BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001D06

Length=501
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CBI17617.3|  unnamed protein product                                242   4e-75   Vitis vinifera
ref|XP_003534510.1|  PREDICTED: basic leucine zipper and W2 domai...    241   1e-74   Glycine max [soybeans]
ref|XP_010927633.1|  PREDICTED: basic leucine zipper and W2 domai...    240   2e-74   Elaeis guineensis
ref|XP_006376044.1|  eIF4-gamma/eIF5/eIF2-epsilon domain-containi...    240   2e-74   Populus trichocarpa [western balsam poplar]
ref|XP_009757517.1|  PREDICTED: basic leucine zipper and W2 domai...    240   3e-74   Nicotiana sylvestris
gb|KDP26874.1|  hypothetical protein JCGZ_18032                         240   3e-74   Jatropha curcas
ref|XP_010926617.1|  PREDICTED: basic leucine zipper and W2 domai...    239   3e-74   Elaeis guineensis
ref|XP_011006974.1|  PREDICTED: basic leucine zipper and W2 domai...    239   3e-74   Populus euphratica
ref|XP_002325904.1|  eIF4-gamma/eIF5/eIF2-epsilon domain-containi...    239   4e-74   Populus trichocarpa [western balsam poplar]
ref|NP_001240059.1|  uncharacterized protein LOC100789838               239   4e-74   Glycine max [soybeans]
gb|KJB26851.1|  hypothetical protein B456_004G262900                    239   4e-74   Gossypium raimondii
ref|XP_010038305.1|  PREDICTED: basic leucine zipper and W2 domai...    239   4e-74   Eucalyptus grandis [rose gum]
ref|XP_009788167.1|  PREDICTED: basic leucine zipper and W2 domai...    239   5e-74   Nicotiana sylvestris
gb|KJB26850.1|  hypothetical protein B456_004G262900                    239   6e-74   Gossypium raimondii
ref|XP_007139724.1|  hypothetical protein PHAVU_008G054000g             239   7e-74   Phaseolus vulgaris [French bean]
ref|XP_011009963.1|  PREDICTED: basic leucine zipper and W2 domai...    239   8e-74   Populus euphratica
ref|XP_009383336.1|  PREDICTED: basic leucine zipper and W2 domai...    238   8e-74   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY38556.1|  BnaA05g12850D                                          240   1e-73   Brassica napus [oilseed rape]
ref|XP_009620435.1|  PREDICTED: basic leucine zipper and W2 domai...    238   1e-73   Nicotiana tomentosiformis
ref|XP_006345823.1|  PREDICTED: basic leucine zipper and W2 domai...    238   1e-73   Solanum tuberosum [potatoes]
ref|XP_004239697.1|  PREDICTED: basic leucine zipper and W2 domai...    238   1e-73   Solanum lycopersicum
ref|XP_009620737.1|  PREDICTED: basic leucine zipper and W2 domai...    238   2e-73   Nicotiana tomentosiformis
ref|XP_009384254.1|  PREDICTED: basic leucine zipper and W2 domai...    237   3e-73   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY51095.1|  BnaC06g42190D                                          242   3e-73   Brassica napus [oilseed rape]
ref|XP_008388811.1|  PREDICTED: basic leucine zipper and W2 domai...    237   3e-73   Malus domestica [apple tree]
ref|XP_002514839.1|  translation initiation factor, putative            237   4e-73   Ricinus communis
gb|KHG11883.1|  Basic leucine zipper and W2 domain-containing 2         236   9e-73   Gossypium arboreum [tree cotton]
gb|KHG20905.1|  Basic leucine zipper and W2 domain-containing 2         235   2e-72   Gossypium arboreum [tree cotton]
ref|XP_010241522.1|  PREDICTED: basic leucine zipper and W2 domai...    235   2e-72   Nelumbo nucifera [Indian lotus]
ref|XP_011084659.1|  PREDICTED: basic leucine zipper and W2 domai...    234   4e-72   Sesamum indicum [beniseed]
ref|XP_008370829.1|  PREDICTED: basic leucine zipper and W2 domai...    234   6e-72   Malus domestica [apple tree]
ref|XP_003624182.1|  Basic leucine zipper and W2 domain-containin...    234   7e-72   Medicago truncatula
ref|XP_008787734.1|  PREDICTED: basic leucine zipper and W2 domai...    233   8e-72   Phoenix dactylifera
ref|XP_004492841.1|  PREDICTED: basic leucine zipper and W2 domai...    233   8e-72   Cicer arietinum [garbanzo]
ref|XP_002270681.2|  PREDICTED: basic leucine zipper and W2 domai...    233   1e-71   Vitis vinifera
ref|XP_004302164.1|  PREDICTED: basic leucine zipper and W2 domai...    233   1e-71   Fragaria vesca subsp. vesca
ref|XP_008800962.1|  PREDICTED: basic leucine zipper and W2 domai...    233   2e-71   Phoenix dactylifera
ref|XP_004138904.1|  PREDICTED: basic leucine zipper and W2 domai...    232   3e-71   Cucumis sativus [cucumbers]
ref|XP_008441730.1|  PREDICTED: basic leucine zipper and W2 domai...    232   4e-71   Cucumis melo [Oriental melon]
ref|XP_006395906.1|  hypothetical protein EUTSA_v10004315mg             232   4e-71   Eutrema salsugineum [saltwater cress]
ref|XP_006847468.1|  hypothetical protein AMTR_s00163p00023880          232   4e-71   Amborella trichopoda
ref|XP_008218452.1|  PREDICTED: basic leucine zipper and W2 domai...    231   4e-71   Prunus mume [ume]
ref|XP_008370828.1|  PREDICTED: basic leucine zipper and W2 domai...    231   5e-71   Malus domestica [apple tree]
ref|XP_010553847.1|  PREDICTED: putative basic leucine zipper and...    231   6e-71   Tarenaya hassleriana [spider flower]
ref|XP_007029311.1|  ARM repeat superfamily protein isoform 2           231   6e-71   
gb|KJB75150.1|  hypothetical protein B456_012G026900                    231   9e-71   Gossypium raimondii
ref|XP_006428599.1|  hypothetical protein CICLE_v10011861mg             231   1e-70   Citrus clementina [clementine]
ref|XP_006283832.1|  hypothetical protein CARUB_v10004933mg             229   4e-70   Capsella rubella
ref|XP_010440787.1|  PREDICTED: protein krasavietz-like                 229   4e-70   Camelina sativa [gold-of-pleasure]
ref|XP_010435501.1|  PREDICTED: protein krasavietz-like                 229   4e-70   Camelina sativa [gold-of-pleasure]
gb|EYU39452.1|  hypothetical protein MIMGU_mgv1a007304mg                229   4e-70   Erythranthe guttata [common monkey flower]
ref|XP_010551247.1|  PREDICTED: protein krasavietz-like                 229   5e-70   Tarenaya hassleriana [spider flower]
gb|KCW58757.1|  hypothetical protein EUGRSUZ_H01394                     228   6e-70   Eucalyptus grandis [rose gum]
gb|KDO54046.1|  hypothetical protein CISIN_1g01470512mg                 226   7e-70   Citrus sinensis [apfelsine]
emb|CDY16396.1|  BnaA02g12000D                                          230   8e-70   Brassica napus [oilseed rape]
ref|XP_010070156.1|  PREDICTED: basic leucine zipper and W2 domai...    228   8e-70   Eucalyptus grandis [rose gum]
emb|CDX91513.1|  BnaC02g16470D                                          230   8e-70   
gb|KDO54042.1|  hypothetical protein CISIN_1g01470512mg                 226   9e-70   Citrus sinensis [apfelsine]
ref|XP_009144656.1|  PREDICTED: basic leucine zipper and W2 domai...    228   9e-70   Brassica rapa
ref|XP_002489171.1|  hypothetical protein SORBIDRAFT_0014s003010        229   3e-69   
ref|XP_002868460.1|  eIF4-gamma/eIF5/eIF2-epsilon domain-containi...    227   3e-69   Arabidopsis lyrata subsp. lyrata
gb|KDO54043.1|  hypothetical protein CISIN_1g01470512mg                 226   3e-69   Citrus sinensis [apfelsine]
ref|NP_568534.1|  C-terminal W2 domain of eIF4-gamma/eIF5/eIF2b-e...    226   4e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007029310.1|  ARM repeat superfamily protein isoform 1           226   4e-69   
ref|XP_011077166.1|  PREDICTED: basic leucine zipper and W2 domai...    226   5e-69   Sesamum indicum [beniseed]
ref|XP_010673945.1|  PREDICTED: basic leucine zipper and W2 domai...    226   5e-69   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001132772.1|  eukaryotic initiation factor 5C CG2922-PF, i...    225   1e-68   Zea mays [maize]
gb|ABG22461.1|  expressed protein                                       224   1e-68   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009127390.1|  PREDICTED: putative basic leucine zipper and...    224   3e-68   Brassica rapa
ref|XP_006300493.1|  hypothetical protein CARUB_v10020379mg             224   3e-68   
gb|KFK39915.1|  hypothetical protein AALP_AA3G305600                    224   3e-68   Arabis alpina [alpine rockcress]
ref|XP_006300494.1|  hypothetical protein CARUB_v10020379mg             224   5e-68   Capsella rubella
ref|XP_002886828.1|  eIF4-gamma/eIF5/eIF2-epsilon domain-containi...    223   6e-68   
ref|NP_001150633.1|  LOC100284266                                       223   7e-68   Zea mays [maize]
ref|NP_001067760.1|  Os11g0414000                                       223   7e-68   
ref|NP_564845.1|  ARM repeat superfamily protein                        223   8e-68   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63296.1|  unknown                                                 223   9e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006662876.1|  PREDICTED: protein extra bases-like                223   9e-68   Oryza brachyantha
ref|XP_007207443.1|  hypothetical protein PRUPE_ppa005197mg             223   3e-67   
ref|XP_010528650.1|  PREDICTED: basic leucine zipper and W2 domai...    222   3e-67   Tarenaya hassleriana [spider flower]
ref|XP_010415061.1|  PREDICTED: basic leucine zipper and W2 domai...    221   4e-67   Camelina sativa [gold-of-pleasure]
ref|XP_010496215.1|  PREDICTED: basic leucine zipper and W2 domai...    221   5e-67   
ref|XP_009338445.1|  PREDICTED: basic leucine zipper and W2 domai...    218   5e-67   Pyrus x bretschneideri [bai li]
ref|XP_009364427.1|  PREDICTED: basic leucine zipper and W2 domai...    218   6e-67   Pyrus x bretschneideri [bai li]
gb|ACN36963.1|  unknown                                                 221   8e-67   Zea mays [maize]
ref|XP_010511414.1|  PREDICTED: basic leucine zipper and W2 domai...    220   1e-66   Camelina sativa [gold-of-pleasure]
gb|AAD26879.1|AC007230_13  Contains similarity to gb|D13630 KIAA0...    221   1e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009342882.1|  PREDICTED: basic leucine zipper and W2 domai...    218   1e-66   
gb|EYU39710.1|  hypothetical protein MIMGU_mgv1a024075mg                219   2e-66   Erythranthe guttata [common monkey flower]
ref|XP_010111086.1|  Basic leucine zipper and W2 domain-containin...    221   2e-66   
ref|XP_004979204.1|  PREDICTED: protein extra bases-like isoform X3     219   2e-66   Setaria italica
gb|ADE77903.1|  unknown                                                 219   3e-66   Picea sitchensis
gb|KHN29266.1|  Riboflavin biosynthesis protein RibD                    228   5e-66   Glycine soja [wild soybean]
gb|EEE68271.1|  hypothetical protein OsJ_26502                          219   6e-66   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004979203.1|  PREDICTED: protein extra bases-like isoform X2     218   1e-65   
tpg|DAA38888.1|  TPA: hypothetical protein ZEAMMB73_614010              217   2e-65   
gb|EMS51816.1|  Basic leucine zipper and W2 domain-containing pro...    213   2e-63   Triticum urartu
ref|XP_002968010.1|  hypothetical protein SELMODRAFT_145222             212   2e-63   Selaginella moellendorffii
gb|AFW20016.1|  eIF5-mimic protein                                      212   2e-63   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002992407.1|  hypothetical protein SELMODRAFT_162293             212   2e-63   Selaginella moellendorffii
ref|XP_003577596.1|  PREDICTED: protein krasavietz-like                 212   2e-63   Brachypodium distachyon [annual false brome]
gb|AFW20017.1|  eIF5-mimic protein                                      211   2e-63   Triticum aestivum [Canadian hard winter wheat]
gb|AFW20014.1|  eIF5-mimic protein                                      211   3e-63   Triticum aestivum [Canadian hard winter wheat]
gb|EMT26430.1|  Basic leucine zipper and W2 domain-containing pro...    212   6e-63   
gb|AFW20015.1|  eIF5-mimic protein                                      210   9e-63   Triticum aestivum [Canadian hard winter wheat]
dbj|BAB09363.1|  unnamed protein product                                209   4e-62   Arabidopsis thaliana [mouse-ear cress]
gb|EPS67129.1|  hypothetical protein M569_07647                         202   9e-62   Genlisea aurea
gb|AFW65367.1|  hypothetical protein ZEAMMB73_053341                    205   1e-60   
gb|AAX95492.1|  putative protein                                        203   4e-60   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001785917.1|  predicted protein                                  202   6e-60   
ref|XP_001758587.1|  predicted protein                                  198   3e-58   
ref|XP_004979202.1|  PREDICTED: protein extra bases-like isoform X1     198   2e-57   
ref|XP_001778269.1|  predicted protein                                  174   3e-49   
ref|XP_006428598.1|  hypothetical protein CICLE_v10011861mg             171   3e-48   
ref|XP_006391576.1|  hypothetical protein EUTSA_v10018708mg             160   6e-44   
gb|EEC84251.1|  hypothetical protein OsI_30699                          154   2e-41   Oryza sativa Indica Group [Indian rice]
gb|KDO54045.1|  hypothetical protein CISIN_1g01470512mg                 130   4e-37   Citrus sinensis [apfelsine]
emb|CDP04197.1|  unnamed protein product                                135   2e-34   Coffea canephora [robusta coffee]
emb|CDP04198.1|  unnamed protein product                                119   5e-31   Coffea canephora [robusta coffee]
gb|AFW65369.1|  hypothetical protein ZEAMMB73_053341                    122   5e-30   
gb|AFW65368.1|  hypothetical protein ZEAMMB73_053341                    122   7e-30   
gb|AAX96720.1|  expressed protein                                       120   4e-29   Oryza sativa Japonica Group [Japonica rice]
gb|KIY97135.1|  Basic leucine zipper and W2 domain-containing pro...    111   2e-27   Monoraphidium neglectum
ref|XP_010451657.1|  PREDICTED: basic leucine zipper and W2 domai...    108   2e-25   
ref|XP_002949287.1|  hypothetical protein VOLCADRAFT_74123              109   5e-25   Volvox carteri f. nagariensis
ref|XP_005649553.1|  flagellar associated protein                       107   2e-24   Coccomyxa subellipsoidea C-169
gb|AFA36552.1|  eIF4-gamma/eIF5/eIF2-epsilon domain-containing pr...    100   6e-23   Lolium perenne [perennial ryegrass]
ref|XP_005851110.1|  hypothetical protein CHLNCDRAFT_33763              101   2e-22   Chlorella variabilis
ref|XP_001691456.1|  flagellar associated protein                       101   4e-22   Chlamydomonas reinhardtii
gb|KHN40477.1|  Basic leucine zipper and W2 domain-containing pro...  94.0    1e-19   Glycine soja [wild soybean]
gb|KDD75188.1|  hypothetical protein H632_c819p1                      89.0    1e-17   Helicosporidium sp. ATCC 50920
gb|ABK92853.1|  unknown                                               83.2    1e-17   Populus trichocarpa [western balsam poplar]
ref|XP_011400310.1|  Basic leucine zipper and W2 domain-containin...  84.0    1e-16   Auxenochlorella protothecoides
ref|XP_006984001.1|  PREDICTED: basic leucine zipper and W2 domai...  76.6    4e-13   Peromyscus maniculatus bairdii
dbj|BAC56581.1|  similar to HSPC028                                   73.2    4e-13   Bos taurus [bovine]
gb|EDL36853.1|  basic leucine zipper and W2 domains 2                 75.9    5e-13   Mus musculus [mouse]
ref|XP_005872379.1|  PREDICTED: basic leucine zipper and W2 domai...  75.1    6e-13   
ref|XP_003363351.2|  PREDICTED: basic leucine zipper and W2 domai...  75.1    7e-13   
ref|XP_006984002.1|  PREDICTED: basic leucine zipper and W2 domai...  75.1    8e-13   
gb|ELR55246.1|  Basic leucine zipper and W2 domain-containing pro...  75.1    9e-13   Bos mutus
ref|XP_006779109.1|  PREDICTED: basic leucine zipper and W2 domai...  74.7    1e-12   Myotis davidii
ref|XP_005872378.1|  PREDICTED: basic leucine zipper and W2 domai...  74.7    1e-12   Myotis brandtii
gb|EPQ11510.1|  Basic leucine zipper and W2 domain-containing pro...  74.7    1e-12   Myotis brandtii
ref|XP_002720899.2|  PREDICTED: basic leucine zipper and W2 domai...  74.7    1e-12   
ref|XP_005609298.1|  PREDICTED: basic leucine zipper and W2 domai...  74.7    1e-12   
dbj|BAB55401.1|  unnamed protein product                              72.4    1e-12   Homo sapiens [man]
ref|XP_001503652.2|  PREDICTED: basic leucine zipper and W2 domai...  74.7    1e-12   
ref|XP_006880325.1|  PREDICTED: basic leucine zipper and W2 domai...  74.7    1e-12   Elephantulus edwardii [Cape long-eared elephant shrew]
gb|EPY75777.1|  basic leucine zipper and W2 domain-containing pro...  74.7    1e-12   Camelus ferus
ref|XP_005377393.1|  PREDICTED: basic leucine zipper and W2 domai...  74.7    1e-12   
ref|XP_004702761.1|  PREDICTED: basic leucine zipper and W2 domai...  74.7    2e-12   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_004582525.1|  PREDICTED: basic leucine zipper and W2 domai...  74.7    2e-12   Ochotona princeps [southern American pika]
ref|XP_008518397.1|  PREDICTED: basic leucine zipper and W2 domai...  74.3    2e-12   Equus przewalskii [Przewalski horse]
gb|AAS07544.1|  unknown                                               72.8    2e-12   Homo sapiens [man]
gb|ELK12556.1|  Basic leucine zipper and W2 domain-containing pro...  74.3    2e-12   Pteropus alecto
ref|XP_004431470.1|  PREDICTED: basic leucine zipper and W2 domai...  74.3    2e-12   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_005550109.1|  PREDICTED: basic leucine zipper and W2 domai...  74.3    3e-12   Macaca fascicularis [crab eating macaque]
dbj|BAE37006.1|  unnamed protein product                              72.4    3e-12   Mus musculus [mouse]
ref|XP_007980165.1|  PREDICTED: basic leucine zipper and W2 domai...  73.6    4e-12   Chlorocebus sabaeus
ref|XP_003252649.1|  PREDICTED: basic leucine zipper and W2 domai...  73.6    4e-12   Nomascus leucogenys [White-cheeked Gibbon]
gb|KFO25107.1|  Basic leucine zipper and W2 domain-containing pro...  73.9    4e-12   Fukomys damarensis [Damara mole rat]
ref|XP_004467998.1|  PREDICTED: basic leucine zipper and W2 domai...  73.6    4e-12   
ref|XP_007670463.1|  PREDICTED: basic leucine zipper and W2 domai...  70.5    4e-12   
ref|XP_004322946.1|  PREDICTED: LOW QUALITY PROTEIN: basic leucin...  73.6    4e-12   
ref|XP_004467999.1|  PREDICTED: basic leucine zipper and W2 domai...  73.6    4e-12   
gb|KFQ25026.1|  Basic leucine zipper and W2 domain-containing pro...  71.2    5e-12   Mesitornis unicolor
ref|XP_005897433.1|  PREDICTED: basic leucine zipper and W2 domai...  72.8    5e-12   Bos mutus
gb|KFM74754.1|  Basic leucine zipper and W2 domain-containing pro...  70.9    5e-12   Stegodyphus mimosarum
ref|XP_006057098.1|  PREDICTED: basic leucine zipper and W2 domai...  72.8    5e-12   Bubalus bubalis [domestic water buffalo]
ref|XP_006984003.1|  PREDICTED: basic leucine zipper and W2 domai...  72.8    5e-12   Peromyscus maniculatus bairdii
ref|NP_001098431.1|  basic leucine zipper and W2 domain-containin...  72.8    5e-12   Bos taurus [bovine]
ref|XP_004677180.1|  PREDICTED: basic leucine zipper and W2 domai...  72.4    6e-12   Condylura cristata
ref|XP_009000566.1|  PREDICTED: basic leucine zipper and W2 domai...  72.4    6e-12   
ref|XP_006515229.1|  PREDICTED: basic leucine zipper and W2 domai...  72.4    7e-12   Mus musculus [mouse]
dbj|BAE21252.1|  unnamed protein product                              72.0    7e-12   Mus musculus [mouse]
ref|NP_054757.1|  basic leucine zipper and W2 domain-containing p...  72.4    7e-12   Homo sapiens [man]
ref|XP_005343908.1|  PREDICTED: basic leucine zipper and W2 domai...  72.4    7e-12   Microtus ochrogaster [prairie voles]
ref|XP_004652900.1|  PREDICTED: basic leucine zipper and W2 domai...  72.4    7e-12   Jaculus jaculus
sp|Q4R6R4.1|BZW2_MACFA  RecName: Full=Basic leucine zipper and W2...  72.4    7e-12   Macaca fascicularis [crab eating macaque]
ref|XP_011361151.1|  PREDICTED: basic leucine zipper and W2 domai...  72.4    7e-12   Pteropus vampyrus
ref|XP_004602288.1|  PREDICTED: basic leucine zipper and W2 domai...  72.4    7e-12   Sorex araneus [Eurasian shrew]
ref|XP_007469093.1|  PREDICTED: basic leucine zipper and W2 domai...  72.0    7e-12   Lipotes vexillifer [baiji]
ref|XP_007089144.1|  PREDICTED: basic leucine zipper and W2 domai...  72.4    7e-12   
ref|XP_008054054.1|  PREDICTED: basic leucine zipper and W2 domai...  72.4    7e-12   Carlito syrichta
ref|XP_006832306.1|  PREDICTED: basic leucine zipper and W2 domai...  72.4    7e-12   Chrysochloris asiatica
ref|XP_005971758.1|  PREDICTED: basic leucine zipper and W2 domai...  72.4    7e-12   Pantholops hodgsonii [Tibetan antelope]
ref|XP_008684584.1|  PREDICTED: LOW QUALITY PROTEIN: basic leucin...  72.4    8e-12   Ursus maritimus [white bear]
ref|XP_004626492.1|  PREDICTED: basic leucine zipper and W2 domai...  72.4    8e-12   Octodon degus
ref|XP_010641639.1|  PREDICTED: basic leucine zipper and W2 domai...  72.4    8e-12   Fukomys damarensis [Damara mole rat]
ref|NP_599229.1|  basic leucine zipper and W2 domain-containing p...  72.4    8e-12   Rattus norvegicus [brown rat]
ref|XP_002917447.1|  PREDICTED: basic leucine zipper and W2 domai...  72.4    8e-12   Ailuropoda melanoleuca
ref|XP_007164967.1|  PREDICTED: basic leucine zipper and W2 domai...  72.4    8e-12   Balaenoptera acutorostrata scammoni
ref|XP_004007819.1|  PREDICTED: basic leucine zipper and W2 domai...  72.4    8e-12   Ovis aries [domestic sheep]
gb|AAG39278.1|AF110323_1  MSTP017                                     72.4    8e-12   Homo sapiens [man]
ref|XP_007944355.1|  PREDICTED: basic leucine zipper and W2 domai...  72.4    8e-12   Orycteropus afer afer
ref|NP_080116.2|  basic leucine zipper and W2 domain-containing p...  72.4    8e-12   Mus musculus [mouse]
ref|NP_001231936.1|  basic leucine zipper and W2 domains 2            72.4    8e-12   Sus scrofa [pigs]
ref|XP_006880326.1|  PREDICTED: basic leucine zipper and W2 domai...  72.4    8e-12   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_005328834.1|  PREDICTED: basic leucine zipper and W2 domai...  72.4    8e-12   Ictidomys tridecemlineatus
ref|XP_003782773.1|  PREDICTED: basic leucine zipper and W2 domai...  72.4    8e-12   Otolemur garnettii
ref|XP_008835828.1|  PREDICTED: basic leucine zipper and W2 domai...  72.4    8e-12   Nannospalax galili
ref|XP_008272300.1|  PREDICTED: basic leucine zipper and W2 domai...  72.4    8e-12   Oryctolagus cuniculus [domestic rabbit]
ref|XP_010965456.1|  PREDICTED: basic leucine zipper and W2 domai...  72.4    8e-12   Camelus bactrianus [camel]
ref|XP_005679051.1|  PREDICTED: basic leucine zipper and W2 domai...  72.4    8e-12   Capra hircus [domestic goat]
ref|XP_004839653.1|  PREDICTED: basic leucine zipper and W2 domai...  72.4    8e-12   Heterocephalus glaber [naked mole rat]
gb|AAI07758.1|  BZW2 protein                                          72.4    8e-12   Homo sapiens [man]
ref|XP_004882667.1|  PREDICTED: basic leucine zipper and W2 domai...  72.4    8e-12   
dbj|BAG50880.1|  unnamed protein product                              72.4    8e-12   Homo sapiens [man]
ref|XP_001495986.1|  PREDICTED: basic leucine zipper and W2 domai...  72.4    8e-12   Equus caballus [domestic horse]
ref|XP_006927164.1|  PREDICTED: LOW QUALITY PROTEIN: basic leucin...  72.4    8e-12   Pteropus alecto
ref|XP_006191697.1|  PREDICTED: basic leucine zipper and W2 domai...  72.4    8e-12   Camelus ferus
ref|XP_007532027.1|  PREDICTED: basic leucine zipper and W2 domai...  72.4    8e-12   Erinaceus europaeus [common hedgehog]
ref|XP_004743452.1|  PREDICTED: basic leucine zipper and W2 domai...  72.4    9e-12   
ref|XP_010982979.1|  PREDICTED: basic leucine zipper and W2 domai...  72.4    9e-12   Camelus dromedarius [camel]
ref|XP_004400259.1|  PREDICTED: basic leucine zipper and W2 domai...  72.4    9e-12   Odobenus rosmarus divergens
dbj|BAE91760.1|  unnamed protein product                              70.5    9e-12   Macaca fascicularis [crab eating macaque]
gb|AAI02136.1|  BZW1 protein                                          70.5    1e-11   Bos taurus [bovine]
dbj|BAE21963.1|  unnamed protein product                              70.5    1e-11   Mus musculus [mouse]
ref|XP_004468000.1|  PREDICTED: basic leucine zipper and W2 domai...  72.0    1e-11   
ref|XP_005076276.1|  PREDICTED: basic leucine zipper and W2 domai...  72.0    1e-11   Mesocricetus auratus [Syrian golden hamster]
ref|XP_003507914.1|  PREDICTED: basic leucine zipper and W2 domai...  72.0    1e-11   Cricetulus griseus [Chinese hamsters]
ref|XP_003407143.1|  PREDICTED: basic leucine zipper and W2 domai...  72.0    1e-11   Loxodonta africana [African bush elephant]
ref|XP_007121680.1|  PREDICTED: basic leucine zipper and W2 domai...  71.6    1e-11   Physeter catodon
ref|XP_010188469.1|  PREDICTED: basic leucine zipper and W2 domai...  70.5    1e-11   Mesitornis unicolor
ref|XP_004263520.1|  PREDICTED: basic leucine zipper and W2 domai...  71.6    1e-11   Orcinus orca [Orca]
ref|XP_003252651.1|  PREDICTED: basic leucine zipper and W2 domai...  68.9    1e-11   
sp|Q803N9.2|BZW1B_DANRE  RecName: Full=Basic leucine zipper and W...  71.2    2e-11   Danio rerio [leopard danio]
gb|AAH44401.1|  Bzw1b protein                                         71.2    2e-11   Danio rerio [leopard danio]
ref|NP_998257.1|  basic leucine zipper and W2 domain-containing p...  71.2    2e-11   Danio rerio [leopard danio]
ref|XP_006902019.1|  PREDICTED: basic leucine zipper and W2 domai...  70.5    2e-11   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_005373296.1|  PREDICTED: basic leucine zipper and W2 domai...  70.5    2e-11   
gb|KFP19841.1|  Basic leucine zipper and W2 domain-containing pro...  70.9    2e-11   Egretta garzetta
ref|XP_005961652.1|  PREDICTED: basic leucine zipper and W2 domai...  70.5    2e-11   Pantholops hodgsonii [Tibetan antelope]
ref|NP_055485.2|  basic leucine zipper and W2 domain-containing p...  70.5    2e-11   Homo sapiens [man]
gb|KFO07364.1|  Basic leucine zipper and W2 domain-containing pro...  70.9    2e-11   Balearica regulorum gibbericeps
ref|XP_007933469.1|  PREDICTED: basic leucine zipper and W2 domai...  70.5    2e-11   Orycteropus afer afer
ref|XP_005070669.1|  PREDICTED: basic leucine zipper and W2 domai...  70.5    2e-11   
gb|KFQ53077.1|  Basic leucine zipper and W2 domain-containing pro...  70.9    2e-11   Pelecanus crispus
gb|ERE73228.1|  basic leucine zipper and W2 domain-containing pro...  68.2    2e-11   Cricetulus griseus [Chinese hamsters]
gb|KFV60001.1|  Basic leucine zipper and W2 domain-containing pro...  70.9    2e-11   Tyto alba [Schleiereule]
ref|XP_005452376.1|  PREDICTED: basic leucine zipper and W2 domai...  70.9    2e-11   Oreochromis niloticus
ref|XP_006792914.1|  PREDICTED: basic leucine zipper and W2 domai...  70.9    2e-11   Neolamprologus brichardi [lyretail cichlid]
ref|XP_003507081.1|  PREDICTED: basic leucine zipper and W2 domai...  70.9    2e-11   Cricetulus griseus [Chinese hamsters]
ref|XP_005484252.1|  PREDICTED: basic leucine zipper and W2 domai...  70.9    2e-11   
gb|ERE81520.1|  basic leucine zipper and W2 domain-containing pro...  70.9    2e-11   Cricetulus griseus [Chinese hamsters]
gb|KFQ20920.1|  Basic leucine zipper and W2 domain-containing pro...  70.9    2e-11   Merops nubicus
gb|KFO52850.1|  Basic leucine zipper and W2 domain-containing pro...  70.9    2e-11   Corvus brachyrhynchos
ref|XP_006889203.1|  PREDICTED: basic leucine zipper and W2 domai...  70.5    2e-11   Elephantulus edwardii [Cape long-eared elephant shrew]
gb|KFM11188.1|  Basic leucine zipper and W2 domain-containing pro...  70.9    2e-11   Aptenodytes forsteri
gb|KFW61776.1|  Basic leucine zipper and W2 domain-containing pro...  70.9    2e-11   Pygoscelis adeliae
ref|XP_005049250.1|  PREDICTED: basic leucine zipper and W2 domai...  70.9    3e-11   
gb|KFQ94798.1|  Basic leucine zipper and W2 domain-containing pro...  70.9    3e-11   Nipponia nippon
gb|KFP93837.1|  Basic leucine zipper and W2 domain-containing pro...  70.9    3e-11   Haliaeetus albicilla
gb|KFP26826.1|  Basic leucine zipper and W2 domain-containing pro...  70.9    3e-11   Colius striatus
ref|XP_010124739.1|  PREDICTED: basic leucine zipper and W2 domai...  70.5    3e-11   Chlamydotis macqueenii
dbj|BAA02795.2|  KIAA0005                                             70.9    3e-11   
gb|KFQ74225.1|  Basic leucine zipper and W2 domain-containing pro...  70.9    3e-11   Phoenicopterus ruber ruber
ref|NP_001006516.1|  basic leucine zipper and W2 domain-containin...  70.9    3e-11   Gallus gallus [bantam]
ref|XP_009460539.1|  PREDICTED: basic leucine zipper and W2 domai...  70.9    3e-11   Nipponia nippon
gb|EMC81148.1|  Basic leucine zipper and W2 domain-containing pro...  70.9    3e-11   
gb|ELW62681.1|  Basic leucine zipper and W2 domain-containing pro...  70.9    3e-11   Tupaia chinensis
ref|XP_005436565.1|  PREDICTED: basic leucine zipper and W2 domai...  70.5    3e-11   
ref|XP_005416002.1|  PREDICTED: basic leucine zipper and W2 domai...  70.1    3e-11   Geospiza fortis
ref|XP_004563379.1|  PREDICTED: basic leucine zipper and W2 domai...  70.9    3e-11   Maylandia zebra
ref|XP_009976811.1|  PREDICTED: basic leucine zipper and W2 domai...  70.1    3e-11   Tauraco erythrolophus
gb|KFU84972.1|  Basic leucine zipper and W2 domain-containing pro...  70.9    3e-11   Chaetura pelagica
ref|XP_006636841.1|  PREDICTED: basic leucine zipper and W2 domai...  70.1    3e-11   
gb|KFQ54440.1|  Basic leucine zipper and W2 domain-containing pro...  70.9    3e-11   Nestor notabilis
dbj|BAD96965.1|  BZW1 protein variant                                 70.9    3e-11   Homo sapiens [man]
ref|XP_005511350.1|  PREDICTED: basic leucine zipper and W2 domai...  70.1    3e-11   
ref|XP_005416001.1|  PREDICTED: basic leucine zipper and W2 domai...  70.9    3e-11   
ref|XP_005230988.1|  PREDICTED: basic leucine zipper and W2 domai...  70.5    3e-11   
ref|XP_002799068.1|  PREDICTED: basic leucine zipper and W2 domai...  70.9    3e-11   
gb|ACX94457.1|  basic leucine zipper and W2 domains 1 transcripti...  69.3    3e-11   Sparus aurata [gilthead bream]
ref|XP_008628053.1|  PREDICTED: basic leucine zipper and W2 domai...  70.1    3e-11   
gb|KFP44844.1|  Basic leucine zipper and W2 domain-containing pro...  70.5    3e-11   Chlamydotis macqueenii
gb|ELR46042.1|  Basic leucine zipper and W2 domain-containing pro...  70.9    3e-11   Bos mutus
ref|XP_007469265.1|  PREDICTED: basic leucine zipper and W2 domai...  70.9    3e-11   Lipotes vexillifer [baiji]
ref|XP_009972311.1|  PREDICTED: basic leucine zipper and W2 domai...  70.1    3e-11   Tyto alba [Schleiereule]
ref|NP_001193998.1|  basic leucine zipper and W2 domain-containin...  70.5    3e-11   
ref|XP_006205233.1|  PREDICTED: basic leucine zipper and W2 domai...  70.5    3e-11   
ref|XP_007251728.1|  PREDICTED: basic leucine zipper and W2 domai...  70.5    3e-11   
ref|XP_005310368.1|  PREDICTED: basic leucine zipper and W2 domai...  70.5    3e-11   
ref|XP_004910219.1|  PREDICTED: basic leucine zipper and W2 domai...  70.9    3e-11   
ref|XP_004262921.1|  PREDICTED: basic leucine zipper and W2 domai...  70.9    3e-11   
ref|XP_004653644.1|  PREDICTED: basic leucine zipper and W2 domai...  70.9    3e-11   
ref|XP_007071924.1|  PREDICTED: basic leucine zipper and W2 domai...  70.5    3e-11   
ref|XP_004910220.1|  PREDICTED: basic leucine zipper and W2 domai...  70.9    3e-11   
ref|XP_004637172.1|  PREDICTED: basic leucine zipper and W2 domai...  68.6    3e-11   
ref|XP_006496260.1|  PREDICTED: basic leucine zipper and W2 domai...  70.9    3e-11   
ref|XP_004033061.1|  PREDICTED: basic leucine zipper and W2 domai...  70.9    3e-11   
ref|XP_008144695.1|  PREDICTED: basic leucine zipper and W2 domai...  70.1    3e-11   
ref|XP_001364367.2|  PREDICTED: basic leucine zipper and W2 domai...  70.5    3e-11   
ref|XP_005373295.1|  PREDICTED: basic leucine zipper and W2 domai...  70.5    3e-11   
ref|XP_003907838.1|  PREDICTED: basic leucine zipper and W2 domai...  70.5    3e-11   
ref|XP_003253960.1|  PREDICTED: basic leucine zipper and W2 domai...  70.5    3e-11   
ref|XP_004004862.1|  PREDICTED: basic leucine zipper and W2 domai...  70.5    3e-11   
ref|XP_006118000.1|  PREDICTED: LOW QUALITY PROTEIN: basic leucin...  70.5    4e-11   
ref|XP_004910221.1|  PREDICTED: basic leucine zipper and W2 domai...  70.5    4e-11   
ref|XP_004378263.1|  PREDICTED: basic leucine zipper and W2 domai...  70.5    4e-11   
ref|XP_007501656.1|  PREDICTED: basic leucine zipper and W2 domai...  70.5    4e-11   
gb|KGL97386.1|  Basic leucine zipper and W2 domain-containing pro...  70.5    4e-11   
ref|XP_003463384.1|  PREDICTED: basic leucine zipper and W2 domai...  70.5    4e-11   
ref|XP_004628712.1|  PREDICTED: basic leucine zipper and W2 domai...  70.5    4e-11   
ref|NP_001193997.1|  basic leucine zipper and W2 domain-containin...  70.5    4e-11   
ref|XP_001170500.1|  PREDICTED: basic leucine zipper and W2 domai...  70.5    4e-11   
ref|XP_007963986.1|  PREDICTED: basic leucine zipper and W2 domai...  70.9    4e-11   
ref|XP_008257167.1|  PREDICTED: basic leucine zipper and W2 domai...  70.9    4e-11   
ref|XP_005049248.1|  PREDICTED: basic leucine zipper and W2 domai...  70.9    4e-11   
ref|XP_005961651.1|  PREDICTED: basic leucine zipper and W2 domai...  70.5    4e-11   
ref|NP_080100.1|  basic leucine zipper and W2 domain-containing p...  70.5    4e-11   
ref|XP_004314115.1|  PREDICTED: basic leucine zipper and W2 domai...  70.5    4e-11   
ref|XP_004458989.1|  PREDICTED: basic leucine zipper and W2 domai...  70.5    4e-11   
ref|XP_010615877.1|  PREDICTED: basic leucine zipper and W2 domai...  70.5    4e-11   
ref|XP_007933453.1|  PREDICTED: basic leucine zipper and W2 domai...  70.5    4e-11   
ref|XP_003907839.1|  PREDICTED: basic leucine zipper and W2 domai...  70.5    4e-11   
ref|XP_003785089.1|  PREDICTED: basic leucine zipper and W2 domai...  70.5    4e-11   
ref|XP_005985943.1|  PREDICTED: LOW QUALITY PROTEIN: basic leucin...  70.5    4e-11   
ref|NP_001126313.1|  basic leucine zipper and W2 domain-containin...  70.5    4e-11   
gb|KGL84078.1|  Basic leucine zipper and W2 domain-containing pro...  70.5    4e-11   
ref|XP_003991058.1|  PREDICTED: basic leucine zipper and W2 domai...  70.5    4e-11   
ref|XP_006190019.1|  PREDICTED: basic leucine zipper and W2 domai...  70.5    4e-11   
ref|XP_004262922.1|  PREDICTED: basic leucine zipper and W2 domai...  70.5    4e-11   
ref|XP_002915887.1|  PREDICTED: basic leucine zipper and W2 domai...  70.5    4e-11   
ref|XP_006205232.1|  PREDICTED: basic leucine zipper and W2 domai...  70.5    4e-11   
ref|XP_004674454.1|  PREDICTED: basic leucine zipper and W2 domai...  70.5    4e-11   
ref|XP_849107.2|  PREDICTED: basic leucine zipper and W2 domain-c...  70.5    4e-11   
ref|XP_006902020.1|  PREDICTED: basic leucine zipper and W2 domai...  70.5    4e-11   
ref|XP_006862055.1|  PREDICTED: basic leucine zipper and W2 domai...  70.5    4e-11   
ref|XP_006022162.1|  PREDICTED: basic leucine zipper and W2 domai...  70.5    4e-11   
ref|XP_006047606.1|  PREDICTED: basic leucine zipper and W2 domai...  70.5    4e-11   
ref|XP_003925721.1|  PREDICTED: basic leucine zipper and W2 domai...  70.5    4e-11   
ref|XP_010306414.1|  PREDICTED: basic leucine zipper and W2 domai...  70.1    4e-11   
ref|XP_009943914.1|  PREDICTED: basic leucine zipper and W2 domai...  70.1    4e-11   
ref|XP_005000767.1|  PREDICTED: basic leucine zipper and W2 domai...  70.5    4e-11   
ref|XP_010222873.1|  PREDICTED: basic leucine zipper and W2 domai...  70.1    4e-11   
ref|XP_004458988.1|  PREDICTED: basic leucine zipper and W2 domai...  70.5    4e-11   
ref|XP_009559513.1|  PREDICTED: LOW QUALITY PROTEIN: basic leucin...  70.1    4e-11   
gb|KFW86992.1|  Basic leucine zipper and W2 domain-containing pro...  70.5    4e-11   
ref|XP_009331180.1|  PREDICTED: basic leucine zipper and W2 domai...  70.1    4e-11   
ref|XP_010076395.1|  PREDICTED: basic leucine zipper and W2 domai...  69.7    4e-11   
gb|KFU99240.1|  Basic leucine zipper and W2 domain-containing pro...  70.1    4e-11   
ref|XP_009888475.1|  PREDICTED: basic leucine zipper and W2 domai...  69.7    4e-11   
ref|XP_010294633.1|  PREDICTED: LOW QUALITY PROTEIN: basic leucin...  70.1    4e-11   
ref|XP_009641859.1|  PREDICTED: LOW QUALITY PROTEIN: basic leucin...  70.1    4e-11   
ref|XP_008068959.1|  PREDICTED: basic leucine zipper and W2 domai...  70.5    5e-11   
ref|XP_010205105.1|  PREDICTED: basic leucine zipper and W2 domai...  70.1    5e-11   
ref|XP_005511349.1|  PREDICTED: basic leucine zipper and W2 domai...  70.1    5e-11   
ref|XP_008945250.1|  PREDICTED: basic leucine zipper and W2 domai...  70.1    5e-11   
ref|XP_005230989.1|  PREDICTED: basic leucine zipper and W2 domai...  70.1    5e-11   
ref|XP_009076880.1|  PREDICTED: LOW QUALITY PROTEIN: basic leucin...  70.1    5e-11   
ref|XP_009282942.1|  PREDICTED: basic leucine zipper and W2 domai...  70.1    5e-11   
ref|XP_005436564.1|  PREDICTED: basic leucine zipper and W2 domai...  70.1    5e-11   
ref|XP_009484334.1|  PREDICTED: basic leucine zipper and W2 domai...  69.7    5e-11   
ref|XP_002190923.1|  PREDICTED: basic leucine zipper and W2 domai...  70.1    5e-11   
ref|XP_009972310.1|  PREDICTED: basic leucine zipper and W2 domai...  70.1    5e-11   
ref|XP_010124738.1|  PREDICTED: basic leucine zipper and W2 domai...  70.1    5e-11   
ref|XP_009512851.1|  PREDICTED: basic leucine zipper and W2 domai...  67.0    5e-11   
ref|XP_006636842.1|  PREDICTED: basic leucine zipper and W2 domai...  70.1    5e-11   
ref|XP_010005650.1|  PREDICTED: basic leucine zipper and W2 domai...  70.1    5e-11   
gb|EPY77221.1|  aldehyde oxidase 3-like protein                       71.2    5e-11   
ref|XP_005519967.1|  PREDICTED: basic leucine zipper and W2 domai...  70.1    5e-11   
ref|XP_008144694.1|  PREDICTED: basic leucine zipper and W2 domai...  70.1    5e-11   
ref|XP_010018166.1|  PREDICTED: LOW QUALITY PROTEIN: basic leucin...  70.1    5e-11   
ref|XP_006756329.1|  PREDICTED: basic leucine zipper and W2 domai...  70.1    5e-11   
dbj|BAB27495.1|  unnamed protein product                              70.1    5e-11   
ref|XP_008144693.1|  PREDICTED: basic leucine zipper and W2 domai...  70.1    5e-11   
ref|XP_005874197.1|  PREDICTED: basic leucine zipper and W2 domai...  69.7    6e-11   
ref|XP_005049249.1|  PREDICTED: basic leucine zipper and W2 domai...  70.1    6e-11   
ref|XP_007897894.1|  PREDICTED: basic leucine zipper and W2 domai...  69.7    6e-11   
ref|XP_008494163.1|  PREDICTED: LOW QUALITY PROTEIN: basic leucin...  69.7    6e-11   
ref|XP_003966731.1|  PREDICTED: basic leucine zipper and W2 domai...  69.7    6e-11   
ref|XP_009888474.1|  PREDICTED: basic leucine zipper and W2 domai...  69.7    7e-11   
ref|XP_008929359.1|  PREDICTED: basic leucine zipper and W2 domai...  69.7    7e-11   
emb|CAG10296.1|  unnamed protein product                              69.7    7e-11   
ref|XP_010076394.1|  PREDICTED: basic leucine zipper and W2 domai...  69.7    7e-11   
ref|XP_005366401.1|  PREDICTED: basic leucine zipper and W2 domai...  69.7    7e-11   
gb|EKC29192.1|  Basic leucine zipper and W2 domain-containing pro...  70.1    7e-11   
ref|XP_005807420.1|  PREDICTED: basic leucine zipper and W2 domai...  69.3    8e-11   
ref|NP_001080291.1|  basic leucine zipper and W2 domain-containin...  69.3    8e-11   
ref|NP_989281.1|  basic leucine zipper and W2 domain-containing p...  69.3    8e-11   
ref|XP_008395642.1|  PREDICTED: basic leucine zipper and W2 domai...  69.3    8e-11   
ref|XP_011479688.1|  PREDICTED: basic leucine zipper and W2 domai...  69.3    9e-11   
ref|XP_003765935.1|  PREDICTED: basic leucine zipper and W2 domai...  69.7    9e-11   
ref|XP_010751712.1|  PREDICTED: basic leucine zipper and W2 domai...  69.3    9e-11   
ref|XP_007568735.1|  PREDICTED: basic leucine zipper and W2 domai...  69.3    9e-11   
ref|XP_005997592.1|  PREDICTED: basic leucine zipper and W2 domai...  69.3    9e-11   
ref|XP_008298567.1|  PREDICTED: basic leucine zipper and W2 domai...  69.3    9e-11   
ref|XP_010765801.1|  PREDICTED: basic leucine zipper and W2 domai...  68.6    1e-10   
ref|XP_010889360.1|  PREDICTED: basic leucine zipper and W2 domai...  69.3    1e-10   
ref|XP_010889363.1|  PREDICTED: basic leucine zipper and W2 domai...  68.9    1e-10   
ref|XP_005997591.1|  PREDICTED: basic leucine zipper and W2 domai...  69.3    1e-10   
gb|KFM79503.1|  Basic leucine zipper and W2 domain-containing pro...  68.9    1e-10   
ref|XP_005145607.1|  PREDICTED: basic leucine zipper and W2 domai...  68.9    1e-10   
ref|XP_010765800.1|  PREDICTED: basic leucine zipper and W2 domai...  68.9    1e-10   
dbj|BAH13321.1|  unnamed protein product                              66.2    1e-10   
ref|XP_005014601.1|  PREDICTED: LOW QUALITY PROTEIN: basic leucin...  68.6    1e-10   
ref|XP_007257126.1|  PREDICTED: basic leucine zipper and W2 domai...  68.6    1e-10   
emb|CDQ73400.1|  unnamed protein product                              68.6    1e-10   
ref|XP_009241238.1|  PREDICTED: basic leucine zipper and W2 domai...  68.2    1e-10   
dbj|BAE40121.1|  unnamed protein product                              68.6    2e-10   
emb|CDQ74967.1|  unnamed protein product                              68.6    2e-10   
gb|ADY39528.1|  putative basic leucine zipper                         66.6    2e-10   
ref|XP_009052769.1|  hypothetical protein LOTGIDRAFT_115834           68.6    2e-10   
ref|XP_003772440.1|  PREDICTED: basic leucine zipper and W2 domai...  68.2    2e-10   
ref|XP_006018981.1|  PREDICTED: basic leucine zipper and W2 domai...  68.2    2e-10   
ref|XP_008112014.1|  PREDICTED: basic leucine zipper and W2 domai...  68.2    2e-10   
ref|XP_007428051.1|  PREDICTED: basic leucine zipper and W2 domai...  68.2    2e-10   
ref|NP_956002.1|  basic leucine zipper and W2 domain-containing p...  68.2    2e-10   
emb|CDQ60337.1|  unnamed protein product                              68.2    2e-10   
ref|XP_006018980.1|  PREDICTED: basic leucine zipper and W2 domai...  68.2    2e-10   
tpg|DAA38889.1|  TPA: hypothetical protein ZEAMMB73_614010            63.5    2e-10   
ref|XP_010900768.1|  PREDICTED: basic leucine zipper and W2 domai...  68.2    2e-10   
ref|XP_004478150.1|  PREDICTED: basic leucine zipper and W2 domai...  67.4    3e-10   
ref|XP_005003706.1|  PREDICTED: LOW QUALITY PROTEIN: basic leucin...  68.2    3e-10   
ref|XP_003962113.1|  PREDICTED: basic leucine zipper and W2 domai...  67.8    4e-10   
gb|KFV07647.1|  Basic leucine zipper and W2 domain-containing pro...  67.4    4e-10   
gb|KFP73601.1|  Basic leucine zipper and W2 domain-containing pro...  67.4    4e-10   
ref|XP_006793711.1|  PREDICTED: basic leucine zipper and W2 domai...  67.4    4e-10   
gb|KFP55573.1|  Basic leucine zipper and W2 domain-containing pro...  67.4    4e-10   
ref|XP_009569125.1|  PREDICTED: basic leucine zipper and W2 domai...  67.0    4e-10   
gb|KFP91580.1|  Basic leucine zipper and W2 domain-containing pro...  67.4    4e-10   
ref|XP_003443375.1|  PREDICTED: basic leucine zipper and W2 domai...  67.4    4e-10   
ref|XP_004478149.1|  PREDICTED: basic leucine zipper and W2 domai...  67.4    4e-10   
ref|XP_004566089.1|  PREDICTED: basic leucine zipper and W2 domai...  67.0    5e-10   
ref|XP_005100739.1|  PREDICTED: basic leucine zipper and W2 domai...  67.0    5e-10   
ref|XP_010143246.1|  PREDICTED: basic leucine zipper and W2 domai...  66.6    5e-10   
gb|ADO28054.1|  basic leucine zipper and w2 domain-containing pro...  67.0    6e-10   
ref|XP_010149860.1|  PREDICTED: basic leucine zipper and W2 domai...  65.5    6e-10   
ref|XP_009569123.1|  PREDICTED: basic leucine zipper and W2 domai...  66.6    6e-10   
ref|XP_005306713.1|  PREDICTED: basic leucine zipper and W2 domai...  66.6    6e-10   
ref|XP_005306712.1|  PREDICTED: basic leucine zipper and W2 domai...  66.6    6e-10   
ref|XP_008322989.1|  PREDICTED: basic leucine zipper and W2 domai...  66.6    6e-10   
ref|XP_002933339.1|  PREDICTED: basic leucine zipper and W2 domai...  66.6    7e-10   
ref|XP_007069562.1|  PREDICTED: basic leucine zipper and W2 domai...  66.6    7e-10   
ref|NP_001006358.2|  basic leucine zipper and W2 domain-containin...  66.6    7e-10   
ref|XP_005306709.1|  PREDICTED: basic leucine zipper and W2 domai...  66.6    7e-10   
sp|Q5ZL42.1|BZW2_CHICK  RecName: Full=Basic leucine zipper and W2...  66.6    7e-10   
ref|XP_009569124.1|  PREDICTED: basic leucine zipper and W2 domai...  66.6    7e-10   
ref|XP_010729962.1|  PREDICTED: basic leucine zipper and W2 domai...  66.6    8e-10   
ref|XP_005306711.1|  PREDICTED: basic leucine zipper and W2 domai...  66.6    8e-10   
gb|ELT97012.1|  hypothetical protein CAPTEDRAFT_164650                66.2    8e-10   
ref|XP_010143245.1|  PREDICTED: basic leucine zipper and W2 domai...  66.2    9e-10   
ref|XP_010182054.1|  PREDICTED: basic leucine zipper and W2 domai...  65.9    9e-10   
ref|XP_005015189.1|  PREDICTED: basic leucine zipper and W2 domai...  65.9    9e-10   
ref|XP_010143244.1|  PREDICTED: basic leucine zipper and W2 domai...  66.2    9e-10   
ref|XP_007430425.1|  PREDICTED: basic leucine zipper and W2 domai...  66.2    1e-09   
emb|CAG10097.1|  unnamed protein product                              66.2    1e-09   
ref|XP_007249349.1|  PREDICTED: basic leucine zipper and W2 domai...  66.2    1e-09   
ref|XP_006138392.1|  PREDICTED: basic leucine zipper and W2 domai...  65.9    1e-09   
ref|XP_008281011.1|  PREDICTED: basic leucine zipper and W2 domai...  65.9    1e-09   
ref|XP_005015188.1|  PREDICTED: basic leucine zipper and W2 domai...  65.9    1e-09   
ref|XP_005152933.1|  PREDICTED: basic leucine zipper and W2 domai...  65.5    1e-09   
ref|XP_005418603.1|  PREDICTED: basic leucine zipper and W2 domai...  65.5    1e-09   
ref|XP_010128746.1|  PREDICTED: basic leucine zipper and W2 domai...  65.5    1e-09   
ref|XP_005518906.1|  PREDICTED: basic leucine zipper and W2 domai...  65.5    1e-09   
ref|XP_007249348.1|  PREDICTED: basic leucine zipper and W2 domai...  65.9    1e-09   
ref|XP_008492410.1|  PREDICTED: basic leucine zipper and W2 domai...  65.5    1e-09   
ref|XP_009993247.1|  PREDICTED: basic leucine zipper and W2 domai...  65.5    1e-09   
ref|XP_003222184.2|  PREDICTED: basic leucine zipper and W2 domai...  65.9    1e-09   
ref|XP_005445165.1|  PREDICTED: basic leucine zipper and W2 domai...  65.5    1e-09   
ref|XP_009482718.1|  PREDICTED: basic leucine zipper and W2 domai...  65.5    1e-09   
ref|XP_009702370.1|  PREDICTED: basic leucine zipper and W2 domai...  65.5    2e-09   
ref|XP_008918612.1|  PREDICTED: basic leucine zipper and W2 domai...  65.5    2e-09   
ref|XP_011452810.1|  PREDICTED: basic leucine zipper and W2 domai...  65.5    2e-09   
ref|XP_010182053.1|  PREDICTED: basic leucine zipper and W2 domai...  65.5    2e-09   
ref|XP_009873335.1|  PREDICTED: basic leucine zipper and W2 domai...  65.5    2e-09   
ref|XP_009812876.1|  PREDICTED: basic leucine zipper and W2 domai...  65.5    2e-09   
ref|XP_005235685.1|  PREDICTED: basic leucine zipper and W2 domai...  65.5    2e-09   
ref|XP_010072667.1|  PREDICTED: basic leucine zipper and W2 domai...  65.5    2e-09   
ref|XP_010311887.1|  PREDICTED: basic leucine zipper and W2 domai...  65.5    2e-09   
ref|XP_008946936.1|  PREDICTED: basic leucine zipper and W2 domai...  65.1    2e-09   
ref|XP_009082503.1|  PREDICTED: basic leucine zipper and W2 domai...  65.1    2e-09   
ref|XP_007249350.1|  PREDICTED: basic leucine zipper and W2 domai...  65.5    2e-09   
ref|XP_009082500.1|  PREDICTED: basic leucine zipper and W2 domai...  65.5    2e-09   
gb|EPB86654.1|  hypothetical protein HMPREF1544_06534                 65.5    2e-09   
ref|XP_010575937.1|  PREDICTED: basic leucine zipper and W2 domai...  65.1    2e-09   
ref|XP_008628175.1|  PREDICTED: basic leucine zipper and W2 domai...  65.1    2e-09   
ref|XP_009459433.1|  PREDICTED: LOW QUALITY PROTEIN: basic leucin...  65.1    2e-09   
ref|XP_009482717.1|  PREDICTED: basic leucine zipper and W2 domai...  65.1    2e-09   
ref|XP_010072668.1|  PREDICTED: basic leucine zipper and W2 domai...  65.1    2e-09   
ref|XP_009917176.1|  PREDICTED: LOW QUALITY PROTEIN: basic leucin...  65.1    2e-09   
ref|XP_009084267.1|  PREDICTED: basic leucine zipper and W2 domai...  65.1    2e-09   
ref|XP_009644688.1|  PREDICTED: LOW QUALITY PROTEIN: basic leucin...  65.1    2e-09   
ref|XP_009679106.1|  PREDICTED: basic leucine zipper and W2 domai...  65.1    2e-09   
gb|EMC81639.1|  Basic leucine zipper and W2 domain-containing pro...  65.1    2e-09   
ref|XP_010397386.1|  PREDICTED: basic leucine zipper and W2 domai...  65.1    2e-09   
ref|XP_008918610.1|  PREDICTED: basic leucine zipper and W2 domai...  65.1    2e-09   
ref|XP_010220161.1|  PREDICTED: basic leucine zipper and W2 domai...  65.1    2e-09   
ref|XP_009324364.1|  PREDICTED: basic leucine zipper and W2 domai...  65.1    2e-09   
ref|XP_009812875.1|  PREDICTED: basic leucine zipper and W2 domai...  65.1    2e-09   
ref|XP_002188448.1|  PREDICTED: basic leucine zipper and W2 domai...  65.1    2e-09   
ref|XP_005152931.1|  PREDICTED: basic leucine zipper and W2 domai...  65.1    2e-09   
ref|XP_010311886.1|  PREDICTED: basic leucine zipper and W2 domai...  65.1    2e-09   
ref|XP_005418602.1|  PREDICTED: basic leucine zipper and W2 domai...  65.1    2e-09   
ref|XP_009993246.1|  PREDICTED: basic leucine zipper and W2 domai...  65.1    2e-09   
ref|XP_009993245.1|  PREDICTED: basic leucine zipper and W2 domai...  65.1    2e-09   
ref|XP_009702362.1|  PREDICTED: basic leucine zipper and W2 domai...  65.1    2e-09   
ref|XP_005152932.1|  PREDICTED: basic leucine zipper and W2 domai...  65.1    2e-09   
ref|XP_009877871.1|  PREDICTED: LOW QUALITY PROTEIN: basic leucin...  65.1    2e-09   



>emb|CBI17617.3| unnamed protein product [Vitis vinifera]
Length=429

 Score =   242 bits (618),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = +1

Query  70   FRSWFMSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESS  249
             RSWFMSSKE+PTLGGTRIKTRKRNIAAPLDPA FADAVVQIYLDNAGDLEL+AKSIESS
Sbjct  14   LRSWFMSSKERPTLGGTRIKTRKRNIAAPLDPATFADAVVQIYLDNAGDLELIAKSIESS  73

Query  250  ELNFSRYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILR  429
            +LNFSRYGDTFFEVVFTGGRTQPGT K DEGERHPYS+I+C+P R  +LPSVIY+QKILR
Sbjct  74   DLNFSRYGDTFFEVVFTGGRTQPGTTKSDEGERHPYSIIDCEPNRVAVLPSVIYIQKILR  133

Query  430  RKPFLIKNLENVMRXLLQSLELFE  501
            R+PFLIKNLENVMR  LQSLELFE
Sbjct  134  RRPFLIKNLENVMRRFLQSLELFE  157



>ref|XP_003534510.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2-like [Glycine max]
Length=411

 Score =   241 bits (614),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKE+PTLGGTRIKTRKRNIAAPLDPAAF+DAVVQIYLDNAGDLEL+AKSIESS+LNFS
Sbjct  1    MSSKERPTLGGTRIKTRKRNIAAPLDPAAFSDAVVQIYLDNAGDLELIAKSIESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGDTFFEVVFTGGRTQPGT KPDEG+RHPYS+IEC+P+RE ILPSVIY+QKILRR+PFL
Sbjct  61   RYGDTFFEVVFTGGRTQPGTTKPDEGDRHPYSIIECEPKREVILPSVIYIQKILRRRPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENVMR  LQSLELFE
Sbjct  121  IKNLENVMRKFLQSLELFE  139



>ref|XP_010927633.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Elaeis guineensis]
Length=411

 Score =   240 bits (613),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNI APLDP+AFADAVVQIYLDNAGDLELVAKSIESS+LNFS
Sbjct  1    MSSKEKPTLGGTRIKTRKRNITAPLDPSAFADAVVQIYLDNAGDLELVAKSIESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGDTFFEVVFTGGRTQPGT+KPDEGERHP+SV++C+P+RE ILPSV+Y+QKILRR+PFL
Sbjct  61   RYGDTFFEVVFTGGRTQPGTIKPDEGERHPFSVLDCEPKREAILPSVLYIQKILRRRPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENVMR  LQSLELFE
Sbjct  121  IKNLENVMRRFLQSLELFE  139



>ref|XP_006376044.1| eIF4-gamma/eIF5/eIF2-epsilon domain-containing family protein 
[Populus trichocarpa]
 gb|ABK94573.1| unknown [Populus trichocarpa]
 gb|ERP53841.1| eIF4-gamma/eIF5/eIF2-epsilon domain-containing family protein 
[Populus trichocarpa]
Length=411

 Score =   240 bits (613),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKE+PTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDNAGDLELVAKSIESS+LNFS
Sbjct  1    MSSKERPTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDNAGDLELVAKSIESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGDTFFEVVFTGGRTQPGT KPDEGERHPYS+I+C+P RE ILPSVIY+QKILRR+PFL
Sbjct  61   RYGDTFFEVVFTGGRTQPGTTKPDEGERHPYSIIDCEPTREVILPSVIYIQKILRRRPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENVMR  LQSLELFE
Sbjct  121  IKNLENVMRRFLQSLELFE  139



>ref|XP_009757517.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2-like [Nicotiana sylvestris]
Length=411

 Score =   240 bits (612),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDNAGDLELVAK++ESS+LNFS
Sbjct  1    MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDNAGDLELVAKNLESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGDTFFEV+F GGRTQPGT+KPDEG+RHPYSVIEC+P RE ILPSVIYVQKILRR+PFL
Sbjct  61   RYGDTFFEVIFIGGRTQPGTIKPDEGDRHPYSVIECEPTREVILPSVIYVQKILRRRPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENVMR +LQSLELFE
Sbjct  121  IKNLENVMRKMLQSLELFE  139



>gb|KDP26874.1| hypothetical protein JCGZ_18032 [Jatropha curcas]
Length=411

 Score =   240 bits (612),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKE+PTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDNAGDLEL+AKSIESS+LNFS
Sbjct  1    MSSKERPTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDNAGDLELIAKSIESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGDTFFEVVFTGGRTQPGT KPDEGERHPYS+I+C+P RE ILPSVIY+QKILRR+PFL
Sbjct  61   RYGDTFFEVVFTGGRTQPGTTKPDEGERHPYSIIDCEPTREVILPSVIYIQKILRRRPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENVMR  LQSLELFE
Sbjct  121  IKNLENVMRRFLQSLELFE  139



>ref|XP_010926617.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2-like [Elaeis guineensis]
Length=411

 Score =   239 bits (611),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDNAGDLELVAKSIESS+LNFS
Sbjct  1    MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDNAGDLELVAKSIESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGDTFFEVVFTGGRTQPGT+KPDEGERHPYSV++C+P+RE ILPSV+Y+QKILRR+PFL
Sbjct  61   RYGDTFFEVVFTGGRTQPGTIKPDEGERHPYSVLDCEPKREAILPSVLYIQKILRRRPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IK+LENVMR  LQSLELFE
Sbjct  121  IKSLENVMRRFLQSLELFE  139



>ref|XP_011006974.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2-like [Populus euphratica]
Length=411

 Score =   239 bits (611),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKE+PTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDNAGDLELVAKSIES++LNFS
Sbjct  1    MSSKERPTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDNAGDLELVAKSIESADLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGDTFFEVVFTGGRTQPGT KPDEGERHPYS+I+C+P RE ILPSVIY QKILRRKPFL
Sbjct  61   RYGDTFFEVVFTGGRTQPGTTKPDEGERHPYSIIDCEPTREIILPSVIYTQKILRRKPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENVMR  LQSLELFE
Sbjct  121  IKNLENVMRRFLQSLELFE  139



>ref|XP_002325904.1| eIF4-gamma/eIF5/eIF2-epsilon domain-containing family protein 
[Populus trichocarpa]
 gb|ABK93058.1| unknown [Populus trichocarpa]
 gb|EEF00286.1| eIF4-gamma/eIF5/eIF2-epsilon domain-containing family protein 
[Populus trichocarpa]
Length=411

 Score =   239 bits (611),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKE+PTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDNAGDLELVAKSIES++LNFS
Sbjct  1    MSSKERPTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDNAGDLELVAKSIESADLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGDTFFEVVFTGGRTQPGT KPDEGERHPYS+I+C+P RE ILPSVIY QKILRRKPFL
Sbjct  61   RYGDTFFEVVFTGGRTQPGTTKPDEGERHPYSIIDCEPTREIILPSVIYTQKILRRKPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENVMR  LQSLELFE
Sbjct  121  IKNLENVMRRFLQSLELFE  139



>ref|NP_001240059.1| uncharacterized protein LOC100789838 [Glycine max]
 gb|ACU20961.1| unknown [Glycine max]
Length=411

 Score =   239 bits (611),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKE+PTLGGTRIKTRKRNIAAPLDPAAF+DAVVQIYLDNAGDLEL+AKSIESS+LNFS
Sbjct  1    MSSKERPTLGGTRIKTRKRNIAAPLDPAAFSDAVVQIYLDNAGDLELIAKSIESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGDTFFEV FTGGRTQPGT KPDEG+RHPYS+IEC+P+RE ILPSVIY+QKILRR+PFL
Sbjct  61   RYGDTFFEVAFTGGRTQPGTTKPDEGDRHPYSIIECEPKREVILPSVIYIQKILRRRPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENVMR  LQSLELFE
Sbjct  121  IKNLENVMRKFLQSLELFE  139



>gb|KJB26851.1| hypothetical protein B456_004G262900 [Gossypium raimondii]
Length=392

 Score =   239 bits (609),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDNAGDLELVAK++ESS+LNFS
Sbjct  1    MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDNAGDLELVAKNLESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGDTFFEVVFTGGRTQPGT+KPDEGERHPYSVIEC+ +RE ILPSVIY+QKILRR+PFL
Sbjct  61   RYGDTFFEVVFTGGRTQPGTIKPDEGERHPYSVIECEAKREAILPSVIYIQKILRRRPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENVMR  LQSLELFE
Sbjct  121  IKNLENVMRRFLQSLELFE  139



>ref|XP_010038305.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2-like [Eucalyptus grandis]
 gb|KCW84578.1| hypothetical protein EUGRSUZ_B01418 [Eucalyptus grandis]
Length=411

 Score =   239 bits (611),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKE+PTLGGTRIKTRKRNIAAPLDPA+FADAVVQIYLDNAGDLELVAKSIE+S+L+FS
Sbjct  1    MSSKERPTLGGTRIKTRKRNIAAPLDPASFADAVVQIYLDNAGDLELVAKSIEASDLDFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGDTFFEV FTGGRTQPGT KPDEGERHPYS+IEC+P+RE ILPSVIY+QKILRR+PFL
Sbjct  61   RYGDTFFEVAFTGGRTQPGTTKPDEGERHPYSIIECEPKRELILPSVIYIQKILRRRPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENVMR  LQSLELFE
Sbjct  121  IKNLENVMRRFLQSLELFE  139



>ref|XP_009788167.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2-like [Nicotiana sylvestris]
Length=411

 Score =   239 bits (610),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDNAGDLELVAKSIES++LNFS
Sbjct  1    MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDNAGDLELVAKSIESTDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGDT FEV+FTGGRTQPGT+KPDEG+RHPYSVIEC+P RE ILPSVIYVQKILRRKPFL
Sbjct  61   RYGDTLFEVIFTGGRTQPGTIKPDEGDRHPYSVIECEPRREVILPSVIYVQKILRRKPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENVMR +LQ LE FE
Sbjct  121  IKNLENVMRRMLQCLEFFE  139



>gb|KJB26850.1| hypothetical protein B456_004G262900 [Gossypium raimondii]
Length=411

 Score =   239 bits (610),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDNAGDLELVAK++ESS+LNFS
Sbjct  1    MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDNAGDLELVAKNLESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGDTFFEVVFTGGRTQPGT+KPDEGERHPYSVIEC+ +RE ILPSVIY+QKILRR+PFL
Sbjct  61   RYGDTFFEVVFTGGRTQPGTIKPDEGERHPYSVIECEAKREAILPSVIYIQKILRRRPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENVMR  LQSLELFE
Sbjct  121  IKNLENVMRRFLQSLELFE  139



>ref|XP_007139724.1| hypothetical protein PHAVU_008G054000g [Phaseolus vulgaris]
 gb|ESW11718.1| hypothetical protein PHAVU_008G054000g [Phaseolus vulgaris]
Length=411

 Score =   239 bits (609),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKE+PTLGGTRIKTRKRNIAAPLDPAAF+DAVVQIYLDNAGDLEL+AKSIESS+LNFS
Sbjct  1    MSSKERPTLGGTRIKTRKRNIAAPLDPAAFSDAVVQIYLDNAGDLELIAKSIESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGDTFFEVVFTGGRTQPGT KPDEG+RHP+S+IEC+P+RE ILPSVIY+QKILRR+PFL
Sbjct  61   RYGDTFFEVVFTGGRTQPGTTKPDEGDRHPHSIIECEPKREVILPSVIYIQKILRRRPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENVMR  LQSLELFE
Sbjct  121  IKNLENVMRRFLQSLELFE  139



>ref|XP_011009963.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Populus euphratica]
Length=411

 Score =   239 bits (609),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKE+PTLGGTRIKTRKRNIAAPLDPAAFADAVVQIY DNAGDLELVAKSIESS+LNFS
Sbjct  1    MSSKERPTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYFDNAGDLELVAKSIESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGDTFFEVVFTGGRTQPGT KPDEGERHPYS+I+C+P RE ILPSVIY+QKILRR+PFL
Sbjct  61   RYGDTFFEVVFTGGRTQPGTTKPDEGERHPYSIIDCEPTREVILPSVIYIQKILRRRPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENVMR  LQSLELFE
Sbjct  121  IKNLENVMRRFLQSLELFE  139



>ref|XP_009383336.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2-like [Musa acuminata subsp. malaccensis]
Length=411

 Score =   238 bits (608),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNI APLDPAAFADAVVQIYL+NAGDLELVAK++ESS+LNFS
Sbjct  1    MSSKEKPTLGGTRIKTRKRNITAPLDPAAFADAVVQIYLENAGDLELVAKNVESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGDTFFEVVFTGGRTQPGT+KPDEGERHPYSV++CQP RE ILPSV+Y+QKILRRKPFL
Sbjct  61   RYGDTFFEVVFTGGRTQPGTIKPDEGERHPYSVLDCQPIREAILPSVLYIQKILRRKPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENVMR  LQSLELFE
Sbjct  121  IKNLENVMRKFLQSLELFE  139



>emb|CDY38556.1| BnaA05g12850D [Brassica napus]
Length=462

 Score =   240 bits (612),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = +1

Query  55   LYFDSFRSWFMSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAK  234
            L FD   SWFMSSKEKPTLGGTRIKTRKRNIAAPLDPAAF+DAVVQIYLDNAGDLELVAK
Sbjct  42   LLFDPSSSWFMSSKEKPTLGGTRIKTRKRNIAAPLDPAAFSDAVVQIYLDNAGDLELVAK  101

Query  235  SIESSELNFSRYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYV  414
            SIES++LNFSRYGD FFEVVF G RTQPGTVKPDEGERHPYSVI+C+P+RE ILPSV+Y+
Sbjct  102  SIESTDLNFSRYGDIFFEVVFIGRRTQPGTVKPDEGERHPYSVIDCEPKREAILPSVVYI  161

Query  415  QKILRRKPFLIKNLENVMRXLLQSLELFE  501
            QKILRR+P LIKNLENV R  LQSLELFE
Sbjct  162  QKILRRRPSLIKNLENVTRRFLQSLELFE  190



>ref|XP_009620435.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2-like [Nicotiana tomentosiformis]
Length=411

 Score =   238 bits (608),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNIA PLDPAAFADAVVQIYLDNAGDLELVAKSIES++LNFS
Sbjct  1    MSSKEKPTLGGTRIKTRKRNIAEPLDPAAFADAVVQIYLDNAGDLELVAKSIESTDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGDT FEV+FTGGRTQPGT+KPDEG+RHPYSVIEC+P RE ILPSVIYVQKILRRKPFL
Sbjct  61   RYGDTLFEVIFTGGRTQPGTIKPDEGDRHPYSVIECEPRREVILPSVIYVQKILRRKPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENVMR +LQ LE FE
Sbjct  121  IKNLENVMRRMLQCLEFFE  139



>ref|XP_006345823.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2-like [Solanum tuberosum]
Length=411

 Score =   238 bits (607),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDNAGDLELVAK++ESS+LNFS
Sbjct  1    MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDNAGDLELVAKNLESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGDTFFEVVF GGRTQPGTVK DEGERHPYSVIEC+P+RE ILPSVIYVQKILRR+PFL
Sbjct  61   RYGDTFFEVVFIGGRTQPGTVKLDEGERHPYSVIECEPKREAILPSVIYVQKILRRRPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENVMR +LQSLELFE
Sbjct  121  IKNLENVMRKMLQSLELFE  139



>ref|XP_004239697.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Solanum lycopersicum]
Length=411

 Score =   238 bits (607),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDNAGDLELVAK++ESS+LNFS
Sbjct  1    MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDNAGDLELVAKNLESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGDTFFEVVF GGRTQPGTVK DEGERHPYSVIEC+P+RE ILPSVIYVQKILRR+PFL
Sbjct  61   RYGDTFFEVVFIGGRTQPGTVKLDEGERHPYSVIECEPKREAILPSVIYVQKILRRRPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENVMR +LQSLELFE
Sbjct  121  IKNLENVMRKMLQSLELFE  139



>ref|XP_009620737.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2-like [Nicotiana tomentosiformis]
Length=411

 Score =   238 bits (607),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDNAGDLELVAK++ESS+LNFS
Sbjct  1    MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDNAGDLELVAKNLESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGDTFFEV+F GGRTQPGT+KPDEG+RHPYSVIEC+P  E ILPSVIYVQKILRR+PFL
Sbjct  61   RYGDTFFEVIFIGGRTQPGTIKPDEGDRHPYSVIECEPTHEVILPSVIYVQKILRRRPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENVMR +LQSLELFE
Sbjct  121  IKNLENVMRKMLQSLELFE  139



>ref|XP_009384254.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2-like [Musa acuminata subsp. malaccensis]
Length=411

 Score =   237 bits (605),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNI APLDPAAFADAVVQIYL+NAGDLELVAK++ESS+LNFS
Sbjct  1    MSSKEKPTLGGTRIKTRKRNITAPLDPAAFADAVVQIYLENAGDLELVAKNVESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGDTFFEVVFTGGRTQPGT+KPDEGERHPYSV++C P+RE ILPSV+Y+QKILRR+PFL
Sbjct  61   RYGDTFFEVVFTGGRTQPGTIKPDEGERHPYSVLDCHPKREAILPSVLYIQKILRRRPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENVMR  LQSLELFE
Sbjct  121  IKNLENVMRKFLQSLELFE  139



>emb|CDY51095.1| BnaC06g42190D [Brassica napus]
Length=598

 Score =   242 bits (617),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 138/149 (93%), Gaps = 0/149 (0%)
 Frame = +1

Query  55   LYFDSFRSWFMSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAK  234
            L+FD   SWFMSSKEKPTLGGTRIKTRKRNIAAPLDPAAF+DAVVQIYLDNAGDLELVAK
Sbjct  48   LFFDPSSSWFMSSKEKPTLGGTRIKTRKRNIAAPLDPAAFSDAVVQIYLDNAGDLELVAK  107

Query  235  SIESSELNFSRYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYV  414
            SIES++LNFSRYGD FFEVVF G RTQPGTVKPDEGERHPYSVI+C+P+RE ILPSV+Y+
Sbjct  108  SIESTDLNFSRYGDIFFEVVFIGRRTQPGTVKPDEGERHPYSVIDCEPKREAILPSVVYI  167

Query  415  QKILRRKPFLIKNLENVMRXLLQSLELFE  501
            QKILRR+P LIKNLENV R  LQSLELFE
Sbjct  168  QKILRRRPSLIKNLENVTRRFLQSLELFE  196



>ref|XP_008388811.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2-like [Malus domestica]
Length=411

 Score =   237 bits (605),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKE+PTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDNAGDLEL+AKSIESS+LNFS
Sbjct  1    MSSKERPTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDNAGDLELIAKSIESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGDTFFEVVFTGGRTQPGT KPDEGERHPYSV+E +P RE ILPSVIY+QKILRR+PFL
Sbjct  61   RYGDTFFEVVFTGGRTQPGTTKPDEGERHPYSVLESEPTRELILPSVIYIQKILRRRPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENVMR  LQSLELFE
Sbjct  121  IKNLENVMRRFLQSLELFE  139



>ref|XP_002514839.1| translation initiation factor, putative [Ricinus communis]
 gb|EEF47393.1| translation initiation factor, putative [Ricinus communis]
Length=411

 Score =   237 bits (604),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKE+PTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDNAGDLEL+AKSIESS+LNFS
Sbjct  1    MSSKERPTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDNAGDLELIAKSIESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGDTFFEV FTGGRTQPGT KPDEGERHP+S+I+C+P+RE ILPSVIY+QKILRR+PFL
Sbjct  61   RYGDTFFEVAFTGGRTQPGTTKPDEGERHPFSLIDCEPKREIILPSVIYIQKILRRRPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENVMR  LQSLELFE
Sbjct  121  IKNLENVMRRFLQSLELFE  139



>gb|KHG11883.1| Basic leucine zipper and W2 domain-containing 2 [Gossypium arboreum]
Length=411

 Score =   236 bits (602),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDNAGDLELV K++ESS+LNFS
Sbjct  1    MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDNAGDLELVPKNLESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGDTFFEVVFTGGRTQPGT+KPDEGERHPYSVIEC+ +RE ILPSVIY+QKILRR+PFL
Sbjct  61   RYGDTFFEVVFTGGRTQPGTIKPDEGERHPYSVIECEAKRETILPSVIYIQKILRRRPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENVMR  LQSLELFE
Sbjct  121  IKNLENVMRRFLQSLELFE  139



>gb|KHG20905.1| Basic leucine zipper and W2 domain-containing 2 [Gossypium arboreum]
Length=422

 Score =   235 bits (600),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 124/138 (90%), Positives = 134/138 (97%), Gaps = 0/138 (0%)
 Frame = +1

Query  88   SSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFSR  267
            SSKEKPTLGGTRIKTRKRNIAAPLDP+AFADAVVQIYLDNAGDLELVA+SIESS+LNFSR
Sbjct  13   SSKEKPTLGGTRIKTRKRNIAAPLDPSAFADAVVQIYLDNAGDLELVARSIESSDLNFSR  72

Query  268  YGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFLI  447
            YGDTFFEVVF GGRTQPGT+KPDEGERHPYS+IEC+ +R+ ILPSVIY+QKILRR+PFLI
Sbjct  73   YGDTFFEVVFAGGRTQPGTLKPDEGERHPYSIIECEAKRDAILPSVIYIQKILRRRPFLI  132

Query  448  KNLENVMRXLLQSLELFE  501
            KNLENVMR LLQSLELFE
Sbjct  133  KNLENVMRRLLQSLELFE  150



>ref|XP_010241522.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2-like [Nelumbo nucifera]
Length=411

 Score =   235 bits (599),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKE+PTLGG RIKTRKRNIAAPLDPA FADAVVQIYLDNAGDLELVAKSIESS+LNFS
Sbjct  1    MSSKERPTLGGARIKTRKRNIAAPLDPATFADAVVQIYLDNAGDLELVAKSIESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGDTFFEVVFTGGRTQPGT KPDEGERH YSVI+C+P+RE ILPSV+Y+QKILRR+PFL
Sbjct  61   RYGDTFFEVVFTGGRTQPGTTKPDEGERHSYSVIDCEPKREAILPSVLYIQKILRRRPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENVMR  LQSLELFE
Sbjct  121  IKNLENVMRRFLQSLELFE  139



>ref|XP_011084659.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2-like [Sesamum indicum]
Length=411

 Score =   234 bits (598),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNIAAPLDPA+F+DAVVQIYLDNAGDLEL+AKSIESS+LNFS
Sbjct  1    MSSKEKPTLGGTRIKTRKRNIAAPLDPASFSDAVVQIYLDNAGDLELIAKSIESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGDTFFEVVF G RTQPGT+K DEGERHPYS+I+C+P+RE ILPSVIY+QKILRR+PFL
Sbjct  61   RYGDTFFEVVFRGARTQPGTIKLDEGERHPYSIIDCEPKREVILPSVIYIQKILRRRPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENVMR  LQSLELFE
Sbjct  121  IKNLENVMRKFLQSLELFE  139



>ref|XP_008370829.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X2 [Malus domestica]
Length=411

 Score =   234 bits (596),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKE+PTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDNAGDLEL+AKSIESS+LNFS
Sbjct  1    MSSKERPTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDNAGDLELIAKSIESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGDTFFEVVFTGGRTQPGT K DEGERHPYSV+E +P RE ILPSVIY+QKILRR+PFL
Sbjct  61   RYGDTFFEVVFTGGRTQPGTTKSDEGERHPYSVLESEPTRELILPSVIYIQKILRRRPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENVMR  LQSLELFE
Sbjct  121  IKNLENVMRRFLQSLELFE  139



>ref|XP_003624182.1| Basic leucine zipper and W2 domain-containing protein [Medicago 
truncatula]
 gb|AES80400.1| eukaryotic translation initiation factor [Medicago truncatula]
Length=411

 Score =   234 bits (596),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDNAGDLEL+AKSIESS+LNFS
Sbjct  1    MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDNAGDLELIAKSIESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGDTFFEV+FTGGRTQPGT KPDEGERHPYS+IE +  RE ILPSVIY+QK+LRR+PFL
Sbjct  61   RYGDTFFEVIFTGGRTQPGTTKPDEGERHPYSIIEYEATREVILPSVIYIQKVLRRRPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENVMR  LQSLELFE
Sbjct  121  IKNLENVMRRFLQSLELFE  139



>ref|XP_008787734.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2-like [Phoenix dactylifera]
Length=411

 Score =   233 bits (595),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDN GDLELVAKSIESS+LNFS
Sbjct  1    MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDNDGDLELVAKSIESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGDTFFEVVFTGGRTQPGT+KPDEGERH YSV++C+P+RE ILPSV+Y+QKILRR+PF+
Sbjct  61   RYGDTFFEVVFTGGRTQPGTIKPDEGERHSYSVLDCEPKREAILPSVLYIQKILRRRPFM  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IK+LENVMR  LQSLELFE
Sbjct  121  IKSLENVMRKFLQSLELFE  139



>ref|XP_004492841.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2-like [Cicer arietinum]
Length=411

 Score =   233 bits (595),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDNAGDLEL+AKSIESS+LNFS
Sbjct  1    MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDNAGDLELIAKSIESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGDTFFEV+FTGGRTQPGT KPDEGERHPYS+IE +  RE ILPSVIY+QK+LRR+PFL
Sbjct  61   RYGDTFFEVIFTGGRTQPGTTKPDEGERHPYSIIEYEATREVILPSVIYIQKVLRRRPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENVMR  LQSLELFE
Sbjct  121  IKNLENVMRRFLQSLELFE  139



>ref|XP_002270681.2| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Vitis vinifera]
Length=411

 Score =   233 bits (595),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKE+PTLGGTRIKTRKRNIAAPLDPA FADAVVQIYLDNAGDLEL+AKSIESS+LNFS
Sbjct  1    MSSKERPTLGGTRIKTRKRNIAAPLDPATFADAVVQIYLDNAGDLELIAKSIESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGDTFFEVVFTGGRTQPGT K DEGERHPYS+I+C+P R  +LPSVIY+QKILRR+PFL
Sbjct  61   RYGDTFFEVVFTGGRTQPGTTKSDEGERHPYSIIDCEPNRVAVLPSVIYIQKILRRRPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENVMR  LQSLELFE
Sbjct  121  IKNLENVMRRFLQSLELFE  139



>ref|XP_004302164.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Fragaria vesca subsp. vesca]
Length=411

 Score =   233 bits (594),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKE+PTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDNAGDLEL+AKSIESS+LNFS
Sbjct  1    MSSKERPTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDNAGDLELIAKSIESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGDTFFEVVFTGGRTQPGT KPDEGERHPYSV+E +P RE I+P VIY+QKILRR+PFL
Sbjct  61   RYGDTFFEVVFTGGRTQPGTTKPDEGERHPYSVLESEPRREVIIPFVIYIQKILRRRPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENVMR  LQSLELFE
Sbjct  121  IKNLENVMRRFLQSLELFE  139



>ref|XP_008800962.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Phoenix dactylifera]
Length=411

 Score =   233 bits (593),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNI APLDP+AFADAVVQIYLDNAGDLELVAKSIESS+LNFS
Sbjct  1    MSSKEKPTLGGTRIKTRKRNITAPLDPSAFADAVVQIYLDNAGDLELVAKSIESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGDTFFEVVFTGGRTQPGT+KPDEGERH YSV++C+P+RE ILP V+Y+QKILRR+PFL
Sbjct  61   RYGDTFFEVVFTGGRTQPGTIKPDEGERHLYSVLDCEPKREAILPFVLYIQKILRRRPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IK+LENVMR  LQSLELFE
Sbjct  121  IKSLENVMRRFLQSLELFE  139



>ref|XP_004138904.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2-like [Cucumis sativus]
 ref|XP_004155121.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2-like [Cucumis sativus]
 gb|KGN61358.1| hypothetical protein Csa_2G097440 [Cucumis sativus]
Length=411

 Score =   232 bits (591),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNI  PLDPA+F+DAVVQIYLDNAGDLEL+A++IESSEL+FS
Sbjct  1    MSSKEKPTLGGTRIKTRKRNITIPLDPASFSDAVVQIYLDNAGDLELIARNIESSELDFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGDTFFEV+FTGGRTQPGT KPDEGERHPYS+I+C+P+RE ILPSVIY+QKILRR+PFL
Sbjct  61   RYGDTFFEVIFTGGRTQPGTTKPDEGERHPYSIIDCEPKREAILPSVIYIQKILRRRPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IK LENVMR  LQSLE FE
Sbjct  121  IKYLENVMRRFLQSLEFFE  139



>ref|XP_008441730.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2-like [Cucumis melo]
Length=411

 Score =   232 bits (591),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNI  PLDPA+F+DAVVQIYLDNAGDLEL+A++IESSEL+FS
Sbjct  1    MSSKEKPTLGGTRIKTRKRNITIPLDPASFSDAVVQIYLDNAGDLELIARNIESSELDFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGDTFFEV+FTGGRTQPGT KPDEGERHPYS+I+C+P+RE ILPSVIY+QKILRR+PFL
Sbjct  61   RYGDTFFEVIFTGGRTQPGTTKPDEGERHPYSIIDCEPKREAILPSVIYIQKILRRRPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IK LENVMR  LQSLE FE
Sbjct  121  IKYLENVMRRFLQSLEFFE  139



>ref|XP_006395906.1| hypothetical protein EUTSA_v10004315mg [Eutrema salsugineum]
 gb|ESQ33192.1| hypothetical protein EUTSA_v10004315mg [Eutrema salsugineum]
Length=411

 Score =   232 bits (591),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNIAAPLDPAAF+DAVVQIYLDNAGDLELVAKS+ESS+LNFS
Sbjct  1    MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFSDAVVQIYLDNAGDLELVAKSVESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGD FFEVVF GGRTQPGTVKPDEGERHPYSVI+C+P+RE ILPSV+Y+QKILRR+P L
Sbjct  61   RYGDIFFEVVFIGGRTQPGTVKPDEGERHPYSVIDCEPKREAILPSVVYIQKILRRRPSL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENV R  LQSLELFE
Sbjct  121  IKNLENVTRRFLQSLELFE  139



>ref|XP_006847468.1| hypothetical protein AMTR_s00163p00023880 [Amborella trichopoda]
 gb|ERN09049.1| hypothetical protein AMTR_s00163p00023880 [Amborella trichopoda]
Length=411

 Score =   232 bits (591),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKE+PTLGGTRIKTRKRNIAAPLDPA FADAVVQIYLDNAGDLELVAKSIESS+LNFS
Sbjct  1    MSSKERPTLGGTRIKTRKRNIAAPLDPATFADAVVQIYLDNAGDLELVAKSIESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGDTFFEVVFTGGRTQPGT+KPDEGERH  SV++C+P RE +LPSV+Y+QKILRR+PFL
Sbjct  61   RYGDTFFEVVFTGGRTQPGTIKPDEGERHTNSVLDCEPMREAVLPSVLYIQKILRRRPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENVMR  LQSLELFE
Sbjct  121  IKNLENVMRRFLQSLELFE  139



>ref|XP_008218452.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Prunus mume]
Length=411

 Score =   231 bits (590),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKE+PTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDNAGDLEL+AK IESS+LNFS
Sbjct  1    MSSKERPTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDNAGDLELIAKCIESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGDTFFEVVFTGGRTQPGT KPDEGERHPYSV+E +  RE ILPSVIY+QKILRR+PFL
Sbjct  61   RYGDTFFEVVFTGGRTQPGTTKPDEGERHPYSVLESEATREVILPSVIYIQKILRRRPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENVMR  LQSLELFE
Sbjct  121  IKNLENVMRRFLQSLELFE  139



>ref|XP_008370828.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X1 [Malus domestica]
Length=412

 Score =   231 bits (590),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 124/138 (90%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = +1

Query  88   SSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFSR  267
            SSKE+PTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDNAGDLEL+AKSIESS+LNFSR
Sbjct  3    SSKERPTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDNAGDLELIAKSIESSDLNFSR  62

Query  268  YGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFLI  447
            YGDTFFEVVFTGGRTQPGT K DEGERHPYSV+E +P RE ILPSVIY+QKILRR+PFLI
Sbjct  63   YGDTFFEVVFTGGRTQPGTTKSDEGERHPYSVLESEPTRELILPSVIYIQKILRRRPFLI  122

Query  448  KNLENVMRXLLQSLELFE  501
            KNLENVMR  LQSLELFE
Sbjct  123  KNLENVMRRFLQSLELFE  140



>ref|XP_010553847.1| PREDICTED: putative basic leucine zipper and W2 domain-containing 
protein 1-like 1 [Tarenaya hassleriana]
Length=412

 Score =   231 bits (589),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNIAAPLDPAAF+DAVVQIYLDNAGDLELVAKSIESS+LNFS
Sbjct  1    MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFSDAVVQIYLDNAGDLELVAKSIESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGD FFEVVFTGGRTQPGT+KP+EGERHP+SV +C+P+RE ILPSV+Y+QKILRRKPFL
Sbjct  61   RYGDIFFEVVFTGGRTQPGTIKPEEGERHPHSVFDCEPKREDILPSVVYIQKILRRKPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENVM   LQSLELFE
Sbjct  121  IKNLENVMGRFLQSLELFE  139



>ref|XP_007029311.1| ARM repeat superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY09813.1| ARM repeat superfamily protein isoform 2 [Theobroma cacao]
Length=411

 Score =   231 bits (589),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYL+N GDLELVA++IESS+LNF+
Sbjct  1    MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLENVGDLELVARNIESSDLNFT  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGDTFFEVVFTGGRTQPGT+KPDEGERHPYS+IEC+ +RE I PSV Y+QKILRR+PFL
Sbjct  61   RYGDTFFEVVFTGGRTQPGTIKPDEGERHPYSIIECEAKREAIFPSVSYIQKILRRRPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENVMR LLQSLELFE
Sbjct  121  IKNLENVMRKLLQSLELFE  139



>gb|KJB75150.1| hypothetical protein B456_012G026900 [Gossypium raimondii]
Length=411

 Score =   231 bits (588),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNIAAPLDP+AFADAVVQIYLDNAGDLELVA+SIESS+LNFS
Sbjct  1    MSSKEKPTLGGTRIKTRKRNIAAPLDPSAFADAVVQIYLDNAGDLELVARSIESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGDTFFEVVF GGRTQPGT+KPDEGE HPYS+IEC+ +R+ IL SVIY+QKILRR+PFL
Sbjct  61   RYGDTFFEVVFAGGRTQPGTLKPDEGECHPYSIIECEAKRDAILLSVIYIQKILRRRPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENVMR LLQSLELFE
Sbjct  121  IKNLENVMRRLLQSLELFE  139



>ref|XP_006428599.1| hypothetical protein CICLE_v10011861mg [Citrus clementina]
 ref|XP_006480435.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2-like [Citrus sinensis]
 gb|ESR41839.1| hypothetical protein CICLE_v10011861mg [Citrus clementina]
Length=411

 Score =   231 bits (588),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIK RKRNIAAPLDPAAF+DAVVQIYLDNAGDLEL+AK IESS+LNFS
Sbjct  1    MSSKEKPTLGGTRIKPRKRNIAAPLDPAAFSDAVVQIYLDNAGDLELIAKCIESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGDTFFEVVFTGGRTQPGT KPDEGERH YS+I+C+P+RE ILPSVIY+QKILRR+PFL
Sbjct  61   RYGDTFFEVVFTGGRTQPGTTKPDEGERHSYSIIDCEPQREAILPSVIYIQKILRRRPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENV R  +QSLELFE
Sbjct  121  IKNLENVTRRFMQSLELFE  139



>ref|XP_006283832.1| hypothetical protein CARUB_v10004933mg [Capsella rubella]
 gb|EOA16730.1| hypothetical protein CARUB_v10004933mg [Capsella rubella]
Length=412

 Score =   229 bits (584),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNIAAPLDPAAF+DAVVQIYLDNAGDLELVAKSIESS+LNF+
Sbjct  1    MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFSDAVVQIYLDNAGDLELVAKSIESSDLNFT  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGD FFEV+F GGRTQPGTVK DEGERH YSVI+C+P+RE ILPSV+Y+QKILRRKPFL
Sbjct  61   RYGDIFFEVIFIGGRTQPGTVKSDEGERHTYSVIDCEPKREAILPSVVYIQKILRRKPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENV R  LQSLELFE
Sbjct  121  IKNLENVTRRFLQSLELFE  139



>ref|XP_010440787.1| PREDICTED: protein krasavietz-like [Camelina sativa]
Length=412

 Score =   229 bits (584),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNIAAPLDPAAF+DAVVQIYLDNAGDLELVAKSIESS+LNF+
Sbjct  1    MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFSDAVVQIYLDNAGDLELVAKSIESSDLNFT  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGD FFEV+F GGRTQPGTVK DEGERH YSVI+C+P+RE ILPSV+Y+QKILRRKPFL
Sbjct  61   RYGDIFFEVIFIGGRTQPGTVKSDEGERHTYSVIDCEPKREAILPSVVYIQKILRRKPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENV R  LQSLELFE
Sbjct  121  IKNLENVTRRFLQSLELFE  139



>ref|XP_010435501.1| PREDICTED: protein krasavietz-like [Camelina sativa]
Length=412

 Score =   229 bits (584),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNIAAPLDPAAF+DAVVQIYLDNAGDLELVAKSIESS+LNF+
Sbjct  1    MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFSDAVVQIYLDNAGDLELVAKSIESSDLNFT  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGD FFEV+F GGRTQPGTVK DEGERH YSVI+C+P+RE ILPSV+Y+QKILRRKPFL
Sbjct  61   RYGDIFFEVIFIGGRTQPGTVKSDEGERHTYSVIDCEPKREAILPSVVYIQKILRRKPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENV R  LQSLELFE
Sbjct  121  IKNLENVTRRFLQSLELFE  139



>gb|EYU39452.1| hypothetical protein MIMGU_mgv1a007304mg [Erythranthe guttata]
Length=411

 Score =   229 bits (584),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNIAAPLDPAAF+DAVVQIYLDNAGDLEL+AK+IESS+LNFS
Sbjct  1    MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFSDAVVQIYLDNAGDLELIAKAIESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGDTFFEVVF G RTQPGT+K DEGERHPYS+ EC+P RE ILPSVIY+QK+LRR+PFL
Sbjct  61   RYGDTFFEVVFRGTRTQPGTIKLDEGERHPYSIFECEPTREVILPSVIYIQKLLRRRPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENVM+  LQSLELFE
Sbjct  121  IKNLENVMQKFLQSLELFE  139



>ref|XP_010551247.1| PREDICTED: protein krasavietz-like [Tarenaya hassleriana]
Length=411

 Score =   229 bits (583),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNIAAPLDPAAF+DAVVQIYLDNAGDLELVAKSIESS+LN S
Sbjct  1    MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFSDAVVQIYLDNAGDLELVAKSIESSDLNLS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGD F EVVFTGGRTQPGT+KP+EGERHPYSV +C+P+RE ILPSV+Y+QKILRR+PFL
Sbjct  61   RYGDIFLEVVFTGGRTQPGTIKPEEGERHPYSVFDCEPKREAILPSVVYIQKILRRRPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENVM   LQSLELFE
Sbjct  121  IKNLENVMGRFLQSLELFE  139



>gb|KCW58757.1| hypothetical protein EUGRSUZ_H01394 [Eucalyptus grandis]
Length=392

 Score =   228 bits (581),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDNAGDLE +AKSIE+S+LNFS
Sbjct  1    MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDNAGDLEHIAKSIEASDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGDTFFEVVFTGGRTQPGT KPDEGERHPYS+++C+ +RE ILPSVIY+QKILRR+PFL
Sbjct  61   RYGDTFFEVVFTGGRTQPGTTKPDEGERHPYSILDCESKREAILPSVIYIQKILRRRPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENVM+ L+QS+E  E
Sbjct  121  IKNLENVMQKLVQSMEFLE  139



>gb|KDO54046.1| hypothetical protein CISIN_1g01470512mg, partial [Citrus sinensis]
Length=349

 Score =   226 bits (577),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 119/137 (87%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = +1

Query  91   SKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFSRY  270
            SKEKPTLGGTRIK RKRNIAAPLDPAAF+DAVVQIYLDNAGDLEL+AK IESS+LNFSRY
Sbjct  1    SKEKPTLGGTRIKPRKRNIAAPLDPAAFSDAVVQIYLDNAGDLELIAKCIESSDLNFSRY  60

Query  271  GDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFLIK  450
            GDTFFEVVFTGGRTQPGT KPDEGERH YS+I+C+P+RE ILPSVIY+QKILRR+PFLIK
Sbjct  61   GDTFFEVVFTGGRTQPGTTKPDEGERHSYSIIDCEPQREAILPSVIYIQKILRRRPFLIK  120

Query  451  NLENVMRXLLQSLELFE  501
            NLENV R  +QSLELFE
Sbjct  121  NLENVTRRFMQSLELFE  137



>emb|CDY16396.1| BnaA02g12000D [Brassica napus]
Length=477

 Score =   230 bits (587),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 136/152 (89%), Gaps = 2/152 (1%)
 Frame = +1

Query  46   GLCLYFDSFRSWFMSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLEL  225
             L L F ++  WFMSSKEKPTLGGTRIKTRKRNIAAPLDPAAF+DAVV IYLDNAGDLEL
Sbjct  56   SLPLIFSTY--WFMSSKEKPTLGGTRIKTRKRNIAAPLDPAAFSDAVVLIYLDNAGDLEL  113

Query  226  VAKSIESSELNFSRYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSV  405
            VAK+IESS+LNFSRYGD FFEVVF GGRTQ G+VK DEGERHPYS+I+C+P RE ILPSV
Sbjct  114  VAKTIESSDLNFSRYGDIFFEVVFIGGRTQTGSVKSDEGERHPYSIIDCEPNREAILPSV  173

Query  406  IYVQKILRRKPFLIKNLENVMRXLLQSLELFE  501
            +Y+QKILRRKPFLIKNLENV R  LQSLELFE
Sbjct  174  VYIQKILRRKPFLIKNLENVTRRFLQSLELFE  205



>ref|XP_010070156.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Eucalyptus grandis]
 gb|KCW58756.1| hypothetical protein EUGRSUZ_H01394 [Eucalyptus grandis]
Length=411

 Score =   228 bits (582),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDNAGDLE +AKSIE+S+LNFS
Sbjct  1    MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDNAGDLEHIAKSIEASDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGDTFFEVVFTGGRTQPGT KPDEGERHPYS+++C+ +RE ILPSVIY+QKILRR+PFL
Sbjct  61   RYGDTFFEVVFTGGRTQPGTTKPDEGERHPYSILDCESKREAILPSVIYIQKILRRRPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENVM+ L+QS+E  E
Sbjct  121  IKNLENVMQKLVQSMEFLE  139



>emb|CDX91513.1| BnaC02g16470D [Brassica napus]
Length=468

 Score =   230 bits (586),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 136/151 (90%), Gaps = 2/151 (1%)
 Frame = +1

Query  49   LCLYFDSFRSWFMSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELV  228
            L L F ++  WFMSSKEKPTLGGTRIKTRKRNIAAPLDPAAF+DAVV IYLDNAGDLELV
Sbjct  48   LPLIFSTY--WFMSSKEKPTLGGTRIKTRKRNIAAPLDPAAFSDAVVLIYLDNAGDLELV  105

Query  229  AKSIESSELNFSRYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVI  408
            AK+IESS+LNFSRYGD FFEVVF GGRTQ G+VK DEGERHPYS+I+C+P RE ILPSV+
Sbjct  106  AKTIESSDLNFSRYGDIFFEVVFIGGRTQTGSVKSDEGERHPYSIIDCEPNREAILPSVV  165

Query  409  YVQKILRRKPFLIKNLENVMRXLLQSLELFE  501
            Y+QKILRRKPFLIKNLENV R  LQSLELFE
Sbjct  166  YIQKILRRKPFLIKNLENVTRRFLQSLELFE  196



>gb|KDO54042.1| hypothetical protein CISIN_1g01470512mg, partial [Citrus sinensis]
Length=327

 Score =   226 bits (575),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 119/137 (87%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = +1

Query  91   SKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFSRY  270
            SKEKPTLGGTRIK RKRNIAAPLDPAAF+DAVVQIYLDNAGDLEL+AK IESS+LNFSRY
Sbjct  1    SKEKPTLGGTRIKPRKRNIAAPLDPAAFSDAVVQIYLDNAGDLELIAKCIESSDLNFSRY  60

Query  271  GDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFLIK  450
            GDTFFEVVFTGGRTQPGT KPDEGERH YS+I+C+P+RE ILPSVIY+QKILRR+PFLIK
Sbjct  61   GDTFFEVVFTGGRTQPGTTKPDEGERHSYSIIDCEPQREAILPSVIYIQKILRRRPFLIK  120

Query  451  NLENVMRXLLQSLELFE  501
            NLENV R  +QSLELFE
Sbjct  121  NLENVTRRFMQSLELFE  137



>ref|XP_009144656.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Brassica rapa]
Length=411

 Score =   228 bits (581),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNIAAPLDPAAF+DAVVQIYLDNAGDLELVAKSIES++LNFS
Sbjct  1    MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFSDAVVQIYLDNAGDLELVAKSIESTDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGD FFEVVF G RTQPGTVKPDEGERHPYSVI+C+P+RE ILPSV+Y+QKILRR+P L
Sbjct  61   RYGDIFFEVVFIGRRTQPGTVKPDEGERHPYSVIDCEPKREAILPSVVYIQKILRRRPSL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENV R  LQSLELFE
Sbjct  121  IKNLENVTRRFLQSLELFE  139



>ref|XP_002489171.1| hypothetical protein SORBIDRAFT_0014s003010 [Sorghum bicolor]
 gb|EES20303.1| hypothetical protein SORBIDRAFT_0014s003010 [Sorghum bicolor]
Length=472

 Score =   229 bits (583),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = +1

Query  73   RSWFMSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSE  252
            RS FMSSKEKPTLGGTRIKTRKRNIAAPLDPA+F+DA+VQIYLDN GDLELVAKSIESS+
Sbjct  58   RSLFMSSKEKPTLGGTRIKTRKRNIAAPLDPASFSDAIVQIYLDNGGDLELVAKSIESSD  117

Query  253  LNFSRYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRR  432
            LNFSRYGDTFFEVVF GGRTQPGT+KP+EG+RHPYSV++C  +RE ILP V+Y+QK LRR
Sbjct  118  LNFSRYGDTFFEVVFVGGRTQPGTIKPEEGDRHPYSVLDCAAQRETILPFVLYIQKTLRR  177

Query  433  KPFLIKNLENVMRXLLQSLELFE  501
            +PFLIKNLENVMR  LQSLE FE
Sbjct  178  RPFLIKNLENVMRKFLQSLEFFE  200



>ref|XP_002868460.1| eIF4-gamma/eIF5/eIF2-epsilon domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH44719.1| eIF4-gamma/eIF5/eIF2-epsilon domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
Length=411

 Score =   227 bits (578),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNIAAPLDPAAF+DAVVQIYLDNAGDLELVAKSIESS+LNF+
Sbjct  1    MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFSDAVVQIYLDNAGDLELVAKSIESSDLNFT  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGD FFEVVF GGRTQ GTVK DEGERH YSVI+C+P+RE ILPSV+Y+QKILRRKPFL
Sbjct  61   RYGDIFFEVVFIGGRTQAGTVKSDEGERHTYSVIDCEPKREAILPSVVYIQKILRRKPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENV R  LQSLELFE
Sbjct  121  IKNLENVTRRFLQSLELFE  139



>gb|KDO54043.1| hypothetical protein CISIN_1g01470512mg, partial [Citrus sinensis]
 gb|KDO54044.1| hypothetical protein CISIN_1g01470512mg, partial [Citrus sinensis]
Length=387

 Score =   226 bits (576),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 119/137 (87%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = +1

Query  91   SKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFSRY  270
            SKEKPTLGGTRIK RKRNIAAPLDPAAF+DAVVQIYLDNAGDLEL+AK IESS+LNFSRY
Sbjct  1    SKEKPTLGGTRIKPRKRNIAAPLDPAAFSDAVVQIYLDNAGDLELIAKCIESSDLNFSRY  60

Query  271  GDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFLIK  450
            GDTFFEVVFTGGRTQPGT KPDEGERH YS+I+C+P+RE ILPSVIY+QKILRR+PFLIK
Sbjct  61   GDTFFEVVFTGGRTQPGTTKPDEGERHSYSIIDCEPQREAILPSVIYIQKILRRRPFLIK  120

Query  451  NLENVMRXLLQSLELFE  501
            NLENV R  +QSLELFE
Sbjct  121  NLENVTRRFMQSLELFE  137



>ref|NP_568534.1| C-terminal W2 domain of eIF4-gamma/eIF5/eIF2b-epsilon-containing 
protein [Arabidopsis thaliana]
 gb|AAL15273.1| AT5g36230/T30G6_9 [Arabidopsis thaliana]
 gb|AAM97138.1| putative protein [Arabidopsis thaliana]
 gb|AED94060.1| C-terminal W2 domain of eIF4-gamma/eIF5/eIF2b-epsilon-containing 
protein [Arabidopsis thaliana]
Length=411

 Score =   226 bits (577),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNIAAPLDPAAF+DAVVQIY DNAGDLELVAKSIESS+LNF+
Sbjct  1    MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFSDAVVQIYHDNAGDLELVAKSIESSDLNFT  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGD FFEV+F GGRTQPGTVK DEGERH YSVI+C+P+RE ILPSV+Y+QKILRRKPFL
Sbjct  61   RYGDIFFEVIFIGGRTQPGTVKSDEGERHTYSVIDCEPKREAILPSVVYIQKILRRKPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENV R  LQSLELFE
Sbjct  121  IKNLENVTRRFLQSLELFE  139



>ref|XP_007029310.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY09812.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
Length=414

 Score =   226 bits (577),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 120/137 (88%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = +1

Query  91   SKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFSRY  270
            SKEKPTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYL+N GDLELVA++IESS+LNF+RY
Sbjct  6    SKEKPTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLENVGDLELVARNIESSDLNFTRY  65

Query  271  GDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFLIK  450
            GDTFFEVVFTGGRTQPGT+KPDEGERHPYS+IEC+ +RE I PSV Y+QKILRR+PFLIK
Sbjct  66   GDTFFEVVFTGGRTQPGTIKPDEGERHPYSIIECEAKREAIFPSVSYIQKILRRRPFLIK  125

Query  451  NLENVMRXLLQSLELFE  501
            NLENVMR LLQSLELFE
Sbjct  126  NLENVMRKLLQSLELFE  142



>ref|XP_011077166.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2-like [Sesamum indicum]
Length=411

 Score =   226 bits (576),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNIAAPLDPAAF+DAVVQIYLDNAGDLELVAK+IESS+LNFS
Sbjct  1    MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFSDAVVQIYLDNAGDLELVAKNIESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGDTFFEVVF G RTQPGT+K DEGE HPYS+ +C+P+RE ILPSV+Y+QKILRR+PFL
Sbjct  61   RYGDTFFEVVFRGARTQPGTIKLDEGECHPYSIFDCEPKREVILPSVLYIQKILRRRPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENVM+  LQSLELFE
Sbjct  121  IKNLENVMQKFLQSLELFE  139



>ref|XP_010673945.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2-like [Beta vulgaris subsp. vulgaris]
Length=411

 Score =   226 bits (576),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKE+PTLGGTRIKTRKRNIAAPLDPAAF+DAVVQIYLDNAGDLEL+AKSIESSEL+FS
Sbjct  1    MSSKERPTLGGTRIKTRKRNIAAPLDPAAFSDAVVQIYLDNAGDLELIAKSIESSELDFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGDTFFEV+FTGGRTQPGT KPDEGERH +SVI C+P+RE ILPSV ++QKILRR+PFL
Sbjct  61   RYGDTFFEVLFTGGRTQPGTTKPDEGERHSFSVIHCEPKREDILPSVFFIQKILRRRPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IK LENVMR  LQSLELFE
Sbjct  121  IKYLENVMRRFLQSLELFE  139



>ref|NP_001132772.1| eukaryotic initiation factor 5C CG2922-PF, isoform F isoform 
1 [Zea mays]
 gb|ACF81764.1| unknown [Zea mays]
 gb|ACG37654.1| eukaryotic initiation factor 5C CG2922-PF, isoform F [Zea mays]
 gb|AFW65365.1| eukaryotic initiation factor 5C CG2922-PF, isoform F isoform 
1 [Zea mays]
 gb|AFW65366.1| eukaryotic initiation factor 5C CG2922-PF, isoform F isoform 
2 [Zea mays]
Length=411

 Score =   225 bits (574),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNIAAPLDPA+F+DA+VQIYLDN GDLELVAKSIESS+LNFS
Sbjct  1    MSSKEKPTLGGTRIKTRKRNIAAPLDPASFSDAIVQIYLDNGGDLELVAKSIESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGDTFFEVVF GGRTQPGTVKP+EG+RHPYSV++C  +RE ILP V+Y+QK LRR+PFL
Sbjct  61   RYGDTFFEVVFVGGRTQPGTVKPEEGDRHPYSVLDCASQREAILPFVLYIQKTLRRRPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENVMR  LQSLE FE
Sbjct  121  IKNLENVMRKFLQSLEFFE  139



>gb|ABG22461.1| expressed protein [Oryza sativa Japonica Group]
Length=355

 Score =   224 bits (570),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 130/140 (93%), Gaps = 1/140 (1%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGG RIKTRKRNIAAPLDPA+F+DA+VQIYLDNAGDLELVAKSIESS+LNFS
Sbjct  1    MSSKEKPTLGGQRIKTRKRNIAAPLDPASFSDAIVQIYLDNAGDLELVAKSIESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKP-DEGERHPYSVIECQPEREFILPSVIYVQKILRRKPF  441
            RYGDTFFEVVF GGRTQPGT+KP +EGERHPYSV++C  +RE ILPSV+Y+QK LRR+PF
Sbjct  61   RYGDTFFEVVFIGGRTQPGTIKPEEEGERHPYSVLDCAAQREAILPSVLYIQKTLRRRPF  120

Query  442  LIKNLENVMRXLLQSLELFE  501
            LIKNLENVMR  LQSLE FE
Sbjct  121  LIKNLENVMRKFLQSLEFFE  140



>ref|XP_009127390.1| PREDICTED: putative basic leucine zipper and W2 domain-containing 
protein 1-like 1 [Brassica rapa]
Length=411

 Score =   224 bits (572),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNIAAPLDPAAF+DAVV IYLDNAGDLELVAK+IESS+LNFS
Sbjct  1    MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFSDAVVLIYLDNAGDLELVAKAIESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGD FFEVVF GGRTQ G+VK DEGERHPYS+I+C+P RE ILPSV+Y+QKILRRKPFL
Sbjct  61   RYGDIFFEVVFIGGRTQTGSVKSDEGERHPYSIIDCEPNREAILPSVVYIQKILRRKPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENV R  LQSLELFE
Sbjct  121  IKNLENVTRRFLQSLELFE  139



>ref|XP_006300493.1| hypothetical protein CARUB_v10020379mg [Capsella rubella]
 gb|EOA33391.1| hypothetical protein CARUB_v10020379mg [Capsella rubella]
Length=401

 Score =   224 bits (570),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNIAAPLDPAAF+DAVVQIYLDNAGDLELVAKS+ESS+LNFS
Sbjct  1    MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFSDAVVQIYLDNAGDLELVAKSLESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGD FFEVVF GGRTQ G+VK DEGERHPYS+I+C+P R+ ILPSV+Y+QKILRRK FL
Sbjct  61   RYGDIFFEVVFIGGRTQTGSVKSDEGERHPYSIIDCEPTRDAILPSVVYIQKILRRKAFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENV R  LQSLELFE
Sbjct  121  IKNLENVTRRFLQSLELFE  139



>gb|KFK39915.1| hypothetical protein AALP_AA3G305600 [Arabis alpina]
Length=411

 Score =   224 bits (571),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNIAAPLDPAAF+DAVV IYLDNAGDLELVAKSIESS+LNFS
Sbjct  1    MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFSDAVVLIYLDNAGDLELVAKSIESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGD FFEVVF GGRTQ G+VK DEGERHPYS+I+C+P RE ILPSV+Y+QKILRR+PFL
Sbjct  61   RYGDIFFEVVFIGGRTQTGSVKSDEGERHPYSIIDCEPTREAILPSVVYIQKILRRRPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENV R  LQSLELFE
Sbjct  121  IKNLENVTRRFLQSLELFE  139



>ref|XP_006300494.1| hypothetical protein CARUB_v10020379mg [Capsella rubella]
 gb|EOA33392.1| hypothetical protein CARUB_v10020379mg [Capsella rubella]
Length=411

 Score =   224 bits (570),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNIAAPLDPAAF+DAVVQIYLDNAGDLELVAKS+ESS+LNFS
Sbjct  1    MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFSDAVVQIYLDNAGDLELVAKSLESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGD FFEVVF GGRTQ G+VK DEGERHPYS+I+C+P R+ ILPSV+Y+QKILRRK FL
Sbjct  61   RYGDIFFEVVFIGGRTQTGSVKSDEGERHPYSIIDCEPTRDAILPSVVYIQKILRRKAFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENV R  LQSLELFE
Sbjct  121  IKNLENVTRRFLQSLELFE  139



>ref|XP_002886828.1| eIF4-gamma/eIF5/eIF2-epsilon domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH63087.1| eIF4-gamma/eIF5/eIF2-epsilon domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
Length=411

 Score =   223 bits (569),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNIAAPLDPAAF+DAVVQIY+DNAGDLELVAKS+ESS+LNFS
Sbjct  1    MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFSDAVVQIYVDNAGDLELVAKSLESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGD FFEVVF GGRTQ G+VK DEGERHPYS+I+C+P RE ILPSV+Y+QKILRRK FL
Sbjct  61   RYGDIFFEVVFIGGRTQTGSVKSDEGERHPYSIIDCEPTREAILPSVVYIQKILRRKAFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENV R  LQSLELFE
Sbjct  121  IKNLENVTRRFLQSLELFE  139



>ref|NP_001150633.1| LOC100284266 [Zea mays]
 gb|ACG39841.1| eukaryotic initiation factor 5C CG2922-PF, isoform F [Zea mays]
 tpg|DAA38887.1| TPA: eukaryotic initiation factor 5C CG2922-PF, isoform F [Zea 
mays]
Length=411

 Score =   223 bits (569),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNIAAPLDPA+F+DA+VQIYLDN GDLELVAKSIESS+LNFS
Sbjct  1    MSSKEKPTLGGTRIKTRKRNIAAPLDPASFSDAIVQIYLDNGGDLELVAKSIESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGDTFFEVVF GGRTQPGTVKP+EG+RHPYS+++C  +RE ILP V+Y+QK LRR+PFL
Sbjct  61   RYGDTFFEVVFVGGRTQPGTVKPEEGDRHPYSMLDCVAQRETILPFVLYIQKTLRRRPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENVMR  LQSLE FE
Sbjct  121  IKNLENVMRKFLQSLEFFE  139



>ref|NP_001067760.1| Os11g0414000 [Oryza sativa Japonica Group]
 gb|ABA93043.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF28123.1| Os11g0414000 [Oryza sativa Japonica Group]
 gb|ACA50521.1| eIF4-gamma/eIF5/eIF2-epsilon domain containing protein [Oryza 
sativa Japonica Group]
 dbj|BAG92409.1| unnamed protein product [Oryza sativa Japonica Group]
Length=412

 Score =   223 bits (569),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 130/140 (93%), Gaps = 1/140 (1%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGG RIKTRKRNIAAPLDPA+F+DA+VQIYLDNAGDLELVAKSIESS+LNFS
Sbjct  1    MSSKEKPTLGGQRIKTRKRNIAAPLDPASFSDAIVQIYLDNAGDLELVAKSIESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKP-DEGERHPYSVIECQPEREFILPSVIYVQKILRRKPF  441
            RYGDTFFEVVF GGRTQPGT+KP +EGERHPYSV++C  +RE ILPSV+Y+QK LRR+PF
Sbjct  61   RYGDTFFEVVFIGGRTQPGTIKPEEEGERHPYSVLDCAAQREAILPSVLYIQKTLRRRPF  120

Query  442  LIKNLENVMRXLLQSLELFE  501
            LIKNLENVMR  LQSLE FE
Sbjct  121  LIKNLENVMRKFLQSLEFFE  140



>ref|NP_564845.1| ARM repeat superfamily protein [Arabidopsis thaliana]
 gb|AAL07030.1| unknown protein [Arabidopsis thaliana]
 gb|AAP04157.1| unknown protein [Arabidopsis thaliana]
 gb|AEE34345.1| ARM repeat superfamily protein [Arabidopsis thaliana]
Length=411

 Score =   223 bits (568),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNIAAPLDPAAF+DA+VQIYLDNAGDLELVA+S+ESS+LNFS
Sbjct  1    MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFSDALVQIYLDNAGDLELVARSLESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGD FFEVVF GGRTQ G+VK DEGERHPYS+I+C+P+RE ILPSV+Y+QKILRRK FL
Sbjct  61   RYGDIFFEVVFIGGRTQTGSVKSDEGERHPYSIIDCEPKREAILPSVVYIQKILRRKAFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENV R  LQSLELFE
Sbjct  121  IKNLENVTRRFLQSLELFE  139



>gb|AAM63296.1| unknown [Arabidopsis thaliana]
Length=411

 Score =   223 bits (568),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNIAAPLDPAAF+DA+VQIYLDNAGDLELVA+S+ESS+LNFS
Sbjct  1    MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFSDALVQIYLDNAGDLELVARSLESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGD FFEVVF GGRTQ G+VK DEGERHPYS+I+C+P+RE ILPSV+Y+QKILRRK FL
Sbjct  61   RYGDIFFEVVFIGGRTQTGSVKSDEGERHPYSIIDCEPKREAILPSVVYIQKILRRKAFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENV R  LQSLELFE
Sbjct  121  IKNLENVTRRFLQSLELFE  139



>ref|XP_006662876.1| PREDICTED: protein extra bases-like [Oryza brachyantha]
Length=412

 Score =   223 bits (568),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 130/140 (93%), Gaps = 1/140 (1%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGG RIKTRKRNIAAPLDPA+F+DA+VQIYLDNAGDLELVAKSIESS+LNFS
Sbjct  1    MSSKEKPTLGGQRIKTRKRNIAAPLDPASFSDAIVQIYLDNAGDLELVAKSIESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKP-DEGERHPYSVIECQPEREFILPSVIYVQKILRRKPF  441
            RYGDTFFEVVF GGRTQPGT+KP +EGERHPYSV++C  +RE +LPSV+Y+QK LRR+PF
Sbjct  61   RYGDTFFEVVFIGGRTQPGTIKPEEEGERHPYSVLDCAAQREAVLPSVLYIQKTLRRRPF  120

Query  442  LIKNLENVMRXLLQSLELFE  501
            LIKNLENVMR  LQSLE FE
Sbjct  121  LIKNLENVMRKFLQSLEFFE  140



>ref|XP_007207443.1| hypothetical protein PRUPE_ppa005197mg [Prunus persica]
 gb|EMJ08642.1| hypothetical protein PRUPE_ppa005197mg [Prunus persica]
Length=472

 Score =   223 bits (569),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 120/136 (88%), Positives = 128/136 (94%), Gaps = 0/136 (0%)
 Frame = +1

Query  94   KEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFSRYG  273
            KE+PTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDNAGDLEL+AK IESS+LNFSRYG
Sbjct  65   KERPTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDNAGDLELIAKCIESSDLNFSRYG  124

Query  274  DTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFLIKN  453
            DTFFEVVFTGGRTQPGT KPDEGERHPYSV+E +  R+ ILPSVIY+QKILRR+PFLIKN
Sbjct  125  DTFFEVVFTGGRTQPGTTKPDEGERHPYSVLESEATRDVILPSVIYIQKILRRRPFLIKN  184

Query  454  LENVMRXLLQSLELFE  501
            LENVMR  LQSLELFE
Sbjct  185  LENVMRRFLQSLELFE  200



>ref|XP_010528650.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2-like [Tarenaya hassleriana]
Length=411

 Score =   222 bits (565),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNIAAPLDPAAF+DAVVQIYLDNAGDLELVAKSIES++LNFS
Sbjct  1    MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFSDAVVQIYLDNAGDLELVAKSIESTDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGD FFEVVFTGGRTQPGT+KP+EGERH +SV + +P+RE IL SV+Y+QKILRR+PFL
Sbjct  61   RYGDIFFEVVFTGGRTQPGTIKPEEGERHHHSVFDGEPKREAILQSVVYIQKILRRRPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENVMR  LQSLELFE
Sbjct  121  IKNLENVMRRFLQSLELFE  139



>ref|XP_010415061.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2-like [Camelina sativa]
Length=411

 Score =   221 bits (564),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNIAAPLDPAAF+DA+VQIYLD+AGDLELVAKS+ESS+LNFS
Sbjct  1    MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFSDALVQIYLDSAGDLELVAKSLESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGD FFEVVF GGRTQ G+VK DEGERHPYS+I+C+P RE ILPSV+Y+QKILRRK FL
Sbjct  61   RYGDIFFEVVFIGGRTQTGSVKSDEGERHPYSIIDCEPTREAILPSVVYIQKILRRKAFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENV R  LQSLELFE
Sbjct  121  IKNLENVTRRFLQSLELFE  139



>ref|XP_010496215.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2-like [Camelina sativa]
Length=411

 Score =   221 bits (563),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNIAAPLDPAAF+DA+VQIYLD AGDLELVAKS+ESS+LNFS
Sbjct  1    MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFSDALVQIYLDTAGDLELVAKSLESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGD FFEVVF GGRTQ G+VK DEGERHPYS+I+C+P RE ILPSV+Y+QKILRRK FL
Sbjct  61   RYGDIFFEVVFIGGRTQTGSVKSDEGERHPYSIIDCEPTREAILPSVVYIQKILRRKAFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENV R  LQSLELFE
Sbjct  121  IKNLENVTRRFLQSLELFE  139



>ref|XP_009338445.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2-like [Pyrus x bretschneideri]
Length=327

 Score =   218 bits (556),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  112  GGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFSRYGDTFFEV  291
             GTRIKTRKRNIAAPLD AAFADAVVQIYLDNAGDLEL+AKSIESS+LNFSRYGDTFFEV
Sbjct  3    SGTRIKTRKRNIAAPLDTAAFADAVVQIYLDNAGDLELIAKSIESSDLNFSRYGDTFFEV  62

Query  292  VFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFLIKNLENVMR  471
            VFTGGRTQPGT KPDEGERHPYSV+E +P RE ILPSVIY+QKILRR+PFLIKNLENVMR
Sbjct  63   VFTGGRTQPGTTKPDEGERHPYSVLESEPTRELILPSVIYIQKILRRRPFLIKNLENVMR  122

Query  472  XLLQSLELFE  501
              LQSLELFE
Sbjct  123  RFLQSLELFE  132



>ref|XP_009364427.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2-like [Pyrus x bretschneideri]
Length=327

 Score =   218 bits (556),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  112  GGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFSRYGDTFFEV  291
             GTRIKTRKRNIAAPLD AAFADAVVQIYLDNAGDLEL+AKSIESS+LNFSRYGDTFFEV
Sbjct  3    SGTRIKTRKRNIAAPLDTAAFADAVVQIYLDNAGDLELIAKSIESSDLNFSRYGDTFFEV  62

Query  292  VFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFLIKNLENVMR  471
            VFTGGRTQPGT KPDEGERHPYSV+E +P RE ILPSVIY+QKILRR+PFLIKNLENVMR
Sbjct  63   VFTGGRTQPGTTKPDEGERHPYSVLESEPTRELILPSVIYIQKILRRRPFLIKNLENVMR  122

Query  472  XLLQSLELFE  501
              LQSLELFE
Sbjct  123  RFLQSLELFE  132



>gb|ACN36963.1| unknown [Zea mays]
Length=411

 Score =   221 bits (562),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNIAAPLDPA+F+DA+VQIYLDN GDLELVAKSIESS+LNF 
Sbjct  1    MSSKEKPTLGGTRIKTRKRNIAAPLDPASFSDAIVQIYLDNGGDLELVAKSIESSDLNFL  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGDTFFEVVF GGRTQPGTVKP+EG+RHPYS+++C  +RE ILP V+Y+QK LRR+PFL
Sbjct  61   RYGDTFFEVVFVGGRTQPGTVKPEEGDRHPYSMLDCVAQRETILPFVLYIQKTLRRRPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENVMR  LQSLE FE
Sbjct  121  IKNLENVMRKFLQSLEFFE  139



>ref|XP_010511414.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2-like [Camelina sativa]
Length=411

 Score =   220 bits (561),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNIAAPLDPAAF+DA+V IYLDNAGDLELVAKS+ESS+LNFS
Sbjct  1    MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFSDALVLIYLDNAGDLELVAKSLESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGD FFEVVF GGRTQ G+VK DEGERHPYS+I+C+P RE ILPSV+Y+QKILRRK FL
Sbjct  61   RYGDIFFEVVFIGGRTQTGSVKSDEGERHPYSIIDCEPTREAILPSVVYIQKILRRKAFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENV R  LQSLELFE
Sbjct  121  IKNLENVTRRFLQSLELFE  139



>gb|AAD26879.1|AC007230_13 Contains similarity to gb|D13630 KIAA0005 gene from Homo sapiens. 
ESTs gb|T45345, gb|T21086, gb|R90360, gb|T20468, gb|T45191 
and gb|AI100459 come from this gene [Arabidopsis thaliana]
Length=426

 Score =   221 bits (562),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = +1

Query  88   SSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFSR  267
            SSKEKPTLGGTRIKTRKRNIAAPLDPAAF+DA+VQIYLDNAGDLELVA+S+ESS+LNFSR
Sbjct  17   SSKEKPTLGGTRIKTRKRNIAAPLDPAAFSDALVQIYLDNAGDLELVARSLESSDLNFSR  76

Query  268  YGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFLI  447
            YGD FFEVVF GGRTQ G+VK DEGERHPYS+I+C+P+RE ILPSV+Y+QKILRRK FLI
Sbjct  77   YGDIFFEVVFIGGRTQTGSVKSDEGERHPYSIIDCEPKREAILPSVVYIQKILRRKAFLI  136

Query  448  KNLENVMRXLLQSLELFE  501
            KNLENV R  LQSLELFE
Sbjct  137  KNLENVTRRFLQSLELFE  154



>ref|XP_009342882.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2-like [Pyrus x bretschneideri]
Length=327

 Score =   218 bits (554),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  112  GGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFSRYGDTFFEV  291
             GTRIKTRKRN+AAPLD AAFADAVVQIYLDNAGDLEL+AKSIESS+LNFSRYGDTFFEV
Sbjct  3    SGTRIKTRKRNLAAPLDTAAFADAVVQIYLDNAGDLELIAKSIESSDLNFSRYGDTFFEV  62

Query  292  VFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFLIKNLENVMR  471
            VFTGGRTQPGT KPDEGERHPYSV+E +P RE ILPSVIY+QKILRR+PFLIKNLENVMR
Sbjct  63   VFTGGRTQPGTTKPDEGERHPYSVLESEPTRELILPSVIYIQKILRRRPFLIKNLENVMR  122

Query  472  XLLQSLELFE  501
              LQSLELFE
Sbjct  123  RFLQSLELFE  132



>gb|EYU39710.1| hypothetical protein MIMGU_mgv1a024075mg [Erythranthe guttata]
Length=401

 Score =   219 bits (559),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNIAAPLDPAAF+DAVVQIYLDNAGDLELVAKSIESS+LNFS
Sbjct  1    MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFSDAVVQIYLDNAGDLELVAKSIESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGDTFFEVVF G RTQPGT K DEGE HPY++I+C+P+RE ILPSVIY+QKILRRKPFL
Sbjct  61   RYGDTFFEVVFRGARTQPGTFKLDEGEHHPYAIIDCEPKREVILPSVIYIQKILRRKPFL  120

Query  445  IKNLENVMRXLLQ  483
            IKNLENVM+  LQ
Sbjct  121  IKNLENVMQRFLQ  133



>ref|XP_010111086.1| Basic leucine zipper and W2 domain-containing protein 2 [Morus 
notabilis]
 gb|EXC29948.1| Basic leucine zipper and W2 domain-containing protein 2 [Morus 
notabilis]
Length=482

 Score =   221 bits (564),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 131/142 (92%), Gaps = 4/142 (3%)
 Frame = +1

Query  88   SSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFSR  267
            +SKE+PTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDNAGDLE VAKS ESS+LNFSR
Sbjct  69   NSKERPTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDNAGDLEAVAKSFESSDLNFSR  128

Query  268  YGDTFFE----VVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRK  435
            YGDTFFE    V+FTGGRTQPGT KPDEGERHPYS+++ +P+RE ILPSVIY+QKILRR+
Sbjct  129  YGDTFFEASFFVIFTGGRTQPGTTKPDEGERHPYSILDYEPKREVILPSVIYIQKILRRR  188

Query  436  PFLIKNLENVMRXLLQSLELFE  501
            PFLIKNLENVMR  LQSLELFE
Sbjct  189  PFLIKNLENVMRKFLQSLELFE  210



>ref|XP_004979204.1| PREDICTED: protein extra bases-like isoform X3 [Setaria italica]
Length=412

 Score =   219 bits (559),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 129/140 (92%), Gaps = 1/140 (1%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNIAAPLDPA+F+DA+VQIYLDN GDLELVAKSIESS+LNFS
Sbjct  1    MSSKEKPTLGGTRIKTRKRNIAAPLDPASFSDAIVQIYLDNGGDLELVAKSIESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKP-DEGERHPYSVIECQPEREFILPSVIYVQKILRRKPF  441
            RYGDTFFEVVF GGRTQPGT+KP +EG+RHPYSV++C  +RE ILP V+Y+QK LRR+PF
Sbjct  61   RYGDTFFEVVFVGGRTQPGTIKPEEEGDRHPYSVLDCAAQREAILPFVLYLQKTLRRRPF  120

Query  442  LIKNLENVMRXLLQSLELFE  501
            LIKNLENVMR  LQSLE FE
Sbjct  121  LIKNLENVMRKFLQSLEFFE  140



>gb|ADE77903.1| unknown [Picea sitchensis]
Length=411

 Score =   219 bits (558),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKE+PTLGG RIKTRKRNIAAPLDP  FADAVVQIYL++ GDLELVAKSIESS+L+FS
Sbjct  1    MSSKERPTLGGARIKTRKRNIAAPLDPTTFADAVVQIYLEHEGDLELVAKSIESSDLDFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGDTFFEVVF GGRTQPGT+KP+EG+RHP++V+ C+P R+ ILPSV+Y+QKILRR+PFL
Sbjct  61   RYGDTFFEVVFIGGRTQPGTIKPEEGDRHPHAVLNCEPARQNILPSVLYIQKILRRRPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENVMR  LQSLELFE
Sbjct  121  IKNLENVMRRFLQSLELFE  139



>gb|KHN29266.1| Riboflavin biosynthesis protein RibD [Glycine soja]
Length=1096

 Score =   228 bits (581),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 146/179 (82%), Gaps = 18/179 (10%)
 Frame = +1

Query  10   FSLFIFA*RIAEGLCLYFDSFRSWFMS--SKEKPTLGGTRIKTRKRNIaapldpaafada  183
            F+ F+++  +   + +Y     SW +   SKE+PTLGGTRIKTRKRNIAAPLDPAAF+DA
Sbjct  159  FAHFLYSAVMTISVLVYI---LSWVLQCHSKERPTLGGTRIKTRKRNIAAPLDPAAFSDA  215

Query  184  VVQIYLDNAGDLELVAKSIESSELNFSRYGDTFFE-------------VVFTGGRTQPGT  324
            VVQIYLDNAGDLEL+AKSIESS+LNFSRYGDTFFE             VVFTGGRTQPGT
Sbjct  216  VVQIYLDNAGDLELIAKSIESSDLNFSRYGDTFFEASFLNYLKTFTLIVVFTGGRTQPGT  275

Query  325  VKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFLIKNLENVMRXLLQSLELFE  501
             KPDEG+RHPYS+IEC+P+RE ILPSVIY+QKILRR+PFLIKNLENVMR  LQSLELFE
Sbjct  276  TKPDEGDRHPYSIIECEPKREVILPSVIYIQKILRRRPFLIKNLENVMRKFLQSLELFE  334



>gb|EEE68271.1| hypothetical protein OsJ_26502 [Oryza sativa Japonica Group]
Length=449

 Score =   219 bits (558),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 128/139 (92%), Gaps = 1/139 (1%)
 Frame = +1

Query  88   SSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFSR  267
             SKEKPTLGG RIKTRKRNIAAPLDPA+F+DA+VQIYLDNAGDLELVAKSIESS+LNFSR
Sbjct  39   CSKEKPTLGGQRIKTRKRNIAAPLDPASFSDAIVQIYLDNAGDLELVAKSIESSDLNFSR  98

Query  268  YGDTFFEVVFTGGRTQPGTVKP-DEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            YGDTFFEVVF GGRTQPGT+KP +EGERHPYSV++C  +RE ILPSV+Y+QK LRR+PFL
Sbjct  99   YGDTFFEVVFIGGRTQPGTIKPEEEGERHPYSVLDCAAQREAILPSVLYIQKTLRRRPFL  158

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENVMR  LQSLE FE
Sbjct  159  IKNLENVMRKFLQSLEFFE  177



>ref|XP_004979203.1| PREDICTED: protein extra bases-like isoform X2 [Setaria italica]
Length=418

 Score =   218 bits (555),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 130/143 (91%), Gaps = 1/143 (1%)
 Frame = +1

Query  76   SWFMSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSEL  255
            S+  SSKEKPTLGGTRIKTRKRNIAAPLDPA+F+DA+VQIYLDN GDLELVAKSIESS+L
Sbjct  4    SFLCSSKEKPTLGGTRIKTRKRNIAAPLDPASFSDAIVQIYLDNGGDLELVAKSIESSDL  63

Query  256  NFSRYGDTFFEVVFTGGRTQPGTVKP-DEGERHPYSVIECQPEREFILPSVIYVQKILRR  432
            NFSRYGDTFFEVVF GGRTQPGT+KP +EG+RHPYSV++C  +RE ILP V+Y+QK LRR
Sbjct  64   NFSRYGDTFFEVVFVGGRTQPGTIKPEEEGDRHPYSVLDCAAQREAILPFVLYLQKTLRR  123

Query  433  KPFLIKNLENVMRXLLQSLELFE  501
            +PFLIKNLENVMR  LQSLE FE
Sbjct  124  RPFLIKNLENVMRKFLQSLEFFE  146



>tpg|DAA38888.1| TPA: hypothetical protein ZEAMMB73_614010 [Zea mays]
Length=415

 Score =   217 bits (553),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 129/143 (90%), Gaps = 4/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDL----ELVAKSIESSE  252
            MSSKEKPTLGGTRIKTRKRNIAAPLDPA+F+DA+VQIYLDN GDL    ELVAKSIESS+
Sbjct  1    MSSKEKPTLGGTRIKTRKRNIAAPLDPASFSDAIVQIYLDNGGDLVRPSELVAKSIESSD  60

Query  253  LNFSRYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRR  432
            LNFSRYGDTFFEVVF GGRTQPGTVKP+EG+RHPYS+++C  +RE ILP V+Y+QK LRR
Sbjct  61   LNFSRYGDTFFEVVFVGGRTQPGTVKPEEGDRHPYSMLDCVAQRETILPFVLYIQKTLRR  120

Query  433  KPFLIKNLENVMRXLLQSLELFE  501
            +PFLIKNLENVMR  LQSLE FE
Sbjct  121  RPFLIKNLENVMRKFLQSLEFFE  143



>gb|EMS51816.1| Basic leucine zipper and W2 domain-containing protein 2 [Triticum 
urartu]
Length=426

 Score =   213 bits (541),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 128/140 (91%), Gaps = 1/140 (1%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            +SSKEKPTLGG RIKTRKRNIAAPLDP++F+DA+VQIYLDNAGDLELVAKSIESS+LNFS
Sbjct  15   LSSKEKPTLGGQRIKTRKRNIAAPLDPSSFSDAIVQIYLDNAGDLELVAKSIESSDLNFS  74

Query  265  RYGDTFFEVVFTGGRTQPGTVKP-DEGERHPYSVIECQPEREFILPSVIYVQKILRRKPF  441
            RYGDTFFEVVF G RTQPGT+KP +EGERHPYS+I+C  +RE ILP V+++QK LRR+PF
Sbjct  75   RYGDTFFEVVFIGVRTQPGTIKPEEEGERHPYSLIDCAAQREAILPYVLFIQKTLRRRPF  134

Query  442  LIKNLENVMRXLLQSLELFE  501
            LIK+LENVMR  LQSLE FE
Sbjct  135  LIKSLENVMRKFLQSLEFFE  154



>ref|XP_002968010.1| hypothetical protein SELMODRAFT_145222 [Selaginella moellendorffii]
 gb|EFJ31357.1| hypothetical protein SELMODRAFT_145222 [Selaginella moellendorffii]
Length=411

 Score =   212 bits (539),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MS+KE+PTLGGTRIKTRKRNIA PLDP++FADA+VQIYLD+AGDLEL AKSIE+S+L+FS
Sbjct  1    MSTKERPTLGGTRIKTRKRNIAIPLDPSSFADAIVQIYLDHAGDLELTAKSIEASDLDFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGDTFFEVVFTGGR QPGT KP++GER PY+V+ C+  R  ILP V+Y+QKI+RR+PFL
Sbjct  61   RYGDTFFEVVFTGGRNQPGTTKPEDGERQPYAVLNCEATRPSILPYVLYIQKIIRRRPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENVMR LLQSLELF+
Sbjct  121  IKNLENVMRRLLQSLELFD  139



>gb|AFW20016.1| eIF5-mimic protein [Triticum aestivum]
Length=412

 Score =   212 bits (539),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 126/140 (90%), Gaps = 1/140 (1%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGG RIKTRKRNIAAP DP++F+DA+VQ YLDNAGDLELVAKSIESS+LNFS
Sbjct  1    MSSKEKPTLGGQRIKTRKRNIAAPSDPSSFSDAIVQTYLDNAGDLELVAKSIESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKP-DEGERHPYSVIECQPEREFILPSVIYVQKILRRKPF  441
            RYGDTFFEVVF G RTQPGT+KP +EGERHPYS+I+C  +RE ILP V+++QK LRR+PF
Sbjct  61   RYGDTFFEVVFIGVRTQPGTIKPEEEGERHPYSLIDCAAQREAILPYVLFIQKTLRRRPF  120

Query  442  LIKNLENVMRXLLQSLELFE  501
            LIK+LENVMR  LQSLE FE
Sbjct  121  LIKSLENVMRKFLQSLEFFE  140



>ref|XP_002992407.1| hypothetical protein SELMODRAFT_162293 [Selaginella moellendorffii]
 gb|EFJ06557.1| hypothetical protein SELMODRAFT_162293 [Selaginella moellendorffii]
Length=411

 Score =   212 bits (539),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MS+KE+PTLGGTRIKTRKRNIA PLDP++FADA+VQIYLD+AGDLEL AKSIE+S+L+FS
Sbjct  1    MSTKERPTLGGTRIKTRKRNIAIPLDPSSFADAIVQIYLDHAGDLELTAKSIEASDLDFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYGDTFFEVVFTGGR QPGT KP++GER PY+V+ C+  R  ILP V+Y+QKI+RR+PFL
Sbjct  61   RYGDTFFEVVFTGGRNQPGTTKPEDGERQPYAVLNCEATRPSILPYVLYIQKIIRRRPFL  120

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENVMR LLQSLELF+
Sbjct  121  IKNLENVMRRLLQSLELFD  139



>ref|XP_003577596.1| PREDICTED: protein krasavietz-like [Brachypodium distachyon]
Length=412

 Score =   212 bits (539),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 128/140 (91%), Gaps = 1/140 (1%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGG RIKTRKRNIAAPLDPA+F+DA+VQIYLDNAGDLELVAKS+ESS+LNFS
Sbjct  1    MSSKEKPTLGGQRIKTRKRNIAAPLDPASFSDAIVQIYLDNAGDLELVAKSVESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKP-DEGERHPYSVIECQPEREFILPSVIYVQKILRRKPF  441
            RYGDTFFEVVF G RTQPGT+KP +EGERHPYS+I+C  +RE I+P V+++QK LRR+PF
Sbjct  61   RYGDTFFEVVFIGVRTQPGTIKPEEEGERHPYSLIDCAAQREAIVPYVLFIQKTLRRRPF  120

Query  442  LIKNLENVMRXLLQSLELFE  501
            LIK+LENVMR  LQSLE FE
Sbjct  121  LIKSLENVMRKFLQSLEFFE  140



>gb|AFW20017.1| eIF5-mimic protein [Triticum aestivum]
Length=412

 Score =   211 bits (538),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 128/140 (91%), Gaps = 1/140 (1%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGG RIKTRKRNIAAPLDP++F+DA+VQIYLDNAG+LELVAKSIESS+LNFS
Sbjct  1    MSSKEKPTLGGQRIKTRKRNIAAPLDPSSFSDAIVQIYLDNAGNLELVAKSIESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKP-DEGERHPYSVIECQPEREFILPSVIYVQKILRRKPF  441
            RYGDTFFEVVF G RTQPGT+KP +EGERHPYS+I+C  +RE ILP V+++QK LRR+PF
Sbjct  61   RYGDTFFEVVFIGVRTQPGTIKPEEEGERHPYSLIDCAAQREAILPYVLFIQKTLRRRPF  120

Query  442  LIKNLENVMRXLLQSLELFE  501
            LIK+LENVMR  LQSLE FE
Sbjct  121  LIKSLENVMRKFLQSLEFFE  140



>gb|AFW20014.1| eIF5-mimic protein [Triticum aestivum]
Length=412

 Score =   211 bits (538),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 127/140 (91%), Gaps = 1/140 (1%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGG RIKTRKRNIAAPLDP++F+DA+VQIYLDNAGDLELVAKSIESS+LNFS
Sbjct  1    MSSKEKPTLGGQRIKTRKRNIAAPLDPSSFSDAIVQIYLDNAGDLELVAKSIESSDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKP-DEGERHPYSVIECQPEREFILPSVIYVQKILRRKPF  441
            RYGDT FEVVF G RTQPGT+KP +EGERHPYS+I+C  +RE ILP V+++QK LRR+PF
Sbjct  61   RYGDTLFEVVFIGVRTQPGTIKPEEEGERHPYSLIDCAAQREAILPYVLFIQKTLRRRPF  120

Query  442  LIKNLENVMRXLLQSLELFE  501
            LIK+LENVMR  LQSLE FE
Sbjct  121  LIKSLENVMRKFLQSLEFFE  140



>gb|EMT26430.1| Basic leucine zipper and W2 domain-containing protein 2 [Aegilops 
tauschii]
Length=482

 Score =   212 bits (540),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 128/140 (91%), Gaps = 1/140 (1%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            +SSKEKPTLGG RIKTRKRNIAAPLDP++F+DA+VQIYLDNAGDLELVAKSIESS+LNFS
Sbjct  71   LSSKEKPTLGGQRIKTRKRNIAAPLDPSSFSDAIVQIYLDNAGDLELVAKSIESSDLNFS  130

Query  265  RYGDTFFEVVFTGGRTQPGTVKP-DEGERHPYSVIECQPEREFILPSVIYVQKILRRKPF  441
            RYGDTFFEVVF G RTQPGT+KP +EGERHPYS+I+C  +RE ILP V+++QK LRR+PF
Sbjct  131  RYGDTFFEVVFIGVRTQPGTIKPEEEGERHPYSLIDCAAQREAILPYVLFIQKTLRRRPF  190

Query  442  LIKNLENVMRXLLQSLELFE  501
            LIK+LENVMR  LQSLE FE
Sbjct  191  LIKSLENVMRKFLQSLEFFE  210



>gb|AFW20015.1| eIF5-mimic protein [Triticum aestivum]
Length=412

 Score =   210 bits (534),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 126/140 (90%), Gaps = 1/140 (1%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGG RIKTRKRNIAAPLDP++F+DA+VQIYLDNAGDLELVAKSIES +LNFS
Sbjct  1    MSSKEKPTLGGQRIKTRKRNIAAPLDPSSFSDAIVQIYLDNAGDLELVAKSIESPDLNFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKP-DEGERHPYSVIECQPEREFILPSVIYVQKILRRKPF  441
            RYGDTFFEV F G RTQPGT+KP +EGERHPYS+I+C  +RE ILP V+++QK LRR+PF
Sbjct  61   RYGDTFFEVAFIGVRTQPGTIKPEEEGERHPYSLIDCAAQREAILPYVLFIQKTLRRRPF  120

Query  442  LIKNLENVMRXLLQSLELFE  501
            LIK+LENVMR  LQSLE FE
Sbjct  121  LIKSLENVMRKFLQSLEFFE  140



>dbj|BAB09363.1| unnamed protein product [Arabidopsis thaliana]
Length=429

 Score =   209 bits (531),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = +1

Query  88   SSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFSR  267
            +++ +  L GTRIKTRKRNIAAPLDPAAF+DAVVQIY DNAGDLELVAKSIESS+LNF+R
Sbjct  20   AARRRNPLSGTRIKTRKRNIAAPLDPAAFSDAVVQIYHDNAGDLELVAKSIESSDLNFTR  79

Query  268  YGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFLI  447
            YGD FFEV+F GGRTQPGTVK DEGERH YSVI+C+P+RE ILPSV+Y+QKILRRKPFLI
Sbjct  80   YGDIFFEVIFIGGRTQPGTVKSDEGERHTYSVIDCEPKREAILPSVVYIQKILRRKPFLI  139

Query  448  KNLENVMRXLLQSLELFE  501
            KNLENV R  LQSLELFE
Sbjct  140  KNLENVTRRFLQSLELFE  157



>gb|EPS67129.1| hypothetical protein M569_07647, partial [Genlisea aurea]
Length=222

 Score =   202 bits (513),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 107/129 (83%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = +1

Query  115  GTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFSRYGDTFFEVV  294
            GTRIKTRKRNI APLDPA F+DAVVQIYLDN+GDLELVAK +ESSELNFSRYGDTFFEVV
Sbjct  1    GTRIKTRKRNITAPLDPAGFSDAVVQIYLDNSGDLELVAKCLESSELNFSRYGDTFFEVV  60

Query  295  FTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFLIKNLENVMRX  474
            F G RTQPGTVKPDEGE HPYS+I+  P RE ILPSV+Y+QKILRR+PFLIKNLENVM+ 
Sbjct  61   FRGARTQPGTVKPDEGESHPYSIIDSDPTREAILPSVLYIQKILRRRPFLIKNLENVMQR  120

Query  475  LLQSLELFE  501
             LQSLELF+
Sbjct  121  FLQSLELFQ  129



>gb|AFW65367.1| hypothetical protein ZEAMMB73_053341 [Zea mays]
Length=420

 Score =   205 bits (521),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 107/129 (83%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = +1

Query  115  GTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFSRYGDTFFEVV  294
            GTRIKTRKRNIAAPLDPA+F+DA+VQIYLDN GDLELVAKSIESS+LNFSRYGDTFFEVV
Sbjct  20   GTRIKTRKRNIAAPLDPASFSDAIVQIYLDNGGDLELVAKSIESSDLNFSRYGDTFFEVV  79

Query  295  FTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFLIKNLENVMRX  474
            F GGRTQPGTVKP+EG+RHPYSV++C  +RE ILP V+Y+QK LRR+PFLIKNLENVMR 
Sbjct  80   FVGGRTQPGTVKPEEGDRHPYSVLDCASQREAILPFVLYIQKTLRRRPFLIKNLENVMRK  139

Query  475  LLQSLELFE  501
             LQSLE FE
Sbjct  140  FLQSLEFFE  148



>gb|AAX95492.1| putative protein [Oryza sativa Japonica Group]
Length=412

 Score =   203 bits (516),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 120/130 (92%), Gaps = 1/130 (1%)
 Frame = +1

Query  115  GTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFSRYGDTFFEVV  294
            G RIKTRKRNIAAPLDPA+F+DA+VQIYLDNAGDLELVAKSIESS+LNFSRYGDTFFEVV
Sbjct  11   GQRIKTRKRNIAAPLDPASFSDAIVQIYLDNAGDLELVAKSIESSDLNFSRYGDTFFEVV  70

Query  295  FTGGRTQPGTVKP-DEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFLIKNLENVMR  471
            F GGRTQPGT+KP +EGERHPYSV++C  +RE ILPSV+Y+QK LRR+PFLIKNLENVMR
Sbjct  71   FIGGRTQPGTIKPEEEGERHPYSVLDCAAQREAILPSVLYIQKTLRRRPFLIKNLENVMR  130

Query  472  XLLQSLELFE  501
              LQSLE FE
Sbjct  131  KFLQSLEFFE  140



>ref|XP_001785917.1| predicted protein [Physcomitrella patens]
 gb|EDQ49275.1| predicted protein [Physcomitrella patens]
Length=411

 Score =   202 bits (515),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNIA PLD   FADAVVQIY +++GDLEL+AK +++SEL+FS
Sbjct  1    MSSKEKPTLGGTRIKTRKRNIAVPLDTGTFADAVVQIYNEHSGDLELIAKDVDASELDFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYG+TFFEVVFTGGR QPGT KP+EGERHPYSV+ C   RE ILP V+++QKI+RR+PF+
Sbjct  61   RYGETFFEVVFTGGRNQPGTTKPEEGERHPYSVLNCDDTRESILPIVLFLQKIIRRRPFM  120

Query  445  IKNLENVMRXLLQSLELF  498
            IK LENVM+ LLQSLEL+
Sbjct  121  IKTLENVMKRLLQSLELY  138



>ref|XP_001758587.1| predicted protein [Physcomitrella patens]
 gb|EDQ76565.1| predicted protein [Physcomitrella patens]
Length=411

 Score =   198 bits (504),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNIA PLD   FADAVVQIY ++ GDLEL+AK +++SEL+FS
Sbjct  1    MSSKEKPTLGGTRIKTRKRNIAVPLDTGTFADAVVQIYNEHKGDLELIAKDVDASELDFS  60

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
            RYG+TFFEVVFTGGR QPGT KP+EGERH YSV+ C   RE ILP V+++QKI+RR+PF+
Sbjct  61   RYGETFFEVVFTGGRNQPGTTKPEEGERHMYSVLTCNDTRESILPVVLFLQKIIRRRPFM  120

Query  445  IKNLENVMRXLLQSLELF  498
            IK LENVM+ LLQSLEL+
Sbjct  121  IKALENVMKRLLQSLELY  138



>ref|XP_004979202.1| PREDICTED: protein extra bases-like isoform X1 [Setaria italica]
Length=499

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 119/130 (92%), Gaps = 1/130 (1%)
 Frame = +1

Query  115  GTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFSRYGDTFFEVV  294
            GTRIKTRKRNIAAPLDPA+F+DA+VQIYLDN GDLELVAKSIESS+LNFSRYGDTFFEVV
Sbjct  98   GTRIKTRKRNIAAPLDPASFSDAIVQIYLDNGGDLELVAKSIESSDLNFSRYGDTFFEVV  157

Query  295  FTGGRTQPGTVKP-DEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFLIKNLENVMR  471
            F GGRTQPGT+KP +EG+RHPYSV++C  +RE ILP V+Y+QK LRR+PFLIKNLENVMR
Sbjct  158  FVGGRTQPGTIKPEEEGDRHPYSVLDCAAQREAILPFVLYLQKTLRRRPFLIKNLENVMR  217

Query  472  XLLQSLELFE  501
              LQSLE FE
Sbjct  218  KFLQSLEFFE  227



>ref|XP_001778269.1| predicted protein [Physcomitrella patens]
 gb|EDQ56936.1| predicted protein [Physcomitrella patens]
Length=404

 Score =   174 bits (442),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = +1

Query  112  GGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFSRYGDTFFEV  291
             GTRIKTRKRNIA PLD A FADAVVQIY ++ GDLEL+AK ++SSEL+FSRYG+TFFEV
Sbjct  5    SGTRIKTRKRNIAVPLDTATFADAVVQIYNEHKGDLELIAKDVDSSELDFSRYGETFFEV  64

Query  292  VFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFLIKNLENVMR  471
            VFTG   QPGT KP+EGERHPYSV+ C   RE ILP V+++QKI+RR+PF+IK LENVM+
Sbjct  65   VFTGEPNQPGTTKPEEGERHPYSVLNCDDTRESILPVVLFLQKIIRRRPFMIKTLENVMK  124

Query  472  XLLQSLELF  498
             LLQSL +F
Sbjct  125  RLLQSLVIF  133



>ref|XP_006428598.1| hypothetical protein CICLE_v10011861mg [Citrus clementina]
 gb|ESR41838.1| hypothetical protein CICLE_v10011861mg [Citrus clementina]
Length=368

 Score =   171 bits (433),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/94 (83%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = +1

Query  220  ELVAKSIESSELNFSRYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILP  399
            EL+AK IESS+LNFSRYGDTFFEVVFTGGRTQPGT KPDEGERH YS+I+C+P+RE ILP
Sbjct  3    ELIAKCIESSDLNFSRYGDTFFEVVFTGGRTQPGTTKPDEGERHSYSIIDCEPQREAILP  62

Query  400  SVIYVQKILRRKPFLIKNLENVMRXLLQSLELFE  501
            SVIY+QKILRR+PFLIKNLENV R  +QSLELFE
Sbjct  63   SVIYIQKILRRRPFLIKNLENVTRRFMQSLELFE  96



>ref|XP_006391576.1| hypothetical protein EUTSA_v10018708mg [Eutrema salsugineum]
 gb|ESQ28862.1| hypothetical protein EUTSA_v10018708mg [Eutrema salsugineum]
Length=381

 Score =   160 bits (405),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 103/139 (74%), Gaps = 23/139 (17%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNIA PLDPAAF+DAVV IYLDNAGDL               
Sbjct  1    MSSKEKPTLGGTRIKTRKRNIAPPLDPAAFSDAVVVIYLDNAGDL---------------  45

Query  265  RYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFL  444
                    VVF GGRTQ  +VK D+GE HPYS+I+C+P RE ILPSV+Y+Q ILRRKPFL
Sbjct  46   --------VVFIGGRTQTCSVKSDDGECHPYSIIDCEPTREAILPSVVYIQNILRRKPFL  97

Query  445  IKNLENVMRXLLQSLELFE  501
            IKNLENV R  LQSLELFE
Sbjct  98   IKNLENVTRRFLQSLELFE  116



>gb|EEC84251.1| hypothetical protein OsI_30699 [Oryza sativa Indica Group]
Length=376

 Score =   154 bits (388),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 105/138 (76%), Gaps = 0/138 (0%)
 Frame = +1

Query  88   SSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFSR  267
             SKEKPTLGG RIKTRKRNIAAPLDPA+F+DA+VQIYLDNAGDLELVAKSIESS+LNFSR
Sbjct  39   CSKEKPTLGGQRIKTRKRNIAAPLDPASFSDAIVQIYLDNAGDLELVAKSIESSDLNFSR  98

Query  268  YGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFLI  447
            YGDTFFEVVF GGRTQPGT+KP+E E  P   + C  +     PSV  + K   +KPF +
Sbjct  99   YGDTFFEVVFIGGRTQPGTIKPEEKEDLPQFRLRCHGQAGPFSPSVFTITKPWPQKPFWL  158

Query  448  KNLENVMRXLLQSLELFE  501
            + LE +      S+E+ E
Sbjct  159  RILEKLRPKSSHSMEVLE  176



>gb|KDO54045.1| hypothetical protein CISIN_1g01470512mg, partial [Citrus sinensis]
Length=359

 Score =   130 bits (328),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 58/72 (81%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +1

Query  286  EVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFLIKNLENV  465
            +VVFTGGRTQPGT KPDEGERH YS+I+C+P+RE ILPSVIY+QKILRR+PFLIKNLENV
Sbjct  38   QVVFTGGRTQPGTTKPDEGERHSYSIIDCEPQREAILPSVIYIQKILRRRPFLIKNLENV  97

Query  466  MRXLLQSLELFE  501
             R  +QSLELFE
Sbjct  98   TRRFMQSLELFE  109


 Score = 50.4 bits (119),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  179  MQWSRSIWIMLVIWNSLLRALSHQNLTSLDTVTLFLR  289
            MQWSR IWIMLVIWN L  AL+   LTS DTVT FLR
Sbjct  1    MQWSRFIWIMLVIWNLLPSALNLLTLTSQDTVTPFLR  37



>emb|CDP04197.1| unnamed protein product [Coffea canephora]
Length=378

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +1

Query  289  VVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFLIKNLENVM  468
            VVFTGGRTQPGT KPDEG+RHPYS+IEC+P+R+ ILPSV+Y+QKILRRKPFLIKNLENVM
Sbjct  36   VVFTGGRTQPGTTKPDEGDRHPYSIIECEPKRDVILPSVVYIQKILRRKPFLIKNLENVM  95

Query  469  RXLLQSLELFE  501
            R  LQSLELFE
Sbjct  96   RRFLQSLELFE  106



>emb|CDP04198.1| unnamed protein product [Coffea canephora]
Length=107

 Score =   119 bits (298),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +1

Query  58   YFDSFRSWFMSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKS  237
            + D   SWFMSSKE+PTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDNAGDLEL+AKS
Sbjct  24   FLDFSTSWFMSSKERPTLGGTRIKTRKRNIAAPLDPAAFADAVVQIYLDNAGDLELIAKS  83

Query  238  IESSELNFSRYGDTFFEVVFTG  303
            IESS+LNFSRYGDTFFE   +G
Sbjct  84   IESSDLNFSRYGDTFFEASISG  105



>gb|AFW65369.1| hypothetical protein ZEAMMB73_053341 [Zea mays]
Length=333

 Score =   122 bits (306),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +1

Query  286  EVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFLIKNLENV  465
            +VVF GGRTQPGTVKP+EG+RHPYSV++C  +RE ILP V+Y+QK LRR+PFLIKNLENV
Sbjct  11   QVVFVGGRTQPGTVKPEEGDRHPYSVLDCASQREAILPFVLYIQKTLRRRPFLIKNLENV  70

Query  466  MRXLLQSLELFE  501
            MR  LQSLE FE
Sbjct  71   MRKFLQSLEFFE  82



>gb|AFW65368.1| hypothetical protein ZEAMMB73_053341 [Zea mays]
Length=354

 Score =   122 bits (306),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +1

Query  286  EVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFLIKNLENV  465
            +VVF GGRTQPGTVKP+EG+RHPYSV++C  +RE ILP V+Y+QK LRR+PFLIKNLENV
Sbjct  11   QVVFVGGRTQPGTVKPEEGDRHPYSVLDCASQREAILPFVLYIQKTLRRRPFLIKNLENV  70

Query  466  MRXLLQSLELFE  501
            MR  LQSLE FE
Sbjct  71   MRKFLQSLEFFE  82



>gb|AAX96720.1| expressed protein [Oryza sativa Japonica Group]
Length=344

 Score =   120 bits (300),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 63/72 (88%), Gaps = 1/72 (1%)
 Frame = +1

Query  289  VVFTGGRTQPGTVKPDE-GERHPYSVIECQPEREFILPSVIYVQKILRRKPFLIKNLENV  465
            VVF GGRTQPGT+KP+E GERHPYSV++C  +RE ILPSV+Y+QK LRR+PFLIKNLENV
Sbjct  1    VVFIGGRTQPGTIKPEEEGERHPYSVLDCAAQREAILPSVLYIQKTLRRRPFLIKNLENV  60

Query  466  MRXLLQSLELFE  501
            MR  LQSLE FE
Sbjct  61   MRKFLQSLEFFE  72



>gb|KIY97135.1| Basic leucine zipper and W2 domain-containing protein 1 [Monoraphidium 
neglectum]
Length=168

 Score =   111 bits (278),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/147 (45%), Positives = 94/147 (64%), Gaps = 9/147 (6%)
 Frame = +1

Query  85   MSSKE-KPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAG-------DLELVAKSI  240
            MS+KE +PTL G  +KTRKRNI  P DP +FADA+VQI+ D A        +L+   K++
Sbjct  1    MSAKEERPTLAGVNVKTRKRNIVVPSDPGSFADAIVQIFADAADEGVSIDKNLDAGVKAL  60

Query  241  ESSELNFSRYGDTFFEVVFTGGR-TQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQ  417
            +S++L+FSRY DT FEV+F GGR    G +  D+ ER   +V+ C+P  + I P V   Q
Sbjct  61   DSADLDFSRYADTLFEVLFAGGRLATGGNLADDQKERLATNVLACEPNPDAIAPFVKVFQ  120

Query  418  KILRRKPFLIKNLENVMRXLLQSLELF  498
             ++RR+PFL+K LE  +   + SLE +
Sbjct  121  SLIRRRPFLVKGLEATLNKFILSLEFY  147



>ref|XP_010451657.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
1-like [Camelina sativa]
Length=273

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/69 (94%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFS  264
            MSSKEKPTLGGTRIKTRKRNIAAPLDPAAF+DAVVQIYLDNAGDLELVAKSIESS+LNF+
Sbjct  1    MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFSDAVVQIYLDNAGDLELVAKSIESSDLNFT  60

Query  265  RYGDTFFEV  291
            RYGD FFEV
Sbjct  61   RYGDIFFEV  69



>ref|XP_002949287.1| hypothetical protein VOLCADRAFT_74123 [Volvox carteri f. nagariensis]
 gb|EFJ49780.1| hypothetical protein VOLCADRAFT_74123 [Volvox carteri f. nagariensis]
Length=421

 Score =   109 bits (272),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 69/147 (47%), Positives = 90/147 (61%), Gaps = 8/147 (5%)
 Frame = +1

Query  85   MSSKE-KPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNA------GDLELVAKSIE  243
            MS+KE KPTL G  +KTRKRNI  P DP +FADAVV +  D A       DLE  AK+++
Sbjct  1    MSTKEEKPTLAGVNVKTRKRNIVIPEDPGSFADAVVTLCQDAADGVSLEADLEAAAKALD  60

Query  244  SSELNFSRYGDTFFEVVFTGGRTQPGT-VKPDEGERHPYSVIECQPEREFILPSVIYVQK  420
             +EL +SRYGD  F+V F GGR   G  +  ++  R    ++ C+P RE I P     Q 
Sbjct  61   GAELEYSRYGDILFQVFFAGGRLGTGAQLAAEDKMRLSTHILACEPTREAINPYFKLFQT  120

Query  421  ILRRKPFLIKNLENVMRXLLQSLELFE  501
            + RR+PFLI+ LEN +  LL SLE F+
Sbjct  121  LTRRRPFLIRGLENTLVKLLLSLEFFD  147



>ref|XP_005649553.1| flagellar associated protein [Coccomyxa subellipsoidea C-169]
 gb|EIE25009.1| flagellar associated protein [Coccomyxa subellipsoidea C-169]
Length=422

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 98/145 (68%), Gaps = 7/145 (5%)
 Frame = +1

Query  85   MSSKE-KPTLGGTRIKTRKRNIaapldpaafadaVVQIYLD--NAGDLE--LVA--KSIE  243
            MSSKE KPTL G +IKTRKRNIA  LDP +FADAVV I+ D  +  DLE  L A  K +E
Sbjct  1    MSSKEEKPTLAGVQIKTRKRNIAVALDPGSFADAVVTIFEDAKDGDDLEKNLSAGVKVVE  60

Query  244  SSELNFSRYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKI  423
             ++L+FSRYGDT FEV F GGR   G    +EG++   +V+  +  ++ I+P +   Q +
Sbjct  61   GTQLDFSRYGDTLFEVFFAGGRLAAGGNVVEEGKKLDTNVLAAEATKDAIVPYMKMFQIL  120

Query  424  LRRKPFLIKNLENVMRXLLQSLELF  498
            LR++PFLI+ LEN +  LL+SL+ +
Sbjct  121  LRKRPFLIRPLENTLIKLLKSLDFY  145



>gb|AFA36552.1| eIF4-gamma/eIF5/eIF2-epsilon domain-containing protein, partial 
[Lolium perenne]
Length=168

 Score =   100 bits (248),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 56/65 (86%), Gaps = 1/65 (2%)
 Frame = +1

Query  310  TQPGTVKPDE-GERHPYSVIECQPEREFILPSVIYVQKILRRKPFLIKNLENVMRXLLQS  486
            TQPGT+KP+E GERHPYS+I+C  +RE ILP V+++QK LRR+PFLIK+LENVMR  LQS
Sbjct  1    TQPGTIKPEEEGERHPYSLIDCAAQRESILPYVLFIQKTLRRRPFLIKSLENVMRKFLQS  60

Query  487  LELFE  501
            LE FE
Sbjct  61   LEFFE  65



>ref|XP_005851110.1| hypothetical protein CHLNCDRAFT_33763 [Chlorella variabilis]
 gb|EFN59008.1| hypothetical protein CHLNCDRAFT_33763 [Chlorella variabilis]
Length=417

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 91/153 (59%), Gaps = 17/153 (11%)
 Frame = +1

Query  85   MSSKE-KPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDN-------------AGDLE  222
            MS+KE KP L G RIKTRKRNI  P DP +FADA++ I  D               GD  
Sbjct  1    MSTKEEKPQLAGVRIKTRKRNIVVPHDPQSFADALIDIIEDAREEGTEHNNVSKILGD--  58

Query  223  LVAKSIESSELNFSRYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPS  402
               KS++ +EL+FSRYGD  FEV F G R   G     EG++  ++++    +RE ILP 
Sbjct  59   -ANKSLDIAELDFSRYGDVLFEVAFAGARLTTGGNVATEGKKLDFNILAGPADREAILPY  117

Query  403  VIYVQKILRRKPFLIKNLENVMRXLLQSLELFE  501
            + + Q ++RR+PFL+K LENV++  +  +E ++
Sbjct  118  IKWFQTMIRRRPFLVKALENVLQKFVMGMEFYD  150



>ref|XP_001691456.1| flagellar associated protein [Chlamydomonas reinhardtii]
 gb|EDP05189.1| flagellar associated protein [Chlamydomonas reinhardtii]
Length=425

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 89/150 (59%), Gaps = 11/150 (7%)
 Frame = +1

Query  85   MSSKE-KPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNA---------GDLELVAK  234
            MS+KE KPTL G  +KTRKRNI  P DP +FADA+V +  D A          DLE  AK
Sbjct  1    MSTKEEKPTLAGVNVKTRKRNIVIPEDPGSFADAIVTLCQDAASDDGSAGLEADLEAAAK  60

Query  235  SIESSELNFSRYGDTFFEVVFTGGRTQPGT-VKPDEGERHPYSVIECQPEREFILPSVIY  411
            +++ +EL +SRYGD  F+V F GGR   G  +  ++  R   +++  +  RE I P    
Sbjct  61   ALDGAELEYSRYGDVLFQVFFAGGRLGTGAQLAAEDKMRLATNILAAEATREAINPYFKL  120

Query  412  VQKILRRKPFLIKNLENVMRXLLQSLELFE  501
             Q + RR+PFLI+ LEN +  L+ SLE F+
Sbjct  121  FQTLTRRRPFLIRGLENTLVKLMLSLEFFD  150



>gb|KHN40477.1| Basic leucine zipper and W2 domain-containing protein 2 [Glycine 
soja]
Length=393

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +1

Query  88   SSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESSELNFSR  267
            SSKE+PTLGGTRIKTRKRNIAAPLDPAAF+DAVVQIYLDNAGDLEL+AKSIESS+LNFSR
Sbjct  58   SSKERPTLGGTRIKTRKRNIAAPLDPAAFSDAVVQIYLDNAGDLELIAKSIESSDLNFSR  117

Query  268  YGDTFFEVVF  297
            Y    F  +F
Sbjct  118  YVPWVFNELF  127



>gb|KDD75188.1| hypothetical protein H632_c819p1 [Helicosporidium sp. ATCC 50920]
Length=447

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 87/142 (61%), Gaps = 14/142 (10%)
 Frame = +1

Query  115  GTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESS-------------EL  255
            G R+KTRKRNI  P DP +FADAV+++ L +A + + V K+++++             EL
Sbjct  28   GVRLKTRKRNIVVPHDPQSFADAVIEV-LSDARESDDVDKTLDAANKVINEFWVLDGAEL  86

Query  256  NFSRYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRK  435
            +FSRYG+  FEV F G R   G     EG++  + ++   PE   I+P V + Q ++RR+
Sbjct  87   DFSRYGEVLFEVAFAGARLTTGANVSVEGKQLSWHILASPPEPSAIIPFVRWFQTMIRRR  146

Query  436  PFLIKNLENVMRXLLQSLELFE  501
            PFL+K+LEN +  LL S+E ++
Sbjct  147  PFLVKHLENTLVKLLLSMEFYD  168



>gb|ABK92853.1| unknown [Populus trichocarpa]
Length=61

 Score = 83.2 bits (204),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +2

Query  179  MQWSRSIWIMLVIWNSLLRALSHQNLTSLDTVTLFLRLYSQEVVLNLEQLNRMRGSATLT  358
            MQWSR  WIMLVIWN LLRAL+ Q LTS DTVT FLRL+SQE   NL Q N M+GSA LT
Sbjct  1    MQWSRYTWIMLVIWNLLLRALNPQTLTSQDTVTPFLRLFSQEAAHNLAQQNLMKGSAILT  60

Query  359  L  361
            L
Sbjct  61   L  61



>ref|XP_011400310.1| Basic leucine zipper and W2 domain-containing protein 1-A [Auxenochlorella 
protothecoides]
 gb|KFM27343.1| Basic leucine zipper and W2 domain-containing protein 1-A [Auxenochlorella 
protothecoides]
Length=188

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 83/148 (56%), Gaps = 19/148 (13%)
 Frame = +1

Query  115  GTRIKTRKRNIaapldpaafadaVVQIYLD--NAGDLELVAKS-----------------  237
            G R+KTRKRNI  P DP +FA+AV+ +  D   + D+E    +                 
Sbjct  24   GVRLKTRKRNIVVPHDPQSFAEAVIAVLGDAQESDDIERTLDAANKASWRCNWWHAQMHI  83

Query  238  IESSELNFSRYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQ  417
            ++S+EL+FSRYGD  FEV F G R   G     EG+   ++++    E   I+P + + Q
Sbjct  84   LDSAELDFSRYGDVLFEVAFAGARLTTGGNVSHEGKPLEFNILASPAETAAIVPYIKWFQ  143

Query  418  KILRRKPFLIKNLENVMRXLLQSLELFE  501
             ++RR+PFL+K+LEN +  L+ SLE ++
Sbjct  144  TMIRRRPFLVKSLENTLIKLILSLEFYD  171



>ref|XP_006984001.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X1 [Peromyscus maniculatus bairdii]
Length=459

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 52/149 (35%), Positives = 78/149 (52%), Gaps = 5/149 (3%)
 Frame = +1

Query  67   SFRSWFMSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES  246
            S  S FM+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S
Sbjct  35   SLDSNFMNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDS  94

Query  247  --SELNFSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIY  411
              S L++ RY DT F+++  G    PG  + D+G++     + V   + + E I      
Sbjct  95   TGSRLDYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSAKEDHETIRNYAQV  154

Query  412  VQKILRRKPFLIKNLENVMRXLLQSLELF  498
              K++RR  +L K  E+ M+ LL  L+ F
Sbjct  155  FNKLIRRYKYLEKAFEDEMKKLLLFLKAF  183



>dbj|BAC56581.1| similar to HSPC028 [Bos taurus]
Length=163

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRSYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>gb|EDL36853.1| basic leucine zipper and W2 domains 2 [Mus musculus]
Length=459

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 52/149 (35%), Positives = 77/149 (52%), Gaps = 5/149 (3%)
 Frame = +1

Query  67   SFRSWFMSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES  246
            S  S FM+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S
Sbjct  35   SLDSNFMNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDS  94

Query  247  --SELNFSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIY  411
              S L++ RY DT F+++  G    PG  + D+G++     + V     + E I      
Sbjct  95   TGSRLDYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQV  154

Query  412  VQKILRRKPFLIKNLENVMRXLLQSLELF  498
              K++RR  +L K  E+ M+ LL  L+ F
Sbjct  155  FNKLIRRYKYLEKAFEDEMKKLLLFLKAF  183



>ref|XP_005872379.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X2 [Myotis brandtii]
Length=353

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 75/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V   + + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSAKEDHETIRNHAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDAMKKLLLFLKAF  143



>ref|XP_003363351.2| PREDICTED: basic leucine zipper and W2 domain-containing protein 
1 isoform X2 [Equus caballus]
Length=370

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 53/153 (35%), Positives = 81/153 (53%), Gaps = 6/153 (4%)
 Frame = +1

Query  52   CLYFDSFRSWFMSSK--EKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLEL  225
            C YF   R  FM+++  +KPTL G R KTRKR+     DP  F D ++Q   +   DLE 
Sbjct  9    CFYFH--RVSFMNNQKQQKPTLSGQRFKTRKRDEKERFDPTQFQDCIIQGLTETGTDLEA  66

Query  226  VAKSIESS--ELNFSRYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILP  399
            VAK +++S  +L++ RY +T F+++  GG   PG    D+  R    V   Q + E +  
Sbjct  67   VAKFLDASGAKLDYRRYAETLFDILVAGGMLAPGGTLADDMMRTDVCVFAAQEDLETMQA  126

Query  400  SVIYVQKILRRKPFLIKNLENVMRXLLQSLELF  498
                  K++RR  +L K  E+ ++ LL  L+ F
Sbjct  127  FAQVFNKLIRRYKYLEKGFEDEVKKLLLFLKGF  159



>ref|XP_006984002.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X2 [Peromyscus maniculatus bairdii]
Length=425

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 76/144 (53%), Gaps = 5/144 (3%)
 Frame = +1

Query  82   FMSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SEL  255
            FM+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L
Sbjct  6    FMNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRL  65

Query  256  NFSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKIL  426
            ++ RY DT F+++  G    PG  + D+G++     + V   + + E I        K++
Sbjct  66   DYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSAKEDHETIRNYAQVFNKLI  125

Query  427  RRKPFLIKNLENVMRXLLQSLELF  498
            RR  +L K  E+ M+ LL  L+ F
Sbjct  126  RRYKYLEKAFEDEMKKLLLFLKAF  149



>gb|ELR55246.1| Basic leucine zipper and W2 domain-containing protein 2, partial 
[Bos mutus]
Length=421

 Score = 75.1 bits (183),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 75/144 (52%), Gaps = 5/144 (3%)
 Frame = +1

Query  82   FMSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SEL  255
            FM+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L
Sbjct  2    FMNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRL  61

Query  256  NFSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKIL  426
            ++ RY DT F+++  G    PG  + D+G++     + V     + E I        K++
Sbjct  62   DYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRSYAQVFNKLI  121

Query  427  RRKPFLIKNLENVMRXLLQSLELF  498
            RR  +L K  E+ M+ LL  L+ F
Sbjct  122  RRYKYLEKAFEDEMKKLLLFLKAF  145



>ref|XP_006779109.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Myotis davidii]
Length=410

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 75/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V   + + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSAKEDHETIRNHAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDAMKKLLLFLKAF  143



>ref|XP_005872378.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X1 [Myotis brandtii]
 ref|XP_006085107.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Myotis lucifugus]
 ref|XP_008146677.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Eptesicus fuscus]
 ref|XP_008146686.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Eptesicus fuscus]
Length=419

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 75/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V   + + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSAKEDHETIRNHAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDAMKKLLLFLKAF  143



>gb|EPQ11510.1| Basic leucine zipper and W2 domain-containing protein 2 [Myotis 
brandtii]
Length=424

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 75/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V   + + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSAKEDHETIRNHAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDAMKKLLLFLKAF  143



>ref|XP_002720899.2| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X1 [Oryctolagus cuniculus]
Length=438

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 75/144 (52%), Gaps = 5/144 (3%)
 Frame = +1

Query  82   FMSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SEL  255
            FM+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L
Sbjct  19   FMNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRL  78

Query  256  NFSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKIL  426
            ++ RY DT F+++  G    PG  + D+G++     + V     + E I        K++
Sbjct  79   DYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLI  138

Query  427  RRKPFLIKNLENVMRXLLQSLELF  498
            RR  +L K  E+ M+ LL  L+ F
Sbjct  139  RRYKYLEKAFEDEMKKLLLFLKAF  162



>ref|XP_005609298.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X2 [Equus caballus]
 ref|XP_008518396.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X1 [Equus przewalskii]
Length=449

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 75/144 (52%), Gaps = 5/144 (3%)
 Frame = +1

Query  82   FMSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SEL  255
            FM+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L
Sbjct  30   FMNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRL  89

Query  256  NFSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKIL  426
            ++ RY DT F+++  G    PG  + D+G++     + V     + E I        K++
Sbjct  90   DYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLI  149

Query  427  RRKPFLIKNLENVMRXLLQSLELF  498
            RR  +L K  E+ M+ LL  L+ F
Sbjct  150  RRYKYLEKAFEDEMKKLLLFLKAF  173



>dbj|BAB55401.1| unnamed protein product [Homo sapiens]
 gb|EAW93678.1| basic leucine zipper and W2 domains 2, isoform CRA_c [Homo sapiens]
Length=201

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>ref|XP_001503652.2| PREDICTED: basic leucine zipper and W2 domain-containing protein 
1 isoformX1 [Equus caballus]
Length=436

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/153 (35%), Positives = 81/153 (53%), Gaps = 6/153 (4%)
 Frame = +1

Query  52   CLYFDSFRSWFMSSK--EKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLEL  225
            C YF   R  FM+++  +KPTL G R KTRKR+     DP  F D ++Q   +   DLE 
Sbjct  9    CFYFH--RVSFMNNQKQQKPTLSGQRFKTRKRDEKERFDPTQFQDCIIQGLTETGTDLEA  66

Query  226  VAKSIESS--ELNFSRYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILP  399
            VAK +++S  +L++ RY +T F+++  GG   PG    D+  R    V   Q + E +  
Sbjct  67   VAKFLDASGAKLDYRRYAETLFDILVAGGMLAPGGTLADDMMRTDVCVFAAQEDLETMQA  126

Query  400  SVIYVQKILRRKPFLIKNLENVMRXLLQSLELF  498
                  K++RR  +L K  E+ ++ LL  L+ F
Sbjct  127  FAQVFNKLIRRYKYLEKGFEDEVKKLLLFLKGF  159



>ref|XP_006880325.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X1 [Elephantulus edwardii]
Length=424

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 75/144 (52%), Gaps = 5/144 (3%)
 Frame = +1

Query  82   FMSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SEL  255
            FM+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L
Sbjct  5    FMNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRL  64

Query  256  NFSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKIL  426
            ++ RY DT F+++  G    PG  + D+G++     + V     + E I        K++
Sbjct  65   DYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLI  124

Query  427  RRKPFLIKNLENVMRXLLQSLELF  498
            RR  +L K  E+ M+ LL  L+ F
Sbjct  125  RRYKYLEKAFEDEMKKLLLFLKAF  148



>gb|EPY75777.1| basic leucine zipper and W2 domain-containing protein 2 isoform 
4 [Camelus ferus]
Length=431

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 75/144 (52%), Gaps = 5/144 (3%)
 Frame = +1

Query  82   FMSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SEL  255
            FM+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L
Sbjct  10   FMNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRL  69

Query  256  NFSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKIL  426
            ++ RY DT F+++  G    PG  + D+G++     + V     + E I        K++
Sbjct  70   DYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLI  129

Query  427  RRKPFLIKNLENVMRXLLQSLELF  498
            RR  +L K  E+ M+ LL  L+ F
Sbjct  130  RRYKYLEKAFEDEMKKLLLFLKAF  153



>ref|XP_005377393.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X1 [Chinchilla lanigera]
Length=435

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 75/144 (52%), Gaps = 5/144 (3%)
 Frame = +1

Query  82   FMSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SEL  255
            FM+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L
Sbjct  16   FMNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRL  75

Query  256  NFSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKIL  426
            ++ RY DT F+++  G    PG  + D+G++     + V     + E I        K++
Sbjct  76   DYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLI  135

Query  427  RRKPFLIKNLENVMRXLLQSLELF  498
            RR  +L K  E+ M+ LL  L+ F
Sbjct  136  RRYKYLEKAFEDEMKKLLLFLKAF  159



>ref|XP_004702761.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Echinops telfairi]
Length=456

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 75/144 (52%), Gaps = 5/144 (3%)
 Frame = +1

Query  82   FMSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SEL  255
            FM+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L
Sbjct  37   FMNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRL  96

Query  256  NFSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKIL  426
            ++ RY DT F+++  G    PG  + D+G++     + V     + E I        K++
Sbjct  97   DYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLI  156

Query  427  RRKPFLIKNLENVMRXLLQSLELF  498
            RR  +L K  E+ M+ LL  L+ F
Sbjct  157  RRYKYLEKAFEDEMKKLLLFLKAF  180



>ref|XP_004582525.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Ochotona princeps]
Length=464

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 75/144 (52%), Gaps = 5/144 (3%)
 Frame = +1

Query  82   FMSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SEL  255
            FM+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L
Sbjct  45   FMNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRL  104

Query  256  NFSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKIL  426
            ++ RY DT F+++  G    PG  + D+G++     + V     + E I        K++
Sbjct  105  DYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLI  164

Query  427  RRKPFLIKNLENVMRXLLQSLELF  498
            RR  +L K  E+ M+ LL  L+ F
Sbjct  165  RRYKYLEKAFEDEMKKLLLFLKAF  188



>ref|XP_008518397.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X2 [Equus przewalskii]
Length=437

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 75/144 (52%), Gaps = 5/144 (3%)
 Frame = +1

Query  82   FMSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SEL  255
            FM+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L
Sbjct  18   FMNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRL  77

Query  256  NFSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKIL  426
            ++ RY DT F+++  G    PG  + D+G++     + V     + E I        K++
Sbjct  78   DYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLI  137

Query  427  RRKPFLIKNLENVMRXLLQSLELF  498
            RR  +L K  E+ M+ LL  L+ F
Sbjct  138  RRYKYLEKAFEDEMKKLLLFLKAF  161



>gb|AAS07544.1| unknown [Homo sapiens]
Length=274

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>gb|ELK12556.1| Basic leucine zipper and W2 domain-containing protein 2 [Pteropus 
alecto]
Length=497

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 75/144 (52%), Gaps = 5/144 (3%)
 Frame = +1

Query  82   FMSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SEL  255
            FM+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L
Sbjct  12   FMNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRL  71

Query  256  NFSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKIL  426
            ++ RY DT F+++  G    PG  + D+G++     + V     + E I        K++
Sbjct  72   DYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLI  131

Query  427  RRKPFLIKNLENVMRXLLQSLELF  498
            RR  +L K  E+ M+ LL  L+ F
Sbjct  132  RRYKYLEKAFEDEMKKLLLFLKAF  155



>ref|XP_004431470.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform 1 [Ceratotherium simum simum]
Length=471

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 75/144 (52%), Gaps = 5/144 (3%)
 Frame = +1

Query  82   FMSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SEL  255
            FM+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L
Sbjct  52   FMNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRL  111

Query  256  NFSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKIL  426
            ++ RY DT F+++  G    PG  + D+G++     + V     + E I        K++
Sbjct  112  DYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLI  171

Query  427  RRKPFLIKNLENVMRXLLQSLELF  498
            RR  +L K  E+ M+ LL  L+ F
Sbjct  172  RRYKYLEKAFEDEMKKLLLFLKAF  195



>ref|XP_005550109.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X1 [Macaca fascicularis]
Length=519

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 50/144 (35%), Positives = 75/144 (52%), Gaps = 5/144 (3%)
 Frame = +1

Query  82   FMSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SEL  255
            FM+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L
Sbjct  100  FMNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRL  159

Query  256  NFSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKIL  426
            ++ RY DT F+++  G    PG  + D+G++     + V     + E I        K++
Sbjct  160  DYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLI  219

Query  427  RRKPFLIKNLENVMRXLLQSLELF  498
            RR  +L K  E+ M+ LL  L+ F
Sbjct  220  RRYKYLEKAFEDEMKKLLLFLKAF  243



>dbj|BAE37006.1| unnamed protein product [Mus musculus]
Length=305

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>ref|XP_007980165.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X1 [Chlorocebus sabaeus]
Length=519

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 50/144 (35%), Positives = 75/144 (52%), Gaps = 5/144 (3%)
 Frame = +1

Query  82   FMSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SEL  255
            FM+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L
Sbjct  100  FMNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRL  159

Query  256  NFSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKIL  426
            ++ RY DT F+++  G    PG  + D+G++     + V     + E I        K++
Sbjct  160  DYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLI  219

Query  427  RRKPFLIKNLENVMRXLLQSLELF  498
            RR  +L K  E+ M+ LL  L+ F
Sbjct  220  RRYKYLEKAFEDEMKKLLLFLKAF  243



>ref|XP_003252649.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform 1 [Nomascus leucogenys]
Length=524

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 50/144 (35%), Positives = 75/144 (52%), Gaps = 5/144 (3%)
 Frame = +1

Query  82   FMSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SEL  255
            FM+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L
Sbjct  105  FMNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRL  164

Query  256  NFSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKIL  426
            ++ RY DT F+++  G    PG  + D+G++     + V     + E I        K++
Sbjct  165  DYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLI  224

Query  427  RRKPFLIKNLENVMRXLLQSLELF  498
            RR  +L K  E+ M+ LL  L+ F
Sbjct  225  RRYKYLEKAFEDEMKKLLLFLKAF  248



>gb|KFO25107.1| Basic leucine zipper and W2 domain-containing protein 2 [Fukomys 
damarensis]
Length=653

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 50/144 (35%), Positives = 75/144 (52%), Gaps = 5/144 (3%)
 Frame = +1

Query  82   FMSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SEL  255
            FM+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L
Sbjct  234  FMNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRL  293

Query  256  NFSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKIL  426
            ++ RY DT F+++  G    PG  + D+G++     + V     + E I        K++
Sbjct  294  DYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLI  353

Query  427  RRKPFLIKNLENVMRXLLQSLELF  498
            RR  +L K  E+ M+ LL  L+ F
Sbjct  354  RRYKYLEKAFEDEMKKLLLFLKAF  377



>ref|XP_004467998.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform 1 [Dasypus novemcinctus]
Length=538

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 50/144 (35%), Positives = 75/144 (52%), Gaps = 5/144 (3%)
 Frame = +1

Query  82   FMSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SEL  255
            FM+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L
Sbjct  88   FMNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRL  147

Query  256  NFSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKIL  426
            ++ RY DT F+++  G    PG  + D+G++     + V     + E I        K++
Sbjct  148  DYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLI  207

Query  427  RRKPFLIKNLENVMRXLLQSLELF  498
            RR  +L K  E+ M+ LL  L+ F
Sbjct  208  RRYKYLEKAFEDEMKKLLLFLKAF  231



>ref|XP_007670463.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Ornithorhynchus anatinus]
Length=154

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 71/134 (53%), Gaps = 5/134 (4%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D++VQ   D  GDLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDSLVQGLNDAGGDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGER---HPYSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+V+  G    PG  + D+G++     + V     + + I        K++R
Sbjct  61   YRRYADTLFDVLVAGSMLAPGGTRIDDGDKTKMTKHCVFSADEDHDAIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMR  471
            R  +L K  E+ ++
Sbjct  121  RYKYLEKAFEDEIK  134



>ref|XP_004322946.1| PREDICTED: LOW QUALITY PROTEIN: basic leucine zipper and W2 domain-containing 
protein 2-like [Tursiops truncatus]
Length=510

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 75/144 (52%), Gaps = 5/144 (3%)
 Frame = +1

Query  82   FMSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SEL  255
            FM+  +KP L G R KTRKR+     +P  F D ++Q   +   DLE VAK ++S  S L
Sbjct  90   FMNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLIQGLNEAGDDLEAVAKFLDSTGSRL  149

Query  256  NFSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKIL  426
            ++ RY DT F+++  G    PG  + D+G++     + V     + E I        K++
Sbjct  150  DYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLI  209

Query  427  RRKPFLIKNLENVMRXLLQSLELF  498
            RR  +L K  E+ M+ LL  L+ F
Sbjct  210  RRYKYLEKAFEDEMKKLLLFLKAF  233



>ref|XP_004467999.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform 2 [Dasypus novemcinctus]
Length=507

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 50/144 (35%), Positives = 75/144 (52%), Gaps = 5/144 (3%)
 Frame = +1

Query  82   FMSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SEL  255
            FM+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L
Sbjct  88   FMNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRL  147

Query  256  NFSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKIL  426
            ++ RY DT F+++  G    PG  + D+G++     + V     + E I        K++
Sbjct  148  DYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLI  207

Query  427  RRKPFLIKNLENVMRXLLQSLELF  498
            RR  +L K  E+ M+ LL  L+ F
Sbjct  208  RRYKYLEKAFEDEMKKLLLFLKAF  231



>gb|KFQ25026.1| Basic leucine zipper and W2 domain-containing protein 1, partial 
[Mesitornis unicolor]
Length=280

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 78/146 (53%), Gaps = 4/146 (3%)
 Frame = +1

Query  73   RSWFMSSK--EKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES  246
            R  FM+++  +KPTL G R KTRKR+     DP  F D ++Q   +   DLE VAK +++
Sbjct  1    RVSFMNNQKPQKPTLSGQRFKTRKRDEKERFDPTQFQDCIIQGLTETGTDLEAVAKFLDA  60

Query  247  S--ELNFSRYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQK  420
            S  +L++ RY +T F+++  GG   PG    D+  R    V   Q + E +        K
Sbjct  61   SGAKLDYRRYAETLFDILVAGGMLAPGGTLADDMTRTNVCVFAAQEDLETMQAFAQVFNK  120

Query  421  ILRRKPFLIKNLENVMRXLLQSLELF  498
            ++RR  +L K  E+ ++ LL  L+ F
Sbjct  121  LIRRYKYLEKGFEDEVKKLLLFLKGF  146



>ref|XP_005897433.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X1 [Bos mutus]
 ref|XP_005897434.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X2 [Bos mutus]
Length=419

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRSYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>gb|KFM74754.1| Basic leucine zipper and W2 domain-containing protein 1, partial 
[Stegodyphus mimosarum]
Length=227

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 52/146 (36%), Positives = 81/146 (55%), Gaps = 8/146 (5%)
 Frame = +1

Query  85   MSSK-EKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SEL  255
            MS K EKPTL G RIKTRKR+     DP  F DA++Q   ++  DLELV+K +++  S+L
Sbjct  1    MSQKTEKPTLSGQRIKTRKRDEKEKYDPTGFRDAIIQGLNESGSDLELVSKFLDTAGSKL  60

Query  256  NFSRYGDTFFEVVFTGGRTQPG-----TVKPDEGERHPYSVIECQPEREFILPSVIYVQK  420
            ++ RYG+T F+++  GG   PG      V P +  R    +     + + +      + K
Sbjct  61   DYRRYGETLFDILLAGGILAPGGTLALDVDPQKTSRTDVCIFSAANDLDTLKNFAQVITK  120

Query  421  ILRRKPFLIKNLENVMRXLLQSLELF  498
            ++RR  +L K LE+  + +L  L+ F
Sbjct  121  VIRRYKYLEKTLEDEFKKVLVFLKGF  146



>ref|XP_006057098.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X1 [Bubalus bubalis]
 ref|XP_006057099.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X2 [Bubalus bubalis]
 ref|XP_010860470.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Bison bison bison]
 ref|XP_010860471.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Bison bison bison]
Length=419

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRSYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>ref|XP_006984003.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X3 [Peromyscus maniculatus bairdii]
Length=419

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 75/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V   + + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSAKEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>ref|NP_001098431.1| basic leucine zipper and W2 domain-containing protein 2 [Bos 
taurus]
 ref|XP_005205230.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X1 [Bos taurus]
 gb|AAI46208.1| BZW2 protein [Bos taurus]
 tpg|DAA30741.1| TPA: basic leucine zipper and W2 domains 2 [Bos taurus]
Length=419

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRSYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>ref|XP_004677180.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Condylura cristata]
Length=362

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>ref|XP_009000566.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X2 [Callithrix jacchus]
Length=378

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>ref|XP_006515229.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X1 [Mus musculus]
Length=387

 Score = 72.4 bits (176),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>dbj|BAE21252.1| unnamed protein product [Mus musculus]
Length=374

 Score = 72.0 bits (175),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>ref|NP_054757.1| basic leucine zipper and W2 domain-containing protein 2 [Homo 
sapiens]
 ref|NP_001153239.1| basic leucine zipper and W2 domain-containing protein 2 [Homo 
sapiens]
 ref|NP_001181788.1| basic leucine zipper and W2 domain-containing protein 2 [Macaca 
mulatta]
 ref|XP_002751583.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X1 [Callithrix jacchus]
 ref|XP_001104484.2| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2-like isoform 1 [Macaca mulatta]
 ref|XP_003252650.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform 2 [Nomascus leucogenys]
 ref|XP_003318377.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Pan troglodytes]
 ref|XP_003639532.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X1 [Canis lupus familiaris]
 ref|XP_003825064.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Pan paniscus]
 ref|XP_003896293.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Papio anubis]
 ref|XP_003896294.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Papio anubis]
 ref|XP_003982869.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Felis catus]
 ref|XP_004431471.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform 2 [Ceratotherium simum simum]
 ref|XP_004743454.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X3 [Mustela putorius furo]
 ref|XP_004789314.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X3 [Mustela putorius furo]
 ref|XP_005377394.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X2 [Chinchilla lanigera]
 ref|XP_005550110.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X2 [Macaca fascicularis]
 ref|XP_005550111.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X3 [Macaca fascicularis]
 ref|XP_005550112.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X4 [Macaca fascicularis]
 ref|XP_005550113.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X5 [Macaca fascicularis]
 ref|XP_005628641.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X2 [Canis lupus familiaris]
 ref|XP_006165850.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X2 [Tupaia chinensis]
 ref|XP_006715769.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X1 [Homo sapiens]
 ref|XP_006715770.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X2 [Homo sapiens]
 ref|XP_006715771.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X3 [Homo sapiens]
 ref|XP_006736190.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X1 [Leptonychotes weddellii]
 ref|XP_006736191.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X2 [Leptonychotes weddellii]
 ref|XP_006929293.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Felis catus]
 ref|XP_007980169.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X4 [Chlorocebus sabaeus]
 ref|XP_008583897.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Galeopterus variegatus]
 ref|XP_009000565.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X1 [Callithrix jacchus]
 ref|XP_003825063.2| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Pan paniscus]
 ref|XP_008976952.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Pan paniscus]
 ref|XP_009201563.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Papio anubis]
 ref|XP_009201564.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Papio anubis]
 ref|XP_009201565.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Papio anubis]
 ref|XP_009201566.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Papio anubis]
 ref|XP_002818228.2| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X2 [Pongo abelii]
 ref|XP_009450976.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Pan troglodytes]
 ref|XP_009450977.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Pan troglodytes]
 ref|XP_518982.4| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Pan troglodytes]
 ref|XP_010355967.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Rhinopithecus roxellana]
 ref|XP_010355968.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Rhinopithecus roxellana]
 ref|XP_010355969.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Rhinopithecus roxellana]
 ref|XP_010355970.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Rhinopithecus roxellana]
 ref|XP_010355971.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Rhinopithecus roxellana]
 sp|Q9Y6E2.1|BZW2_HUMAN RecName: Full=Basic leucine zipper and W2 domain-containing protein 
2 [Homo sapiens]
 gb|AAD39844.1| HSPC028 [Homo sapiens]
 dbj|BAA91562.1| unnamed protein product [Homo sapiens]
 gb|AAH03056.1| Basic leucine zipper and W2 domains 2 [Homo sapiens]
 gb|AAH08453.1| Basic leucine zipper and W2 domains 2 [Homo sapiens]
 gb|AAH09597.1| Basic leucine zipper and W2 domains 2 [Homo sapiens]
 gb|EAL24285.1| basic leucine zipper and W2 domains 2 [Homo sapiens]
 gb|EAW93675.1| basic leucine zipper and W2 domains 2, isoform CRA_a [Homo sapiens]
 gb|EAW93676.1| basic leucine zipper and W2 domains 2, isoform CRA_a [Homo sapiens]
 gb|EAW93679.1| basic leucine zipper and W2 domains 2, isoform CRA_a [Homo sapiens]
 gb|ABM83422.1| basic leucine zipper and W2 domains 2 [synthetic construct]
 gb|ABM86634.1| basic leucine zipper and W2 domains 2 [synthetic construct]
 gb|EHH17470.1| Basic leucine zipper and W2 domain-containing protein 2 [Macaca 
mulatta]
 gb|EHH52296.1| Basic leucine zipper and W2 domain-containing protein 2 [Macaca 
fascicularis]
 gb|AIC51238.1| BZW2, partial [synthetic construct]
 gb|AIC63379.1| BZW2, partial [synthetic construct]
Length=419

 Score = 72.4 bits (176),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>ref|XP_005343908.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Microtus ochrogaster]
Length=419

 Score = 72.4 bits (176),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>ref|XP_004652900.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Jaculus jaculus]
Length=419

 Score = 72.4 bits (176),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>sp|Q4R6R4.1|BZW2_MACFA RecName: Full=Basic leucine zipper and W2 domain-containing protein 
2 [Macaca fascicularis]
 dbj|BAE01210.1| unnamed protein product [Macaca fascicularis]
Length=419

 Score = 72.4 bits (176),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>ref|XP_011361151.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Pteropus vampyrus]
Length=419

 Score = 72.4 bits (176),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>ref|XP_004602288.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X1 [Sorex araneus]
 ref|XP_004602289.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X2 [Sorex araneus]
Length=419

 Score = 72.4 bits (176),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>ref|XP_007469093.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2, partial [Lipotes vexillifer]
Length=350

 Score = 72.0 bits (175),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 48/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D ++Q   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLIQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>ref|XP_007089144.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X1 [Panthera tigris altaica]
 ref|XP_007089145.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X2 [Panthera tigris altaica]
Length=425

 Score = 72.4 bits (176),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>ref|XP_008054054.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Tarsius syrichta]
Length=419

 Score = 72.4 bits (176),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>ref|XP_006832306.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Chrysochloris asiatica]
Length=419

 Score = 72.4 bits (176),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>ref|XP_005971758.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Pantholops hodgsonii]
Length=419

 Score = 72.4 bits (176),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>ref|XP_008684584.1| PREDICTED: LOW QUALITY PROTEIN: basic leucine zipper and W2 domain-containing 
protein 2 [Ursus maritimus]
Length=419

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>ref|XP_004626492.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Octodon degus]
Length=419

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>ref|XP_010641639.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Fukomys damarensis]
Length=419

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>ref|NP_599229.1| basic leucine zipper and W2 domain-containing protein 2 [Rattus 
norvegicus]
 sp|Q9WTT7.1|BZW2_RAT RecName: Full=Basic leucine zipper and W2 domain-containing protein 
2; AltName: Full=Brain development-related molecule 2 
[Rattus norvegicus]
 gb|AAD20436.1| unknown [Rattus norvegicus]
 gb|AAH63149.1| Basic leucine zipper and W2 domains 2 [Rattus norvegicus]
 gb|EDM03313.1| basic leucine zipper and W2 domains 2, isoform CRA_a [Rattus 
norvegicus]
Length=419

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>ref|XP_002917447.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Ailuropoda melanoleuca]
Length=419

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>ref|XP_007164967.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Balaenoptera acutorostrata scammoni]
Length=420

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>ref|XP_004007819.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Ovis aries]
Length=419

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>gb|AAG39278.1|AF110323_1 MSTP017 [Homo sapiens]
Length=419

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>ref|XP_007944355.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Orycteropus afer afer]
 ref|XP_007944363.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Orycteropus afer afer]
Length=419

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>ref|NP_080116.2| basic leucine zipper and W2 domain-containing protein 2 [Mus 
musculus]
 sp|Q91VK1.1|BZW2_MOUSE RecName: Full=Basic leucine zipper and W2 domain-containing protein 
2 [Mus musculus]
 sp|Q2L4X1.1|BZW2_MUSMM RecName: Full=Basic leucine zipper and W2 domain-containing protein 
2; AltName: Full=Brain development-related molecule 2 
[Mus musculus molossinus]
 gb|AAH13060.1| Basic leucine zipper and W2 domains 2 [Mus musculus]
 dbj|BAE35861.1| unnamed protein product [Mus musculus]
 dbj|BAE79268.1| Bdm2 [Mus musculus molossinus]
Length=419

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>ref|NP_001231936.1| basic leucine zipper and W2 domains 2 [Sus scrofa]
Length=419

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>ref|XP_006880326.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X2 [Elephantulus edwardii]
Length=419

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>ref|XP_005328834.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Ictidomys tridecemlineatus]
Length=419

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>ref|XP_003782773.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform 1 [Otolemur garnettii]
 ref|XP_003782774.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform 2 [Otolemur garnettii]
Length=419

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKKTNHCVFSANEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>ref|XP_008835828.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Nannospalax galili]
Length=419

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSASEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>ref|XP_008272300.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X2 [Oryctolagus cuniculus]
Length=419

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>ref|XP_010965456.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Camelus bactrianus]
Length=419

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>ref|XP_005679051.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X1 [Capra hircus]
 ref|XP_005679052.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X2 [Capra hircus]
Length=419

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>ref|XP_004839653.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X1 [Heterocephalus glaber]
 ref|XP_004839654.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X2 [Heterocephalus glaber]
Length=419

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>gb|AAI07758.1| BZW2 protein, partial [Homo sapiens]
Length=416

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>ref|XP_004882667.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Heterocephalus glaber]
Length=419

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>dbj|BAG50880.1| unnamed protein product [Homo sapiens]
Length=419

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>ref|XP_001495986.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X1 [Equus caballus]
 ref|XP_005609299.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X3 [Equus caballus]
 ref|XP_005609300.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X4 [Equus caballus]
 ref|XP_005609301.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X5 [Equus caballus]
 ref|XP_008518398.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X3 [Equus przewalskii]
 ref|XP_008518399.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X3 [Equus przewalskii]
Length=419

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>ref|XP_006927164.1| PREDICTED: LOW QUALITY PROTEIN: basic leucine zipper and W2 domains 
2 [Pteropus alecto]
Length=419

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>ref|XP_006191697.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Camelus ferus]
 ref|XP_006211791.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X1 [Vicugna pacos]
 ref|XP_006211792.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X2 [Vicugna pacos]
Length=419

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>ref|XP_007532027.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Erinaceus europaeus]
 ref|XP_007532028.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Erinaceus europaeus]
Length=419

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSASEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>ref|XP_004743452.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X1 [Mustela putorius furo]
 ref|XP_004743453.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X2 [Mustela putorius furo]
 ref|XP_004789312.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X1 [Mustela putorius furo]
 ref|XP_004789313.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X2 [Mustela putorius furo]
Length=428

 Score = 72.4 bits (176),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>ref|XP_010982979.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Camelus dromedarius]
Length=438

 Score = 72.4 bits (176),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>ref|XP_004400259.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform 1 [Odobenus rosmarus divergens]
Length=419

 Score = 72.4 bits (176),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSASEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>dbj|BAE91760.1| unnamed protein product [Macaca fascicularis]
Length=275

 Score = 70.5 bits (171),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 73/137 (53%), Gaps = 2/137 (1%)
 Frame = +1

Query  94   KEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESS--ELNFSR  267
            ++KPTL G R KTRKR+     DP  F D ++Q   +   DLE VAK +++S  +L++ R
Sbjct  6    QQKPTLSGQRFKTRKRDEKERFDPTQFQDCIIQGLTETGTDLEAVAKFLDASGAKLDYRR  65

Query  268  YGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFLI  447
            Y +T F+++  GG   PG    D+  R    V   Q + E +        K++RR  +L 
Sbjct  66   YAETLFDILVAGGMLAPGGTLADDMMRTDVCVFAAQEDLETMQAFAQVFNKLIRRYKYLE  125

Query  448  KNLENVMRXLLQSLELF  498
            K  E+ ++ LL  L+ F
Sbjct  126  KGFEDEVKKLLLFLKGF  142



>gb|AAI02136.1| BZW1 protein [Bos taurus]
Length=284

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 73/137 (53%), Gaps = 2/137 (1%)
 Frame = +1

Query  94   KEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESS--ELNFSR  267
            ++KPTL G R KTRKR+     DP  F D ++Q   +   DLE VAK +++S  +L++ R
Sbjct  6    QQKPTLSGQRFKTRKRDEKERFDPTQFQDCIIQGLTETGTDLEAVAKFLDASGAKLDYRR  65

Query  268  YGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFLI  447
            Y +T F+++  GG   PG    D+  R    V   Q + E +        K++RR  +L 
Sbjct  66   YAETLFDILVAGGMLAPGGTLADDMMRTDVCVFAAQEDLETMQAFAQVFNKLIRRYKYLE  125

Query  448  KNLENVMRXLLQSLELF  498
            K  E+ ++ LL  L+ F
Sbjct  126  KGFEDEVKKLLLFLKGF  142



>dbj|BAE21963.1| unnamed protein product [Mus musculus]
Length=282

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 73/137 (53%), Gaps = 2/137 (1%)
 Frame = +1

Query  94   KEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESS--ELNFSR  267
            ++KPTL G R KTRKR+     DP  F D ++Q   +   DLE VAK +++S  +L++ R
Sbjct  6    QQKPTLSGQRFKTRKRDEKERFDPTQFQDCIIQGLTETGTDLEAVAKFLDASGAKLDYRR  65

Query  268  YGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFLI  447
            Y +T F+++  GG   PG    D+  R    V   Q + E +        K++RR  +L 
Sbjct  66   YAETLFDILVAGGMLAPGGTLADDMMRTDVCVFAAQEDLETMQAFAQVFNKLIRRYKYLE  125

Query  448  KNLENVMRXLLQSLELF  498
            K  E+ ++ LL  L+ F
Sbjct  126  KGFEDEVKKLLLFLKGF  142



>ref|XP_004468000.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform 3 [Dasypus novemcinctus]
Length=450

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>ref|XP_005076276.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Mesocricetus auratus]
Length=419

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE +AK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAIAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>ref|XP_003507914.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Cricetulus griseus]
 ref|XP_007616536.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Cricetulus griseus]
Length=419

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE +AK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAIAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>ref|XP_003407143.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Loxodonta africana]
 ref|XP_004377478.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform 1 [Trichechus manatus latirostris]
 ref|XP_004377479.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform 2 [Trichechus manatus latirostris]
Length=419

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D ++Q   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLIQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>ref|XP_007121680.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X1 [Physeter catodon]
 ref|XP_007121681.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform X2 [Physeter catodon]
Length=419

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D ++Q   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLIQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>ref|XP_010188469.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
1, partial [Mesitornis unicolor]
Length=286

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 72/136 (53%), Gaps = 2/136 (1%)
 Frame = +1

Query  97   EKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESS--ELNFSRY  270
            +KPTL G R KTRKR+     DP  F D ++Q   +   DLE VAK +++S  +L++ RY
Sbjct  7    QKPTLSGQRFKTRKRDEKERFDPTQFQDCIIQGLTETGTDLEAVAKFLDASGAKLDYRRY  66

Query  271  GDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFLIK  450
             +T F+++  GG   PG    D+  R    V   Q + E +        K++RR  +L K
Sbjct  67   AETLFDILVAGGMLAPGGTLADDMTRTNVCVFAAQEDLETMQAFAQVFNKLIRRYKYLEK  126

Query  451  NLENVMRXLLQSLELF  498
              E+ ++ LL  L+ F
Sbjct  127  GFEDEVKKLLLFLKGF  142



>ref|XP_004263520.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform 1 [Orcinus orca]
 ref|XP_004263521.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform 2 [Orcinus orca]
Length=419

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/143 (34%), Positives = 74/143 (52%), Gaps = 5/143 (3%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D ++Q   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLIQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ M+ LL  L+ F
Sbjct  121  RYKYLEKAFEDEMKKLLLFLKAF  143



>ref|XP_003252651.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 isoform 3 [Nomascus leucogenys]
 ref|XP_004045178.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
2 [Gorilla gorilla gorilla]
Length=161

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 71/138 (51%), Gaps = 5/138 (4%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE VAK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQ  483
            R  +L K  E+ M+  L+
Sbjct  121  RYKYLEKAFEDEMKKALR  138



>sp|Q803N9.2|BZW1B_DANRE RecName: Full=Basic leucine zipper and W2 domain-containing protein 
1-B [Danio rerio]
 gb|AAH91971.1| Bzw1b protein [Danio rerio]
Length=418

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 74/137 (54%), Gaps = 2/137 (1%)
 Frame = +1

Query  94   KEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESS--ELNFSR  267
            ++KPTL G R KTRKR+     DP+ F +++VQ       DLE VAK ++SS  +L++ R
Sbjct  6    QQKPTLTGQRFKTRKRDEKERFDPSQFQESIVQGLNQTGTDLEAVAKFLDSSGAKLDYRR  65

Query  268  YGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFLI  447
            Y +T F+++  GG   PG    D+  R  Y V   Q + + +        K++RR  +L 
Sbjct  66   YAETLFDILVAGGMLAPGGALSDDMTRTKYCVFTAQEDIKTMKAYAQVFNKLIRRYKYLE  125

Query  448  KNLENVMRXLLQSLELF  498
            K  E  ++ LL  L+ F
Sbjct  126  KGFEEEIKKLLLFLKGF  142



>gb|AAH44401.1| Bzw1b protein [Danio rerio]
Length=418

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 74/137 (54%), Gaps = 2/137 (1%)
 Frame = +1

Query  94   KEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESS--ELNFSR  267
            ++KPTL G R KTRKR+     DP+ F +++VQ       DLE VAK ++SS  +L++ R
Sbjct  6    QQKPTLTGQRFKTRKRDEKERFDPSQFQESIVQGLNQTGTDLEAVAKFLDSSGAKLDYRR  65

Query  268  YGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFLI  447
            Y +T F+++  GG   PG    D+  R  Y V   Q + + +        K++RR  +L 
Sbjct  66   YAETLFDILVAGGMLAPGGALSDDMTRTKYCVFTAQEDIKTMKAYAQVFNKLIRRYKYLE  125

Query  448  KNLENVMRXLLQSLELF  498
            K  E  ++ LL  L+ F
Sbjct  126  KGFEEEIKKLLLFLKGF  142



>ref|NP_998257.1| basic leucine zipper and W2 domain-containing protein 1-B [Danio 
rerio]
 ref|XP_005167447.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
1-B isoform X1 [Danio rerio]
 gb|AAH66527.1| Basic leucine zipper and W2 domains 1b [Danio rerio]
Length=418

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 74/137 (54%), Gaps = 2/137 (1%)
 Frame = +1

Query  94   KEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESS--ELNFSR  267
            ++KPTL G R KTRKR+     DP+ F +++VQ       DLE VAK ++SS  +L++ R
Sbjct  6    QQKPTLTGQRFKTRKRDEKERFDPSQFQESIVQGLNQTGTDLEAVAKFLDSSGAKLDYRR  65

Query  268  YGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFLI  447
            Y +T F+++  GG   PG    D+  R  Y V   Q + + +        K++RR  +L 
Sbjct  66   YAETLFDILVAGGMLAPGGALSDDMTRTKYCVFTAQEDIKTMKAYAQVFNKLIRRYKYLE  125

Query  448  KNLENVMRXLLQSLELF  498
            K  E  ++ LL  L+ F
Sbjct  126  KGFEEEIKKLLLFLKGF  142



>ref|XP_006902019.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
1-like isoform X1 [Elephantulus edwardii]
Length=353

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 73/137 (53%), Gaps = 2/137 (1%)
 Frame = +1

Query  94   KEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESS--ELNFSR  267
            ++KPTL G R KTRKR+     DP  F D ++Q   +   DLE VAK +++S  +L++ R
Sbjct  6    QQKPTLSGQRFKTRKRDEKERFDPTQFQDCIIQGLTETGTDLEAVAKFLDASGAKLDYRR  65

Query  268  YGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFLI  447
            Y +T F+++  GG   PG    D+  R    V   Q + E +        K++RR  +L 
Sbjct  66   YAETLFDILVAGGMLAPGGTLADDMMRTDVCVFAAQEDLETMQAFAQVFNKLIRRYKYLE  125

Query  448  KNLENVMRXLLQSLELF  498
            K  E+ ++ LL  L+ F
Sbjct  126  KGFEDEVKKLLLFLKGF  142



>ref|XP_005373296.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
1 isoform X2 [Chinchilla lanigera]
Length=353

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 73/137 (53%), Gaps = 2/137 (1%)
 Frame = +1

Query  94   KEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESS--ELNFSR  267
            ++KPTL G R KTRKR+     DP  F D ++Q   +   DLE VAK +++S  +L++ R
Sbjct  6    QQKPTLSGQRFKTRKRDEKERFDPTQFQDCIIQGLTETGTDLEAVAKFLDASGAKLDYRR  65

Query  268  YGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFLI  447
            Y +T F+++  GG   PG    D+  R    V   Q + E +        K++RR  +L 
Sbjct  66   YAETLFDILVAGGMLAPGGTLADDMMRTDVCVFAAQEDLETMQAFAQVFNKLIRRYKYLE  125

Query  448  KNLENVMRXLLQSLELF  498
            K  E+ ++ LL  L+ F
Sbjct  126  KGFEDEVKKLLLFLKGF  142



>gb|KFP19841.1| Basic leucine zipper and W2 domain-containing protein 1, partial 
[Egretta garzetta]
Length=382

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 78/146 (53%), Gaps = 4/146 (3%)
 Frame = +1

Query  73   RSWFMSSK--EKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES  246
            R  FM+++  +KPTL G R KTRKR+     DP  F D ++Q   +   DLE VAK +++
Sbjct  1    RVSFMNNQKPQKPTLSGQRFKTRKRDEKERFDPTQFQDCIIQGLTETGTDLEAVAKFLDA  60

Query  247  S--ELNFSRYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQK  420
            S  +L++ RY +T F+++  GG   PG    D+  R    V   Q + E +        K
Sbjct  61   SGAKLDYRRYAETLFDILVAGGMLAPGGTLADDMTRTNVCVFAAQEDLETMQAFAQVFNK  120

Query  421  ILRRKPFLIKNLENVMRXLLQSLELF  498
            ++RR  +L K  E+ ++ LL  L+ F
Sbjct  121  LIRRYKYLEKGFEDEVKKLLLFLKGF  146



>ref|XP_005961652.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
1-like isoform X2 [Pantholops hodgsonii]
Length=353

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 72/137 (53%), Gaps = 2/137 (1%)
 Frame = +1

Query  94   KEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESS--ELNFSR  267
            ++KPTL G R KTRKR+      P  F D ++Q   +   DLE VAK +++S  +L++ R
Sbjct  6    QQKPTLSGQRFKTRKRDEKERFGPTQFQDCIIQGLTETGTDLEAVAKFLDASGAKLDYRR  65

Query  268  YGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFLI  447
            Y +T F+++  GG   PG    D+  R    V   Q + E +        K++RR  +L 
Sbjct  66   YAETLFDILVAGGMLAPGGTLADDMMRADVCVFAAQEDLETMQAFAQVFNKLIRRYKYLE  125

Query  448  KNLENVMRXLLQSLELF  498
            K  E+ ++ LL  L+ F
Sbjct  126  KGFEDEVKKLLLFLKGF  142



>ref|NP_055485.2| basic leucine zipper and W2 domain-containing protein 1 isoform 
4 [Homo sapiens]
 ref|XP_003253959.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
1 isoform 2 [Nomascus leucogenys]
 ref|XP_004378266.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
1 isoform 4 [Trichechus manatus latirostris]
 ref|XP_004426838.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
1 isoform 2 [Ceratotherium simum simum]
 ref|XP_004601322.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
1 isoform X4 [Sorex araneus]
 ref|XP_004674456.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
1 isoform X3 [Condylura cristata]
 ref|XP_006190020.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
1 isoform X2 [Camelus ferus]
 ref|XP_006862056.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
1 isoform X2 [Chrysochloris asiatica]
 ref|XP_007532181.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
1 isoform X2 [Erinaceus europaeus]
 gb|AAH01804.1| Basic leucine zipper and W2 domains 1 [Homo sapiens]
Length=353

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 73/137 (53%), Gaps = 2/137 (1%)
 Frame = +1

Query  94   KEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESS--ELNFSR  267
            ++KPTL G R KTRKR+     DP  F D ++Q   +   DLE VAK +++S  +L++ R
Sbjct  6    QQKPTLSGQRFKTRKRDEKERFDPTQFQDCIIQGLTETGTDLEAVAKFLDASGAKLDYRR  65

Query  268  YGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFLI  447
            Y +T F+++  GG   PG    D+  R    V   Q + E +        K++RR  +L 
Sbjct  66   YAETLFDILVAGGMLAPGGTLADDMMRTDVCVFAAQEDLETMQAFAQVFNKLIRRYKYLE  125

Query  448  KNLENVMRXLLQSLELF  498
            K  E+ ++ LL  L+ F
Sbjct  126  KGFEDEVKKLLLFLKGF  142



>gb|KFO07364.1| Basic leucine zipper and W2 domain-containing protein 1, partial 
[Balearica regulorum gibbericeps]
Length=394

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 77/143 (54%), Gaps = 4/143 (3%)
 Frame = +1

Query  82   FMSSK--EKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESS--  249
            FM+++  +KPTL G R KTRKR+     DP  F D ++Q   +   DLE VAK +++S  
Sbjct  4    FMNNQKPQKPTLSGQRFKTRKRDEKERFDPTQFQDCIIQGLTETGTDLEAVAKFLDASGA  63

Query  250  ELNFSRYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILR  429
            +L++ RY +T F+++  GG   PG    D+  R    V   Q + E +        K++R
Sbjct  64   KLDYRRYAETLFDILVAGGMLAPGGTLADDMTRTNVCVFAAQEDLETMQAFAQVFNKLIR  123

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ ++ LL  L+ F
Sbjct  124  RYKYLEKGFEDEVKKLLLFLKGF  146



>ref|XP_007933469.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
1 isoform X3 [Orycteropus afer afer]
Length=362

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 73/137 (53%), Gaps = 2/137 (1%)
 Frame = +1

Query  94   KEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESS--ELNFSR  267
            ++KPTL G R KTRKR+     DP  F D ++Q   +   DLE VAK +++S  +L++ R
Sbjct  6    QQKPTLSGQRFKTRKRDEKERFDPTQFQDCIIQGLTETGTDLEAVAKFLDASGAKLDYRR  65

Query  268  YGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFLI  447
            Y +T F+++  GG   PG    D+  R    V   Q + E +        K++RR  +L 
Sbjct  66   YAETLFDILVAGGMLAPGGTLADDMMRTDVCVFAAQEDLETMQAFAQVFNKLIRRYKYLE  125

Query  448  KNLENVMRXLLQSLELF  498
            K  E+ ++ LL  L+ F
Sbjct  126  KGFEDEVKKLLLFLKGF  142



>ref|XP_005070669.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
1 [Mesocricetus auratus]
Length=353

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 73/137 (53%), Gaps = 2/137 (1%)
 Frame = +1

Query  94   KEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESS--ELNFSR  267
            ++KPTL G R KTRKR+     DP  F D ++Q   +   DLE VAK +++S  +L++ R
Sbjct  6    QQKPTLSGQRFKTRKRDEKERFDPTQFQDCIIQGLTETGTDLEAVAKFLDASGAKLDYRR  65

Query  268  YGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFLI  447
            Y +T F+++  GG   PG    D+  R    V   Q + E +        K++RR  +L 
Sbjct  66   YAETLFDILVAGGMLAPGGTLADDMMRTDVCVFAAQEDLETMQAFAQVFNKLIRRYKYLE  125

Query  448  KNLENVMRXLLQSLELF  498
            K  E+ ++ LL  L+ F
Sbjct  126  KGFEDEVKKLLLFLKGF  142



>gb|KFQ53077.1| Basic leucine zipper and W2 domain-containing protein 1, partial 
[Pelecanus crispus]
Length=391

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 77/143 (54%), Gaps = 4/143 (3%)
 Frame = +1

Query  82   FMSSK--EKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESS--  249
            FM+++  +KPTL G R KTRKR+     DP  F D ++Q   +   DLE VAK +++S  
Sbjct  4    FMNNQKPQKPTLSGQRFKTRKRDEKERFDPTQFQDCIIQGLTETGTDLEAVAKFLDASGA  63

Query  250  ELNFSRYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILR  429
            +L++ RY +T F+++  GG   PG    D+  R    V   Q + E +        K++R
Sbjct  64   KLDYRRYAETLFDILVAGGMLAPGGTLADDMTRTNVCVFAAQEDLETMQAFAQVFNKLIR  123

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ ++ LL  L+ F
Sbjct  124  RYKYLEKGFEDEVKKLLLFLKGF  146



>gb|ERE73228.1| basic leucine zipper and W2 domain-containing protein 2 [Cricetulus 
griseus]
Length=143

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/142 (32%), Positives = 74/142 (52%), Gaps = 5/142 (4%)
 Frame = +1

Query  85   MSSKEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIES--SELN  258
            M+  +KP L G R KTRKR+     +P  F D +VQ   +   DLE +AK ++S  S L+
Sbjct  1    MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAIAKFLDSTGSRLD  60

Query  259  FSRYGDTFFEVVFTGGRTQPGTVKPDEGERHP---YSVIECQPEREFILPSVIYVQKILR  429
            + RY DT F+++  G    PG  + D+G++     + V     + E I        K++R
Sbjct  61   YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR  120

Query  430  RKPFLIKNLENVMRXLLQSLEL  495
            R  +L K  E+ M+  + +++L
Sbjct  121  RYKYLEKAFEDEMKKEIVTVKL  142



>gb|KFV60001.1| Basic leucine zipper and W2 domain-containing protein 1, partial 
[Tyto alba]
Length=424

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 77/143 (54%), Gaps = 4/143 (3%)
 Frame = +1

Query  82   FMSSK--EKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESS--  249
            FM+++  +KPTL G R KTRKR+     DP  F D ++Q   +   DLE VAK +++S  
Sbjct  4    FMNNQKPQKPTLSGQRFKTRKRDEKERFDPTQFQDCIIQGLTETGTDLEAVAKFLDASGA  63

Query  250  ELNFSRYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILR  429
            +L++ RY +T F+++  GG   PG    D+  R    V   Q + E +        K++R
Sbjct  64   KLDYRRYAETLFDILVAGGMLAPGGTLADDMTRTNVCVFAAQEDLETMQAFAQVFNKLIR  123

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ ++ LL  L+ F
Sbjct  124  RYKYLEKGFEDEVKKLLLFLKGF  146



>ref|XP_005452376.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
1-A-like [Oreochromis niloticus]
Length=419

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 73/137 (53%), Gaps = 2/137 (1%)
 Frame = +1

Query  94   KEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESS--ELNFSR  267
            ++KPTL G R KTRKR+     DP  F +++VQ       DLE VAK +++S  +L++ R
Sbjct  6    QQKPTLTGQRFKTRKRDEKERFDPTQFQESIVQGLNQTGTDLEAVAKFLDASGAKLDYRR  65

Query  268  YGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFLI  447
            Y +T F+++  GG   PG    D+  R  Y +   Q + E +        K++RR  +L 
Sbjct  66   YAETLFDILVAGGMLAPGGTLSDDMTRTEYCLFTAQEDLETMQAYAQVFNKLIRRYKYLE  125

Query  448  KNLENVMRXLLQSLELF  498
            K  E  ++ LL  L+ F
Sbjct  126  KGFEEEIKKLLLFLKGF  142



>ref|XP_006792914.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
1-A-like [Neolamprologus brichardi]
Length=419

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 73/137 (53%), Gaps = 2/137 (1%)
 Frame = +1

Query  94   KEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESS--ELNFSR  267
            ++KPTL G R KTRKR+     DP  F +++VQ       DLE VAK +++S  +L++ R
Sbjct  6    QQKPTLTGQRFKTRKRDEKERFDPTQFQESIVQGLNQTGTDLEAVAKFLDASGAKLDYRR  65

Query  268  YGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFLI  447
            Y +T F+++  GG   PG    D+  R  Y +   Q + E +        K++RR  +L 
Sbjct  66   YAETLFDILVAGGMLAPGGTLSDDMTRTEYCLFTAQEDLETMQAYAQVFNKLIRRYKYLE  125

Query  448  KNLENVMRXLLQSLELF  498
            K  E  ++ LL  L+ F
Sbjct  126  KGFEEEIKKLLLFLKGF  142



>ref|XP_003507081.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
1 isoform X1 [Cricetulus griseus]
 ref|XP_007611177.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
1 isoform X1 [Cricetulus griseus]
Length=419

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 73/137 (53%), Gaps = 2/137 (1%)
 Frame = +1

Query  94   KEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESS--ELNFSR  267
            ++KPTL G R KTRKR+     DP  F D +VQ   +   DLE VAK +++S  +L++ R
Sbjct  6    QQKPTLSGQRFKTRKRDEKERFDPTQFQDCIVQGLTETGADLEAVAKFLDASGAKLDYRR  65

Query  268  YGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFLI  447
            Y +T F+++  GG   PG    D+  R    V   Q + E +        K++RR  +L 
Sbjct  66   YAETLFDILVAGGMLAPGGTLADDVMRTRVCVFAAQEDLETMQAFAQVFNKLIRRYKYLE  125

Query  448  KNLENVMRXLLQSLELF  498
            K  E+ ++ LL  L+ F
Sbjct  126  KGFEDEVKKLLLFLKGF  142



>ref|XP_005484252.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
1 isoform X1 [Zonotrichia albicollis]
Length=426

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 77/143 (54%), Gaps = 4/143 (3%)
 Frame = +1

Query  82   FMSSK--EKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESS--  249
            FM+++  +KPTL G R KTRKR+     DP  F D ++Q   +   DLE VAK +++S  
Sbjct  7    FMNNQKPQKPTLSGQRFKTRKRDEKERFDPTQFQDCIIQGLTETGTDLEAVAKFLDASGA  66

Query  250  ELNFSRYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILR  429
            +L++ RY +T F+++  GG   PG    D+  R    V   Q + E +        K++R
Sbjct  67   KLDYRRYAETLFDILVAGGMLAPGGTLADDMTRTNVCVFAAQEDLETMQAFAQVFNKLIR  126

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ ++ LL  L+ F
Sbjct  127  RYKYLEKGFEDEVKKLLLFLKGF  149



>gb|ERE81520.1| basic leucine zipper and W2 domain-containing protein 1 [Cricetulus 
griseus]
Length=427

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 73/137 (53%), Gaps = 2/137 (1%)
 Frame = +1

Query  94   KEKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESS--ELNFSR  267
            ++KPTL G R KTRKR+     DP  F D +VQ   +   DLE VAK +++S  +L++ R
Sbjct  6    QQKPTLSGQRFKTRKRDEKERFDPTQFQDCIVQGLTETGADLEAVAKFLDASGAKLDYRR  65

Query  268  YGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILRRKPFLI  447
            Y +T F+++  GG   PG    D+  R    V   Q + E +        K++RR  +L 
Sbjct  66   YAETLFDILVAGGMLAPGGTLADDVMRTRVCVFAAQEDLETMQAFAQVFNKLIRRYKYLE  125

Query  448  KNLENVMRXLLQSLELF  498
            K  E+ ++ LL  L+ F
Sbjct  126  KGFEDEVKKLLLFLKGF  142



>gb|KFQ20920.1| Basic leucine zipper and W2 domain-containing protein 1, partial 
[Merops nubicus]
Length=387

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 77/143 (54%), Gaps = 4/143 (3%)
 Frame = +1

Query  82   FMSSK--EKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESS--  249
            FM+++  +KPTL G R KTRKR+     DP  F D ++Q   +   DLE VAK +++S  
Sbjct  4    FMNNQKPQKPTLSGQRFKTRKRDEKERFDPTQFQDCIIQGLTETGTDLEAVAKFLDASGA  63

Query  250  ELNFSRYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILR  429
            +L++ RY +T F+++  GG   PG    D+  R    V   Q + E +        K++R
Sbjct  64   KLDYRRYAETLFDILVAGGMLAPGGTLADDMTRTNVCVFAAQEDLETMQAFAQVFNKLIR  123

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ ++ LL  L+ F
Sbjct  124  RYKYLEKGFEDEVKKLLLFLKGF  146



>gb|KFO52850.1| Basic leucine zipper and W2 domain-containing protein 1, partial 
[Corvus brachyrhynchos]
 gb|KFV64304.1| Basic leucine zipper and W2 domain-containing protein 1, partial 
[Picoides pubescens]
Length=423

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 77/143 (54%), Gaps = 4/143 (3%)
 Frame = +1

Query  82   FMSSK--EKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESS--  249
            FM+++  +KPTL G R KTRKR+     DP  F D ++Q   +   DLE VAK +++S  
Sbjct  4    FMNNQKPQKPTLSGQRFKTRKRDEKERFDPTQFQDCIIQGLTETGTDLEAVAKFLDASGA  63

Query  250  ELNFSRYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILR  429
            +L++ RY +T F+++  GG   PG    D+  R    V   Q + E +        K++R
Sbjct  64   KLDYRRYAETLFDILVAGGMLAPGGTLADDMTRTNVCVFAAQEDLETMQAFAQVFNKLIR  123

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ ++ LL  L+ F
Sbjct  124  RYKYLEKGFEDEVKKLLLFLKGF  146



>ref|XP_006889203.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 
1 [Elephantulus edwardii]
Length=365

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 77/143 (54%), Gaps = 4/143 (3%)
 Frame = +1

Query  82   FMSSK--EKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESS--  249
            FM+++  +KPTL G R KTRKR+     DP  F D ++Q   +   DLE VAK +++S  
Sbjct  32   FMNNQKQQKPTLSGQRFKTRKRDEKERFDPTQFQDCIIQGLTETGTDLEAVAKFLDASGA  91

Query  250  ELNFSRYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILR  429
            +L++ RY +T F+++  GG   PG    D+  R    V   Q + E +        K++R
Sbjct  92   KLDYRRYAETLFDILVAGGMLAPGGTLADDMMRTDVCVFAAQEDLETMQAFAQVFNKLIR  151

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ ++ LL  L+ F
Sbjct  152  RYKYLEKGFEDEVKKLLLFLKGF  174



>gb|KFM11188.1| Basic leucine zipper and W2 domain-containing protein 1, partial 
[Aptenodytes forsteri]
 gb|KFO84664.1| Basic leucine zipper and W2 domain-containing protein 1, partial 
[Buceros rhinoceros silvestris]
 gb|KFP53139.1| Basic leucine zipper and W2 domain-containing protein 1, partial 
[Cathartes aura]
 gb|KFU99717.1| Basic leucine zipper and W2 domain-containing protein 1, partial 
[Tauraco erythrolophus]
Length=423

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 77/143 (54%), Gaps = 4/143 (3%)
 Frame = +1

Query  82   FMSSK--EKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESS--  249
            FM+++  +KPTL G R KTRKR+     DP  F D ++Q   +   DLE VAK +++S  
Sbjct  4    FMNNQKPQKPTLSGQRFKTRKRDEKERFDPTQFQDCIIQGLTETGTDLEAVAKFLDASGA  63

Query  250  ELNFSRYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILR  429
            +L++ RY +T F+++  GG   PG    D+  R    V   Q + E +        K++R
Sbjct  64   KLDYRRYAETLFDILVAGGMLAPGGTLADDMTRTNVCVFAAQEDLETMQAFAQVFNKLIR  123

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ ++ LL  L+ F
Sbjct  124  RYKYLEKGFEDEVKKLLLFLKGF  146



>gb|KFW61776.1| Basic leucine zipper and W2 domain-containing protein 1, partial 
[Pygoscelis adeliae]
Length=395

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 77/143 (54%), Gaps = 4/143 (3%)
 Frame = +1

Query  82   FMSSK--EKPTLGGTRIKTRKRNIaapldpaafadaVVQIYLDNAGDLELVAKSIESS--  249
            FM+++  +KPTL G R KTRKR+     DP  F D ++Q   +   DLE VAK +++S  
Sbjct  4    FMNNQKPQKPTLSGQRFKTRKRDEKERFDPTQFQDCIIQGLTETGTDLEAVAKFLDASGA  63

Query  250  ELNFSRYGDTFFEVVFTGGRTQPGTVKPDEGERHPYSVIECQPEREFILPSVIYVQKILR  429
            +L++ RY +T F+++  GG   PG    D+  R    V   Q + E +        K++R
Sbjct  64   KLDYRRYAETLFDILVAGGMLAPGGTLADDMTRTNVCVFAAQEDLETMQAFAQVFNKLIR  123

Query  430  RKPFLIKNLENVMRXLLQSLELF  498
            R  +L K  E+ ++ LL  L+ F
Sbjct  124  RYKYLEKGFEDEVKKLLLFLKGF  146



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564814758300