_004448194.1|  PREDICTED: polypyrimidine tract-binding prot...  85.9    4e-16   Dasypus novemcinctus
ref|XP_006610359.1|  PREDICTED: polypyrimidine tract-binding prot...  85.9    4e-16   Apis dorsata [rock honeybee]
ref|XP_006610360.1|  PREDICTED: polypyrimidine tract-binding prot...  85.9    4e-16   Apis dorsata [rock honeybee]
ref|XP_003401618.1|  PREDICTED: polypyrimidine tract-binding prot...  85.9    4e-16   Bombus terrestris [large earth bumblebee]
ref|XP_008183518.1|  PREDICTED: polypyrimidine tract-binding prot...  86.3    4e-16   Acyrthosiphon pisum
ref|XP_005083396.1|  PREDICTED: polypyrimidine tract-binding prot...  85.9    4e-16   
ref|XP_008183515.1|  PREDICTED: polypyrimidine tract-binding prot...  86.3    4e-16   
ref|XP_006610363.1|  PREDICTED: polypyrimidine tract-binding prot...  85.9    4e-16   
ref|XP_006610362.1|  PREDICTED: polypyrimidine tract-binding prot...  85.9    4e-16   
ref|XP_011265123.1|  PREDICTED: polypyrimidine tract-binding prot...  85.9    4e-16   
ref|XP_003491847.1|  PREDICTED: polypyrimidine tract-binding prot...  85.9    4e-16   
ref|XP_011265131.1|  PREDICTED: polypyrimidine tract-binding prot...  85.9    4e-16   
ref|XP_008183514.1|  PREDICTED: polypyrimidine tract-binding prot...  85.9    4e-16   
ref|XP_011265142.1|  PREDICTED: polypyrimidine tract-binding prot...  85.9    4e-16   
ref|XP_007641364.1|  PREDICTED: polypyrimidine tract-binding prot...  85.9    4e-16   
ref|XP_003693343.1|  PREDICTED: polypyrimidine tract-binding prot...  85.9    4e-16   
ref|XP_008183512.1|  PREDICTED: polypyrimidine tract-binding prot...  85.9    4e-16   
ref|XP_010964919.1|  PREDICTED: LOW QUALITY PROTEIN: polypyrimidi...  85.9    4e-16   
gb|EGV99470.1|  Polypyrimidine tract-binding protein 1                85.5    4e-16   
ref|XP_011265151.1|  PREDICTED: polypyrimidine tract-binding prot...  85.9    4e-16   
ref|XP_004654921.1|  PREDICTED: polypyrimidine tract-binding prot...  85.5    4e-16   
ref|XP_006206507.1|  PREDICTED: polypyrimidine tract-binding prot...  85.9    4e-16   
ref|XP_006206506.1|  PREDICTED: polypyrimidine tract-binding prot...  85.9    4e-16   
ref|XP_006206508.1|  PREDICTED: polypyrimidine tract-binding prot...  85.5    4e-16   
ref|XP_006610358.1|  PREDICTED: polypyrimidine tract-binding prot...  85.9    4e-16   
ref|XP_004654919.1|  PREDICTED: polypyrimidine tract-binding prot...  85.9    4e-16   
ref|XP_008183513.1|  PREDICTED: polypyrimidine tract-binding prot...  85.9    4e-16   
ref|XP_004654920.1|  PREDICTED: polypyrimidine tract-binding prot...  85.5    4e-16   
ref|XP_006610357.1|  PREDICTED: polypyrimidine tract-binding prot...  85.9    4e-16   
ref|XP_010998195.1|  PREDICTED: LOW QUALITY PROTEIN: polypyrimidi...  85.5    5e-16   
ref|XP_006610353.1|  PREDICTED: polypyrimidine tract-binding prot...  85.9    5e-16   
ref|XP_006803670.1|  PREDICTED: polypyrimidine tract-binding prot...  85.5    5e-16   
ref|XP_006610354.1|  PREDICTED: polypyrimidine tract-binding prot...  85.9    5e-16   
ref|XP_010793114.1|  PREDICTED: polypyrimidine tract-binding prot...  81.6    5e-16   
ref|XP_006134839.1|  PREDICTED: polypyrimidine tract-binding prot...  85.5    5e-16   
ref|XP_006610356.1|  PREDICTED: polypyrimidine tract-binding prot...  85.9    5e-16   
ref|XP_005312160.1|  PREDICTED: polypyrimidine tract-binding prot...  85.5    5e-16   
ref|XP_006610355.1|  PREDICTED: polypyrimidine tract-binding prot...  85.9    5e-16   
ref|XP_010805519.1|  PREDICTED: polypyrimidine tract-binding prot...  85.5    5e-16   
ref|XP_011204465.1|  PREDICTED: polypyrimidine tract-binding prot...  85.9    5e-16   
ref|XP_005475708.1|  PREDICTED: polypyrimidine tract-binding prot...  85.5    5e-16   
ref|XP_010842900.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    5e-16   
ref|XP_006803669.1|  PREDICTED: polypyrimidine tract-binding prot...  85.5    5e-16   
ref|XP_011204466.1|  PREDICTED: polypyrimidine tract-binding prot...  85.9    5e-16   
ref|XP_007235501.1|  PREDICTED: polypyrimidine tract-binding prot...  84.7    5e-16   
ref|NP_001289713.1|  polypyrimidine tract-binding protein 1 isofo...  85.5    5e-16   
ref|XP_004323432.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    5e-16   
ref|XP_004689460.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    5e-16   
ref|XP_007062379.1|  PREDICTED: polypyrimidine tract-binding prot...  85.5    5e-16   
ref|XP_011204464.1|  PREDICTED: polypyrimidine tract-binding prot...  85.9    5e-16   
ref|XP_004569391.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    5e-16   
ref|XP_005682944.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    5e-16   
ref|XP_004689458.1|  PREDICTED: polypyrimidine tract-binding prot...  85.5    5e-16   
gb|ELR46101.1|  Polypyrimidine tract-binding protein 1                85.5    5e-16   
ref|XP_006803668.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    5e-16   
ref|XP_010633269.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    5e-16   
ref|XP_006764846.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    5e-16   
ref|XP_004569390.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    5e-16   
ref|XP_003736615.1|  GA15927, isoform B                               85.5    5e-16   
ref|XP_005682943.1|  PREDICTED: polypyrimidine tract-binding prot...  85.5    5e-16   
ref|XP_005682940.1|  PREDICTED: polypyrimidine tract-binding prot...  85.5    6e-16   
ref|XP_008174283.1|  PREDICTED: polypyrimidine tract-binding prot...  85.5    6e-16   
ref|NP_776867.1|  polypyrimidine tract-binding protein 1 isoform 2    85.1    6e-16   
gb|EPQ08049.1|  Polypyrimidine tract-binding protein 1                85.1    6e-16   
ref|XP_004906928.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_005682941.1|  PREDICTED: polypyrimidine tract-binding prot...  85.5    6e-16   
ref|XP_004866064.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_004614851.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_007176708.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_005332001.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_004441434.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_005682942.1|  PREDICTED: polypyrimidine tract-binding prot...  85.5    6e-16   
ref|XP_007460475.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_004285937.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_008148935.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
pdb|2CQ1|A  Chain A, Solution Structure Of Rna Binding Domain In ...  80.1    6e-16   
ref|XP_004614850.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_007130211.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_004689459.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_004866062.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_007130212.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_005866730.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_005661470.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_004906927.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_004866063.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_010633268.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_008590365.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_007176707.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_005661467.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_008590366.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_004866061.1|  PREDICTED: polypyrimidine tract-binding prot...  85.5    6e-16   
ref|XP_004008815.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_005332002.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_005406080.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_005661468.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_004441432.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_004323433.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_004285936.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_004323431.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_007460472.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|NP_999396.1|  polypyrimidine tract-binding protein 1              85.1    6e-16   
ref|XP_005866727.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_011175608.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_004778180.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_004906926.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_005332000.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_005661471.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_011175600.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_011175565.1|  PREDICTED: polypyrimidine tract-binding prot...  85.5    6e-16   
ref|XP_008148934.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_005406079.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_005633222.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_008148933.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_004395496.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_004441433.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_004866060.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_005406078.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_004614848.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_004906925.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_011286958.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_011175574.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_001915461.2|  PREDICTED: LOW QUALITY PROTEIN: polypyrimidi...  85.5    6e-16   
gb|ELK29416.1|  Polypyrimidine tract-binding protein 1                85.1    6e-16   
ref|XP_005866728.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_006764845.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_005331998.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
gb|EHB16932.1|  Polypyrimidine tract-binding protein 1                85.1    6e-16   
ref|XP_004395498.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_004614849.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_006101883.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_005661469.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_004778179.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_542215.2|  PREDICTED: polypyrimidine tract-binding protein...  85.1    6e-16   
ref|XP_004778178.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    6e-16   
ref|XP_868641.1|  PREDICTED: polypyrimidine tract-binding protein...  85.1    7e-16   
ref|XP_005331999.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    7e-16   
gb|KFO28919.1|  Polypyrimidine tract-binding protein 1                85.1    7e-16   
ref|XP_005866729.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    7e-16   
ref|XP_004285935.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    7e-16   
ref|XP_005991998.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    7e-16   
ref|XP_004395497.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    7e-16   
ref|XP_008324417.1|  PREDICTED: polypyrimidine tract-binding prot...  84.7    7e-16   
ref|XP_003460925.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    7e-16   
ref|XP_004778173.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    7e-16   
ref|XP_003788880.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    7e-16   
ref|XP_006101882.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    7e-16   
ref|XP_007524853.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    7e-16   
ref|XP_005406077.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    7e-16   
ref|XP_004866059.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    7e-16   
ref|XP_004778177.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    7e-16   
ref|XP_868637.1|  PREDICTED: polypyrimidine tract-binding protein...  85.1    7e-16   
ref|XP_004866058.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    7e-16   
emb|CAA52653.1|  polypyrimidine tract binding protein                 85.1    7e-16   
ref|XP_004778175.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    7e-16   
gb|EFB16926.1|  hypothetical protein PANDA_012716                     85.1    7e-16   
ref|XP_004778176.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    7e-16   
ref|XP_003460926.1|  PREDICTED: polypyrimidine tract-binding prot...  84.7    7e-16   
ref|XP_011175583.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    7e-16   
ref|XP_004866057.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    7e-16   
ref|XP_011175592.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    7e-16   
ref|XP_001981034.1|  GG11844                                          85.5    7e-16   
ref|XP_008964626.1|  PREDICTED: polypyrimidine tract-binding prot...  84.3    7e-16   
ref|XP_005406076.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    8e-16   
ref|XP_011228537.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    8e-16   
ref|XP_011050686.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    8e-16   
ref|XP_007524852.1|  PREDICTED: polypyrimidine tract-binding prot...  84.7    8e-16   
ref|XP_010373232.1|  PREDICTED: polypyrimidine tract-binding prot...  84.7    8e-16   
ref|XP_011050685.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    8e-16   
ref|XP_010373233.1|  PREDICTED: polypyrimidine tract-binding prot...  84.7    8e-16   
ref|XP_001358876.2|  GA15927, isoform A                               85.5    8e-16   
ref|XP_008709569.1|  PREDICTED: LOW QUALITY PROTEIN: polypyrimidi...  84.7    8e-16   
ref|XP_011050683.1|  PREDICTED: polypyrimidine tract-binding prot...  85.1    8e-16   
ref|XP_010885900.1|  PREDICTED: polypyrimidine tract-binding prot...  84.7    9e-16   
ref|XP_003292087.1|  hypothetical protein DICPUDRAFT_82723            85.1    9e-16   
ref|XP_011050684.1|  PREDICTED: polypyrimidine tract-binding prot...  84.7    9e-16   
ref|XP_011050681.1|  PREDICTED: polypyrimidine tract-binding prot...  84.7    9e-16   
ref|XP_011050682.1|  PREDICTED: polypyrimidine tract-binding prot...  84.7    9e-16   
gb|KFQ22944.1|  Polypyrimidine tract-binding protein 3                84.3    1e-15   
ref|XP_005947655.1|  PREDICTED: polypyrimidine tract-binding prot...  84.3    1e-15   
ref|XP_011472629.1|  PREDICTED: polypyrimidine tract-binding prot...  84.3    1e-15   
ref|XP_004561995.1|  PREDICTED: polypyrimidine tract-binding prot...  84.3    1e-15   
ref|XP_010174624.1|  PREDICTED: polypyrimidine tract-binding prot...  82.0    1e-15   
ref|XP_010004946.1|  PREDICTED: polypyrimidine tract-binding prot...  84.3    1e-15   
ref|XP_004927080.1|  PREDICTED: polypyrimidine tract-binding prot...  84.7    1e-15   
ref|XP_005748480.1|  PREDICTED: polypyrimidine tract-binding prot...  84.3    1e-15   
ref|XP_010183019.1|  PREDICTED: polypyrimidine tract-binding prot...  84.3    1e-15   
ref|XP_011472630.1|  PREDICTED: polypyrimidine tract-binding prot...  84.3    1e-15   
ref|XP_005947654.1|  PREDICTED: polypyrimidine tract-binding prot...  84.3    1e-15   
ref|XP_009303446.1|  PREDICTED: polypyrimidine tract-binding prot...  84.3    1e-15   
ref|XP_011472628.1|  PREDICTED: polypyrimidine tract-binding prot...  84.3    1e-15   
ref|XP_011472627.1|  PREDICTED: polypyrimidine tract-binding prot...  84.3    1e-15   
ref|NP_001097993.1|  hephaestus, isoform M                            84.3    1e-15   
ref|XP_005259655.1|  PREDICTED: polypyrimidine tract-binding prot...  84.3    1e-15   
gb|KFP49381.1|  Polypyrimidine tract-binding protein 1                82.4    1e-15   
ref|XP_011472626.1|  PREDICTED: polypyrimidine tract-binding prot...  84.3    1e-15   
dbj|BAB86943.1|  polypirimidine tract binding protein                 84.3    1e-15   
ref|NP_524703.1|  hephaestus, isoform C                               84.3    1e-15   
ref|XP_010186106.1|  PREDICTED: polypyrimidine tract-binding prot...  81.3    1e-15   
ref|NP_114368.1|  polypyrimidine tract-binding protein 1 isoform c    84.3    1e-15   
ref|XP_004600105.1|  PREDICTED: LOW QUALITY PROTEIN: polypyrimidi...  84.3    1e-15   
ref|XP_006864731.1|  PREDICTED: polypyrimidine tract-binding prot...  84.0    1e-15   
gb|AAL39463.1|  LD03185p                                              84.3    1e-15   
ref|XP_005587388.1|  PREDICTED: polypyrimidine tract-binding prot...  84.0    1e-15   
dbj|BAE32096.1|  unnamed protein product                              84.3    1e-15   
ref|NP_001287630.1|  hephaestus, isoform Z                            84.3    1e-15   
ref|XP_003914597.1|  PREDICTED: polypyrimidine tract-binding prot...  84.0    1e-15   
ref|XP_004059657.1|  PREDICTED: polypyrimidine tract-binding prot...  84.0    1e-15   
gb|EAW61158.1|  polypyrimidine tract binding protein 1, isoform C...  84.0    1e-15   
ref|XP_006864730.1|  PREDICTED: polypyrimidine tract-binding prot...  84.0    1e-15   
gb|EAW61157.1|  polypyrimidine tract binding protein 1, isoform C...  84.0    1e-15   
ref|XP_007992731.1|  PREDICTED: polypyrimidine tract-binding prot...  84.0    1e-15   
ref|NP_001120518.1|  polypyrimidine tract binding protein 3           84.0    1e-15   
ref|XP_001092214.2|  PREDICTED: polypyrimidine tract-binding prot...  84.0    1e-15   
ref|NP_788776.2|  hephaestus, isoform G                               84.3    1e-15   
ref|NP_733460.1|  hephaestus, isoform B                               84.3    1e-15   
ref|XP_003914596.1|  PREDICTED: polypyrimidine tract-binding prot...  84.3    1e-15   
ref|XP_005587390.1|  PREDICTED: polypyrimidine tract-binding prot...  84.0    1e-15   
gb|EAW61153.1|  polypyrimidine tract binding protein 1, isoform C...  84.0    1e-15   
ref|XP_008835418.1|  PREDICTED: polypyrimidine tract-binding prot...  84.3    1e-15   
ref|NP_002810.1|  polypyrimidine tract-binding protein 1 isoform a    84.0    1e-15   
ref|XP_011149492.1|  PREDICTED: polypyrimidine tract-binding prot...  84.3    1e-15   
ref|XP_005587387.1|  PREDICTED: polypyrimidine tract-binding prot...  84.0    1e-15   
ref|XP_005587385.1|  PREDICTED: polypyrimidine tract-binding prot...  84.0    1e-15   
ref|XP_005259654.1|  PREDICTED: polypyrimidine tract-binding prot...  84.0    1e-15   
ref|NP_001097992.1|  hephaestus, isoform L                            84.3    1e-15   
ref|XP_007992729.1|  PREDICTED: polypyrimidine tract-binding prot...  84.0    1e-15   
ref|XP_004059656.1|  PREDICTED: polypyrimidine tract-binding prot...  84.0    1e-15   



>emb|CDP17953.1| unnamed protein product [Coffea canephora]
Length=432

 Score =   197 bits (501),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            YTNVQPSIRGRNVY+QFSSHQELTTMDQNTQ RGDE
Sbjct  61   YTNVQPSIRGRNVYVQFSSHQELTTMDQNTQGRGDE  96



>ref|XP_010665155.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X2 [Vitis vinifera]
Length=256

 Score =   191 bits (484),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 90/96 (94%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSA NA+QF
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAANAMQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            YTNVQPSIRGRNVY+QFSSHQELTT+DQN Q RGDE
Sbjct  61   YTNVQPSIRGRNVYVQFSSHQELTTVDQNAQGRGDE  96



>ref|XP_008345274.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
[Malus domestica]
Length=111

 Score =   184 bits (466),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQAL+QMQD  +AV+ALQF
Sbjct  12   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALIQMQDTAAAVSALQF  71

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEVFKL  382
            Y NVQP+IRGRNVY+QFSSHQELTTM QN Q RGDEV  L
Sbjct  72   YANVQPAIRGRNVYVQFSSHQELTTMYQNAQGRGDEVGTL  111



>gb|KCW69168.1| hypothetical protein EUGRSUZ_F02695 [Eucalyptus grandis]
Length=334

 Score =   190 bits (483),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 89/96 (93%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQD+PSA+NALQF
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDIPSAINALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            Y NVQPSIRGRNVY+QFSSHQELTT+DQN Q+RGDE
Sbjct  61   YANVQPSIRGRNVYVQFSSHQELTTVDQNAQARGDE  96



>ref|XP_009621582.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X1 [Nicotiana tomentosiformis]
Length=443

 Score =   192 bits (489),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/96 (95%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKVIH+RNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF
Sbjct  1    MTEPSKVIHIRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            Y+NVQPSIRGRNVY+QFSSHQELTTMDQN+Q RGDE
Sbjct  61   YSNVQPSIRGRNVYVQFSSHQELTTMDQNSQGRGDE  96



>gb|KCW69167.1| hypothetical protein EUGRSUZ_F02695 [Eucalyptus grandis]
Length=353

 Score =   190 bits (483),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/96 (93%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQD+PSA+NALQF
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDIPSAINALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            Y NVQPSIRGRNVY+QFSSHQELTT+DQN Q+RGDE
Sbjct  61   YANVQPSIRGRNVYVQFSSHQELTTVDQNAQARGDE  96



>ref|XP_009597471.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
[Nicotiana tomentosiformis]
 ref|XP_009597472.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
[Nicotiana tomentosiformis]
 ref|XP_009597473.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
[Nicotiana tomentosiformis]
Length=441

 Score =   192 bits (489),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/96 (96%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MT+PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAV ALQF
Sbjct  1    MTDPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVKALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            YTNVQPSIRGRNVY+QFSSHQELTTMDQNTQ RGDE
Sbjct  61   YTNVQPSIRGRNVYVQFSSHQELTTMDQNTQGRGDE  96



>ref|XP_002302167.2| polypyrimidine tract-binding family protein [Populus trichocarpa]
 gb|EEE81440.2| polypyrimidine tract-binding family protein [Populus trichocarpa]
Length=436

 Score =   191 bits (486),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/96 (94%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSA+NALQ 
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAINALQL  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            YTN+QP+IRGRNVY+QFSSHQELTTMDQNTQ RGDE
Sbjct  61   YTNIQPTIRGRNVYVQFSSHQELTTMDQNTQGRGDE  96



>gb|KJB28978.1| hypothetical protein B456_005G078200 [Gossypium raimondii]
Length=415

 Score =   191 bits (485),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/98 (91%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M E SKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQD+PSA+NA+QF
Sbjct  1    MAEASKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDIPSAINAMQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEVF  376
            YTNVQP+IRGRNVY+QFSSHQELTTMDQN Q RGDEVF
Sbjct  61   YTNVQPTIRGRNVYVQFSSHQELTTMDQNAQGRGDEVF  98



>ref|XP_006386305.1| hypothetical protein POPTR_0002s06660g [Populus trichocarpa]
 gb|ERP64102.1| hypothetical protein POPTR_0002s06660g [Populus trichocarpa]
Length=437

 Score =   191 bits (486),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/96 (94%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSA+NALQ 
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAINALQL  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            YTN+QP+IRGRNVY+QFSSHQELTTMDQNTQ RGDE
Sbjct  61   YTNIQPTIRGRNVYVQFSSHQELTTMDQNTQGRGDE  96



>ref|XP_011042880.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X2 [Populus euphratica]
Length=435

 Score =   191 bits (486),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/96 (94%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSA+NALQ 
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAINALQL  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            YTN+QP+IRGRNVY+QFSSHQELTTMDQNTQ RGDE
Sbjct  61   YTNIQPTIRGRNVYVQFSSHQELTTMDQNTQGRGDE  96



>ref|XP_011042879.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X1 [Populus euphratica]
Length=436

 Score =   191 bits (486),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/96 (94%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSA+NALQ 
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAINALQL  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            YTN+QP+IRGRNVY+QFSSHQELTTMDQNTQ RGDE
Sbjct  61   YTNIQPTIRGRNVYVQFSSHQELTTMDQNTQGRGDE  96



>ref|XP_006473080.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X2 [Citrus sinensis]
 gb|KDO83776.1| hypothetical protein CISIN_1g013267mg [Citrus sinensis]
Length=437

 Score =   191 bits (486),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/96 (94%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSA+NALQF
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAINALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            YTNVQP+IRGRNVY+QFSSHQELTTM+QN Q RGDE
Sbjct  61   YTNVQPTIRGRNVYVQFSSHQELTTMEQNAQGRGDE  96



>ref|XP_006434492.1| hypothetical protein CICLE_v10001148mg [Citrus clementina]
 gb|ESR47732.1| hypothetical protein CICLE_v10001148mg [Citrus clementina]
Length=437

 Score =   191 bits (486),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/96 (94%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSA+NALQF
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAINALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            YTNVQP+IRGRNVY+QFSSHQELTTM+QN Q RGDE
Sbjct  61   YTNVQPTIRGRNVYVQFSSHQELTTMEQNAQGRGDE  96



>ref|XP_006434490.1| hypothetical protein CICLE_v10001148mg [Citrus clementina]
 ref|XP_006434491.1| hypothetical protein CICLE_v10001148mg [Citrus clementina]
 gb|ESR47730.1| hypothetical protein CICLE_v10001148mg [Citrus clementina]
 gb|ESR47731.1| hypothetical protein CICLE_v10001148mg [Citrus clementina]
Length=446

 Score =   191 bits (486),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/96 (94%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSA+NALQF
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAINALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            YTNVQP+IRGRNVY+QFSSHQELTTM+QN Q RGDE
Sbjct  61   YTNVQPTIRGRNVYVQFSSHQELTTMEQNAQGRGDE  96



>ref|XP_006473079.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X1 [Citrus sinensis]
 gb|KDO83775.1| hypothetical protein CISIN_1g013267mg [Citrus sinensis]
Length=446

 Score =   191 bits (486),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/96 (94%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSA+NALQF
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAINALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            YTNVQP+IRGRNVY+QFSSHQELTTM+QN Q RGDE
Sbjct  61   YTNVQPTIRGRNVYVQFSSHQELTTMEQNAQGRGDE  96



>ref|XP_002524303.1| polypyrimidine tract binding protein, putative [Ricinus communis]
 gb|EEF38043.1| polypyrimidine tract binding protein, putative [Ricinus communis]
Length=437

 Score =   191 bits (485),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQD+PSA+NALQF
Sbjct  1    MAEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDIPSAINALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEVFKL*FNFK  397
            Y NVQP+IRGRNVY+QFSSHQELTTMDQN+Q R DE F L   FK
Sbjct  61   YGNVQPTIRGRNVYVQFSSHQELTTMDQNSQGRADEPFVLAVRFK  105



>ref|XP_002306709.2| hypothetical protein POPTR_0005s21660g, partial [Populus trichocarpa]
 gb|EEE93705.2| hypothetical protein POPTR_0005s21660g, partial [Populus trichocarpa]
Length=520

 Score =   193 bits (490),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/97 (94%), Positives = 96/97 (99%), Gaps = 0/97 (0%)
 Frame = +2

Query  80   KMTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQ  259
            KMTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSA+NALQ
Sbjct  90   KMTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAINALQ  149

Query  260  FYTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            +YT+VQP+IRGRNVYIQFSSHQELTTMDQNTQ RG+E
Sbjct  150  YYTDVQPTIRGRNVYIQFSSHQELTTMDQNTQGRGEE  186



>ref|XP_010665151.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X1 [Vitis vinifera]
 ref|XP_010665152.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X1 [Vitis vinifera]
 ref|XP_010665153.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X1 [Vitis vinifera]
 emb|CBI18226.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   191 bits (485),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/96 (94%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSA NA+QF
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAANAMQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            YTNVQPSIRGRNVY+QFSSHQELTT+DQN Q RGDE
Sbjct  61   YTNVQPSIRGRNVYVQFSSHQELTTVDQNAQGRGDE  96



>ref|XP_010062097.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 [Eucalyptus 
grandis]
 ref|XP_010062098.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 [Eucalyptus 
grandis]
 ref|XP_010062099.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 [Eucalyptus 
grandis]
 ref|XP_010062100.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 [Eucalyptus 
grandis]
 gb|KCW69166.1| hypothetical protein EUGRSUZ_F02695 [Eucalyptus grandis]
Length=444

 Score =   191 bits (484),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 89/96 (93%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQD+PSA+NALQF
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDIPSAINALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            Y NVQPSIRGRNVY+QFSSHQELTT+DQN Q+RGDE
Sbjct  61   YANVQPSIRGRNVYVQFSSHQELTTVDQNAQARGDE  96



>ref|XP_009768478.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
[Nicotiana sylvestris]
Length=585

 Score =   193 bits (491),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 92/96 (96%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MT+PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAV ALQF
Sbjct  1    MTDPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVKALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            YTNVQPSIRGRNVY+QFSSHQELTTMDQNTQ RGDE
Sbjct  61   YTNVQPSIRGRNVYVQFSSHQELTTMDQNTQGRGDE  96



>ref|XP_009765394.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
[Nicotiana sylvestris]
Length=443

 Score =   191 bits (484),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 91/96 (95%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQ VPSAVNALQF
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQGVPSAVNALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            Y+NVQPSIRGRNVY+QFSSHQELTTMDQN+Q RGDE
Sbjct  61   YSNVQPSIRGRNVYVQFSSHQELTTMDQNSQGRGDE  96



>ref|XP_011044257.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X4 [Populus euphratica]
Length=435

 Score =   190 bits (482),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/96 (93%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSA+NALQ+
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAINALQY  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            YT+VQP+IRGRNVY+QFSSHQELTTMDQNTQ RG+E
Sbjct  61   YTDVQPTIRGRNVYVQFSSHQELTTMDQNTQGRGEE  96



>ref|XP_011044254.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X2 [Populus euphratica]
Length=436

 Score =   190 bits (482),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/96 (93%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSA+NALQ+
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAINALQY  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            YT+VQP+IRGRNVY+QFSSHQELTTMDQNTQ RG+E
Sbjct  61   YTDVQPTIRGRNVYVQFSSHQELTTMDQNTQGRGEE  96



>ref|XP_011044253.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X1 [Populus euphratica]
 ref|XP_011044258.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X1 [Populus euphratica]
Length=436

 Score =   190 bits (482),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/96 (93%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSA+NALQ+
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAINALQY  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            YT+VQP+IRGRNVY+QFSSHQELTTMDQNTQ RG+E
Sbjct  61   YTDVQPTIRGRNVYVQFSSHQELTTMDQNTQGRGEE  96



>ref|XP_011044256.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X3 [Populus euphratica]
Length=435

 Score =   189 bits (481),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/96 (93%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSA+NALQ+
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAINALQY  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            YT+VQP+IRGRNVY+QFSSHQELTTMDQNTQ RG+E
Sbjct  61   YTDVQPTIRGRNVYVQFSSHQELTTMDQNTQGRGEE  96



>ref|XP_007019550.1| Polypyrimidine tract-binding protein 3 [Theobroma cacao]
 gb|EOY16775.1| Polypyrimidine tract-binding protein 3 [Theobroma cacao]
Length=718

 Score =   192 bits (489),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 89/98 (91%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = +2

Query  77   LKMTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNAL  256
            L+M EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQD+PSA+NAL
Sbjct  267  LQMAEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDIPSAINAL  326

Query  257  QFYTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            QFYTNVQP+IRGRNVY+QFSSHQELTTMDQ  Q RGDE
Sbjct  327  QFYTNVQPTIRGRNVYVQFSSHQELTTMDQTAQGRGDE  364



>ref|NP_001274797.1| polypyrimidine tract-binding protein homolog 3-like [Solanum 
tuberosum]
 gb|AEG89703.1| polypyrimidine tract-binding protein 1 [Solanum tuberosum]
Length=441

 Score =   188 bits (477),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M++PSKV+HVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAV ALQF
Sbjct  1    MSDPSKVVHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVKALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            Y+NVQPSIRGRNVY+QFSSHQELTTMDQN Q RGDE
Sbjct  61   YSNVQPSIRGRNVYVQFSSHQELTTMDQNAQGRGDE  96



>gb|ACI43571.1| RBP50 [Cucurbita maxima]
Length=445

 Score =   188 bits (477),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 89/96 (93%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQAL+QMQDVPSAVNALQF
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALIQMQDVPSAVNALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            + NVQPSIRGRNVY+QFSSHQELTT DQN Q RGDE
Sbjct  61   FANVQPSIRGRNVYVQFSSHQELTTADQNAQGRGDE  96



>ref|XP_004162168.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
[Cucumis sativus]
Length=432

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQAL+QMQDVPSAVNALQF
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALMQMQDVPSAVNALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            + N+QPSIRGRNVY+QFSSHQELTT DQN Q RGDE
Sbjct  61   FANLQPSIRGRNVYVQFSSHQELTTADQNAQGRGDE  96



>gb|KHG00385.1| hypothetical protein F383_17340 [Gossypium arboreum]
Length=439

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M E SKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQD+PSA+NA+QF
Sbjct  1    MAEASKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDIPSAINAMQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            YTNVQP+IRGRNVY+QFSSHQELTTMDQN Q RGDE
Sbjct  61   YTNVQPTIRGRNVYVQFSSHQELTTMDQNAQGRGDE  96



>ref|XP_008463064.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 [Cucumis 
melo]
Length=444

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQAL+QMQDVPSAVNALQF
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALMQMQDVPSAVNALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            + N+QPSIRGRNVY+QFSSHQELTT DQN Q RGDE
Sbjct  61   FANLQPSIRGRNVYVQFSSHQELTTADQNAQGRGDE  96



>gb|KJB28976.1| hypothetical protein B456_005G078200 [Gossypium raimondii]
 gb|KJB28977.1| hypothetical protein B456_005G078200 [Gossypium raimondii]
Length=438

 Score =   186 bits (473),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M E SKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQD+PSA+NA+QF
Sbjct  1    MAEASKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDIPSAINAMQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            YTNVQP+IRGRNVY+QFSSHQELTTMDQN Q RGDE
Sbjct  61   YTNVQPTIRGRNVYVQFSSHQELTTMDQNAQGRGDE  96



>gb|KHG00384.1| hypothetical protein F383_17340 [Gossypium arboreum]
Length=445

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M E SKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQD+PSA+NA+QF
Sbjct  1    MAEASKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDIPSAINAMQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            YTNVQP+IRGRNVY+QFSSHQELTTMDQN Q RGDE
Sbjct  61   YTNVQPTIRGRNVYVQFSSHQELTTMDQNAQGRGDE  96



>ref|XP_004252004.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 [Solanum 
lycopersicum]
Length=441

 Score =   186 bits (473),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M++PSKV+HVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAV ALQF
Sbjct  1    MSDPSKVVHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVKALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            Y NVQPSIRGRNVY+QFSSHQELTTMDQN Q RGDE
Sbjct  61   YLNVQPSIRGRNVYVQFSSHQELTTMDQNVQGRGDE  96



>ref|XP_011078771.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 [Sesamum 
indicum]
 ref|XP_011078772.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 [Sesamum 
indicum]
 ref|XP_011078773.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 [Sesamum 
indicum]
 ref|XP_011078774.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 [Sesamum 
indicum]
Length=437

 Score =   186 bits (471),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQD+ SAV+ALQF
Sbjct  1    MAEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDIASAVSALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            YTNVQPSIRGRNVY+QFSSHQELT MDQN Q+RGDE
Sbjct  61   YTNVQPSIRGRNVYVQFSSHQELTIMDQNAQARGDE  96



>ref|XP_003536416.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
[Glycine max]
 gb|KHN17024.1| Polypyrimidine tract-binding protein like 3 [Glycine soja]
Length=443

 Score =   186 bits (471),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 90/96 (94%), Positives = 93/96 (97%), Gaps = 1/96 (1%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQAL+QMQDVPSAVNALQF
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALIQMQDVPSAVNALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            Y NVQPSIRGRNVY+QFSSHQELTTMDQ +Q RGDE
Sbjct  61   YANVQPSIRGRNVYVQFSSHQELTTMDQ-SQGRGDE  95



>ref|XP_007143560.1| hypothetical protein PHAVU_007G081900g [Phaseolus vulgaris]
 gb|ESW15554.1| hypothetical protein PHAVU_007G081900g [Phaseolus vulgaris]
Length=443

 Score =   186 bits (471),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 89/96 (93%), Positives = 93/96 (97%), Gaps = 1/96 (1%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKV+HVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF
Sbjct  1    MTEPSKVVHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            Y N+QPSIRGRNVY+QFSSHQELTTMDQ +Q RGDE
Sbjct  61   YANIQPSIRGRNVYVQFSSHQELTTMDQ-SQGRGDE  95



>gb|KCW71107.1| hypothetical protein EUGRSUZ_F04205 [Eucalyptus grandis]
Length=319

 Score =   182 bits (461),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M E SKVIH+RNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSA+NA+Q 
Sbjct  1    MAEASKVIHIRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAINAMQV  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            Y+NVQP+IRGRNVY+QFSSHQELTT+DQNTQ RGDE
Sbjct  61   YSNVQPTIRGRNVYVQFSSHQELTTVDQNTQGRGDE  96



>gb|EYU20662.1| hypothetical protein MIMGU_mgv1a006642mg [Erythranthe guttata]
Length=437

 Score =   184 bits (467),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M EPSKVIHVRNVGHEI+ENDLLQLFQPFGVITKLVMLRAKNQALLQMQD+ SAVNALQF
Sbjct  1    MAEPSKVIHVRNVGHEIAENDLLQLFQPFGVITKLVMLRAKNQALLQMQDITSAVNALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            Y+NVQPSIRGRNVY+QFSSHQELT +DQN+Q+RGDE
Sbjct  61   YSNVQPSIRGRNVYVQFSSHQELTVIDQNSQARGDE  96



>ref|XP_006605400.1| PREDICTED: uncharacterized protein LOC100819672 isoform X1 [Glycine 
max]
 ref|XP_006605401.1| PREDICTED: uncharacterized protein LOC100819672 isoform X2 [Glycine 
max]
 ref|XP_006605402.1| PREDICTED: uncharacterized protein LOC100819672 isoform X3 [Glycine 
max]
Length=443

 Score =   184 bits (467),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/96 (93%), Positives = 93/96 (97%), Gaps = 1/96 (1%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQAL+QMQDVPSAVNALQF
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALIQMQDVPSAVNALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            Y NVQPSIRGRNVY+QFSSHQELTTM+Q +Q RGDE
Sbjct  61   YANVQPSIRGRNVYVQFSSHQELTTMEQ-SQGRGDE  95



>ref|XP_007151988.1| hypothetical protein PHAVU_004G092400g [Phaseolus vulgaris]
 gb|ESW23982.1| hypothetical protein PHAVU_004G092400g [Phaseolus vulgaris]
Length=439

 Score =   184 bits (466),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/96 (93%), Positives = 93/96 (97%), Gaps = 1/96 (1%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQD+PSAVNALQF
Sbjct  1    MAEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDIPSAVNALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            Y+NVQPSIRGRNVY+QFSSHQELTTMDQN Q+R DE
Sbjct  61   YSNVQPSIRGRNVYVQFSSHQELTTMDQN-QAREDE  95



>gb|KHN46405.1| Polypyrimidine tract-binding protein like 3 [Glycine soja]
Length=443

 Score =   184 bits (466),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/96 (93%), Positives = 93/96 (97%), Gaps = 1/96 (1%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQAL+QMQDVPSAVNALQF
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALIQMQDVPSAVNALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            Y NVQPSIRGRNVY+QFSSHQELTTM+Q +Q RGDE
Sbjct  61   YANVQPSIRGRNVYVQFSSHQELTTMEQ-SQGRGDE  95



>ref|NP_001242751.1| uncharacterized protein LOC100819672 [Glycine max]
 gb|ACU20184.1| unknown [Glycine max]
Length=431

 Score =   184 bits (466),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/96 (93%), Positives = 93/96 (97%), Gaps = 1/96 (1%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQAL+QMQDVPSAVNALQF
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALIQMQDVPSAVNALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            Y NVQPSIRGRNVY+QFSSHQELTTM+Q +Q RGDE
Sbjct  61   YANVQPSIRGRNVYVQFSSHQELTTMEQ-SQGRGDE  95



>ref|XP_003518587.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
[Glycine max]
Length=439

 Score =   183 bits (464),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 89/96 (93%), Positives = 92/96 (96%), Gaps = 1/96 (1%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQD+PSAVNALQF
Sbjct  1    MAEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDIPSAVNALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            Y NVQPSIRGRNVY+QFSSHQELTTMDQN Q+R DE
Sbjct  61   YANVQPSIRGRNVYVQFSSHQELTTMDQN-QAREDE  95



>ref|XP_003548101.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X1 [Glycine max]
 ref|XP_006599485.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X2 [Glycine max]
 gb|KHN41293.1| Polypyrimidine tract-binding protein like 3 [Glycine soja]
Length=439

 Score =   183 bits (464),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 89/96 (93%), Positives = 92/96 (96%), Gaps = 1/96 (1%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQD+PSAVNALQF
Sbjct  1    MAEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDIPSAVNALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            Y NVQPSIRGRNVY+QFSSHQELTTMDQN Q+R DE
Sbjct  61   YANVQPSIRGRNVYVQFSSHQELTTMDQN-QAREDE  95



>ref|XP_010063840.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
[Eucalyptus grandis]
 ref|XP_010063841.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
[Eucalyptus grandis]
 gb|KCW71106.1| hypothetical protein EUGRSUZ_F04205 [Eucalyptus grandis]
Length=445

 Score =   183 bits (464),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M E SKVIH+RNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSA+NA+Q 
Sbjct  1    MAEASKVIHIRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAINAMQV  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            Y+NVQP+IRGRNVY+QFSSHQELTT+DQNTQ RGDE
Sbjct  61   YSNVQPTIRGRNVYVQFSSHQELTTVDQNTQGRGDE  96



>ref|XP_007201036.1| hypothetical protein PRUPE_ppa005775mg [Prunus persica]
 ref|XP_008237509.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X1 [Prunus mume]
 gb|EMJ02235.1| hypothetical protein PRUPE_ppa005775mg [Prunus persica]
Length=444

 Score =   182 bits (462),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQAL+QMQD P+AV+ALQF
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALIQMQDTPAAVSALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            Y NVQP+IRGRNVY+QFSSHQELTTM QN Q RGDE
Sbjct  61   YGNVQPAIRGRNVYVQFSSHQELTTMYQNAQGRGDE  96



>ref|XP_010681101.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
[Beta vulgaris subsp. vulgaris]
Length=443

 Score =   182 bits (462),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M+E SKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQAL+QMQDVPSAVN LQ+
Sbjct  1    MSEASKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALVQMQDVPSAVNILQY  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            YTN QP+IRGRNVYIQFSSHQELTTMDQN+  RGDE
Sbjct  61   YTNTQPTIRGRNVYIQFSSHQELTTMDQNSHGRGDE  96



>ref|XP_008237510.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X2 [Prunus mume]
Length=438

 Score =   182 bits (461),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQAL+QMQD P+AV+ALQF
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALIQMQDTPAAVSALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            Y NVQP+IRGRNVY+QFSSHQELTTM QN Q RGDE
Sbjct  61   YGNVQPAIRGRNVYVQFSSHQELTTMYQNAQGRGDE  96



>gb|KHN00751.1| Polypyrimidine tract-binding protein like 3 [Glycine soja]
Length=439

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 92/96 (96%), Gaps = 1/96 (1%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALL+MQD+PSAVNALQF
Sbjct  1    MAEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLRMQDIPSAVNALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            Y NVQPSIRGRNVY+QFSSHQELTTMDQN Q+R DE
Sbjct  61   YANVQPSIRGRNVYVQFSSHQELTTMDQN-QAREDE  95



>ref|XP_010527313.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X2 [Tarenaya hassleriana]
Length=449

 Score =   181 bits (460),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/98 (89%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +2

Query  77   LKMTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNAL  256
              M EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQM+DV +AVNAL
Sbjct  16   FGMAEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMEDVSAAVNAL  75

Query  257  QFYTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            QFYTNVQPSIRGRNVYIQFSSHQELTT++Q T  RGDE
Sbjct  76   QFYTNVQPSIRGRNVYIQFSSHQELTTVEQTTHGRGDE  113



>ref|XP_010527312.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X1 [Tarenaya hassleriana]
Length=450

 Score =   181 bits (459),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/98 (89%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +2

Query  77   LKMTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNAL  256
              M EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQM+DV +AVNAL
Sbjct  16   FGMAEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMEDVSAAVNAL  75

Query  257  QFYTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            QFYTNVQPSIRGRNVYIQFSSHQELTT++Q T  RGDE
Sbjct  76   QFYTNVQPSIRGRNVYIQFSSHQELTTVEQTTHGRGDE  113



>ref|XP_006351367.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
[Solanum tuberosum]
Length=444

 Score =   181 bits (458),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKVIHVRNVG EISENDLLQLFQPFGVITKLVMLRAKNQALLQMQD+ +AVNA+QF
Sbjct  1    MTEPSKVIHVRNVGQEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDIAAAVNAMQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            Y+NVQPSIRGR+VY+QFSSHQELTT+DQN Q RGDE
Sbjct  61   YSNVQPSIRGRSVYVQFSSHQELTTVDQNAQGRGDE  96



>ref|XP_008369222.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
[Malus domestica]
Length=467

 Score =   181 bits (458),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQAL+QMQD  +AV+ALQF
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALIQMQDTAAAVSALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            Y NVQP+IRGRNVY+QFSSHQELTTM QN Q RGDE
Sbjct  61   YANVQPAIRGRNVYVQFSSHQELTTMYQNAQGRGDE  96



>gb|AEG89704.1| polypyrimidine tract-binding protein 6 [Solanum tuberosum]
Length=444

 Score =   180 bits (457),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKVIHVRNVG EISENDLLQLFQPFGVITKLVMLRAKNQALLQMQD+ +AVNA+QF
Sbjct  1    MTEPSKVIHVRNVGQEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDIAAAVNAMQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            Y+NVQPSIRGR+VY+QFSSHQELTT+DQN Q RGDE
Sbjct  61   YSNVQPSIRGRSVYVQFSSHQELTTVDQNAQGRGDE  96



>ref|XP_009336734.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009341177.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X2 [Pyrus x bretschneideri]
Length=438

 Score =   180 bits (456),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQAL+QMQD  +AV+ALQF
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALIQMQDTAAAVSALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            Y NVQP+IRGRNVY+QFSSHQELTTM QN Q RGDE
Sbjct  61   YANVQPAIRGRNVYVQFSSHQELTTMYQNAQGRGDE  96



>ref|XP_009336732.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009336733.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009341174.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009341175.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009341176.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009341178.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X1 [Pyrus x bretschneideri]
Length=444

 Score =   180 bits (456),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQAL+QMQD  +AV+ALQF
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALIQMQDTAAAVSALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            Y NVQP+IRGRNVY+QFSSHQELTTM QN Q RGDE
Sbjct  61   YANVQPAIRGRNVYVQFSSHQELTTMYQNAQGRGDE  96



>ref|XP_004290497.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 [Fragaria 
vesca subsp. vesca]
Length=445

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQAL+QMQD  +AV+ALQF
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALIQMQDTAAAVSALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            Y NVQP++RGRNVY+QFSSHQELTTM QN Q RGDE
Sbjct  61   YANVQPAVRGRNVYVQFSSHQELTTMYQNAQGRGDE  96



>gb|AFW68316.1| hypothetical protein ZEAMMB73_143783 [Zea mays]
 gb|AFW78166.1| hypothetical protein ZEAMMB73_011466 [Zea mays]
Length=128

 Score =   169 bits (429),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 100/112 (89%), Gaps = 2/112 (2%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M+EPSKVIH+RNVGHEI+E+DLLQL QPFGV++K+VMLRAKNQ LLQM+D+ ++V+ALQ+
Sbjct  1    MSEPSKVIHIRNVGHEIAESDLLQLLQPFGVVSKIVMLRAKNQTLLQMEDIHASVSALQY  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSR-GDEVFKL*FNFKQTKVLY  415
            YT+VQPSIRGRNVY+QFSSHQELTT DQ++  R  D+VFKL F+F + K L+
Sbjct  61   YTSVQPSIRGRNVYMQFSSHQELTT-DQSSHGRNSDQVFKLLFSFTRAKKLW  111



>ref|XP_004249306.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
[Solanum lycopersicum]
 ref|XP_010312158.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
[Solanum lycopersicum]
Length=444

 Score =   178 bits (451),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKVIHVRNVG EISENDLLQLFQPFGVITKLVMLRAKNQALLQMQ++ +AVNA+QF
Sbjct  1    MTEPSKVIHVRNVGQEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQEIGAAVNAMQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            Y+NVQPSIRGR+VY+QFSSHQELTT+DQN Q RGDE
Sbjct  61   YSNVQPSIRGRSVYVQFSSHQELTTVDQNAQGRGDE  96



>ref|XP_010533404.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X3 [Tarenaya hassleriana]
Length=433

 Score =   177 bits (449),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 91/97 (94%), Gaps = 1/97 (1%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M+EPSKVIHVRNVGHEISENDLLQLFQPFG +TKLVMLRAKNQALLQMQDV +AVNALQF
Sbjct  1    MSEPSKVIHVRNVGHEISENDLLQLFQPFGAVTKLVMLRAKNQALLQMQDVSAAVNALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNT-QSRGDE  370
            YTNVQPSIRGRNVYIQFSSHQELTTM+QNT   R DE
Sbjct  61   YTNVQPSIRGRNVYIQFSSHQELTTMEQNTHHGRVDE  97



>ref|XP_010533403.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X2 [Tarenaya hassleriana]
Length=434

 Score =   177 bits (449),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 91/97 (94%), Gaps = 1/97 (1%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M+EPSKVIHVRNVGHEISENDLLQLFQPFG +TKLVMLRAKNQALLQMQDV +AVNALQF
Sbjct  1    MSEPSKVIHVRNVGHEISENDLLQLFQPFGAVTKLVMLRAKNQALLQMQDVSAAVNALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNT-QSRGDE  370
            YTNVQPSIRGRNVYIQFSSHQELTTM+QNT   R DE
Sbjct  61   YTNVQPSIRGRNVYIQFSSHQELTTMEQNTHHGRVDE  97



>ref|XP_010246265.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
[Nelumbo nucifera]
Length=447

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKVIH+RNVGHEISENDLLQL QPFGV+TKLVMLRAKNQALLQM DV SAVNALQ+
Sbjct  1    MTEPSKVIHIRNVGHEISENDLLQLVQPFGVVTKLVMLRAKNQALLQMHDVASAVNALQY  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSR  361
            YTN+QPS+RGRNVYIQFSSHQELTTMDQN Q R
Sbjct  61   YTNIQPSVRGRNVYIQFSSHQELTTMDQNAQGR  93



>ref|XP_010533405.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X4 [Tarenaya hassleriana]
Length=443

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 91/97 (94%), Gaps = 1/97 (1%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M+EPSKVIHVRNVGHEISENDLLQLFQPFG +TKLVMLRAKNQALLQMQDV +AVNALQF
Sbjct  8    MSEPSKVIHVRNVGHEISENDLLQLFQPFGAVTKLVMLRAKNQALLQMQDVSAAVNALQF  67

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNT-QSRGDE  370
            YTNVQPSIRGRNVYIQFSSHQELTTM+QNT   R DE
Sbjct  68   YTNVQPSIRGRNVYIQFSSHQELTTMEQNTHHGRVDE  104



>ref|XP_010533402.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X1 [Tarenaya hassleriana]
Length=435

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 91/97 (94%), Gaps = 1/97 (1%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M+EPSKVIHVRNVGHEISENDLLQLFQPFG +TKLVMLRAKNQALLQMQDV +AVNALQF
Sbjct  1    MSEPSKVIHVRNVGHEISENDLLQLFQPFGAVTKLVMLRAKNQALLQMQDVSAAVNALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNT-QSRGDE  370
            YTNVQPSIRGRNVYIQFSSHQELTTM+QNT   R DE
Sbjct  61   YTNVQPSIRGRNVYIQFSSHQELTTMEQNTHHGRVDE  97



>ref|XP_010533406.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X5 [Tarenaya hassleriana]
Length=436

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 91/97 (94%), Gaps = 1/97 (1%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M+EPSKVIHVRNVGHEISENDLLQLFQPFG +TKLVMLRAKNQALLQMQDV +AVNALQF
Sbjct  1    MSEPSKVIHVRNVGHEISENDLLQLFQPFGAVTKLVMLRAKNQALLQMQDVSAAVNALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNT-QSRGDE  370
            YTNVQPSIRGRNVYIQFSSHQELTTM+QNT   R DE
Sbjct  61   YTNVQPSIRGRNVYIQFSSHQELTTMEQNTHHGRVDE  97



>ref|XP_010260993.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X1 [Nelumbo nucifera]
Length=448

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 90/97 (93%), Gaps = 1/97 (1%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKVIH+RNVGHEISENDLLQL QPFGV+TKLVMLRAKNQALLQM DV SAVNAL +
Sbjct  1    MTEPSKVIHIRNVGHEISENDLLQLVQPFGVVTKLVMLRAKNQALLQMHDVASAVNALHY  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSR-GDE  370
            YTNVQPS+RGRNVYIQFSSHQELTTMDQN Q R GD+
Sbjct  61   YTNVQPSVRGRNVYIQFSSHQELTTMDQNAQGRKGDQ  97



>ref|XP_010260994.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X2 [Nelumbo nucifera]
Length=447

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 90/97 (93%), Gaps = 1/97 (1%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKVIH+RNVGHEISENDLLQL QPFGV+TKLVMLRAKNQALLQM DV SAVNAL +
Sbjct  1    MTEPSKVIHIRNVGHEISENDLLQLVQPFGVVTKLVMLRAKNQALLQMHDVASAVNALHY  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSR-GDE  370
            YTNVQPS+RGRNVYIQFSSHQELTTMDQN Q R GD+
Sbjct  61   YTNVQPSVRGRNVYIQFSSHQELTTMDQNAQGRKGDQ  97



>ref|XP_003592082.1| Polypyrimidine tract-binding protein-like protein [Medicago truncatula]
 gb|AES62333.1| polypyrimidine tract-binding-like protein [Medicago truncatula]
 gb|AFK34374.1| unknown [Medicago truncatula]
Length=443

 Score =   176 bits (446),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 90/96 (94%), Gaps = 1/96 (1%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQAL+QMQDVPSAV+AL F
Sbjct  1    MAEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALIQMQDVPSAVSALHF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            Y N QPSIRGRNVY+QFSSHQELTT+DQ +Q RGDE
Sbjct  61   YGNTQPSIRGRNVYVQFSSHQELTTIDQ-SQGRGDE  95



>ref|XP_010479003.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X2 [Camelina sativa]
Length=433

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M E SKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAV+ALQF
Sbjct  1    MAESSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVSALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            +TNVQP+IRGRNVY+QFSSHQELTT++QN   R DE
Sbjct  61   FTNVQPTIRGRNVYVQFSSHQELTTIEQNIHGREDE  96



>ref|XP_010479002.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X1 [Camelina sativa]
Length=433

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M E SKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAV+ALQF
Sbjct  1    MAESSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVSALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            +TNVQP+IRGRNVY+QFSSHQELTT++QN   R DE
Sbjct  61   FTNVQPTIRGRNVYVQFSSHQELTTIEQNIHGREDE  96



>ref|XP_010500100.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
[Camelina sativa]
 ref|XP_010500101.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
[Camelina sativa]
Length=433

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M E SKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAV+ALQF
Sbjct  1    MAESSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVSALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            +TNVQP+IRGRNVY+QFSSHQELTT++QN   R DE
Sbjct  61   FTNVQPTIRGRNVYVQFSSHQELTTIEQNIHGREDE  96



>ref|XP_010461394.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 [Camelina 
sativa]
Length=433

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M E SKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAV+ALQF
Sbjct  1    MAESSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVSALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            +TNVQP+IRGRNVY+QFSSHQELTT++QN   R DE
Sbjct  61   FTNVQPTIRGRNVYVQFSSHQELTTIEQNIHGREDE  96



>ref|XP_006303776.1| hypothetical protein CARUB_v10012016mg [Capsella rubella]
 gb|EOA36674.1| hypothetical protein CARUB_v10012016mg [Capsella rubella]
Length=420

 Score =   173 bits (438),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M E SKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDV SAV+ALQF
Sbjct  1    MAESSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVSSAVSALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            +TNVQP+IRGRNVY+QFSSHQELTT++QN   R DE
Sbjct  61   FTNVQPTIRGRNVYVQFSSHQELTTIEQNIHGREDE  96



>ref|XP_008384421.1| PREDICTED: LOW QUALITY PROTEIN: polypyrimidine tract-binding 
protein homolog 3-like [Malus domestica]
Length=428

 Score =   173 bits (438),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPS VIHVRNVGHEISENDLL+LFQPFGVITKLVMLRAKNQAL+QMQD  +AV+ALQF
Sbjct  1    MTEPSNVIHVRNVGHEISENDLLRLFQPFGVITKLVMLRAKNQALIQMQDTTAAVSALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            Y NVQP++RGRNVY+QFSSHQELTTM QN Q RG+E
Sbjct  61   YANVQPALRGRNVYVQFSSHQELTTMYQNAQGRGNE  96



>ref|XP_004138369.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform 1 [Cucumis sativus]
Length=434

 Score =   173 bits (438),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 90/98 (92%), Gaps = 2/98 (2%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEIS--ENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNAL  256
            MTEPSKVIHVRNVG  +S  +NDLLQLFQPFGVITKLVMLRAKNQAL+QMQDVPSAVNAL
Sbjct  1    MTEPSKVIHVRNVGLSLSLSQNDLLQLFQPFGVITKLVMLRAKNQALMQMQDVPSAVNAL  60

Query  257  QFYTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            QF+ N+QPSIRGRNVY+QFSSHQELTT DQN Q RGDE
Sbjct  61   QFFANLQPSIRGRNVYVQFSSHQELTTADQNAQGRGDE  98



>ref|XP_006395995.1| hypothetical protein EUTSA_v10004261mg [Eutrema salsugineum]
 ref|XP_006395996.1| hypothetical protein EUTSA_v10004261mg [Eutrema salsugineum]
 gb|ESQ33281.1| hypothetical protein EUTSA_v10004261mg [Eutrema salsugineum]
 gb|ESQ33282.1| hypothetical protein EUTSA_v10004261mg [Eutrema salsugineum]
Length=432

 Score =   172 bits (437),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M E SKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDV SAV+ALQF
Sbjct  1    MAESSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVSSAVSALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            +TNVQP+IRGRNVYIQFSSHQELTT++QN   R DE
Sbjct  61   FTNVQPTIRGRNVYIQFSSHQELTTIEQNIHGREDE  96



>ref|XP_002893943.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70202.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=432

 Score =   172 bits (436),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M E SKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDV SA++ALQF
Sbjct  1    MAESSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVSSAISALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            +TNVQP+IRGRNVY+QFSSHQELTT++QN   R DE
Sbjct  61   FTNVQPTIRGRNVYVQFSSHQELTTIEQNIHGREDE  96



>ref|NP_175010.2| polypyrimidine tract-binding protein 3 [Arabidopsis thaliana]
 ref|NP_001077672.1| polypyrimidine tract-binding protein 3 [Arabidopsis thaliana]
 sp|Q6ICX4.1|PTBP3_ARATH RecName: Full=Polypyrimidine tract-binding protein homolog 3 
[Arabidopsis thaliana]
 gb|AAT44975.1| At1g43190 [Arabidopsis thaliana]
 gb|AAT70479.1| At1g43190 [Arabidopsis thaliana]
 dbj|BAF00629.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE31961.1| polypyrimidine tract-binding protein 3 [Arabidopsis thaliana]
 gb|AEE31962.1| polypyrimidine tract-binding protein 3 [Arabidopsis thaliana]
Length=432

 Score =   172 bits (436),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M E SKV+HVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDV SAV+ALQF
Sbjct  1    MAESSKVVHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVSSAVSALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            +TNVQP+IRGRNVY+QFSSHQELTT++QN   R DE
Sbjct  61   FTNVQPTIRGRNVYVQFSSHQELTTIEQNIHGREDE  96



>emb|CBI21552.3| unnamed protein product [Vitis vinifera]
Length=374

 Score =   171 bits (432),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 83/97 (86%), Positives = 90/97 (93%), Gaps = 1/97 (1%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKVIHVRNVG EISENDLLQL  PFGV+TKLVMLRAKNQALLQMQDV SAV+ALQ+
Sbjct  1    MTEPSKVIHVRNVGPEISENDLLQLVHPFGVVTKLVMLRAKNQALLQMQDVASAVSALQY  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSR-GDE  370
            Y NVQPS+RGRNVY+QFSSHQELTTMDQN+Q R GD+
Sbjct  61   YANVQPSVRGRNVYVQFSSHQELTTMDQNSQGRKGDQ  97



>emb|CDY36013.1| BnaA08g04480D [Brassica napus]
Length=432

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M E SKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDV SA+ ALQF
Sbjct  1    MAESSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVSSAITALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            +TNVQP+IRGRNVYIQFSSHQELTT +QN   R DE
Sbjct  61   FTNVQPTIRGRNVYIQFSSHQELTTAEQNIHGREDE  96



>ref|XP_009107488.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 [Brassica 
rapa]
Length=432

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M E SKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDV SA+ ALQF
Sbjct  1    MAESSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVSSAITALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            +TNVQP+IRGRNVYIQFSSHQELTT +QN   R DE
Sbjct  61   FTNVQPTIRGRNVYIQFSSHQELTTAEQNIHGREDE  96



>ref|XP_009385102.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
[Musa acuminata subsp. malaccensis]
Length=447

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 90/97 (93%), Gaps = 1/97 (1%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKVIH+RNVGHEISENDLLQL QPFGV+TKLVMLRAKNQALLQM D+ SAVN LQ+
Sbjct  1    MTEPSKVIHIRNVGHEISENDLLQLVQPFGVVTKLVMLRAKNQALLQMHDLTSAVNVLQY  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSR-GDE  370
            YT+VQPS+RGRNVYIQFSSHQELTT DQN+Q R GD+
Sbjct  61   YTSVQPSVRGRNVYIQFSSHQELTTADQNSQGRKGDQ  97



>emb|CDY47859.1| BnaCnng15550D [Brassica napus]
Length=454

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M E SKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDV SA+ ALQF
Sbjct  1    MAESSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVSSAITALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            +TNVQP+IRGRNVYIQFSSHQELTT +QN   R DE
Sbjct  61   FTNVQPTIRGRNVYIQFSSHQELTTAEQNIHGREDE  96



>ref|XP_002277938.2| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X1 [Vitis vinifera]
Length=448

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/97 (86%), Positives = 90/97 (93%), Gaps = 1/97 (1%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKVIHVRNVG EISENDLLQL  PFGV+TKLVMLRAKNQALLQMQDV SAV+ALQ+
Sbjct  1    MTEPSKVIHVRNVGPEISENDLLQLVHPFGVVTKLVMLRAKNQALLQMQDVASAVSALQY  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSR-GDE  370
            Y NVQPS+RGRNVY+QFSSHQELTTMDQN+Q R GD+
Sbjct  61   YANVQPSVRGRNVYVQFSSHQELTTMDQNSQGRKGDQ  97



>ref|XP_010927403.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X2 [Elaeis guineensis]
Length=432

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/97 (84%), Positives = 89/97 (92%), Gaps = 1/97 (1%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKVIH+RNVGHEISENDLLQL QPFG + KLVMLRAKNQAL+QM D+PSAVN LQ+
Sbjct  1    MTEPSKVIHIRNVGHEISENDLLQLVQPFGPVNKLVMLRAKNQALIQMHDLPSAVNVLQY  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSR-GDE  370
            YTNVQPS+RGRNVYIQFSSHQELTT DQN+Q R GD+
Sbjct  61   YTNVQPSVRGRNVYIQFSSHQELTTADQNSQGRKGDQ  97



>ref|XP_006854512.1| hypothetical protein AMTR_s00175p00061780 [Amborella trichopoda]
 gb|ERN15979.1| hypothetical protein AMTR_s00175p00061780 [Amborella trichopoda]
Length=493

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/99 (84%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +2

Query  71   RPLKMTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVN  250
            R  KMTEPSKVIHVRNVGHEISENDLLQL QPFGV+ K VMLRAKNQALLQM D+PSAVN
Sbjct  28   RFTKMTEPSKVIHVRNVGHEISENDLLQLVQPFGVVDKRVMLRAKNQALLQMHDIPSAVN  87

Query  251  ALQFYTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGD  367
            ALQ+YTNVQPS+RGRNVY+QFSSHQELTT DQN Q   D
Sbjct  88   ALQYYTNVQPSVRGRNVYMQFSSHQELTTPDQNGQGSKD  126



>ref|XP_010927400.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X1 [Elaeis guineensis]
 ref|XP_010927401.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X1 [Elaeis guineensis]
 ref|XP_010927402.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X1 [Elaeis guineensis]
Length=446

 Score =   171 bits (432),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/97 (84%), Positives = 89/97 (92%), Gaps = 1/97 (1%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKVIH+RNVGHEISENDLLQL QPFG + KLVMLRAKNQAL+QM D+PSAVN LQ+
Sbjct  1    MTEPSKVIHIRNVGHEISENDLLQLVQPFGPVNKLVMLRAKNQALIQMHDLPSAVNVLQY  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSR-GDE  370
            YTNVQPS+RGRNVYIQFSSHQELTT DQN+Q R GD+
Sbjct  61   YTNVQPSVRGRNVYIQFSSHQELTTADQNSQGRKGDQ  97



>emb|CAN82466.1| hypothetical protein VITISV_002663 [Vitis vinifera]
Length=476

 Score =   171 bits (433),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 83/97 (86%), Positives = 90/97 (93%), Gaps = 1/97 (1%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKVIHVRNVG EISENDLLQL  PFGV+TKLVMLRAKNQALLQMQDV SAV+ALQ+
Sbjct  1    MTEPSKVIHVRNVGPEISENDLLQLVHPFGVVTKLVMLRAKNQALLQMQDVASAVSALQY  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSR-GDE  370
            Y NVQPS+RGRNVY+QFSSHQELTTMDQN+Q R GD+
Sbjct  61   YANVQPSVRGRNVYVQFSSHQELTTMDQNSQGRKGDQ  97



>ref|XP_010912015.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X2 [Elaeis guineensis]
Length=446

 Score =   171 bits (432),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/97 (84%), Positives = 89/97 (92%), Gaps = 1/97 (1%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKVIH+RNVGHEISENDLLQL QPFG + KLVMLRAKNQALLQM D+PSAVN LQ+
Sbjct  1    MTEPSKVIHIRNVGHEISENDLLQLVQPFGPVNKLVMLRAKNQALLQMHDLPSAVNVLQY  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQS-RGDE  370
            Y+NVQPS+RGRNVYIQFSSHQELTT DQN+Q  RGD+
Sbjct  61   YSNVQPSVRGRNVYIQFSSHQELTTADQNSQGRRGDQ  97



>ref|XP_008785843.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X1 [Phoenix dactylifera]
 ref|XP_008785844.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X2 [Phoenix dactylifera]
Length=446

 Score =   171 bits (432),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/97 (84%), Positives = 89/97 (92%), Gaps = 1/97 (1%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKVIH+RNVGHEISENDLLQL QPFG + KLVMLRAKNQALLQM D+PSAVN LQ+
Sbjct  1    MTEPSKVIHIRNVGHEISENDLLQLVQPFGPVNKLVMLRAKNQALLQMHDLPSAVNVLQY  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQS-RGDE  370
            Y+NVQPS+RGRNVYIQFSSHQELTT DQN+Q  RGD+
Sbjct  61   YSNVQPSVRGRNVYIQFSSHQELTTADQNSQGRRGDQ  97



>ref|XP_010912014.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X1 [Elaeis guineensis]
Length=453

 Score =   171 bits (432),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/97 (84%), Positives = 89/97 (92%), Gaps = 1/97 (1%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKVIH+RNVGHEISENDLLQL QPFG + KLVMLRAKNQALLQM D+PSAVN LQ+
Sbjct  1    MTEPSKVIHIRNVGHEISENDLLQLVQPFGPVNKLVMLRAKNQALLQMHDLPSAVNVLQY  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQS-RGDE  370
            Y+NVQPS+RGRNVYIQFSSHQELTT DQN+Q  RGD+
Sbjct  61   YSNVQPSVRGRNVYIQFSSHQELTTADQNSQGRRGDQ  97



>ref|XP_009393413.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009393414.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009393415.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
[Musa acuminata subsp. malaccensis]
Length=447

 Score =   170 bits (431),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 90/97 (93%), Gaps = 1/97 (1%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPS+VIH+RNVGHEISENDLLQL QPFGV+TKLVMLRAKNQALLQM D+ S++N LQ+
Sbjct  1    MTEPSRVIHIRNVGHEISENDLLQLVQPFGVVTKLVMLRAKNQALLQMHDLSSSINVLQY  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSR-GDE  370
            YTNVQPS+RGRNVYIQFSSHQELTT DQN+Q R GD+
Sbjct  61   YTNVQPSVRGRNVYIQFSSHQELTTADQNSQGRKGDQ  97



>ref|NP_001266083.1| polypyrimidine tract-binding protein homolog 3-like [Cicer arietinum]
 emb|CAD70621.1| polypyrimidine track-binding protein homologue [Cicer arietinum]
Length=442

 Score =   169 bits (429),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 88/96 (92%), Gaps = 1/96 (1%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M EPSKVIHVRNVGHEISENDLLQLFQ FGVITKLVMLR KNQALLQM+D+PSA++ALQF
Sbjct  1    MAEPSKVIHVRNVGHEISENDLLQLFQTFGVITKLVMLRTKNQALLQMEDIPSAISALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            Y N QPSIRGRNVY+QFSSH+ELTTMDQ +Q R DE
Sbjct  61   YANAQPSIRGRNVYVQFSSHKELTTMDQ-SQGRDDE  95



>ref|XP_004496454.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X3 [Cicer arietinum]
Length=444

 Score =   167 bits (424),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 87/96 (91%), Gaps = 1/96 (1%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKVIHVRNVGHEISE DL  LFQ FG ITKLVMLRAKNQAL+QMQDVPSA++ALQF
Sbjct  1    MTEPSKVIHVRNVGHEISEKDLFLLFQRFGAITKLVMLRAKNQALIQMQDVPSAISALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            Y N QPSIRGRNVY+QFSSHQELTT+DQ +Q RGDE
Sbjct  61   YANTQPSIRGRNVYVQFSSHQELTTVDQ-SQGRGDE  95



>ref|XP_004496452.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X1 [Cicer arietinum]
 ref|XP_004496453.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X2 [Cicer arietinum]
Length=476

 Score =   168 bits (425),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 87/96 (91%), Gaps = 1/96 (1%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKVIHVRNVGHEISE DL  LFQ FG ITKLVMLRAKNQAL+QMQDVPSA++ALQF
Sbjct  1    MTEPSKVIHVRNVGHEISEKDLFLLFQRFGAITKLVMLRAKNQALIQMQDVPSAISALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            Y N QPSIRGRNVY+QFSSHQELTT+DQ +Q RGDE
Sbjct  61   YANTQPSIRGRNVYVQFSSHQELTTVDQ-SQGRGDE  95



>gb|EPS74228.1| hypothetical protein M569_00523 [Genlisea aurea]
Length=437

 Score =   167 bits (422),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 76/96 (79%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M EPSKVIH+RNVGHEI E+DL+QLFQPFGV++KL+MLRAKNQALLQMQD+PSAVNA+Q+
Sbjct  1    MAEPSKVIHLRNVGHEIIESDLIQLFQPFGVVSKLMMLRAKNQALLQMQDIPSAVNAMQY  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            Y NVQP IRGRNVY+QFSSHQEL  MDQ +Q+R DE
Sbjct  61   YANVQPIIRGRNVYVQFSSHQELMVMDQASQARVDE  96



>ref|XP_008793925.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
[Phoenix dactylifera]
 ref|XP_008793926.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
[Phoenix dactylifera]
Length=446

 Score =   167 bits (422),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKVIH+RNVGHEISENDLLQL QPFG ++KLV+LRAKNQAL+QM D+PSAVN LQ+
Sbjct  1    MTEPSKVIHIRNVGHEISENDLLQLVQPFGPVSKLVILRAKNQALIQMHDLPSAVNVLQY  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSR  361
            YTNVQPS+RGRNVYIQFSSHQELTT DQ +Q R
Sbjct  61   YTNVQPSVRGRNVYIQFSSHQELTTADQTSQGR  93



>ref|XP_003619162.1| Polypyrimidine tract-binding protein-like protein [Medicago truncatula]
Length=354

 Score =   163 bits (413),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 87/96 (91%), Gaps = 1/96 (1%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M E SKVIHVRNVGHEISENDLLQLFQPFGV+TKLVMLRAKNQAL+QMQDV SA +A+QF
Sbjct  1    MAEQSKVIHVRNVGHEISENDLLQLFQPFGVVTKLVMLRAKNQALVQMQDVASADSAIQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            Y N QPSIRGRNVY+QFSSH+ELTTMDQN Q R DE
Sbjct  61   YINSQPSIRGRNVYVQFSSHRELTTMDQN-QGREDE  95



>gb|AES75380.2| polypyrimidine tract-binding-like protein [Medicago truncatula]
Length=443

 Score =   164 bits (414),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 87/96 (91%), Gaps = 1/96 (1%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M E SKVIHVRNVGHEISENDLLQLFQPFGV+TKLVMLRAKNQAL+QMQDV SA +A+QF
Sbjct  1    MAEQSKVIHVRNVGHEISENDLLQLFQPFGVVTKLVMLRAKNQALVQMQDVASADSAIQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            Y N QPSIRGRNVY+QFSSH+ELTTMDQN Q R DE
Sbjct  61   YINSQPSIRGRNVYVQFSSHRELTTMDQN-QGREDE  95



>ref|NP_001077673.1| polypyrimidine tract-binding protein 3 [Arabidopsis thaliana]
 gb|AEE31963.1| polypyrimidine tract-binding protein 3 [Arabidopsis thaliana]
Length=430

 Score =   162 bits (410),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 87/96 (91%), Gaps = 2/96 (2%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M E SKV+HVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDV SAV+ALQF
Sbjct  1    MAESSKVVHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVSSAVSALQF  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            +TNVQP+I  RNVY+QFSSHQELTT++QN   R DE
Sbjct  61   FTNVQPTI--RNVYVQFSSHQELTTIEQNIHGREDE  94



>ref|XP_006842980.1| hypothetical protein AMTR_s00076p00078090 [Amborella trichopoda]
 gb|ERN04655.1| hypothetical protein AMTR_s00076p00078090 [Amborella trichopoda]
Length=463

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 85/98 (87%), Gaps = 2/98 (2%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M EPSKVIH+RNVGHEISE+DL QL QPFG + K+VMLRAKNQALLQM DV SAVNALQ+
Sbjct  1    MVEPSKVIHIRNVGHEISEHDLHQLVQPFGAVMKVVMLRAKNQALLQMHDVASAVNALQY  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSR--GDE  370
            YT VQPSIRGRNVYIQFSSHQELTT DQN Q R  GD+
Sbjct  61   YTTVQPSIRGRNVYIQFSSHQELTTADQNGQGRNNGDQ  98



>ref|XP_009411927.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=422

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/87 (86%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M EPSKVIH+RNVGHEISENDLLQL QPFGV+TKLVMLRAKNQALLQM D+ SAVN LQ+
Sbjct  1    MAEPSKVIHIRNVGHEISENDLLQLVQPFGVVTKLVMLRAKNQALLQMHDLNSAVNVLQY  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMD  343
            YT+VQPS+RGRNVYIQFSSHQELTT D
Sbjct  61   YTSVQPSVRGRNVYIQFSSHQELTTTD  87



>ref|XP_009411926.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=445

 Score =   160 bits (404),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/87 (86%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M EPSKVIH+RNVGHEISENDLLQL QPFGV+TKLVMLRAKNQALLQM D+ SAVN LQ+
Sbjct  1    MAEPSKVIHIRNVGHEISENDLLQLVQPFGVVTKLVMLRAKNQALLQMHDLNSAVNVLQY  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMD  343
            YT+VQPS+RGRNVYIQFSSHQELTT D
Sbjct  61   YTSVQPSVRGRNVYIQFSSHQELTTTD  87



>gb|EEE55726.1| hypothetical protein OsJ_04208 [Oryza sativa Japonica Group]
Length=309

 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M EPSKVIH+RNVGHEISE++LLQ+ QPFG + KLVMLRAKNQAL+QM+D+ SAVN +Q+
Sbjct  1    MAEPSKVIHIRNVGHEISESELLQVVQPFGTVAKLVMLRAKNQALVQMEDLASAVNVIQY  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRG-DEVFKL*FNFKQTKVLY  415
            Y  +QPS+RGRNVY+Q+SSHQELTT DQ++  R  D+ FK  +N    KV Y
Sbjct  61   YNTIQPSVRGRNVYLQYSSHQELTT-DQSSHGRNPDQAFKPSYNISHVKVQY  111



>gb|AFW81821.1| hypothetical protein ZEAMMB73_476847 [Zea mays]
Length=339

 Score =   154 bits (388),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 90/97 (93%), Gaps = 1/97 (1%)
 Frame = +2

Query  80   KMTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQ  259
            +M+EPSKVIH+RNVGHEI+E+DLLQL QPFG+++K+VMLRAKNQALLQM+D+ ++V+ALQ
Sbjct  85   RMSEPSKVIHIRNVGHEIAESDLLQLLQPFGMVSKIVMLRAKNQALLQMEDLHASVSALQ  144

Query  260  FYTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            +YT+VQPSIRGRNVY+QFSSHQELTT DQ++  R  +
Sbjct  145  YYTSVQPSIRGRNVYMQFSSHQELTT-DQSSHGRNSD  180



>ref|XP_001761356.1| predicted protein [Physcomitrella patens]
 gb|EDQ73745.1| predicted protein [Physcomitrella patens]
Length=441

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKV+H+RNVG E++E+DLLQL Q FGV+ K+VMLRAKNQALLQMQDVPSA+N +Q+
Sbjct  1    MTEPSKVLHIRNVGPEVAESDLLQLAQSFGVVQKVVMLRAKNQALLQMQDVPSAINVMQY  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSR  361
            YT VQPS+RGRNVY+QFSSH+ELTT DQN Q+R
Sbjct  61   YTTVQPSVRGRNVYMQFSSHKELTTPDQNGQTR  93



>gb|KDP30748.1| hypothetical protein JCGZ_15177 [Jatropha curcas]
Length=434

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/77 (94%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +2

Query  140  NDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTNVQPSIRGRNVYIQFSS  319
            NDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSA+NALQFYTNVQP+IRGRNVY+QFSS
Sbjct  25   NDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAINALQFYTNVQPAIRGRNVYVQFSS  84

Query  320  HQELTTMDQNTQSRGDE  370
            HQELTTMDQN+Q RGDE
Sbjct  85   HQELTTMDQNSQGRGDE  101



>gb|EMS57308.1| Polypyrimidine tract-binding protein-like protein 3 [Triticum 
urartu]
Length=323

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 85/96 (89%), Gaps = 1/96 (1%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M EPSKVIH+RNVGHEI+E DLLQL QPFG ++KLVMLR KNQALLQMQD+ S+V+ALQ+
Sbjct  1    MAEPSKVIHIRNVGHEITEADLLQLLQPFGSVSKLVMLRGKNQALLQMQDIHSSVSALQY  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            Y+ VQPS+RGR+VY+QFSSHQELTT DQ++ SR  +
Sbjct  61   YSGVQPSVRGRHVYMQFSSHQELTT-DQSSHSRNSD  95



>ref|XP_002441164.1| hypothetical protein SORBIDRAFT_09g021560 [Sorghum bicolor]
 gb|EES19594.1| hypothetical protein SORBIDRAFT_09g021560 [Sorghum bicolor]
Length=444

 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 89/96 (93%), Gaps = 1/96 (1%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M+EPSKVIH+RNVGHEI+E+DLLQL QPFGV++K+VMLRAKNQALLQM+D+ ++V+ALQ+
Sbjct  1    MSEPSKVIHIRNVGHEIAESDLLQLLQPFGVVSKIVMLRAKNQALLQMEDIHASVSALQY  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            YT+VQPSIRGRNVY+QFSSHQELTT DQ++  R  +
Sbjct  61   YTSVQPSIRGRNVYMQFSSHQELTT-DQSSHGRNSD  95



>gb|AFW68313.1| hypothetical protein ZEAMMB73_143783 [Zea mays]
Length=251

 Score =   149 bits (377),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 89/98 (91%), Gaps = 3/98 (3%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQA--LLQMQDVPSAVNAL  256
            M+EPSKVIH+RNVGHEI+E+DLLQL QPFGV++K+VMLRAKNQA  LLQM+D+ ++V+AL
Sbjct  1    MSEPSKVIHIRNVGHEIAESDLLQLLQPFGVVSKIVMLRAKNQAQTLLQMEDIHASVSAL  60

Query  257  QFYTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            Q+YT+VQPSIRGRNVY+QFSSHQELTT DQ++  R  +
Sbjct  61   QYYTSVQPSIRGRNVYMQFSSHQELTT-DQSSHGRNSD  97



>ref|XP_008655270.1| PREDICTED: uncharacterized protein LOC100383343 isoform X1 [Zea 
mays]
 gb|AFW81820.1| hypothetical protein ZEAMMB73_476847 [Zea mays]
Length=529

 Score =   154 bits (389),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 90/97 (93%), Gaps = 1/97 (1%)
 Frame = +2

Query  80   KMTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQ  259
            +M+EPSKVIH+RNVGHEI+E+DLLQL QPFG+++K+VMLRAKNQALLQM+D+ ++V+ALQ
Sbjct  85   RMSEPSKVIHIRNVGHEIAESDLLQLLQPFGMVSKIVMLRAKNQALLQMEDLHASVSALQ  144

Query  260  FYTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            +YT+VQPSIRGRNVY+QFSSHQELTT DQ++  R  +
Sbjct  145  YYTSVQPSIRGRNVYMQFSSHQELTT-DQSSHGRNSD  180



>ref|XP_008644686.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X1 [Zea mays]
 ref|XP_008648139.1| PREDICTED: uncharacterized protein LOC100383701 isoform X1 [Zea 
mays]
 gb|AFW68314.1| hypothetical protein ZEAMMB73_143783 [Zea mays]
Length=445

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 88/96 (92%), Gaps = 1/96 (1%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M+EPSKVIH+RNVGHEI+E+DLLQL QPFGV++K+VMLRAKNQ LLQM+D+ ++V+ALQ+
Sbjct  1    MSEPSKVIHIRNVGHEIAESDLLQLLQPFGVVSKIVMLRAKNQTLLQMEDIHASVSALQY  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            YT+VQPSIRGRNVY+QFSSHQELTT DQ++  R  +
Sbjct  61   YTSVQPSIRGRNVYMQFSSHQELTT-DQSSHGRNSD  95



>ref|XP_008644687.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X2 [Zea mays]
 ref|XP_008648140.1| PREDICTED: uncharacterized protein LOC100383701 isoform X2 [Zea 
mays]
 gb|AFW68315.1| hypothetical protein ZEAMMB73_143783 [Zea mays]
 gb|AFW78164.1| hypothetical protein ZEAMMB73_011466 [Zea mays]
Length=444

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 88/96 (92%), Gaps = 1/96 (1%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M+EPSKVIH+RNVGHEI+E+DLLQL QPFGV++K+VMLRAKNQ LLQM+D+ ++V+ALQ+
Sbjct  1    MSEPSKVIHIRNVGHEIAESDLLQLLQPFGVVSKIVMLRAKNQTLLQMEDIHASVSALQY  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            YT+VQPSIRGRNVY+QFSSHQELTT DQ++  R  +
Sbjct  61   YTSVQPSIRGRNVYMQFSSHQELTT-DQSSHGRNSD  95



>gb|AFW78165.1| hypothetical protein ZEAMMB73_011466 [Zea mays]
Length=444

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 88/96 (92%), Gaps = 1/96 (1%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M+EPSKVIH+RNVGHEI+E+DLLQL QPFGV++K+VMLRAKNQ LLQM+D+ ++V+ALQ+
Sbjct  1    MSEPSKVIHIRNVGHEIAESDLLQLLQPFGVVSKIVMLRAKNQTLLQMEDIHASVSALQY  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            YT+VQPSIRGRNVY+QFSSHQELTT DQ++  R  +
Sbjct  61   YTSVQPSIRGRNVYMQFSSHQELTT-DQSSHGRNSD  95



>ref|NP_001169470.1| uncharacterized protein LOC100383343 [Zea mays]
 gb|ACN33854.1| unknown [Zea mays]
Length=444

 Score =   152 bits (385),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 89/96 (93%), Gaps = 1/96 (1%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M+EPSKVIH+RNVGHEI+E+DLLQL QPFG+++K+VMLRAKNQALLQM+D+ ++V+ALQ+
Sbjct  1    MSEPSKVIHIRNVGHEIAESDLLQLLQPFGMVSKIVMLRAKNQALLQMEDLHASVSALQY  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            YT+VQPSIRGRNVY+QFSSHQELTT DQ++  R  +
Sbjct  61   YTSVQPSIRGRNVYMQFSSHQELTT-DQSSHGRNSD  95



>gb|KGN45884.1| hypothetical protein Csa_6G017000 [Cucumis sativus]
Length=459

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 80/98 (82%), Gaps = 13/98 (13%)
 Frame = +2

Query  77   LKMTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNAL  256
             +MTEPSK             NDLLQLFQPFGVITKLVMLRAKNQAL+QMQDVPSAVNAL
Sbjct  27   FRMTEPSK-------------NDLLQLFQPFGVITKLVMLRAKNQALMQMQDVPSAVNAL  73

Query  257  QFYTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            QF+ N+QPSIRGRNVY+QFSSHQELTT DQN Q RGDE
Sbjct  74   QFFANLQPSIRGRNVYVQFSSHQELTTADQNAQGRGDE  111



>ref|XP_002973098.1| hypothetical protein SELMODRAFT_173175 [Selaginella moellendorffii]
 ref|XP_002976769.1| hypothetical protein SELMODRAFT_105564 [Selaginella moellendorffii]
 gb|EFJ22438.1| hypothetical protein SELMODRAFT_105564 [Selaginella moellendorffii]
 gb|EFJ25472.1| hypothetical protein SELMODRAFT_173175 [Selaginella moellendorffii]
Length=436

 Score =   151 bits (382),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 87/99 (88%), Gaps = 3/99 (3%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKV+HVRNVG EI+E+DLL L QPFG ++K+V+LR KNQALLQMQDV +A++A+Q+
Sbjct  1    MTEPSKVLHVRNVGQEITESDLLGLVQPFGSVSKMVLLRTKNQALLQMQDVNAAISAMQY  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSR---GDE  370
            YT+VQPS+RGRNVYIQFSSHQELTT DQ TQ R   GD+
Sbjct  61   YTSVQPSVRGRNVYIQFSSHQELTTSDQATQPRRPAGDQ  99



>ref|XP_004961956.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X1 [Setaria italica]
 ref|XP_004961957.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X2 [Setaria italica]
Length=444

 Score =   150 bits (380),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 87/96 (91%), Gaps = 1/96 (1%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M EPSKVIH+RNVGHEI+E+DLLQL QPFG+++K+VMLRAKNQALLQM+D+ ++V ALQ+
Sbjct  1    MAEPSKVIHIRNVGHEIAESDLLQLLQPFGLVSKIVMLRAKNQALLQMEDIHASVTALQY  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            Y++VQPS+RGRNVY+QFSSHQELTT DQ++  R  +
Sbjct  61   YSSVQPSVRGRNVYMQFSSHQELTT-DQSSHGRNSD  95



>ref|NP_001055652.1| Os05g0437300 [Oryza sativa Japonica Group]
 dbj|BAF17566.1| Os05g0437300 [Oryza sativa Japonica Group]
 dbj|BAG95704.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC79291.1| hypothetical protein OsI_20097 [Oryza sativa Indica Group]
 gb|EEE63848.1| hypothetical protein OsJ_18672 [Oryza sativa Japonica Group]
Length=444

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 85/96 (89%), Gaps = 1/96 (1%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M EPSKVIH+RNVGHEI+E DLLQL QPFG ++K+VMLRAKNQALLQMQD+ ++V+ALQ+
Sbjct  1    MAEPSKVIHIRNVGHEIAEADLLQLLQPFGNVSKIVMLRAKNQALLQMQDLHNSVSALQY  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            Y+ VQPS+RGRNVY+QFSSHQELTT DQN+  R  +
Sbjct  61   YSTVQPSVRGRNVYMQFSSHQELTT-DQNSHGRNSD  95



>ref|XP_003568375.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
[Brachypodium distachyon]
Length=444

 Score =   149 bits (377),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 84/96 (88%), Gaps = 1/96 (1%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M E SKVIH+RNVGHEI+E DLLQL QPFG ++K+VMLRAKNQALLQMQD+ S+V+ALQ+
Sbjct  1    MAEASKVIHIRNVGHEIAEADLLQLLQPFGAVSKIVMLRAKNQALLQMQDIHSSVSALQY  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            YT VQPS+RGRN+Y+QFSSHQELTT DQ++  R  +
Sbjct  61   YTTVQPSVRGRNIYMQFSSHQELTT-DQSSHGRNSD  95



>gb|ADE75620.1| unknown [Picea sitchensis]
Length=471

 Score =   149 bits (377),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 85/98 (87%), Gaps = 2/98 (2%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M EPSKV+H+RNVGHEISENDLL L Q FG++TKLVMLRAKNQALLQM  V +A++ALQ+
Sbjct  1    MAEPSKVLHIRNVGHEISENDLLNLVQQFGLVTKLVMLRAKNQALLQMHHVSAAIDALQY  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSR--GDE  370
            Y+ VQPS+RGRNVYIQFSSHQELTT++  T +R  GD+
Sbjct  61   YSTVQPSVRGRNVYIQFSSHQELTTVEHPTHARQSGDQ  98



>ref|XP_010680298.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010680300.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 [Beta 
vulgaris subsp. vulgaris]
Length=445

 Score =   149 bits (375),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 83/93 (89%), Gaps = 2/93 (2%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M+E SKVIHVRNVGHEI+ENDLLQL QPFG +TKLVMLR KNQALLQMQDV +A+N + +
Sbjct  1    MSETSKVIHVRNVGHEITENDLLQLVQPFGSVTKLVMLRTKNQALLQMQDVATAINLVDY  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSR  361
            YTNVQP++RGRNVY+QFSSHQELTT DQ TQ R
Sbjct  61   YTNVQPNVRGRNVYMQFSSHQELTT-DQ-TQGR  91



>ref|XP_010106865.1| Polypyrimidine tract-binding protein-3-like protein [Morus notabilis]
 gb|EXC12325.1| Polypyrimidine tract-binding protein-3-like protein [Morus notabilis]
Length=483

 Score =   149 bits (376),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 69/77 (90%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +2

Query  140  NDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTNVQPSIRGRNVYIQFSS  319
            NDLLQLFQPFGVITKLVMLRAKNQAL+QMQD+P AVNALQFY NVQP+IRGRNVY+QFSS
Sbjct  53   NDLLQLFQPFGVITKLVMLRAKNQALIQMQDIPPAVNALQFYANVQPAIRGRNVYVQFSS  112

Query  320  HQELTTMDQNTQSRGDE  370
            HQELTTMDQN Q RGDE
Sbjct  113  HQELTTMDQNAQGRGDE  129



>gb|ADE76165.1| unknown [Picea sitchensis]
Length=461

 Score =   149 bits (375),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 83/98 (85%), Gaps = 2/98 (2%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTE SKV+H+RNVG EISENDLLQL Q FG +TKLVMLRAKNQAL+QM D+PSA+  L  
Sbjct  1    MTEASKVLHIRNVGAEISENDLLQLVQRFGTVTKLVMLRAKNQALMQMNDIPSAITVLDH  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSR--GDE  370
            Y+ VQPSIRGRNVYIQFSSHQELTT +Q+ Q+R  GD+
Sbjct  61   YSTVQPSIRGRNVYIQFSSHQELTTTEQSGQARRNGDQ  98



>ref|XP_006654460.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X2 [Oryza brachyantha]
Length=444

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 84/96 (88%), Gaps = 1/96 (1%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M EPSKVIH+RNVGHEI+E DLLQL QPFG + K+VMLRAKNQALLQMQD+ ++V+ALQ+
Sbjct  1    MAEPSKVIHIRNVGHEIAEADLLQLLQPFGNVAKIVMLRAKNQALLQMQDLHNSVSALQY  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            Y+ VQPS+RGRNVY+QFSSHQELTT DQ++  R  +
Sbjct  61   YSAVQPSVRGRNVYMQFSSHQELTT-DQSSHGRNSD  95



>ref|XP_006654459.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X1 [Oryza brachyantha]
Length=445

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 84/96 (88%), Gaps = 1/96 (1%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M EPSKVIH+RNVGHEI+E DLLQL QPFG + K+VMLRAKNQALLQMQD+ ++V+ALQ+
Sbjct  1    MAEPSKVIHIRNVGHEIAEADLLQLLQPFGNVAKIVMLRAKNQALLQMQDLHNSVSALQY  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            Y+ VQPS+RGRNVY+QFSSHQELTT DQ++  R  +
Sbjct  61   YSAVQPSVRGRNVYMQFSSHQELTT-DQSSHGRNSD  95



>emb|CBH32581.1| RNA recognition domain containing protein [Triticum aestivum]
Length=277

 Score =   143 bits (360),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 82/93 (88%), Gaps = 1/93 (1%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M EPS+VIH+RNVGHEISE DLLQ+ QPFG + KLVMLR KNQAL+QM+D+ ++++A+Q+
Sbjct  1    MAEPSRVIHIRNVGHEISETDLLQVVQPFGAVAKLVMLRTKNQALVQMEDLSASISAIQY  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSR  361
            YT +QPS+RGRNVY+Q+SSHQELTT DQ++  R
Sbjct  61   YTTIQPSVRGRNVYLQYSSHQELTT-DQSSHGR  92



>gb|EEC71864.1| hypothetical protein OsI_04570 [Oryza sativa Indica Group]
Length=443

 Score =   145 bits (367),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 82/93 (88%), Gaps = 1/93 (1%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M EPSKVIH+RNVGHEISE++LLQ+ QPFG + KLVMLRAKNQAL+QM+D+ SAVN +Q+
Sbjct  1    MAEPSKVIHIRNVGHEISESELLQVVQPFGTVAKLVMLRAKNQALVQMEDLASAVNVIQY  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSR  361
            Y  +QPS+RGRNVY+Q+SSHQELTT DQ++  R
Sbjct  61   YNTIQPSVRGRNVYLQYSSHQELTT-DQSSHGR  92



>ref|XP_006665040.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
[Oryza brachyantha]
Length=443

 Score =   145 bits (366),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 82/93 (88%), Gaps = 1/93 (1%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M EPSKVIH+RNVGHEISE++LLQ+ QPFG + KLVMLRAKNQAL+QM+D+ SAVN +Q+
Sbjct  1    MGEPSKVIHIRNVGHEISESELLQVVQPFGTVAKLVMLRAKNQALVQMEDLASAVNVIQY  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSR  361
            Y  +QPS+RGRN+Y+QFSSHQELTT DQ++  R
Sbjct  61   YNTIQPSVRGRNIYLQFSSHQELTT-DQSSHGR  92



>gb|AIZ74340.1| polypyrimidine tract-binding protein [Pinus massoniana]
Length=465

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 84/98 (86%), Gaps = 3/98 (3%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTE SKV+H+RNVG EISENDLLQL Q FG +TKLVMLRAKNQAL+QM D+PSA++ L  
Sbjct  1    MTEASKVLHIRNVGAEISENDLLQLVQRFGTVTKLVMLRAKNQALMQMHDIPSAISVLDH  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSR--GDE  370
            Y+ VQPSIRGRNVYIQFSSHQELTT +Q+ Q+R  GD+
Sbjct  61   YSTVQPSIRGRNVYIQFSSHQELTT-EQSGQARRNGDQ  97



>ref|XP_003564696.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X2 [Brachypodium distachyon]
Length=443

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 84/93 (90%), Gaps = 1/93 (1%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M +PS+VIH+RNVGHEISE+DLLQ+ QPFG + KLVMLRAKNQAL+QM+D+ ++V+A+Q+
Sbjct  1    MGDPSRVIHIRNVGHEISESDLLQVVQPFGTVAKLVMLRAKNQALVQMEDLAASVSAIQY  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSR  361
            YT +QPS+RGRNVY+Q+SSHQELTT DQ++  R
Sbjct  61   YTTIQPSVRGRNVYLQYSSHQELTT-DQSSHGR  92



>gb|EMT30091.1| Polypyrimidine tract-binding protein-3-like protein [Aegilops 
tauschii]
Length=506

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 83/94 (88%), Gaps = 1/94 (1%)
 Frame = +2

Query  80   KMTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQ  259
            +M EPS+VIH+RNVGHEISE DLLQ+ QPFG + KLVMLR KNQAL+QM+D+ ++++A+Q
Sbjct  30   RMAEPSRVIHIRNVGHEISETDLLQVVQPFGAVAKLVMLRTKNQALVQMEDLSASISAIQ  89

Query  260  FYTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSR  361
            +YT +QPS+RGRNVY+Q+SSHQELTT DQ++  R
Sbjct  90   YYTTIQPSVRGRNVYLQYSSHQELTT-DQSSHGR  122



>emb|CBH32582.1| RNA recognition domain containing protein,expressed [Triticum 
aestivum]
 emb|CDM85150.1| unnamed protein product [Triticum aestivum]
Length=439

 Score =   144 bits (362),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 82/93 (88%), Gaps = 1/93 (1%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M EPS+VIH+RNVGHEISE DLLQ+ QPFG + KLVMLR KNQAL+QM+D+ ++++A+Q+
Sbjct  1    MAEPSRVIHIRNVGHEISETDLLQVVQPFGAVAKLVMLRTKNQALVQMEDLSASISAIQY  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSR  361
            YT +QPS+RGRNVY+Q+SSHQELTT DQ++  R
Sbjct  61   YTTIQPSVRGRNVYLQYSSHQELTT-DQSSHGR  92



>ref|XP_010232611.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X1 [Brachypodium distachyon]
Length=470

 Score =   144 bits (362),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 84/93 (90%), Gaps = 1/93 (1%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M +PS+VIH+RNVGHEISE+DLLQ+ QPFG + KLVMLRAKNQAL+QM+D+ ++V+A+Q+
Sbjct  1    MGDPSRVIHIRNVGHEISESDLLQVVQPFGTVAKLVMLRAKNQALVQMEDLAASVSAIQY  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSR  361
            YT +QPS+RGRNVY+Q+SSHQELTT DQ++  R
Sbjct  61   YTTIQPSVRGRNVYLQYSSHQELTT-DQSSHGR  92



>gb|EMS55211.1| Polypyrimidine tract-binding protein-like protein 3 [Triticum 
urartu]
Length=528

 Score =   144 bits (362),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 82/93 (88%), Gaps = 1/93 (1%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M EPS+VIH+RNVGHEISE DLLQ+ QPFG + KLVMLR KNQAL+QM+D+ ++++A+Q+
Sbjct  1    MAEPSRVIHIRNVGHEISETDLLQVVQPFGAVAKLVMLRTKNQALVQMEDLSASISAIQY  60

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSR  361
            YT +QPS+RGRNVY+Q+SSHQELTT DQ++  R
Sbjct  61   YTTIQPSVRGRNVYLQYSSHQELTT-DQSSHGR  92



>ref|NP_001044916.1| Os01g0867800 [Oryza sativa Japonica Group]
 dbj|BAF06830.1| Os01g0867800 [Oryza sativa Japonica Group]
 dbj|BAG91238.1| unnamed protein product [Oryza sativa Japonica Group]
Length=439

 Score =   134 bits (337),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 78/93 (84%), Gaps = 5/93 (5%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M EPSKVIH+RNVGHEISE++LLQ+ QPFG + KLVMLRAKN    QM+D+ SAVN +Q+
Sbjct  1    MAEPSKVIHIRNVGHEISESELLQVVQPFGTVAKLVMLRAKN----QMEDLASAVNVIQY  56

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSR  361
            Y  +QPS+RGRNVY+Q+SSHQELTT DQ++  R
Sbjct  57   YNTIQPSVRGRNVYLQYSSHQELTT-DQSSHGR  88



>gb|KEH25911.1| polypyrimidine tract-binding-like protein [Medicago truncatula]
Length=336

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 79/96 (82%), Gaps = 7/96 (7%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M EPSKVIHVRNVG EI+ENDLL LFQPFGVITKL++LRAKN      Q++PSA+ A++F
Sbjct  1    MAEPSKVIHVRNVGPEIAENDLLLLFQPFGVITKLMVLRAKN------QNIPSAIRAVEF  54

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            Y N QPSIRGRN+Y+QFSSH+ +T+ +Q +Q R DE
Sbjct  55   YANAQPSIRGRNLYVQFSSHRVITSANQ-SQGREDE  89



>gb|AAV59307.1| putative polypyrimidine track-binding protein [Oryza sativa Japonica 
Group]
Length=389

 Score =   129 bits (323),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 77/96 (80%), Gaps = 9/96 (9%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            M EPSKVIH+RNVGHEI+E DLLQL QPFG ++K+        ALLQMQD+ ++V+ALQ+
Sbjct  1    MAEPSKVIHIRNVGHEIAEADLLQLLQPFGNVSKI--------ALLQMQDLHNSVSALQY  52

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            Y+ VQPS+RGRNVY+QFSSHQELTT DQN+  R  +
Sbjct  53   YSTVQPSVRGRNVYMQFSSHQELTT-DQNSHGRNSD  87



>ref|XP_009621583.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X2 [Nicotiana tomentosiformis]
Length=407

 Score =   120 bits (301),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 56/60 (93%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +2

Query  191  MLRAKNQALLQMQDVPSAVNALQFYTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            MLRAKNQALLQMQDVPSAVNALQFY+NVQPSIRGRNVY+QFSSHQELTTMDQN+Q RGDE
Sbjct  1    MLRAKNQALLQMQDVPSAVNALQFYSNVQPSIRGRNVYVQFSSHQELTTMDQNSQGRGDE  60



>ref|XP_004138370.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform 2 [Cucumis sativus]
Length=408

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +2

Query  191  MLRAKNQALLQMQDVPSAVNALQFYTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            MLRAKNQAL+QMQDVPSAVNALQF+ N+QPSIRGRNVY+QFSSHQELTT DQN Q RGDE
Sbjct  1    MLRAKNQALMQMQDVPSAVNALQFFANLQPSIRGRNVYVQFSSHQELTTADQNAQGRGDE  60



>ref|XP_003632518.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X2 [Vitis vinifera]
Length=412

 Score =   107 bits (266),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 57/61 (93%), Gaps = 1/61 (2%)
 Frame = +2

Query  191  MLRAKNQALLQMQDVPSAVNALQFYTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSR-GD  367
            MLRAKNQALLQMQDV SAV+ALQ+Y NVQPS+RGRNVY+QFSSHQELTTMDQN+Q R GD
Sbjct  1    MLRAKNQALLQMQDVASAVSALQYYANVQPSVRGRNVYVQFSSHQELTTMDQNSQGRKGD  60

Query  368  E  370
            +
Sbjct  61   Q  61



>ref|XP_001759167.1| predicted protein [Physcomitrella patens]
 gb|EDQ75851.1| predicted protein [Physcomitrella patens]
Length=410

 Score =   106 bits (264),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 64/93 (69%), Gaps = 23/93 (25%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            MTEPSKV+H+RNVG EI+E                       QALLQMQD+PSA+N +Q+
Sbjct  1    MTEPSKVLHIRNVGPEIAE-----------------------QALLQMQDIPSAINLMQY  37

Query  263  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSR  361
            YT VQPS+RGRNVY+QFSSH ELTT DQ+ Q+R
Sbjct  38   YTTVQPSVRGRNVYMQFSSHPELTTPDQSGQTR  70



>ref|XP_003592083.1| Polypyrimidine tract-binding protein-like protein [Medicago truncatula]
Length=407

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 55/60 (92%), Gaps = 1/60 (2%)
 Frame = +2

Query  191  MLRAKNQALLQMQDVPSAVNALQFYTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            MLRAKNQAL+QMQDVPSAV+AL FY N QPSIRGRNVY+QFSSHQELTT+DQ +Q RGDE
Sbjct  1    MLRAKNQALIQMQDVPSAVSALHFYGNTQPSIRGRNVYVQFSSHQELTTIDQ-SQGRGDE  59



>ref|XP_004337140.1| protein kinase domain containing protein [Acanthamoeba castellanii 
str. Neff]
 gb|ELR15127.1| protein kinase domain containing protein [Acanthamoeba castellanii 
str. Neff]
Length=515

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 62/81 (77%), Gaps = 0/81 (0%)
 Frame = +2

Query  92   PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  271
            PSKV+H RNV  E+++ D+++L  PFG + K+VML +KNQALL+  D+ +A++   FY +
Sbjct  163  PSKVLHFRNVTSELTQEDIMELAAPFGTVEKVVMLTSKNQALLEFADIAAAISMSNFYLS  222

Query  272  VQPSIRGRNVYIQFSSHQELT  334
             QP+IRGR VY++FS HQ+LT
Sbjct  223  TQPNIRGRKVYMRFSRHQQLT  243



>ref|XP_003619163.1| Polypyrimidine tract-binding protein-like protein [Medicago truncatula]
Length=318

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 53/60 (88%), Gaps = 1/60 (2%)
 Frame = +2

Query  191  MLRAKNQALLQMQDVPSAVNALQFYTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  370
            MLRAKNQAL+QMQDV SA +A+QFY N QPSIRGRNVY+QFSSH+ELTTMDQN Q R DE
Sbjct  1    MLRAKNQALVQMQDVASADSAIQFYINSQPSIRGRNVYVQFSSHRELTTMDQN-QGREDE  59



>ref|XP_002433623.1| polypyrimidine tract binding protein, putative [Ixodes scapularis]
 gb|EEC05023.1| polypyrimidine tract binding protein, putative, partial [Ixodes 
scapularis]
Length=512

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = +2

Query  83   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  262
            + +PS+V+H+RN+ ++ ++ D++ L  PFG +T ++ L+ KNQA L+M D  SAV+ + +
Sbjct  45   LGKPSRVVHIRNIPNDATDTDIVHLGIPFGKVTNVLQLKGKNQAFLEMSDEASAVSMVDY  104

Query  263  YTNVQPSIRGRNVYIQFSSHQELTT  337
            +T   P++RGR VY+QFS+H+EL T
Sbjct  105  FTKASPTVRGRVVYVQFSNHRELKT  129



>pdb|1SJQ|A Chain A, Nmr Structure Of Rrm1 From Human Polypyrimidine Tract 
Binding Protein Isoform 1 (Ptb1)
Length=105

 Score = 86.7 bits (213),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 62/91 (68%), Gaps = 0/91 (0%)
 Frame = +2

Query  92   PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  271
            PS+VIH+R +  +++E +++ L  PFG +T L+ML+ KNQA ++M    +A   + +YT+
Sbjct  15   PSRVIHIRKLPIDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTS  74

Query  272  VQPSIRGRNVYIQFSSHQELTTMDQNTQSRG  364
            V P +RG+ +YIQFS+H+EL T     Q+R 
Sbjct  75   VTPVLRGQPIYIQFSNHKELKTDSSPNQARA  105



>ref|XP_001663911.1| AAEL013723-PA [Aedes aegypti]
 gb|EAT34016.1| AAEL013723-PA [Aedes aegypti]
Length=539

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 65/91 (71%), Gaps = 1/91 (1%)
 Frame = +2

Query  77   LKMTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNAL  256
            L + +PS+V+H+RN+ +E SE D++ L  PFG +T +++L+ KNQA L+M D  +A + +
Sbjct  8    LSVPKPSRVVHIRNIPNESSEVDVMHLGVPFGRVTNVLVLKGKNQAFLEMADETAATSMV  67

Query  257  QFYTNVQPSIRGRNVYIQFSSHQELTTMDQN  349
              +T   P +RGR VY+QFS+H+EL T DQN
Sbjct  68   TMFTATPPIVRGRTVYVQFSNHRELKT-DQN  97



>pdb|2AD9|A Chain A, Solution Structure Of Polypyrimidine Tract Binding Protein 
Rbd1 Complexed With Cucucu Rna
Length=119

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 62/90 (69%), Gaps = 0/90 (0%)
 Frame = +2

Query  92   PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  271
            PS+VIH+R +  +++E +++ L  PFG +T L+ML+ KNQA ++M    +A   + +YT+
Sbjct  30   PSRVIHIRKLPIDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTS  89

Query  272  VQPSIRGRNVYIQFSSHQELTTMDQNTQSR  361
            V P +RG+ +YIQFS+H+EL T     Q+R
Sbjct  90   VTPVLRGQPIYIQFSNHKELKTDSSPNQAR  119



>ref|XP_001848742.1| polypyrimidine tract binding protein [Culex quinquefasciatus]
 gb|EDS28948.1| polypyrimidine tract binding protein [Culex quinquefasciatus]
Length=572

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 64/88 (73%), Gaps = 1/88 (1%)
 Frame = +2

Query  86   TEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFY  265
            ++PS+V+H+RN+ +E SE D++ L  PFG +T +++L+ KNQA L+M D  +A + +  +
Sbjct  20   SKPSRVVHIRNIPNESSEVDVMHLGVPFGRVTNVLVLKGKNQAFLEMADESAATSMVTMF  79

Query  266  TNVQPSIRGRNVYIQFSSHQELTTMDQN  349
            T   P +RGR VY+QFS+H+EL T DQN
Sbjct  80   TATPPIVRGRTVYVQFSNHRELKT-DQN  106



>ref|XP_001636058.1| predicted protein [Nematostella vectensis]
 gb|EDO43995.1| predicted protein, partial [Nematostella vectensis]
Length=470

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = +2

Query  92   PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  271
            PSKV+H+RNV  E ++ +++ L  P+G +T ++ML+ KNQA L+M+   +A+  +  Y+ 
Sbjct  1    PSKVLHLRNVAAEATDAEIIALGIPYGRVTNVLMLKGKNQAFLEMKTKENAMALMNSYSY  60

Query  272  VQPSIRGRNVYIQFSSHQELTT  337
            + PSIRGR +YIQ+S+HQELTT
Sbjct  61   IPPSIRGRQIYIQYSNHQELTT  82



>ref|XP_001842351.1| polypyrimidine tract binding protein [Culex quinquefasciatus]
 gb|EDS42784.1| polypyrimidine tract binding protein [Culex quinquefasciatus]
Length=535

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 41/87 (47%), Positives = 63/87 (72%), Gaps = 1/87 (1%)
 Frame = +2

Query  89   EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  268
            +PS+V+H+RN+ +E SE D++ L  PFG +T +++L+ KNQA L+M D  +A + +  +T
Sbjct  20   KPSRVVHIRNIPNESSEVDVMHLGVPFGRVTNVLVLKGKNQAFLEMADESAATSMVTMFT  79

Query  269  NVQPSIRGRNVYIQFSSHQELTTMDQN  349
               P +RGR VY+QFS+H+EL T DQN
Sbjct  80   ATPPIVRGRTVYVQFSNHRELKT-DQN  105



>gb|KFM66418.1| Polypyrimidine tract-binding protein 2, partial [Stegodyphus 
mimosarum]
Length=501

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 60/84 (71%), Gaps = 1/84 (1%)
 Frame = +2

Query  89   EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  268
            +PS+V+H+RNV  + +E D++ L   FG +T +++L+ KNQA L+M D  SA + + +Y 
Sbjct  62   KPSRVVHIRNVSSDATETDIIHLGIAFGRVTNVLLLKGKNQAFLEMSDEASATSMVNYYA  121

Query  269  NV-QPSIRGRNVYIQFSSHQELTT  337
            N   P +RGRNVY+QFS+H+EL T
Sbjct  122  NSGAPYVRGRNVYVQFSNHKELKT  145



>ref|XP_010753398.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X3 [Larimichthys crocea]
Length=508

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 63/96 (66%), Gaps = 0/96 (0%)
 Frame = +2

Query  92   PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  271
            PS+VIH+R + ++I+E +++ L  PFG +T L+ML+AKNQA L+M    +A N + +Y+ 
Sbjct  23   PSRVIHIRKLPNDIAETEVISLGLPFGDVTNLLMLKAKNQAFLEMNSEEAAQNMVSYYST  82

Query  272  VQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEVFK  379
            V P IR   VY+QFS+H+EL T +   Q R     +
Sbjct  83   VMPIIRHHPVYVQFSNHKELKTDNSPNQERAQAALR  118



>gb|EDL31649.1| mCG13402, isoform CRA_f [Mus musculus]
Length=257

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +2

Query  92   PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  271
            PS+VIHVR +  +++E +++ L  PFG +T L+ML+ KNQA ++M    +A   + +YT+
Sbjct  83   PSRVIHVRKLPSDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTS  142

Query  272  VQPSIRGRNVYIQFSSHQELTT  337
            V P +RG+ +YIQFS+H+EL T
Sbjct  143  VAPVLRGQPIYIQFSNHKELKT  164



>ref|XP_010753397.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X2 [Larimichthys crocea]
Length=532

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 63/96 (66%), Gaps = 0/96 (0%)
 Frame = +2

Query  92   PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  271
            PS+VIH+R + ++I+E +++ L  PFG +T L+ML+AKNQA L+M    +A N + +Y+ 
Sbjct  53   PSRVIHIRKLPNDIAETEVISLGLPFGDVTNLLMLKAKNQAFLEMNSEEAAQNMVSYYST  112

Query  272  VQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEVFK  379
            V P IR   VY+QFS+H+EL T +   Q R     +
Sbjct  113  VMPIIRHHPVYVQFSNHKELKTDNSPNQERAQAALR  148



>ref|XP_010753396.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X1 [Larimichthys crocea]
Length=538

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 63/96 (66%), Gaps = 0/96 (0%)
 Frame = +2

Query  92   PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  271
            PS+VIH+R + ++I+E +++ L  PFG +T L+ML+AKNQA L+M    +A N + +Y+ 
Sbjct  53   PSRVIHIRKLPNDIAETEVISLGLPFGDVTNLLMLKAKNQAFLEMNSEEAAQNMVSYYST  112

Query  272  VQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEVFK  379
            V P IR   VY+QFS+H+EL T +   Q R     +
Sbjct  113  VMPIIRHHPVYVQFSNHKELKTDNSPNQERAQAALR  148



>ref|XP_004479297.1| PREDICTED: polypyrimidine tract-binding protein 1-like [Dasypus 
novemcinctus]
Length=247

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +2

Query  92   PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  271
            PS+VIHVR +  +++E +++ L  PFG +T L+ML+ KNQA ++M    +A   + +YT+
Sbjct  57   PSRVIHVRKLPGDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTLVNYYTS  116

Query  272  VQPSIRGRNVYIQFSSHQELTT  337
            V P +RG+ VYIQFS+H+EL T
Sbjct  117  VTPVLRGQPVYIQFSNHKELKT  138



>ref|XP_008560051.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X5 
[Microplitis demolitor]
Length=537

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +2

Query  89   EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  268
            +PS+VIH+RN+  E+SE++++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y 
Sbjct  15   KPSRVIHIRNIASEVSESEIINLGMPFGRVTNVLVLKGKNQAFLEMADENAATTMVGYYA  74

Query  269  NVQPSIRGRNVYIQFSSHQELTT  337
            +   ++RGR VY+Q+S+H+EL T
Sbjct  75   SSGAALRGRAVYVQYSNHRELKT  97



>ref|XP_004711004.1| PREDICTED: polypyrimidine tract-binding protein 3 isoform X1 
[Echinops telfairi]
Length=524

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 70/113 (62%), Gaps = 1/113 (1%)
 Frame = +2

Query  86   TEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFY  265
              PS+V+H+R + ++++E +++ L  PFG +T L+ML+ KNQA L+M    +AV  + +Y
Sbjct  27   CSPSRVLHLRKIPNDVTEAEVISLGLPFGKVTNLLMLKGKNQAFLEMASEEAAVTMVNYY  86

Query  266  TNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEVFKL*FNFKQTKVLYLQG  424
            T V P +R + VYIQ+S+H+EL T +   Q+R     +   N  Q+  L L G
Sbjct  87   TPVTPHLRSQPVYIQYSNHRELKTDNLPNQARAHAALQA-VNAAQSGSLALSG  138



>gb|ADN84938.1| hephaestus [Biston betularia]
Length=181

 Score = 85.1 bits (209),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 62/86 (72%), Gaps = 1/86 (1%)
 Frame = +2

Query  89   EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  268
            +PS+VIH+RN+ +E +E +++QL  PFG +T +++L+ KNQA L+M +  SAV  + ++ 
Sbjct  9    KPSRVIHIRNIPNETTEAEIIQLGLPFGRVTNVLVLKGKNQAFLEMAEEISAVAMVAYFG  68

Query  269  NVQPSIRGRNVYIQFSSHQELTTMDQ  346
                 +RGR VY+QFS+H+EL T DQ
Sbjct  69   GCVAQLRGRAVYVQFSNHKELKT-DQ  93



>ref|XP_004711005.1| PREDICTED: polypyrimidine tract-binding protein 3 isoform X2 
[Echinops telfairi]
Length=521

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 70/113 (62%), Gaps = 1/113 (1%)
 Frame = +2

Query  86   TEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFY  265
              PS+V+H+R + ++++E +++ L  PFG +T L+ML+ KNQA L+M    +AV  + +Y
Sbjct  24   CSPSRVLHLRKIPNDVTEAEVISLGLPFGKVTNLLMLKGKNQAFLEMASEEAAVTMVNYY  83

Query  266  TNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEVFKL*FNFKQTKVLYLQG  424
            T V P +R + VYIQ+S+H+EL T +   Q+R     +   N  Q+  L L G
Sbjct  84   TPVTPHLRSQPVYIQYSNHRELKTDNLPNQARAHAALQA-VNAAQSGSLALSG  135



>dbj|BAC40161.1| unnamed protein product [Mus musculus]
Length=299

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +2

Query  92   PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  271
            PS+VIHVR +  +++E +++ L  PFG +T L+ML+ KNQA ++M    +A   + +YT+
Sbjct  56   PSRVIHVRKLPSDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTS  115

Query  272  VQPSIRGRNVYIQFSSHQELTT  337
            V P +RG+ +YIQFS+H+EL T
Sbjct  116  VAPVLRGQPIYIQFSNHKELKT  137



>ref|XP_008560049.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X3 
[Microplitis demolitor]
Length=587

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +2

Query  89   EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  268
            +PS+VIH+RN+  E+SE++++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y 
Sbjct  65   KPSRVIHIRNIASEVSESEIINLGMPFGRVTNVLVLKGKNQAFLEMADENAATTMVGYYA  124

Query  269  NVQPSIRGRNVYIQFSSHQELTT  337
            +   ++RGR VY+Q+S+H+EL T
Sbjct  125  SSGAALRGRAVYVQYSNHRELKT  147



>ref|XP_008560046.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X1 
[Microplitis demolitor]
 ref|XP_008560047.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X1 
[Microplitis demolitor]
Length=595

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +2

Query  89   EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  268
            +PS+VIH+RN+  E+SE++++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y 
Sbjct  73   KPSRVIHIRNIASEVSESEIINLGMPFGRVTNVLVLKGKNQAFLEMADENAATTMVGYYA  132

Query  269  NVQPSIRGRNVYIQFSSHQELTT  337
            +   ++RGR VY+Q+S+H+EL T
Sbjct  133  SSGAALRGRAVYVQYSNHRELKT  155



>ref|XP_008560048.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X2 
[Microplitis demolitor]
Length=591

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +2

Query  89   EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  268
            +PS+VIH+RN+  E+SE++++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y 
Sbjct  73   KPSRVIHIRNIASEVSESEIINLGMPFGRVTNVLVLKGKNQAFLEMADENAATTMVGYYA  132

Query  269  NVQPSIRGRNVYIQFSSHQELTT  337
            +   ++RGR VY+Q+S+H+EL T
Sbjct  133  SSGAALRGRAVYVQYSNHRELKT  155



>ref|XP_008560050.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X4 
[Microplitis demolitor]
Length=581

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +2

Query  89   EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  268
            +PS+VIH+RN+  E+SE++++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y 
Sbjct  73   KPSRVIHIRNIASEVSESEIINLGMPFGRVTNVLVLKGKNQAFLEMADENAATTMVGYYA  132

Query  269  NVQPSIRGRNVYIQFSSHQELTT  337
            +   ++RGR VY+Q+S+H+EL T
Sbjct  133  SSGAALRGRAVYVQYSNHRELKT  155



>ref|XP_008509748.1| PREDICTED: polypyrimidine tract-binding protein 1-like [Equus 
przewalskii]
Length=330

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = +2

Query  92   PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  271
            PS+VIH+R + ++++E +++ L  PFG +T L+ML+ KNQA ++M    +A   + +YT+
Sbjct  81   PSRVIHIRKLPNDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTS  140

Query  272  VQPSIRGRNVYIQFSSHQELTT  337
            V P +RG+ +YIQFS+H+EL T
Sbjct  141  VTPVLRGQPIYIQFSNHKELKT  162



>ref|XP_002156158.1| PREDICTED: polypyrimidine tract-binding protein 3-like [Hydra 
vulgaris]
Length=494

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 62/92 (67%), Gaps = 0/92 (0%)
 Frame = +2

Query  92   PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  271
            PSKVIH+R +  + +E ++  L  PFG +T ++++R+K+QA L++QDV  A   + +YT 
Sbjct  30   PSKVIHIRQIPMDATEPEIKSLGLPFGEVTNMLLMRSKSQAFLELQDVDCAKTMINYYTY  89

Query  272  VQPSIRGRNVYIQFSSHQELTTMDQNTQSRGD  367
            V P+IR + V++QFS HQEL T +QN     D
Sbjct  90   VSPTIRNQPVFLQFSQHQELRTNNQNNHRDSD  121



>ref|XP_004524390.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X10 [Ceratitis capitata]
Length=571

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +2

Query  89   EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  268
            +PSKVIH+RN+  E SE+D++ L  PFG +T +++L+ KNQA L+M D  SA + +  YT
Sbjct  43   KPSKVIHLRNIPIESSESDVISLGVPFGRVTNVLVLKGKNQAFLEMADEISATSMVSCYT  102

Query  269  NVQPSIRGRNVYIQFSSHQELTT  337
               P +RGR VY+Q+S+H+EL T
Sbjct  103  VTPPHMRGRMVYVQYSNHRELKT  125



>gb|EDL31650.1| mCG13402, isoform CRA_g [Mus musculus]
Length=366

 Score = 86.3 bits (212),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +2

Query  92   PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  271
            PS+VIHVR +  +++E +++ L  PFG +T L+ML+ KNQA ++M    +A   + +YT+
Sbjct  56   PSRVIHVRKLPSDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTS  115

Query  272  VQPSIRGRNVYIQFSSHQELTT  337
            V P +RG+ +YIQFS+H+EL T
Sbjct  116  VAPVLRGQPIYIQFSNHKELKT  137



>ref|XP_004524381.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X1 [Ceratitis capitata]
 ref|XP_004524382.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X2 [Ceratitis capitata]
 ref|XP_004524383.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X3 [Ceratitis capitata]
 ref|XP_004524384.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X4 [Ceratitis capitata]
 ref|XP_004524385.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X5 [Ceratitis capitata]
Length=616

 Score = 88.2 bits (217),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +2

Query  89   EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  268
            +PSKVIH+RN+  E SE+D++ L  PFG +T +++L+ KNQA L+M D  SA + +  YT
Sbjct  88   KPSKVIHLRNIPIESSESDVISLGVPFGRVTNVLVLKGKNQAFLEMADEISATSMVSCYT  147

Query  269  NVQPSIRGRNVYIQFSSHQELTT  337
               P +RGR VY+Q+S+H+EL T
Sbjct  148  VTPPHMRGRMVYVQYSNHRELKT  170



>ref|XP_004524387.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X7 [Ceratitis capitata]
 ref|XP_004524388.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X8 [Ceratitis capitata]
 ref|XP_004524389.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X9 [Ceratitis capitata]
Length=599

 Score = 88.2 bits (217),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +2

Query  89   EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  268
            +PSKVIH+RN+  E SE+D++ L  PFG +T +++L+ KNQA L+M D  SA + +  YT
Sbjct  71   KPSKVIHLRNIPIESSESDVISLGVPFGRVTNVLVLKGKNQAFLEMADEISATSMVSCYT  130

Query  269  NVQPSIRGRNVYIQFSSHQELTT  337
               P +RGR VY+Q+S+H+EL T
Sbjct  131  VTPPHMRGRMVYVQYSNHRELKT  153



>ref|XP_004524386.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X6 [Ceratitis capitata]
Length=612

 Score = 88.2 bits (217),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +2

Query  89   EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  268
            +PSKVIH+RN+  E SE+D++ L  PFG +T +++L+ KNQA L+M D  SA + +  YT
Sbjct  88   KPSKVIHLRNIPIESSESDVISLGVPFGRVTNVLVLKGKNQAFLEMADEISATSMVSCYT  147

Query  269  NVQPSIRGRNVYIQFSSHQELTT  337
               P +RGR VY+Q+S+H+EL T
Sbjct  148  VTPPHMRGRMVYVQYSNHRELKT  170



>gb|ELV09317.1| Polypyrimidine tract-binding protein 1, partial [Tupaia chinensis]
Length=522

 Score = 87.8 bits (216),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 63/92 (68%), Gaps = 0/92 (0%)
 Frame = +2

Query  92   PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  271
            PS+VIH+R +  +++E +++ L  PFG +T L+ML+ KNQA ++M    +A   + +YT+
Sbjct  45   PSRVIHIRKLPSDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNAEEAANTMVNYYTS  104

Query  272  VQPSIRGRNVYIQFSSHQELTTMDQNTQSRGD  367
            V P +RG+ +YIQFS+H+EL T     Q+ G+
Sbjct  105  VTPVLRGQPIYIQFSNHKELKTDSSPNQASGN  136



>ref|XP_007075804.1| PREDICTED: polypyrimidine tract-binding protein 1-like, partial 
[Panthera tigris altaica]
Length=351

 Score = 85.9 bits (211),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +2

Query  92   PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  271
            PS+VIH+R +  +++E +++ L  PFG +T L+ML+ KNQA ++M    +A   + +YT+
Sbjct  59   PSRVIHIRKLPSDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTS  118

Query  272  VQPSIRGRNVYIQFSSHQELTT  337
            V P +RG+ +YIQFS+H+EL T
Sbjct  119  VTPVLRGQPIYIQFSNHKELKT  140



>gb|EDL32215.1| mCG50057 [Mus musculus]
Length=253

 Score = 85.1 bits (209),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = +2

Query  92   PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  271
            PS+VIHVR +  +++E +++ L  PFG +T L+ML+ KNQA  +M    +A   + +YT+
Sbjct  67   PSRVIHVRKLPSDVTEGEVISLGLPFGKVTNLLMLKGKNQAFTEMNTEETANTMVNYYTS  126

Query  272  VQPSIRGRNVYIQFSSHQELTT  337
            V P +RG+ +YIQFS+H+EL T
Sbjct  127  VAPVLRGQPIYIQFSNHKELET  148



>ref|XP_011330848.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X9 
[Cerapachys biroi]
Length=601

 Score = 87.8 bits (216),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +2

Query  89   EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  268
            +PS+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y 
Sbjct  68   KPSRVIHIRNIPNEVSEAEIIHLGLPFGRVTNVLVLKGKNQAFLEMADESAAATMVTYYA  127

Query  269  NVQPSIRGRNVYIQFSSHQELTT  337
            +    +RGR VY+QFS+H+EL T
Sbjct  128  SGMAQLRGRAVYVQFSNHRELKT  150



>ref|XP_011330847.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X8 
[Cerapachys biroi]
Length=607

 Score = 87.8 bits (216),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +2

Query  89   EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  268
            +PS+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y 
Sbjct  74   KPSRVIHIRNIPNEVSEAEIIHLGLPFGRVTNVLVLKGKNQAFLEMADESAAATMVTYYA  133

Query  269  NVQPSIRGRNVYIQFSSHQELTT  337
            +    +RGR VY+QFS+H+EL T
Sbjct  134  SGMAQLRGRAVYVQFSNHRELKT  156



>ref|XP_011330851.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X12 
[Cerapachys biroi]
 ref|XP_011330852.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X12 
[Cerapachys biroi]
Length=579

 Score = 87.8 bits (216),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +2

Query  89   EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  268
            +PS+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y 
Sbjct  46   KPSRVIHIRNIPNEVSEAEIIHLGLPFGRVTNVLVLKGKNQAFLEMADESAAATMVTYYA  105

Query  269  NVQPSIRGRNVYIQFSSHQELTT  337
            +    +RGR VY+QFS+H+EL T
Sbjct  106  SGMAQLRGRAVYVQFSNHRELKT  128



>ref|XP_011330849.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X10 
[Cerapachys biroi]
Length=601

 Score = 87.8 bits (216),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +2

Query  89   EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  268
            +PS+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y 
Sbjct  68   KPSRVIHIRNIPNEVSEAEIIHLGLPFGRVTNVLVLKGKNQAFLEMADESAAATMVTYYA  127

Query  269  NVQPSIRGRNVYIQFSSHQELTT  337
            +    +RGR VY+QFS+H+EL T
Sbjct  128  SGMAQLRGRAVYVQFSNHRELKT  150



>ref|XP_011293652.1| PREDICTED: polypyrimidine tract-binding protein 2 [Musca domestica]
Length=631

 Score = 87.8 bits (216),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 62/87 (71%), Gaps = 1/87 (1%)
 Frame = +2

Query  89   EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  268
            +PSKVIH+RN+ +E S+ D++ L  PFG +T +++L+ KNQA L+M D  SA + +  Y 
Sbjct  95   KPSKVIHLRNIPNESSDADVIALGVPFGRVTNVLVLKGKNQAFLEMADEVSATSMVSCYN  154

Query  269  NVQPSIRGRNVYIQFSSHQELTTMDQN  349
               P +RGR VY+QFS+H+EL T DQN
Sbjct  155  VNPPQMRGRMVYVQFSNHRELKT-DQN  180



>ref|XP_011330846.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X7 
[Cerapachys biroi]
Length=619

 Score = 87.8 bits (216),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +2

Query  89   EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  268
            +PS+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y 
Sbjct  86   KPSRVIHIRNIPNEVSEAEIIHLGLPFGRVTNVLVLKGKNQAFLEMADESAAATMVTYYA  145

Query  269  NVQPSIRGRNVYIQFSSHQELTT  337
            +    +RGR VY+QFS+H+EL T
Sbjct  146  SGMAQLRGRAVYVQFSNHRELKT  168



>ref|XP_008212875.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X5 
[Nasonia vitripennis]
 ref|XP_008212876.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X5 
[Nasonia vitripennis]
 ref|XP_008212877.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X5 
[Nasonia vitripennis]
 ref|XP_008212878.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X5 
[Nasonia vitripennis]
Length=572

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +2

Query  89   EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  268
            +PS+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  SA   + +  
Sbjct  56   KPSRVIHIRNIPNEVSEGEIIHLGMPFGRVTNVLVLKGKNQAFLEMADEGSAATMVTYCA  115

Query  269  NVQPSIRGRNVYIQFSSHQELTT  337
            +    +RGR VY+QFS+H+EL T
Sbjct  116  SCPAQLRGRAVYVQFSNHRELKT  138



>ref|XP_011330850.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X11 
[Cerapachys biroi]
Length=589

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +2

Query  89   EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  268
            +PS+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y 
Sbjct  56   KPSRVIHIRNIPNEVSEAEIIHLGLPFGRVTNVLVLKGKNQAFLEMADESAAATMVTYYA  115

Query  269  NVQPSIRGRNVYIQFSSHQELTT  337
            +    +RGR VY+QFS+H+EL T
Sbjct  116  SGMAQLRGRAVYVQFSNHRELKT  138



>ref|XP_008212882.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X9 
[Nasonia vitripennis]
Length=562

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +2

Query  89   EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  268
            +PS+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  SA   + +  
Sbjct  46   KPSRVIHIRNIPNEVSEGEIIHLGMPFGRVTNVLVLKGKNQAFLEMADEGSAATMVTYCA  105

Query  269  NVQPSIRGRNVYIQFSSHQELTT  337
            +    +RGR VY+QFS+H+EL T
Sbjct  106  SCPAQLRGRAVYVQFSNHRELKT  128



>ref|XP_011330853.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X13 
[Cerapachys biroi]
Length=560

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +2

Query  89   EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  268
            +PS+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y 
Sbjct  27   KPSRVIHIRNIPNEVSEAEIIHLGLPFGRVTNVLVLKGKNQAFLEMADESAAATMVTYYA  86

Query  269  NVQPSIRGRNVYIQFSSHQELTT  337
            +    +RGR VY+QFS+H+EL T
Sbjct  87   SGMAQLRGRAVYVQFSNHRELKT  109



>ref|XP_008212879.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X6 
[Nasonia vitripennis]
Length=568

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +2

Query  89   EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  268
            +PS+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  SA   + +  
Sbjct  52   KPSRVIHIRNIPNEVSEGEIIHLGMPFGRVTNVLVLKGKNQAFLEMADEGSAATMVTYCA  111

Query  269  NVQPSIRGRNVYIQFSSHQELTT  337
            +    +RGR VY+QFS+H+EL T
Sbjct  112  SCPAQLRGRAVYVQFSNHRELKT  134



>ref|XP_008401682.1| PREDICTED: polypyrimidine tract-binding protein 1-like, partial 
[Poecilia reticulata]
Length=423

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 63/96 (66%), Gaps = 0/96 (0%)
 Frame = +2

Query  92   PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  271
            PS+VIH+R +  +I+E +++ L  PFG +T L+ML+AKNQA L+M    +A N + +Y+ 
Sbjct  23   PSRVIHIRKLPSDITEAEVISLGLPFGDVTNLLMLKAKNQAFLEMNSEEAAQNMVGYYST  82

Query  272  VQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEVFK  379
            + P IR + VY+QFS+H+EL T +   Q R     +
Sbjct  83   MMPVIRHQPVYLQFSNHKELKTDNSPNQERAQAALR  118



>ref|XP_008212884.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X11 
[Nasonia vitripennis]
Length=543

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +2

Query  89   EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  268
            +PS+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  SA   + +  
Sbjct  27   KPSRVIHIRNIPNEVSEGEIIHLGMPFGRVTNVLVLKGKNQAFLEMADEGSAATMVTYCA  86

Query  269  NVQPSIRGRNVYIQFSSHQELTT  337
            +    +RGR VY+QFS+H+EL T
Sbjct  87   SCPAQLRGRAVYVQFSNHRELKT  109



>ref|XP_008212880.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X7 
[Nasonia vitripennis]
Length=567

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +2

Query  89   EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  268
            +PS+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  SA   + +  
Sbjct  72   KPSRVIHIRNIPNEVSEGEIIHLGMPFGRVTNVLVLKGKNQAFLEMADEGSAATMVTYCA  131

Query  269  NVQPSIRGRNVYIQFSSHQELTT  337
            +    +RGR VY+QFS+H+EL T
Sbjct  132  SCPAQLRGRAVYVQFSNHRELKT  154



>ref|XP_008212881.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X8 
[Nasonia vitripennis]
Length=566

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +2

Query  89   EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  268
            +PS+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  SA   + +  
Sbjct  72   KPSRVIHIRNIPNEVSEGEIIHLGMPFGRVTNVLVLKGKNQAFLEMADEGSAATMVTYCA  131

Query  269  NVQPSIRGRNVYIQFSSHQELTT  337
            +    +RGR VY+QFS+H+EL T
Sbjct  132  SCPAQLRGRAVYVQFSNHRELKT  154



>ref|XP_008212883.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X10 
[Nasonia vitripennis]
Length=562

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +2

Query  89   EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  268
            +PS+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  SA   + +  
Sbjct  72   KPSRVIHIRNIPNEVSEGEIIHLGMPFGRVTNVLVLKGKNQAFLEMADEGSAATMVTYCA  131

Query  269  NVQPSIRGRNVYIQFSSHQELTT  337
            +    +RGR VY+QFS+H+EL T
Sbjct  132  SCPAQLRGRAVYVQFSNHRELKT  154



>ref|XP_008212874.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X4 
[Nasonia vitripennis]
Length=583

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +2

Query  89   EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  268
            +PS+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  SA   + +  
Sbjct  72   KPSRVIHIRNIPNEVSEGEIIHLGMPFGRVTNVLVLKGKNQAFLEMADEGSAATMVTYCA  131

Query  269  NVQPSIRGRNVYIQFSSHQELTT  337
            +    +RGR VY+QFS+H+EL T
Sbjct  132  SCPAQLRGRAVYVQFSNHRELKT  154



>ref|XP_001603240.2| PREDICTED: polypyrimidine tract-binding protein 1 isoform X2 
[Nasonia vitripennis]
Length=587

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +2

Query  89   EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  268
            +PS+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  SA   + +  
Sbjct  72   KPSRVIHIRNIPNEVSEGEIIHLGMPFGRVTNVLVLKGKNQAFLEMADEGSAATMVTYCA  131

Query  269  NVQPSIRGRNVYIQFSSHQELTT  337
            +    +RGR VY+QFS+H+EL T
Sbjct  132  SCPAQLRGRAVYVQFSNHRELKT  154



>ref|XP_003977560.1| PREDICTED: polypyrimidine tract-binding protein 1-like [Takifugu 
rubripes]
Length=534

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 64/103 (62%), Gaps = 0/103 (0%)
 Frame = +2

Query  71   RPLKMTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVN  250
            +  K   PSKV+H+R +  +I+E +++ L  PFG ++ L+ML+ KNQA L+M    +A N
Sbjct  41   KKFKGDSPSKVVHIRKLPDDITETEVISLGLPFGNVSNLLMLKTKNQAFLEMNCEDAACN  100

Query  251  ALQFYTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEVFK  379
             + +Y+ V P IR + VY+QFS+H+EL T +   Q R     +
Sbjct  101  MVGYYSTVMPVIRHQPVYVQFSNHKELKTDNSPNQERAQAALR  143



>ref|XP_008212870.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X1 
[Nasonia vitripennis]
Length=588

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +2

Query  89   EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  268
            +PS+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  SA   + +  
Sbjct  72   KPSRVIHIRNIPNEVSEGEIIHLGMPFGRVTNVLVLKGKNQAFLEMADEGSAATMVTYCA  131

Query  269  NVQPSIRGRNVYIQFSSHQELTT  337
            +    +RGR VY+QFS+H+EL T
Sbjct  132  SCPAQLRGRAVYVQFSNHRELKT  154



>ref|XP_011330841.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X5 
[Cerapachys biroi]
Length=643

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +2

Query  89   EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  268
            +PS+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y 
Sbjct  110  KPSRVIHIRNIPNEVSEAEIIHLGLPFGRVTNVLVLKGKNQAFLEMADESAAATMVTYYA  169

Query  269  NVQPSIRGRNVYIQFSSHQELTT  337
            +    +RGR VY+QFS+H+EL T
Sbjct  170  SGMAQLRGRAVYVQFSNHRELKT  192



>ref|XP_011194947.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X5 
[Bactrocera cucurbitae]
Length=577

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 63/92 (68%), Gaps = 1/92 (1%)
 Frame = +2

Query  89   EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  268
            +PSKVIH+RN+  E SE D++ L  PFG +T +++L+ KNQA L+M D  SA + +  YT
Sbjct  43   KPSKVIHLRNIPIESSEADVISLGVPFGRVTNVLVLKGKNQAFLEMADEVSATSMVSCYT  102

Query  269  NVQPSIRGRNVYIQFSSHQELTTMDQNTQSRG  364
               P + GR VY+QFS+H+EL T DQ+  + G
Sbjct  103  VTPPHMHGRMVYVQFSNHRELKT-DQSHNNTG  133



>ref|XP_011194921.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X3 
[Bactrocera cucurbitae]
Length=613

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 63/92 (68%), Gaps = 1/92 (1%)
 Frame = +2

Query  89   EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  268
            +PSKVIH+RN+  E SE D++ L  PFG +T +++L+ KNQA L+M D  SA + +  YT
Sbjct  88   KPSKVIHLRNIPIESSEADVISLGVPFGRVTNVLVLKGKNQAFLEMADEVSATSMVSCYT  147

Query  269  NVQPSIRGRNVYIQFSSHQELTTMDQNTQSRG  364
               P + GR VY+QFS+H+EL T DQ+  + G
Sbjct  148  VTPPHMHGRMVYVQFSNHRELKT-DQSHNNTG  178



>ref|XP_011194909.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X1 
[Bactrocera cucurbitae]
Length=622

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 63/92 (68%), Gaps = 1/92 (1%)
 Frame = +2

Query  89   EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  268
            +PSKVIH+RN+  E SE D++ L  PFG +T +++L+ KNQA L+M D  SA + +  YT
Sbjct  88   KPSKVIHLRNIPIESSEADVISLGVPFGRVTNVLVLKGKNQAFLEMADEVSATSMVSCYT  147

Query  269  NVQPSIRGRNVYIQFSSHQELTTMDQNTQSRG  364
               P + GR VY+QFS+H+EL T DQ+  + G
Sbjct  148  VTPPHMHGRMVYVQFSNHRELKT-DQSHNNTG  178



>ref|XP_011194913.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X2 
[Bactrocera cucurbitae]
Length=617

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 63/92 (68%), Gaps = 1/92 (1%)
 Frame = +2

Query  89   EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  268
            +PSKVIH+RN+  E SE D++ L  PFG +T +++L+ KNQA L+M D  SA + +  YT
Sbjct  88   KPSKVIHLRNIPIESSEADVISLGVPFGRVTNVLVLKGKNQAFLEMADEVSATSMVSCYT  147

Query  269  NVQPSIRGRNVYIQFSSHQELTTMDQNTQSRG  364
               P + GR VY+QFS+H+EL T DQ+  + G
Sbjct  148  VTPPHMHGRMVYVQFSNHRELKT-DQSHNNTG  178



>ref|XP_008212871.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X3 
[Nasonia vitripennis]
 ref|XP_008212873.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X3 
[Nasonia vitripennis]
Length=585

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +2

Query  89   EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  268
            +PS+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  SA   + +  
Sbjct  69   KPSRVIHIRNIPNEVSEGEIIHLGMPFGRVTNVLVLKGKNQAFLEMADEGSAATMVTYCA  128

Query  269  NVQPSIRGRNVYIQFSSHQELTT  337
            +    +RGR VY+QFS+H+EL T
Sbjct  129  SCPAQLRGRAVYVQFSNHRELKT  151



>ref|XP_008283570.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X4 [Stegastes partitus]
Length=508

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 63/96 (66%), Gaps = 0/96 (0%)
 Frame = +2

Query  92   PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  271
            PS+VIH+R + ++I+E +++ L  PFG +T L+ML+AKNQA L+M    +A + + +Y+ 
Sbjct  23   PSRVIHIRKLPNDITETEVISLGLPFGDVTNLLMLKAKNQAFLEMNSEEAAQSMVSYYST  82

Query  272  VQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEVFK  379
            V P IR   VY+QFS+H+EL T +   Q R     +
Sbjct  83   VMPIIRHHPVYVQFSNHKELKTDNSPNQERAQAALR  118



>ref|XP_011330840.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X4 
[Cerapachys biroi]
Length=653

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +2

Query  89   EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  268
            +PS+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y 
Sbjct  120  KPSRVIHIRNIPNEVSEAEIIHLGLPFGRVTNVLVLKGKNQAFLEMADESAAATMVTYYA  179

Query  269  NVQPSIRGRNVYIQFSSHQELTT  337
            +    +RGR VY+QFS+H+EL T
Sbjct  180  SGMAQLRGRAVYVQFSNHRELKT  202



>ref|XP_005470623.1| PREDICTED: polypyrimidine tract-binding protein 3 [Oreochromis 
niloticus]
Length=499

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 62/88 (70%), Gaps = 0/88 (0%)
 Frame = +2

Query  92   PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  271
            PS+V+H+R +  ++SE ++L L  PFG ++KL+ L+ KNQA L+M    +AV  + +YT+
Sbjct  25   PSRVLHLRQLPPDVSEQEVLSLALPFGRVSKLITLKTKNQAFLEMASEEAAVTMVNYYTS  84

Query  272  VQPSIRGRNVYIQFSSHQELTTMDQNTQ  355
              PSIR + VYIQ+S+H+EL T +  +Q
Sbjct  85   ATPSIRSQPVYIQYSTHRELKTDNMTSQ  112



>ref|XP_011194929.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X4 
[Bactrocera cucurbitae]
 ref|XP_011194939.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X4 
[Bactrocera cucurbitae]
 ref|XP_011194953.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X4 
[Bactrocera cucurbitae]
Length=605

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 63/92 (68%), Gaps = 1/92 (1%)
 Frame = +2

Query  89   EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  268
            +PSKVIH+RN+  E SE D++ L  PFG +T +++L+ KNQA L+M D  SA + +  YT
Sbjct  71   KPSKVIHLRNIPIESSEADVISLGVPFGRVTNVLVLKGKNQAFLEMADEVSATSMVSCYT  130

Query  269  NVQPSIRGRNVYIQFSSHQELTTMDQNTQSRG  364
               P + GR VY+QFS+H+EL T DQ+  + G
Sbjct  131  VTPPHMHGRMVYVQFSNHRELKT-DQSHNNTG  161



>ref|XP_011330842.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X6 
[Cerapachys biroi]
 ref|XP_011330843.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X6 
[Cerapachys biroi]
Length=642

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +2

Query  89   EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  268
            +PS+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y 
Sbjct  109  KPSRVIHIRNIPNEVSEAEIIHLGLPFGRVTNVLVLKGKNQAFLEMADESAAATMVTYYA  168

Query  269  NVQPSIRGRNVYIQFSSHQELTT  337
            +    +RGR VY+QFS+H+EL T
Sbjct  169  SGMAQLRGRAVYVQFSNHRELKT  191



>ref|XP_011330839.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X3 
[Cerapachys biroi]
Length=675

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +2

Query  89   EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  268
            +PS+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y 
Sbjct  157  KPSRVIHIRNIPNEVSEAEIIHLGLPFGRVTNVLVLKGKNQAFLEMADESAAATMVTYYA  216

Query  269  NVQPSIRGRNVYIQFSSHQELTT  337
            +    +RGR VY+QFS+H+EL T
Sbjct  217  SGMAQLRGRAVYVQFSNHRELKT  239



>ref|XP_011330837.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X1 
[Cerapachys biroi]
Length=689

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +2

Query  89   EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  268
            +PS+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y 
Sbjct  157  KPSRVIHIRNIPNEVSEAEIIHLGLPFGRVTNVLVLKGKNQAFLEMADESAAATMVTYYA  216

Query  269  NVQPSIRGRNVYIQFSSHQELTT  337
            +    +RGR VY+QFS+H+EL T
Sbjct  217  SGMAQLRGRAVYVQFSNHRELKT  239



>ref|XP_007904702.1| PREDICTED: polypyrimidine tract-binding protein 3 isoform X4 
[Callorhinchus milii]
Length=541

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = +2

Query  86   TEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFY  265
            + PS+V+H+R + +E+SE ++L L  PFG +T L+ML+ KNQA ++M    +AV  + +Y
Sbjct  46   SSPSRVLHIRKIPNEVSETEVLSLGLPFGKVTNLLMLKGKNQAFVEMASEEAAVTMVNYY  105

Query  266  TNVQPSIRGRNVYIQFSSHQELTT  337
            T V P +R + +YIQ+S+H+EL T
Sbjct  106  TTVTPHLRNQPIYIQYSNHRELKT  129



>ref|XP_007904703.1| PREDICTED: polypyrimidine tract-binding protein 3 isoform X5 
[Callorhinchus milii]
 ref|XP_007904704.1| PREDICTED: polypyrimidine tract-binding protein 3 isoform X5 
[Callorhinchus milii]
Length=519

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = +2

Query  86   TEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFY  265
            + PS+V+H+R + +E+SE ++L L  PFG +T L+ML+ KNQA ++M    +AV  + +Y
Sbjct  24   SSPSRVLHIRKIPNEVSETEVLSLGLPFGKVTNLLMLKGKNQAFVEMASEEAAVTMVNYY  83

Query  266  TNVQPSIRGRNVYIQFSSHQELTT  337
            T V P +R + +YIQ+S+H+EL T
Sbjct  84   TTVTPHLRNQPIYIQYSNHRELKT  107



>ref|XP_007904705.1| PREDICTED: polypyrimidine tract-binding protein 3 isoform X6 
[Callorhinchus milii]
Length=568

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = +2

Query  86   TEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFY  265
            + PS+V+H+R + +E+SE ++L L  PFG +T L+ML+ KNQA ++M    +AV  + +Y
Sbjct  65   SSPSRVLHIRKIPNEVSETEVLSLGLPFGKVTNLLMLKGKNQAFVEMASEEAAVTMVNYY  124

Query  266  TNVQPSIRGRNVYIQFSSHQELTT  337
            T V P +R + +YIQ+S+H+EL T
Sbjct  125  TTVTPHLRNQPIYIQYSNHRELKT  148



>ref|XP_007904700.1| PREDICTED: polypyrimidine tract-binding protein 3 isoform X2 
[Callorhinchus milii]
Length=550

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = +2

Query  86   TEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFY  265
            + PS+V+H+R + +E+SE ++L L  PFG +T L+ML+ KNQA ++M    +AV  + +Y
Sbjct  55   SSPSRVLHIRKIPNEVSETEVLSLGLPFGKVTNLLMLKGKNQAFVEMASEEAAVTMVNYY  114

Query  266  TNVQPSIRGRNVYIQFSSHQELTT  337
            T V P +R + +YIQ+S+H+EL T
Sbjct  115  TTVTPHLRNQPIYIQYSNHRELKT  138



>ref|XP_011330838.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X2 
[Cerapachys biroi]
Length=678

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +2

Query  89   EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  268
            +PS+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y 
Sbjct  145  KPSRVIHIRNIPNEVSEAEIIHLGLPFGRVTNVLVLKGKNQAFLEMADESAAATMVTYYA  204

Query  269  NVQPSIRGRNVYIQFSSHQELTT  337
            +    +RGR VY+QFS+H+EL T
Sbjct  205  SGMAQLRGRAVYVQFSNHRELKT  227



>ref|XP_008283569.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X3 [Stegastes partitus]
Length=537

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 63/96 (66%), Gaps = 0/96 (0%)
 Frame = +2

Query  92   PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  271
            PS+VIH+R + ++I+E +++ L  PFG +T L+ML+AKNQA L+M    +A + + +Y+ 
Sbjct  52   PSRVIHIRKLPNDITETEVISLGLPFGDVTNLLMLKAKNQAFLEMNSEEAAQSMVSYYST  111

Query  272  VQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEVFK  379
            V P IR   VY+QFS+H+EL T +   Q R     +
Sbjct  112  VMPIIRHHPVYVQFSNHKELKTDNSPNQERAQAALR  147



>ref|XP_007904701.1| PREDICTED: polypyrimidine tract-binding protein 3 isoform X3 
[Callorhinchus milii]
Length=547

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = +2

Query  86   TEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFY  265
            + PS+V+H+R + +E+SE ++L L  PFG +T L+ML+ KNQA ++M    +AV  + +Y
Sbjct  52   SSPSRVLHIRKIPNEVSETEVLSLGLPFGKVTNLLMLKGKNQAFVEMASEEAAVTMVNYY  111

Query  266  TNVQPSIRGRNVYIQFSSHQELTT  337
            T V P +R + +YIQ+S+H+EL T
Sbjct  112  TTVTPHLRNQPIYIQYSNHRELKT  135



>ref|XP_007904698.1| PREDICTED: polypyrimidine tract-binding protein 3 isoform X1 
[Callorhinchus milii]
Length=560

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = +2

Query  86   TEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFY  265
            + PS+V+H+R + +E+SE ++L L  PFG +T L+ML+ KNQA ++M    +AV  + +Y
Sbjct  65   SSPSRVLHIRKIPNEVSETEVLSLGLPFGKVTNLLMLKGKNQAFVEMASEEAAVTMVNYY  124

Query  266  TNVQPSIRGRNVYIQFSSHQELTT  337
            T V P +R + +YIQ+S+H+EL T
Sbjct  125  TTVTPHLRNQPIYIQYSNHRELKT  148



>ref|XP_006182607.1| PREDICTED: polypyrimidine tract-binding protein 1 [Camelus ferus]
Length=410

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +2

Query  92   PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  271
            PS+VIHVR +  +++E +++ L  PFG +T L+ML+ KNQA ++M    +A   + +YT+
Sbjct  57   PSRVIHVRKLPSDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTS  116

Query  272  VQPSIRGRNVYIQFSSHQELTT  337
            V P +RG+ +YIQFS+H+EL T
Sbjct  117  VTPVLRGQPIYIQFSNHKELKT  138



>ref|XP_008283568.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X2 [Stegastes partitus]
Length=538

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 63/96 (66%), Gaps = 0/96 (0%)
 Frame = +2

Query  92   PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  271
            PS+VIH+R + ++I+E +++ L  PFG +T L+ML+AKNQA L+M    +A + + +Y+ 
Sbjct  53   PSRVIHIRKLPNDITETEVISLGLPFGDVTNLLMLKAKNQAFLEMNSEEAAQSMVSYYST  112

Query  272  VQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEVFK  379
            V P IR   VY+QFS+H+EL T +   Q R     +
Sbjct  113  VMPIIRHHPVYVQFSNHKELKTDNSPNQERAQAALR  148



>gb|AAC94999.1| putative polypyrimidine tract-binding protein [Carassius auratus]
Length=165

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = +2

Query  86   TEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFY  265
             +PS+V+H+R V  E+SE +++ L  PFG +T L++L+ KNQA L+M    +A+  + +Y
Sbjct  77   CDPSRVLHIRRVPIEVSEAEVVTLGVPFGKVTNLLLLKGKNQAFLEMASEEAAITMVNYY  136

Query  266  TNVQPSIRGRNVYIQFSSHQELTT  337
            T   P +R + VYIQ+S+H+EL T
Sbjct  137  TTATPLVRNQPVYIQYSNHRELKT  160



>ref|XP_010723221.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X2 [Meleagris gallopavo]
Length=140

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +2

Query  92   PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  271
            PS+VIHVR +  +++E +++ L  PFG +T L+ML+ KNQA ++M    +A   + +YT 
Sbjct  27   PSRVIHVRKLPSDVTEAEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTT  86

Query  272  VQPSIRGRNVYIQFSSHQELTT  337
            V P +R + +YIQFS+H+EL T
Sbjct  87   VTPVLRSQPIYIQFSNHKELKT  108



>ref|XP_008283567.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X1 [Stegastes partitus]
Length=582

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 63/96 (66%), Gaps = 0/96 (0%)
 Frame = +2

Query  92   PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  271
            PS+VIH+R + ++I+E +++ L  PFG +T L+ML+AKNQA L+M    +A + + +Y+ 
Sbjct  97   PSRVIHIRKLPNDITETEVISLGLPFGDVTNLLMLKAKNQAFLEMNSEEAAQSMVSYYST  156

Query  272  VQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEVFK  379
            V P IR   VY+QFS+H+EL T +   Q R     +
Sbjct  157  VMPIIRHHPVYVQFSNHKELKTDNSPNQERAQAALR  192



>sp|P17225.2|PTBP1_MOUSE RecName: Full=Polypyrimidine tract-binding protein 1; Short=PTB; 
AltName: Full=Heterogeneous nuclear ribonucleoprotein I; 
Short=hnRNP I [Mus musculus]
 emb|CAA36321.1| 25kDa nuclear protein [Mus musculus]
Length=527

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 61/90 (68%), Gaps = 0/90 (0%)
 Frame = +2

Query  92   PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  271
            PS+VIHVR +  +++E +++ L  PFG +T L+ML+ KNQA ++M    +A   + +YT+
Sbjct  56   PSRVIHVRKLPSDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTS  115

Query  272  VQPSIRGRNVYIQFSSHQELTTMDQNTQSR  361
            V P +RG+ +YIQFS+H+EL T     Q R
Sbjct  116  VAPVLRGQPIYIQFSNHKELKTDSSPNQVR  145



>dbj|BAD92147.1| polypyrimidine tract-binding protein 1 isoform c variant [Homo 
sapiens]
Length=329

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +2

Query  92   PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  271
            PS+VIH+R +  +++E +++ L  PFG +T L+ML+ KNQA ++M    +A   + +YT+
Sbjct  74   PSRVIHIRKLPIDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTS  133

Query  272  VQPSIRGRNVYIQFSSHQELTT  337
            V P +RG+ +YIQFS+H+EL T
Sbjct  134  VTPVLRGQPIYIQFSNHKELKT  155



>ref|XP_007569508.1| PREDICTED: LOW QUALITY PROTEIN: polypyrimidine tract-binding 
protein 1-like [Poecilia formosa]
Length=560

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 63/96 (66%), Gaps = 0/96 (0%)
 Frame = +2

Query  92   PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  271
            PS+VIH+R +  +I+E +++ L  PFG +T L+ML+AKNQA L+M    +A N + +Y+ 
Sbjct  73   PSRVIHIRKLPSDITEAEVISLGLPFGDVTNLLMLKAKNQAFLEMNSEEAAQNMVGYYST  132

Query  272  VQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEVFK  379
            + P IR + VY+QFS+H+EL T +   Q R     +
Sbjct  133  MMPVIRHQPVYLQFSNHKELKTDNSPNQERAQAALR  168



>gb|EDL31648.1| mCG13402, isoform CRA_e [Mus musculus]
Length=454

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +2

Query  92   PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  271
            PS+VIHVR +  +++E +++ L  PFG +T L+ML+ KNQA ++M    +A   + +YT+
Sbjct  72   PSRVIHVRKLPSDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTS  131

Query  272  VQPSIRGRNVYIQFSSHQELTT  337
            V P +RG+ +YIQFS+H+EL T
Sbjct  132  VAPVLRGQPIYIQFSNHKELKT  153



>gb|EHB09794.1| Polypyrimidine tract-binding protein 1 [Heterocephalus glaber]
Length=543

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 62/90 (69%), Gaps = 0/90 (0%)
 Frame = +2

Query  92   PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  271
            PS+VIH+R +  +++E +++ L  PFG +T L+M++ KNQA ++M    +A   + +YT+
Sbjct  57   PSRVIHIRKLPSDVTEGEVISLVLPFGKVTNLLMVKGKNQAFIEMNTEEAANTMVNYYTS  116

Query  272  VQPSIRGRNVYIQFSSHQELTTMDQNTQSR  361
            V P +RG+ +YIQFS+H+EL T     Q+R
Sbjct  117  VTPVLRGQPIYIQFSNHKELKTDSSPNQAR  146



>ref|XP_010723219.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X1 [Meleagris gallopavo]
Length=158

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 60/89 (67%), Gaps = 0/89 (0%)
 Frame = +2

Query  92   PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  271
            PS+VIHVR +  +++E +++ L  PFG +T L+ML+ KNQA ++M    +A   + +YT 
Sbjct  45   PSRVIHVRKLPSDVTEAEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTT  104

Query  272  VQPSIRGRNVYIQFSSHQELTTMDQNTQS  358
            V P +R + +YIQFS+H+EL T +   Q+
Sbjct  105  VTPVLRSQPIYIQFSNHKELKTDNSPNQA  133



>gb|EMP33475.1| Regulator of differentiation 1, partial [Chelonia mydas]
Length=1600

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 42/111 (38%), Positives = 70/111 (63%), Gaps = 1/111 (1%)
 Frame = +2

Query  92   PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  271
            PS+V+H+R + ++++E +++ L  PFG +T L+ML+ K+QA L+M    +AV  + +YT 
Sbjct  18   PSRVLHLRKIPNDVTEAEVISLGLPFGKVTNLLMLKGKSQAFLEMASEEAAVTMVNYYTP  77

Query  272  VQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEVFKL*FNFKQTKVLYLQG  424
            V P +R + VYIQ+S+H+EL T +   Q+R     +   N  Q+  L L G
Sbjct  78   VTPHLRSQPVYIQYSNHRELKTDNLPNQARTQAALQA-VNAVQSGALALTG  127



>ref|XP_007635822.1| PREDICTED: polypyrimidine tract-binding protein 1-like, partial 
[Cricetulus griseus]
Length=226

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 62/90 (69%), Gaps = 0/90 (0%)
 Frame = +2

Query  92   PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  271
            PS+VIHVR++  +++E +++ L  PFG +T L+ML+ K+QA ++M    +A N + +YT+
Sbjct  93   PSRVIHVRSLPSDVTEGEVISLGLPFGKVTNLLMLKGKHQAFIEMNTEEAANNMVNYYTS  152

Query  272  VQPSIRGRNVYIQFSSHQELTTMDQNTQSR  361
            V P + G+ +Y+QFS+H+EL T      +R
Sbjct  153  VAPVLHGQPIYLQFSNHKELKTDSSPNHAR  182



>ref|XP_005359184.1| PREDICTED: polypyrimidine tract-binding protein 1 [Microtus ochrogaster]
Length=486

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +2

Query  92   PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  271
            PS+VIHVR +  +++E +++ L  PFG +T L+ML+ KNQA ++M    +A   + +YT+
Sbjct  56   PSRVIHVRKLPSDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTS  115

Query  272  VQPSIRGRNVYIQFSSHQELTT  337
            V P +RG+ +YIQFS+H+EL T
Sbjct  116  VAPVLRGQPIYIQFSNHKELKT  137



>ref|XP_011495872.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X4 
[Ceratosolen solmsi marchali]
Length=562

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +2

Query  89   EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  268
            +PS+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y 
Sbjct  72   KPSRVIHIRNIPNEVSEGEIVHLGIPFGRVTNVLVLKGKNQAFLEMADEGAAATMVTYYA  131

Query  269  NVQPSIRGRNVYIQFSSHQELTT  337
            +    +R R VY+QFS+H+EL T
Sbjct  132  SCPAQLRARAVYVQFSNHRELKT  154



>ref|XP_011310461.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X6 
[Fopius arisanus]
Length=537

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +2

Query  89   EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  268
            +PSKVIH+RN+  ++ E++++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y 
Sbjct  15   KPSKVIHIRNISSDVVESEIIHLGMPFGRVTNVLVLKGKNQAFLEMADENAATTMVGYYA  74

Query  269  NVQPSIRGRNVYIQFSSHQELTT  337
                S+RGR VY+Q+S+H+EL T
Sbjct  75   ASGASLRGRAVYVQYSNHRELKT  97



>dbj|BAO03403.1| polypyrimidine tract binding protein 1b splicing isoform [Oryzias 
latipes]
Length=360

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 63/96 (66%), Gaps = 0/96 (0%)
 Frame = +2

Query  92   PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  271
            PS+V+H+R +  +I+E +++ L  PFG +T L+ML+AKNQA L+M    +A N + +Y+ 
Sbjct  53   PSRVLHIRKLPIDITETEVISLGLPFGDVTNLLMLKAKNQAFLEMNSEEAAQNMVGYYST  112

Query  272  VQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEVFK  379
            V P IR + V++QFS+H+EL T +   Q R     +
Sbjct  113  VMPIIRQQPVFVQFSNHKELKTDNSPNQERAQAALR  148



>ref|XP_011495869.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X1 
[Ceratosolen solmsi marchali]
Length=587

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +2

Query  89   EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  268
            +PS+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y 
Sbjct  72   KPSRVIHIRNIPNEVSEGEIVHLGIPFGRVTNVLVLKGKNQAFLEMADEGAAATMVTYYA  131

Query  269  NVQPSIRGRNVYIQFSSHQELTT  337
            +    +R R VY+QFS+H+EL T
Sbjct  132  SCPAQLRARAVYVQFSNHRELKT  154



>gb|AAI03384.1| PTBP1 protein [Bos taurus]
Length=446

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +2

Query  92   PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  271
            PS+VIH+R +  +++E +++ L  PFG +T L+ML+ KNQA ++M    +A   + +YT+
Sbjct  57   PSRVIHIRKLPGDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMHTEEAANTMVNYYTS  116

Query  272  VQPSIRGRNVYIQFSSHQELTT  337
            V P +RG+ +YIQFS+H+EL T
Sbjct  117  VTPVLRGQPIYIQFSNHKELKT  138



>gb|EDL89387.1| polypyrimidine tract binding protein 1, isoform CRA_d [Rattus 
norvegicus]
Length=500

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +2

Query  92   PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  271
            PS+VIHVR +  +++E +++ L  PFG +T L+ML+ KNQA ++M    +A   + +YT+
Sbjct  26   PSRVIHVRKLPSDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMSTEEAANTMVNYYTS  85

Query  272  VQPSIRGRNVYIQFSSHQELTT  337
            V P +RG+ +YIQFS+H+EL T
Sbjct  86   VAPVLRGQPIYIQFSNHKELKT  107



>ref|XP_011310460.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X5 
[Fopius arisanus]
Length=568

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +2

Query  89   EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  268
            +PSKVIH+RN+  ++ E++++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y 
Sbjct  46   KPSKVIHIRNISSDVVESEIIHLGMPFGRVTNVLVLKGKNQAFLEMADENAATTMVGYYA  105

Query  269  NVQPSIRGRNVYIQFSSHQELTT  337
                S+RGR VY+Q+S+H+EL T
Sbjct  106  ASGASLRGRAVYVQYSNHRELKT  128



>ref|XP_011495870.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X2 
[Ceratosolen solmsi marchali]
Length=583

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +2

Query  89   EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  268
            +PS+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y 
Sbjct  72   KPSRVIHIRNIPNEVSEGEIVHLGIPFGRVTNVLVLKGKNQAFLEMADEGAAATMVTYYA  131

Query  269  NVQPSIRGRNVYIQFSSHQELTT  337
            +    +R R VY+QFS+H+EL T
Sbjct  132  SCPAQLRARAVYVQFSNHRELKT  154



>emb|CAA43202.1| pyrimidine binding protein 1 [Rattus norvegicus]
Length=530

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +2

Query  92   PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  271
            PS+VIHVR +  +++E +++ L  PFG +T L+ML+ KNQA ++M    +A   + +YT+
Sbjct  56   PSRVIHVRKLPSDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMSTEEAANTMVNYYTS  115

Query  272  VQPSIRGRNVYIQFSSHQELTT  337
            V P +RG+ +YIQFS+H+EL T
Sbjct  116  VAPVLRGQPIYIQFSNHKELKT  137



>ref|XP_011495871.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X3 
[Ceratosolen solmsi marchali]
Length=583

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +2

Query  89   EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  268
            +PS+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y 
Sbjct  68   KPSRVIHIRNIPNEVSEGEIVHLGIPFGRVTNVLVLKGKNQAFLEMADEGAAATMVTYYA  127

Query  269  NVQPSIRGRNVYIQFSSHQELTT  337
            +    +R R VY+QFS+H+EL T
Sbjct  128  SCPAQLRARAVYVQFSNHRELKT  150



>dbj|BAE37269.1| unnamed protein product [Mus musculus]
Length=520

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +2

Query  92   PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  271
            PS+VIHVR +  +++E +++ L  PFG +T L+ML+ KNQA ++M    +A   + +YT+
Sbjct  56   PSRVIHVRKLPSDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTS  115

Query  272  VQPSIRGRNVYIQFSSHQELTT  337
            V P +RG+ +YIQFS+H+EL T
Sbjct  116  VAPVLRGQPIYIQFSNHKELKT  137



>ref|XP_011265176.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X6 
[Camponotus floridanus]
Length=585

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +2

Query  89   EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  268
            +PS+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y 
Sbjct  56   KPSRVIHIRNIPNEVSEAEIIHLGLPFGRVTNVLVLKGKNQAFLEMADENAAATMVTYYA  115

Query  269  NVQPSIRGRNVYIQFSSHQELTT  337
            +    +RGR VY+QFS+H+EL T
Sbjct  116  SGIAQLRGRAVYVQFSNHRELKT  138



>ref|NP_001257986.1| polypyrimidine tract-binding protein 1 isoform a [Rattus norvegicus]
 gb|AAH61858.1| Ptbp1 protein [Rattus norvegicus]
 gb|EDL89384.1| polypyrimidine tract binding protein 1, isoform CRA_a [Rattus 
norvegicus]
Length=556

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +2

Query  92   PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  271
            PS+VIHVR +  +++E +++ L  PFG +T L+ML+ KNQA ++M    +A   + +YT+
Sbjct  56   PSRVIHVRKLPSDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMSTEEAANTMVNYYTS  115

Query  272  VQPSIRGRNVYIQFSSHQELTT  337
            V P +RG+ +YIQFS+H+EL T
Sbjct  116  VAPVLRGQPIYIQFSNHKELKT  137



>sp|Q00438.1|PTBP1_RAT RecName: Full=Polypyrimidine tract-binding protein 1; Short=PTB; 
AltName: Full=Heterogeneous nuclear ribonucleoprotein I; 
Short=hnRNP I; AltName: Full=Pyrimidine-binding protein; Short=PYBP 
[Rattus norvegicus]
Length=555

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +2

Query  92   PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  271
            PS+VIHVR +  +++E +++ L  PFG +T L+ML+ KNQA ++M    +A   + +YT+
Sbjct  56   PSRVIHVRKLPSDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMSTEEAANTMVNYYTS  115

Query  272  VQPSIRGRNVYIQFSSHQELTT  337
            V P +RG+ +YIQFS+H+EL T
Sbjct  116  VAPVLRGQPIYIQFSNHKELKT  137



>ref|XP_011310459.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X4 
[Fopius arisanus]
Length=581

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +2

Query  89   EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  268
            +PSKVIH+RN+  ++ E++++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y 
Sbjct  72   KPSKVIHIRNISSDVVESEIIHLGMPFGRVTNVLVLKGKNQAFLEMADENAATTMVGYYA  131

Query  269  NVQPSIRGRNVYIQFSSHQELTT  337
                S+RGR VY+Q+S+H+EL T
Sbjct  132  ASGASLRGRAVYVQYSNHRELKT  154



>ref|NP_071961.2| polypyrimidine tract-binding protein 1 isoform b [Rattus norvegicus]
 gb|EDL89386.1| polypyrimidine tract binding protein 1, isoform CRA_c [Rattus 
norvegicus]
Length=530

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +2

Query  92   PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  271
            PS+VIHVR +  +++E +++ L  PFG +T L+ML+ KNQA ++M    +A   + +YT+
Sbjct  56   PSRVIHVRKLPSDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMSTEEAANTMVNYYTS  115

Query  272  VQPSIRGRNVYIQFSSHQELTT  337
            V P +RG+ +YIQFS+H+EL T
Sbjct  116  VAPVLRGQPIYIQFSNHKELKT  137



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559039970400