BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001D04

Length=582
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_001051497.1|  Os03g0787300                                       237   1e-72   
gb|AAD12055.1|  DnaJ protein                                            236   2e-72   Hevea brasiliensis [jebe]
ref|XP_002466747.1|  hypothetical protein SORBIDRAFT_01g013390          236   4e-72   Sorghum bicolor [broomcorn]
ref|NP_001130317.1|  chaperone DNA J2                                   235   7e-72   Zea mays [maize]
gb|EAY92107.1|  hypothetical protein OsI_13813                          234   1e-71   Oryza sativa Indica Group [Indian rice]
ref|XP_006650701.1|  PREDICTED: dnaJ protein homolog 2-like             234   1e-71   Oryza brachyantha
gb|AAX95135.1|  DnaJ protein, putative                                  233   6e-71   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001050779.1|  Os03g0648400                                       233   6e-71   
gb|ABG78615.1|  J-domain protein                                        232   8e-71   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001146715.1|  uncharacterized protein LOC100280317               230   4e-70   
gb|AFW68140.1|  putative dnaJ chaperone family protein isoform 1        230   4e-70   
dbj|BAA35121.1|  DnaJ homolog                                           229   1e-69   Salix gilgiana
ref|XP_006650350.1|  PREDICTED: dnaJ protein homolog 2-like             229   2e-69   
gb|EMT10718.1|  DnaJ protein-like protein                               226   1e-68   
gb|KJB84163.1|  hypothetical protein B456_N007500                       221   2e-68   Gossypium raimondii
dbj|BAJ91943.1|  predicted protein                                      226   2e-68   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB60379.1|  hypothetical protein B456_009G302500                    226   3e-68   Gossypium raimondii
ref|XP_007052233.1|  DNAJ                                               225   5e-68   Theobroma cacao [chocolate]
gb|ABX57881.1|  DnaJ                                                    224   6e-68   Viola baoshanensis
ref|XP_009600920.1|  PREDICTED: dnaJ protein homolog                    224   1e-67   Nicotiana tomentosiformis
ref|XP_010907982.1|  PREDICTED: dnaJ protein homolog                    223   2e-67   Elaeis guineensis
gb|KDO85584.1|  hypothetical protein CISIN_1g014800mg                   218   3e-67   Citrus sinensis [apfelsine]
gb|KJB84165.1|  hypothetical protein B456_N007500                       221   3e-67   Gossypium raimondii
gb|AGY48885.1|  MIP1.3                                                  223   3e-67   Nicotiana benthamiana
emb|CDO99946.1|  unnamed protein product                                223   3e-67   Coffea canephora [robusta coffee]
ref|XP_010248011.1|  PREDICTED: dnaJ protein homolog 2-like             223   4e-67   Nelumbo nucifera [Indian lotus]
ref|XP_007010484.1|  DNAJ                                               222   6e-67   Theobroma cacao [chocolate]
ref|XP_004982304.1|  PREDICTED: dnaJ protein homolog 2-like             222   8e-67   Setaria italica
gb|ABI83623.1|  DnaJ-like protein                                       222   9e-67   Setaria italica
gb|AGY48884.1|  MIP1.2                                                  221   1e-66   Nicotiana benthamiana
gb|AFW67421.1|  putative dnaJ chaperone family protein                  221   1e-66   
ref|XP_007211787.1|  hypothetical protein PRUPE_ppa006330mg             221   1e-66   Prunus persica
ref|XP_003561819.1|  PREDICTED: dnaJ protein homolog                    221   1e-66   Brachypodium distachyon [annual false brome]
ref|XP_008231805.1|  PREDICTED: dnaJ protein homolog                    221   2e-66   Prunus mume [ume]
ref|XP_010090486.1|  DnaJ-like protein                                  221   2e-66   Morus notabilis
ref|XP_010933633.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    221   2e-66   Elaeis guineensis
ref|XP_004249937.1|  PREDICTED: dnaJ protein homolog                    221   2e-66   
gb|KJB84164.1|  hypothetical protein B456_N007500                       221   2e-66   Gossypium raimondii
gb|KJB84159.1|  hypothetical protein B456_N007500                       221   2e-66   Gossypium raimondii
ref|XP_006365672.1|  PREDICTED: dnaJ protein homolog isoform X1         221   2e-66   
ref|XP_009766164.1|  PREDICTED: dnaJ protein homolog 2-like             221   3e-66   Nicotiana sylvestris
ref|XP_002263156.1|  PREDICTED: dnaJ protein homolog                    220   3e-66   Vitis vinifera
ref|XP_006365673.1|  PREDICTED: dnaJ protein homolog isoform X2         220   3e-66   
ref|XP_009418972.1|  PREDICTED: dnaJ protein homolog isoform X2         220   4e-66   
ref|XP_009793841.1|  PREDICTED: dnaJ protein homolog isoform X1         220   4e-66   Nicotiana sylvestris
ref|XP_010031320.1|  PREDICTED: dnaJ protein homolog                    220   5e-66   Eucalyptus grandis [rose gum]
ref|XP_009793842.1|  PREDICTED: dnaJ protein homolog isoform X2         219   5e-66   Nicotiana sylvestris
ref|XP_006445792.1|  hypothetical protein CICLE_v10015385mg             219   6e-66   Citrus clementina [clementine]
ref|XP_009623415.1|  PREDICTED: dnaJ protein homolog                    219   6e-66   Nicotiana tomentosiformis
ref|XP_006485485.1|  PREDICTED: dnaJ protein homolog                    219   7e-66   Citrus sinensis [apfelsine]
gb|ACN39991.1|  unknown                                                 219   7e-66   Picea sitchensis
ref|XP_004239737.1|  PREDICTED: dnaJ protein homolog                    219   8e-66   Solanum lycopersicum
ref|XP_002514419.1|  Chaperone protein dnaJ, putative                   219   9e-66   
ref|XP_010933632.1|  PREDICTED: dnaJ protein homolog isoform X1         219   9e-66   Elaeis guineensis
ref|XP_008354864.1|  PREDICTED: dnaJ protein homolog                    216   1e-65   
ref|NP_001234241.1|  DnaJ-like protein                                  219   1e-65   
ref|XP_011017419.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    219   1e-65   Populus euphratica
ref|XP_004981504.1|  PREDICTED: dnaJ protein homolog                    219   1e-65   Setaria italica
gb|KDO85583.1|  hypothetical protein CISIN_1g014800mg                   216   1e-65   Citrus sinensis [apfelsine]
ref|XP_009398344.1|  PREDICTED: dnaJ protein homolog 2-like             219   1e-65   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAA63965.1|  DnaJ protein                                           218   2e-65   Solanum tuberosum [potatoes]
gb|AAF64454.1|AF239932_1  DnaJ protein                                  218   2e-65   Euphorbia esula [wolf's milk]
ref|XP_008375557.1|  PREDICTED: dnaJ protein homolog                    218   2e-65   
ref|XP_009397426.1|  PREDICTED: dnaJ protein homolog                    218   2e-65   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABI18985.1|  molecular chaperone DjA2                                218   3e-65   Allium ampeloprasum
gb|KDP22008.1|  hypothetical protein JCGZ_03128                         215   4e-65   Jatropha curcas
ref|XP_010258832.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    217   4e-65   Nelumbo nucifera [Indian lotus]
ref|XP_009341572.1|  PREDICTED: dnaJ protein homolog                    217   4e-65   Pyrus x bretschneideri [bai li]
gb|AFW67420.1|  putative dnaJ chaperone family protein                  217   5e-65   
ref|XP_002270362.1|  PREDICTED: dnaJ protein homolog isoform X1         217   5e-65   Vitis vinifera
emb|CBI28261.3|  unnamed protein product                                216   5e-65   Vitis vinifera
ref|XP_008345828.1|  PREDICTED: dnaJ protein homolog                    217   6e-65   Malus domestica [apple tree]
ref|XP_006345881.1|  PREDICTED: dnaJ protein homolog                    217   8e-65   Solanum tuberosum [potatoes]
gb|ABB16980.1|  DnaJ-like protein                                       216   9e-65   Solanum tuberosum [potatoes]
ref|NP_001168650.1|  putative dnaJ chaperone family protein             216   9e-65   Zea mays [maize]
gb|ABA46776.1|  DnaJ-like protein                                       217   1e-64   Solanum tuberosum [potatoes]
ref|XP_010651845.1|  PREDICTED: dnaJ protein homolog isoform X2         216   1e-64   
ref|XP_004510114.1|  PREDICTED: dnaJ protein homolog 2-like             216   1e-64   Cicer arietinum [garbanzo]
gb|AGY48883.1|  MIP1.1b                                                 216   2e-64   Nicotiana benthamiana
ref|XP_006445376.1|  hypothetical protein CICLE_v10020330mg             216   2e-64   Citrus clementina [clementine]
ref|XP_006367020.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    216   2e-64   Solanum tuberosum [potatoes]
ref|XP_004236804.1|  PREDICTED: dnaJ protein homolog isoform X1         216   2e-64   Solanum lycopersicum
ref|NP_001275059.1|  DnaJ-like protein                                  216   2e-64   Solanum tuberosum [potatoes]
ref|XP_009418971.1|  PREDICTED: dnaJ protein homolog isoform X1         215   2e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010053981.1|  PREDICTED: dnaJ protein homolog                    216   3e-64   Eucalyptus grandis [rose gum]
ref|XP_009588725.1|  PREDICTED: dnaJ protein homolog                    215   4e-64   
gb|AFR66645.1|  MIP1.1a                                                 215   4e-64   Nicotiana benthamiana
ref|XP_011084248.1|  PREDICTED: dnaJ protein homolog                    215   4e-64   Sesamum indicum [beniseed]
gb|AAG24642.1|AF308737_1  J1P                                           214   5e-64   Daucus carota [carrots]
ref|XP_009406563.1|  PREDICTED: dnaJ protein homolog                    214   5e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010685460.1|  PREDICTED: dnaJ protein homolog ANJ1               214   8e-64   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007015642.1|  DNAJ isoform 3                                     211   1e-63   
ref|XP_009408520.1|  PREDICTED: dnaJ protein homolog isoform X1         213   1e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003558043.1|  PREDICTED: dnaJ protein homolog                    213   1e-63   Brachypodium distachyon [annual false brome]
ref|XP_011008852.1|  PREDICTED: dnaJ protein homolog isoform X1         213   2e-63   Populus euphratica
ref|XP_002313505.1|  seed maturation protein PM37                       213   2e-63   Populus trichocarpa [western balsam poplar]
ref|XP_008446732.1|  PREDICTED: dnaJ protein homolog                    213   2e-63   Cucumis melo [Oriental melon]
ref|XP_011008853.1|  PREDICTED: dnaJ protein homolog isoform X2         213   2e-63   Populus euphratica
ref|XP_004169945.1|  PREDICTED: dnaJ protein homolog                    213   2e-63   
ref|XP_002515865.1|  Chaperone protein dnaJ, putative                   213   2e-63   Ricinus communis
ref|XP_011024143.1|  PREDICTED: dnaJ protein homolog                    213   3e-63   Populus euphratica
ref|XP_002316479.1|  DnaJ family protein                                213   3e-63   Populus trichocarpa [western balsam poplar]
ref|XP_010907714.1|  PREDICTED: dnaJ protein homolog                    213   3e-63   Elaeis guineensis
emb|CDP09461.1|  unnamed protein product                                213   3e-63   Coffea canephora [robusta coffee]
ref|XP_008787761.1|  PREDICTED: dnaJ protein homolog                    212   4e-63   Phoenix dactylifera
ref|XP_009760224.1|  PREDICTED: dnaJ protein homolog                    212   4e-63   Nicotiana sylvestris
gb|EMS59985.1|  Chaperone protein dnaJ 2                                209   7e-63   Triticum urartu
ref|XP_011032891.1|  PREDICTED: dnaJ protein homolog                    212   7e-63   Populus euphratica
ref|XP_010089281.1|  DnaJ-like protein                                  211   7e-63   Morus notabilis
ref|XP_004306421.1|  PREDICTED: dnaJ protein homolog                    211   7e-63   Fragaria vesca subsp. vesca
gb|EMS60670.1|  DnaJ protein-like protein                               212   8e-63   Triticum urartu
ref|XP_007015641.1|  DNAJ isoform 2                                     211   8e-63   
ref|XP_002310999.1|  DnaJ family protein                                211   1e-62   Populus trichocarpa [western balsam poplar]
ref|XP_002446897.1|  hypothetical protein SORBIDRAFT_06g024520          211   1e-62   Sorghum bicolor [broomcorn]
ref|XP_007015640.1|  DNAJ isoform 1                                     211   1e-62   
ref|XP_009408521.1|  PREDICTED: dnaJ protein homolog isoform X2         211   1e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001768102.1|  predicted protein                                  211   2e-62   
ref|NP_001267695.1|  dnaJ protein homolog                               210   3e-62   Cucumis sativus [cucumbers]
ref|XP_004953339.1|  PREDICTED: dnaJ protein homolog 2-like             210   4e-62   Setaria italica
ref|XP_008803820.1|  PREDICTED: dnaJ protein homolog 2-like             209   4e-62   
ref|XP_010031575.1|  PREDICTED: dnaJ protein homolog                    209   5e-62   Eucalyptus grandis [rose gum]
ref|XP_003521084.1|  PREDICTED: dnaJ protein homolog 2-like             209   6e-62   Glycine max [soybeans]
gb|ACU24346.1|  unknown                                                 209   6e-62   Glycine max [soybeans]
ref|XP_009622737.1|  PREDICTED: dnaJ protein homolog 2-like             209   6e-62   Nicotiana tomentosiformis
gb|EMT20603.1|  DnaJ protein-like protein                               209   8e-62   
ref|XP_003529049.1|  PREDICTED: dnaJ protein homolog 2-like             209   8e-62   Glycine max [soybeans]
ref|NP_001047626.1|  Os02g0656500                                       208   1e-61   
gb|EEC73725.1|  hypothetical protein OsI_08334                          208   1e-61   Oryza sativa Indica Group [Indian rice]
ref|XP_006378828.1|  hypothetical protein POPTR_0010s24930g             209   2e-61   
ref|XP_006386554.1|  hypothetical protein POPTR_0002s14200g             208   2e-61   
gb|KJB35427.1|  hypothetical protein B456_006G117100                    203   2e-61   Gossypium raimondii
ref|XP_002301248.1|  DnaJ family protein                                208   2e-61   
gb|AGY48887.1|  MIP1.4b                                                 207   3e-61   Nicotiana benthamiana
ref|XP_001755408.1|  predicted protein                                  207   4e-61   
gb|EEE57509.1|  hypothetical protein OsJ_07792                          208   4e-61   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006826444.1|  hypothetical protein AMTR_s00004p00172570          207   5e-61   Amborella trichopoda
ref|XP_010919645.1|  PREDICTED: dnaJ protein homolog                    206   1e-60   Elaeis guineensis
ref|XP_001782829.1|  predicted protein                                  206   1e-60   
gb|KJB35428.1|  hypothetical protein B456_006G117100                    202   2e-60   Gossypium raimondii
gb|KHG01500.1|  Chaperone dnaJ 3 -like protein                          202   2e-60   Gossypium arboreum [tree cotton]
gb|KHG17902.1|  Chaperone dnaJ 3 -like protein                          205   2e-60   Gossypium arboreum [tree cotton]
ref|NP_001136581.1|  putative dnaJ chaperone family protein             205   2e-60   Zea mays [maize]
ref|XP_006647626.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    205   3e-60   Oryza brachyantha
ref|XP_006647627.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    205   3e-60   Oryza brachyantha
emb|CAC12824.1|  putative DNAJ protein                                  204   4e-60   Nicotiana tabacum [American tobacco]
emb|CAH67501.1|  OSIGBa0134H18.3                                        204   5e-60   Oryza sativa [red rice]
ref|XP_001774283.1|  predicted protein                                  204   7e-60   
ref|XP_002454540.1|  hypothetical protein SORBIDRAFT_04g032970          204   8e-60   Sorghum bicolor [broomcorn]
ref|XP_009789005.1|  PREDICTED: dnaJ protein homolog                    203   1e-59   Nicotiana sylvestris
gb|KJB41003.1|  hypothetical protein B456_007G087000                    203   1e-59   Gossypium raimondii
gb|ACJ84518.1|  unknown                                                 203   1e-59   Medicago truncatula
ref|XP_003626730.1|  DnaJ protein-like protein                          203   1e-59   Medicago truncatula
gb|KJB35426.1|  hypothetical protein B456_006G117100                    203   1e-59   Gossypium raimondii
emb|CAA04447.1|  DnaJ-like protein                                      203   1e-59   Medicago sativa [alfalfa]
ref|NP_001053485.1|  Os04g0549600                                       202   2e-59   
gb|ABY52936.1|  DnaJ family heat shock protein                          202   2e-59   Oryza sativa Japonica Group [Japonica rice]
sp|P42824.1|DNJH2_ALLPO  RecName: Full=DnaJ protein homolog 2; Fl...    202   3e-59   Allium ampeloprasum
gb|KJB35429.1|  hypothetical protein B456_006G117100                    203   3e-59   Gossypium raimondii
gb|EPS59846.1|  hypothetical protein M569_14958                         197   4e-59   Genlisea aurea
ref|XP_009592511.1|  PREDICTED: dnaJ protein homolog                    201   6e-59   Nicotiana tomentosiformis
gb|AFK48766.1|  unknown                                                 201   7e-59   Medicago truncatula
gb|KJB09149.1|  hypothetical protein B456_001G126200                    201   8e-59   Gossypium raimondii
dbj|BAD25681.1|  putative DnaJ-like protein MsJ1                        201   8e-59   Oryza sativa Japonica Group [Japonica rice]
gb|KHF97331.1|  Chaperone dnaJ 3 -like protein                          201   1e-58   Gossypium arboreum [tree cotton]
ref|XP_006347934.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    201   1e-58   
ref|XP_003570021.1|  PREDICTED: dnaJ protein homolog 2-like             201   1e-58   Brachypodium distachyon [annual false brome]
ref|XP_006424068.1|  hypothetical protein CICLE_v10028531mg             201   1e-58   Citrus clementina [clementine]
ref|XP_010263053.1|  PREDICTED: dnaJ protein homolog                    201   1e-58   Nelumbo nucifera [Indian lotus]
ref|XP_004976432.1|  PREDICTED: dnaJ protein homolog 2-like             200   2e-58   Setaria italica
ref|XP_007134513.1|  hypothetical protein PHAVU_010G053900g             200   2e-58   Phaseolus vulgaris [French bean]
ref|XP_010692097.1|  PREDICTED: dnaJ protein homolog 2-like             200   2e-58   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU36024.1|  hypothetical protein MIMGU_mgv1a007013mg                199   3e-58   Erythranthe guttata [common monkey flower]
ref|XP_009382439.1|  PREDICTED: dnaJ protein homolog                    198   1e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002983333.1|  hypothetical protein SELMODRAFT_118063             198   1e-57   Selaginella moellendorffii
gb|AES67168.2|  DnaJ-class molecular chaperone                          195   1e-57   Medicago truncatula
ref|XP_002969107.1|  hypothetical protein SELMODRAFT_267228             197   3e-57   Selaginella moellendorffii
ref|XP_009411580.1|  PREDICTED: dnaJ protein homolog                    197   4e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006345526.1|  PREDICTED: dnaJ protein homolog isoform X1         197   4e-57   Solanum tuberosum [potatoes]
gb|AGY48888.1|  MIP1L1                                                  197   4e-57   Nicotiana benthamiana
ref|XP_004487721.1|  PREDICTED: dnaJ protein homolog                    194   5e-57   Cicer arietinum [garbanzo]
gb|EYU37228.1|  hypothetical protein MIMGU_mgv1a006942mg                196   7e-57   Erythranthe guttata [common monkey flower]
ref|XP_004506241.1|  PREDICTED: dnaJ protein homolog ANJ1-like          196   7e-57   Cicer arietinum [garbanzo]
ref|XP_002511620.1|  Chaperone protein dnaJ, putative                   195   7e-57   
ref|XP_003596916.1|  DnaJ                                               196   9e-57   Medicago truncatula
ref|XP_007150008.1|  hypothetical protein PHAVU_005G118100g             196   9e-57   Phaseolus vulgaris [French bean]
ref|XP_006340318.1|  PREDICTED: dnaJ protein homolog ANJ1-like is...    195   1e-56   Solanum tuberosum [potatoes]
gb|AGR45906.1|  DnaJ protein 2-like protein                             195   1e-56   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001240264.1|  uncharacterized protein LOC100818805               195   2e-56   Glycine max [soybeans]
gb|KHN17991.1|  DnaJ protein like                                       195   2e-56   Glycine soja [wild soybean]
ref|XP_003540271.1|  PREDICTED: dnaJ protein homolog                    195   2e-56   Glycine max [soybeans]
ref|XP_009779099.1|  PREDICTED: dnaJ protein homolog                    195   2e-56   Nicotiana sylvestris
gb|EYU37227.1|  hypothetical protein MIMGU_mgv1a006922mg                194   3e-56   Erythranthe guttata [common monkey flower]
ref|XP_006837307.1|  hypothetical protein AMTR_s00111p00054240          191   3e-56   
gb|KDP42967.1|  hypothetical protein JCGZ_23909                         194   5e-56   Jatropha curcas
sp|P43644.1|DNJH_ATRNU  RecName: Full=DnaJ protein homolog ANJ1; ...    194   5e-56   Atriplex nummularia
ref|XP_004251216.1|  PREDICTED: dnaJ protein homolog                    194   5e-56   Solanum lycopersicum
ref|XP_009596179.1|  PREDICTED: dnaJ protein homolog                    193   8e-56   Nicotiana tomentosiformis
ref|XP_004229763.1|  PREDICTED: dnaJ protein homolog 2-like             193   1e-55   Solanum lycopersicum
gb|AFK37703.1|  unknown                                                 192   1e-55   Medicago truncatula
ref|XP_010694477.1|  PREDICTED: dnaJ protein homolog                    192   2e-55   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011090296.1|  PREDICTED: dnaJ protein homolog                    192   3e-55   Sesamum indicum [beniseed]
ref|XP_011088982.1|  PREDICTED: dnaJ protein homolog                    191   4e-55   Sesamum indicum [beniseed]
ref|XP_010263054.1|  PREDICTED: dnaJ protein homolog                    191   5e-55   Nelumbo nucifera [Indian lotus]
ref|XP_010089798.1|  DnaJ-like protein                                  191   6e-55   
gb|ACJ85577.1|  unknown                                                 186   6e-55   Medicago truncatula
ref|XP_004139085.1|  PREDICTED: dnaJ protein homolog                    191   8e-55   Cucumis sativus [cucumbers]
emb|CAI64493.1|  OSJNBa0065H10.16                                       191   1e-54   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008230416.1|  PREDICTED: dnaJ protein homolog                    190   1e-54   Prunus mume [ume]
ref|XP_007205259.1|  hypothetical protein PRUPE_ppa006299mg             190   1e-54   Prunus persica
ref|XP_008443634.1|  PREDICTED: dnaJ protein homolog                    189   2e-54   Cucumis melo [Oriental melon]
emb|CAD41609.2|  OSJNBb0034G17.1                                        194   3e-54   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006590333.1|  PREDICTED: uncharacterized protein LOC100808...    189   4e-54   
ref|NP_001238341.1|  seed maturation protein PM37                       188   5e-54   Glycine max [soybeans]
ref|XP_007132506.1|  hypothetical protein PHAVU_011G100000g             188   8e-54   Phaseolus vulgaris [French bean]
gb|AHA84223.1|  seed maturation protein PM37                            188   8e-54   Phaseolus vulgaris [French bean]
gb|EYU36023.1|  hypothetical protein MIMGU_mgv1a007093mg                188   9e-54   Erythranthe guttata [common monkey flower]
dbj|BAK03083.1|  predicted protein                                      180   1e-53   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011093285.1|  PREDICTED: chaperone protein dnaJ 3-like           187   1e-53   Sesamum indicum [beniseed]
ref|NP_001242510.1|  uncharacterized protein LOC100808604               187   1e-53   
ref|XP_009368443.1|  PREDICTED: dnaJ protein homolog                    187   1e-53   Pyrus x bretschneideri [bai li]
ref|XP_003605981.1|  DnaJ                                               187   2e-53   
ref|XP_010493266.1|  PREDICTED: chaperone protein dnaJ 2-like iso...    187   2e-53   Camelina sativa [gold-of-pleasure]
gb|AHA84264.1|  seed maturation protein PM37                            187   2e-53   Phaseolus vulgaris [French bean]
ref|XP_003605980.1|  DnaJ                                               187   2e-53   Medicago truncatula
emb|CDX70980.1|  BnaC03g10640D                                          187   2e-53   
ref|XP_008385581.1|  PREDICTED: dnaJ protein homolog                    187   2e-53   
tpg|DAA41207.1|  TPA: putative dnaJ chaperone family protein            190   2e-53   
dbj|BAA76883.1|  DnaJ homolog protein                                   187   2e-53   Salix gilgiana
emb|CDP15561.1|  unnamed protein product                                185   7e-53   Coffea canephora [robusta coffee]
ref|XP_010535721.1|  PREDICTED: chaperone protein dnaJ 3                186   8e-53   Tarenaya hassleriana [spider flower]
ref|XP_006404506.1|  hypothetical protein EUTSA_v10010407mg             185   1e-52   Eutrema salsugineum [saltwater cress]
ref|XP_002874044.1|  hypothetical protein ARALYDRAFT_489058             184   2e-52   
ref|XP_010544327.1|  PREDICTED: dnaJ protein homolog                    184   4e-52   Tarenaya hassleriana [spider flower]
ref|XP_008232370.1|  PREDICTED: dnaJ protein homolog 2-like             183   4e-52   Prunus mume [ume]
ref|XP_002877319.1|  hypothetical protein ARALYDRAFT_905503             183   5e-52   Arabidopsis lyrata subsp. lyrata
ref|XP_004291531.1|  PREDICTED: dnaJ protein homolog                    183   8e-52   Fragaria vesca subsp. vesca
gb|KDO48715.1|  hypothetical protein CISIN_1g015695mg                   180   8e-52   Citrus sinensis [apfelsine]
ref|XP_002275918.1|  PREDICTED: dnaJ protein homolog 2                  182   9e-52   Vitis vinifera
emb|CAN64325.1|  hypothetical protein VITISV_005641                     182   9e-52   Vitis vinifera
ref|XP_008361658.1|  PREDICTED: dnaJ protein homolog                    182   1e-51   
ref|NP_850653.1|  chaperone protein dnaJ 3                              181   1e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010521621.1|  PREDICTED: dnaJ protein homolog ANJ1-like          182   1e-51   Tarenaya hassleriana [spider flower]
ref|XP_009336413.1|  PREDICTED: dnaJ protein homolog                    182   1e-51   Pyrus x bretschneideri [bai li]
gb|AAB49030.1|  DnaJ homolog                                            181   3e-51   Arabidopsis thaliana [mouse-ear cress]
ref|NP_189997.1|  chaperone protein dnaJ 3                              181   3e-51   Arabidopsis thaliana [mouse-ear cress]
gb|AAK74013.1|  AT3g44110/F26G5_60                                      181   4e-51   Arabidopsis thaliana [mouse-ear cress]
gb|KDO48711.1|  hypothetical protein CISIN_1g015695mg                   180   6e-51   Citrus sinensis [apfelsine]
ref|XP_008359180.1|  PREDICTED: dnaJ protein homolog                    181   6e-51   
ref|XP_010427107.1|  PREDICTED: chaperone protein dnaJ 3 isoform X1     180   1e-50   
gb|KDO48710.1|  hypothetical protein CISIN_1g015695mg                   179   1e-50   Citrus sinensis [apfelsine]
gb|AAB86799.1|  putative                                                179   1e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006292339.1|  hypothetical protein CARUB_v10018551mg             179   1e-50   Capsella rubella
ref|NP_568412.1|  chaperone protein dnaJ 2                              179   1e-50   Arabidopsis thaliana [mouse-ear cress]
emb|CBI16632.3|  unnamed protein product                                183   2e-50   Vitis vinifera
ref|XP_001774301.1|  predicted protein                                  179   2e-50   
ref|XP_008375745.1|  PREDICTED: dnaJ protein homolog 2-like             178   5e-50   Malus domestica [apple tree]
ref|XP_006400711.1|  hypothetical protein EUTSA_v10013655mg             178   6e-50   Eutrema salsugineum [saltwater cress]
gb|KFK26344.1|  hypothetical protein AALP_AA8G235700                    177   9e-50   Arabis alpina [alpine rockcress]
ref|XP_006287824.1|  hypothetical protein CARUB_v10001042mg             177   1e-49   Capsella rubella
ref|XP_010454471.1|  PREDICTED: chaperone protein dnaJ 2                177   2e-49   Camelina sativa [gold-of-pleasure]
emb|CDY65546.1|  BnaCnng47600D                                          177   2e-49   Brassica napus [oilseed rape]
emb|CDX92385.1|  BnaA10g14240D                                          176   2e-49   
ref|XP_009120690.1|  PREDICTED: chaperone protein dnaJ 3-like           176   2e-49   Brassica rapa
ref|XP_010420996.1|  PREDICTED: chaperone protein dnaJ 2 isoform X1     176   2e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010514755.1|  PREDICTED: chaperone protein dnaJ 3-like           176   3e-49   Camelina sativa [gold-of-pleasure]
emb|CDX92386.1|  BnaA10g14250D                                          176   3e-49   
sp|Q03363.1|DNJH1_ALLPO  RecName: Full=DnaJ protein homolog 1; Sh...    175   4e-49   Allium ampeloprasum
ref|XP_009120689.1|  PREDICTED: chaperone protein dnaJ 3-like           175   7e-49   Brassica rapa
gb|KHG16063.1|  DnaJ protein                                            172   8e-49   Gossypium arboreum [tree cotton]
gb|KHG16062.1|  Chaperone protein dnaJ 3                                172   1e-48   Gossypium arboreum [tree cotton]
emb|CDY09117.1|  BnaA02g05430D                                          174   1e-48   Brassica napus [oilseed rape]
ref|XP_004291528.1|  PREDICTED: dnaJ protein homolog                    173   4e-48   Fragaria vesca subsp. vesca
ref|XP_010520679.1|  PREDICTED: chaperone protein dnaJ 3-like           173   8e-48   
ref|XP_009131855.1|  PREDICTED: chaperone protein dnaJ 3-like           171   1e-47   Brassica rapa
ref|XP_009126521.1|  PREDICTED: chaperone protein dnaJ 3                171   3e-47   Brassica rapa
ref|XP_004307004.1|  PREDICTED: dnaJ protein homolog 2-like             169   1e-46   Fragaria vesca subsp. vesca
ref|XP_002963792.1|  hypothetical protein SELMODRAFT_230221             168   2e-46   Selaginella moellendorffii
ref|XP_009388365.1|  PREDICTED: dnaJ protein homolog                    159   1e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002974881.1|  hypothetical protein SELMODRAFT_232411             166   1e-45   Selaginella moellendorffii
gb|ACJ85213.1|  unknown                                                 157   3e-45   
gb|KDP28841.1|  hypothetical protein JCGZ_14612                         165   4e-45   
ref|XP_007220469.1|  hypothetical protein PRUPE_ppa006364mg             165   4e-45   
gb|KDO48709.1|  hypothetical protein CISIN_1g015695mg                   164   6e-45   
gb|AAD09517.1|  NTFP2                                                   155   2e-44   
emb|CAL36997.1|  DnaJ-like protein                                      155   2e-44   
gb|AGY48886.1|  MIP1.4a                                                 162   5e-44   
ref|XP_003058583.1|  predicted protein                                  157   5e-42   
gb|KDP36478.1|  hypothetical protein JCGZ_08608                         149   2e-41   
ref|XP_002507968.1|  predicted protein                                  153   1e-40   
ref|XP_009525521.1|  hypothetical protein PHYSODRAFT_345922             151   7e-40   
ref|XP_011457522.1|  PREDICTED: dnaJ protein homolog                    149   3e-39   
emb|CCA21495.1|  conserved hypothetical protein                         149   3e-39   
ref|XP_002900006.1|  conserved hypothetical protein                     149   5e-39   
ref|XP_005819280.1|  hypothetical protein GUITHDRAFT_121532             149   6e-39   
emb|CCI48830.1|  unnamed protein product                                152   8e-39   
emb|CCI48832.1|  unnamed protein product                                152   9e-39   
emb|CCI48831.1|  unnamed protein product                                152   9e-39   
gb|KHN36510.1|  DnaJ protein like                                       145   9e-39   
emb|CCI48829.1|  unnamed protein product                                152   9e-39   
ref|XP_008890293.1|  hypothetical protein PPTG_00631                    148   1e-38   
ref|XP_001419206.1|  predicted protein                                  147   2e-38   
ref|XP_003080911.1|  DnaJ-like protein (ISS)                            146   7e-38   
ref|XP_008874469.1|  hypothetical protein H310_10010                    145   7e-38   
ref|XP_011416044.1|  PREDICTED: dnaJ homolog subfamily A member 1...    145   1e-37   
ref|XP_004170446.1|  PREDICTED: dnaJ protein homolog                    139   1e-37   
ref|XP_007515206.1|  predicted protein                                  145   1e-37   
ref|XP_005707879.1|  molecular chaperone DnaJ                           145   2e-37   
ref|XP_005645695.1|  DnaJ-like protein                                  144   4e-37   
gb|EKC32228.1|  DnaJ-like protein subfamily A member 1                  141   5e-37   
ref|XP_007764824.1|  hypothetical protein CONPUDRAFT_87768              142   2e-36   
ref|XP_005707432.1|  molecular chaperone DnaJ                           142   2e-36   
gb|AAD09516.1|  NTFP1                                                   132   2e-36   
gb|KIJ17275.1|  hypothetical protein PAXINDRAFT_162188                  140   9e-36   
ref|XP_005852710.1|  DnaJ subfamily A member 2-like protein             139   1e-35   
ref|XP_009830474.1|  hypothetical protein H257_06805                    139   1e-35   
ref|XP_007308701.1|  DnaJ-domain-containing protein                     137   5e-35   
gb|KDQ59400.1|  hypothetical protein JAAARDRAFT_32961                   137   5e-35   
ref|XP_007399859.1|  hypothetical protein PHACADRAFT_262538             137   7e-35   
gb|KIZ04147.1|  putative DnaJ proteinJ1                                 137   1e-34   
ref|XP_002949642.1|  molecular chaperone                                137   1e-34   
gb|EWM24221.1|  HSP40/DnaJ heat shock protein                           137   1e-34   
ref|XP_010583355.1|  PREDICTED: dnaJ homolog subfamily A member 2...    135   2e-34   
ref|XP_002364366.1|  DnaJ domain-containing protein                     137   2e-34   
ref|XP_001691598.1|  DnaJ-like protein                                  136   2e-34   
ref|XP_008885880.1|  DnaJ family chaperone, putative                    136   2e-34   
ref|XP_009830477.1|  hypothetical protein H257_06808                    136   2e-34   
ref|XP_001616597.1|  DnaJ domain containing protein                     136   3e-34   
emb|CBJ30599.1|  Heat shock protein 40                                  136   3e-34   
ref|XP_003969457.1|  PREDICTED: dnaJ homolog subfamily A member 2...    135   4e-34   
ref|NP_001005841.1|  dnaJ homolog subfamily A member 2                  135   5e-34   
gb|KIL69507.1|  hypothetical protein M378DRAFT_20903                    135   6e-34   
ref|XP_002260632.1|  DNAJ protein                                       135   6e-34   
ref|XP_971446.1|  PREDICTED: dnaJ homolog subfamily A member 1          135   6e-34   
ref|XP_008607517.1|  hypothetical protein SDRG_03658                    135   6e-34   
emb|CDO70578.1|  hypothetical protein BN946_scf184636.g10               137   7e-34   
ref|XP_007887604.1|  PREDICTED: dnaJ homolog subfamily A member 2       135   7e-34   
ref|XP_007321427.1|  hypothetical protein SERLADRAFT_474282             134   8e-34   
ref|XP_008607516.1|  hypothetical protein SDRG_03657                    134   8e-34   
ref|XP_002734268.1|  PREDICTED: dnaJ homolog subfamily A member 1...    134   9e-34   
ref|XP_783657.1|  PREDICTED: dnaJ homolog subfamily A member 1-like     134   9e-34   
emb|CCD75013.1|  putative hsp40, subfamily A, members 1,2,4             132   1e-33   
ref|NP_001004807.1|  DnaJ subfamily A member 2                          134   1e-33   
ref|XP_005490145.1|  PREDICTED: dnaJ homolog subfamily A member 2       134   1e-33   
emb|CBK20067.2|  unnamed protein product                                134   2e-33   
ref|XP_007364587.1|  hypothetical protein DICSQDRAFT_135488             134   2e-33   
gb|AAX46634.1|  DnaJ subfamily A member 2                               129   2e-33   
gb|KIK77119.1|  hypothetical protein PAXRUDRAFT_835106                  133   2e-33   
emb|CCM06079.1|  predicted protein                                      136   2e-33   
ref|XP_008874481.1|  hypothetical protein H310_10021                    133   3e-33   
emb|CDS28557.1|  dnaJ subfamily A                                       133   3e-33   
gb|EUT78884.1|  hypothetical protein PFAG_05460                         132   3e-33   
dbj|GAA36748.2|  DnaJ homolog subfamily A member 1                      133   3e-33   
ref|XP_007478072.1|  PREDICTED: dnaJ homolog subfamily A member 4...    132   4e-33   
gb|KIM65128.1|  hypothetical protein SCLCIDRAFT_1212624                 132   4e-33   
ref|XP_009166302.1|  hypothetical protein T265_03526                    132   4e-33   
ref|XP_005526438.1|  PREDICTED: dnaJ homolog subfamily A member 2       132   4e-33   
gb|KIJ69543.1|  hypothetical protein HYDPIDRAFT_172911                  132   5e-33   
ref|XP_001348533.1|  HSP40, subfamily A, putative                       132   5e-33   
gb|KIM80921.1|  hypothetical protein PILCRDRAFT_97896                   132   5e-33   
gb|KDO48708.1|  hypothetical protein CISIN_1g015695mg                   132   5e-33   
ref|XP_009248965.1|  PREDICTED: dnaJ homolog subfamily A member 2       129   6e-33   
gb|KDO48707.1|  hypothetical protein CISIN_1g015695mg                   132   6e-33   
gb|AFJ54624.1|  DnaJ                                                    132   7e-33   
ref|XP_004387526.1|  PREDICTED: dnaJ homolog subfamily A member 4       132   7e-33   
ref|XP_007263805.1|  hypothetical protein FOMMEDRAFT_139033             132   8e-33   
gb|ERL94599.1|  hypothetical protein D910_11876                         132   9e-33   
ref|XP_005283531.1|  PREDICTED: dnaJ homolog subfamily A member 1       131   9e-33   
emb|CDS21532.1|  dnaJ subfamily A                                       131   1e-32   
ref|NP_001274228.1|  DnaJ (Hsp40) homolog, subfamily A, member 1        131   1e-32   
gb|EUB57005.1|  DnaJ subfamily A member                                 131   1e-32   
emb|CDI97251.1|  dnaJ subfamily A                                       131   1e-32   
gb|KDO27150.1|  hypothetical protein SPRG_07857                         131   1e-32   
ref|XP_004617681.1|  PREDICTED: dnaJ homolog subfamily A member 4       131   1e-32   
ref|NP_001187713.1|  DnaJ-like protein subfamily a member 4             131   1e-32   
ref|XP_008612573.1|  DnaJ like subfamily A member 2                     131   1e-32   
gb|KDO27145.1|  hypothetical protein SPRG_07853                         131   1e-32   
emb|CCD75012.1|  putative hsp40, subfamily A, members 1,2,4             131   1e-32   
emb|CAG03075.1|  unnamed protein product                                135   1e-32   
gb|KIK45919.1|  hypothetical protein CY34DRAFT_801078                   131   1e-32   
ref|XP_009542430.1|  hypothetical protein HETIRDRAFT_407567             131   2e-32   
ref|XP_009028927.1|  hypothetical protein HELRODRAFT_95902              131   2e-32   
ref|XP_009034902.1|  hypothetical protein AURANDRAFT_59942              131   2e-32   
ref|XP_006261401.1|  PREDICTED: dnaJ homolog subfamily A member 4       130   2e-32   
ref|NP_001080625.1|  DnaJ subfamily A member 2                          130   2e-32   
ref|XP_001362945.2|  PREDICTED: dnaJ homolog subfamily A member 4...    131   2e-32   
gb|KIP12385.1|  hypothetical protein PHLGIDRAFT_98388                   130   2e-32   
ref|XP_006027277.1|  PREDICTED: dnaJ homolog subfamily A member 4       130   2e-32   
gb|KCW50580.1|  hypothetical protein EUGRSUZ_J00292                     130   2e-32   
ref|NP_001072848.1|  DnaJ (Hsp40) homolog, subfamily A, member 4,...    130   2e-32   
ref|XP_006641433.1|  PREDICTED: dnaJ homolog subfamily A member 2...    130   2e-32   
gb|AES12470.1|  heat shock protein 40                                   130   3e-32   
gb|EWC85742.1|  hypothetical protein PFNF54_05408                       130   3e-32   
ref|XP_007057982.1|  PREDICTED: dnaJ homolog subfamily A member 1       130   3e-32   
gb|KDQ12271.1|  hypothetical protein BOTBODRAFT_419527                  130   3e-32   
ref|XP_003699212.1|  PREDICTED: dnaJ homolog subfamily A member 1...    130   3e-32   
ref|XP_006114888.1|  PREDICTED: dnaJ homolog subfamily A member 1       130   3e-32   
gb|ACM09839.1|  DnaJ homolog subfamily A member 2                       127   3e-32   
gb|KIY62309.1|  hypothetical protein CYLTODRAFT_438937                  130   3e-32   
gb|ETW28492.1|  hypothetical protein PFFCH_04123                        130   3e-32   
ref|XP_003784609.1|  PREDICTED: dnaJ homolog subfamily A member 4       130   4e-32   
ref|XP_003494215.1|  PREDICTED: dnaJ homolog subfamily A member 1...    130   4e-32   
ref|XP_003395031.1|  PREDICTED: dnaJ homolog subfamily A member 1...    130   4e-32   
ref|XP_008036924.1|  hypothetical protein TRAVEDRAFT_146311             129   5e-32   
emb|CCA68652.1|  probable YDJ1-mitochondrial and ER import protein      129   5e-32   
ref|XP_001511550.1|  PREDICTED: dnaJ homolog subfamily A member 4       129   5e-32   
gb|KIJ29865.1|  hypothetical protein M422DRAFT_214779                   129   5e-32   
gb|EMD34506.1|  hypothetical protein CERSUDRAFT_86596                   129   5e-32   
gb|AIS25018.1|  heat shock protein 40                                   130   5e-32   
gb|EGW13880.1|  DnaJ-like subfamily A member 1                          125   6e-32   
ref|XP_003127042.1|  PREDICTED: dnaJ homolog subfamily A member 2       129   6e-32   
gb|ERE91501.1|  putative dnaJ subfamily A member 4-like protein         125   6e-32   
ref|XP_007625571.1|  PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog...    129   6e-32   
ref|XP_006729764.1|  PREDICTED: dnaJ homolog subfamily A member 2       129   7e-32   
ref|XP_004825473.1|  PREDICTED: dnaJ homolog subfamily A member 2       129   8e-32   
ref|XP_011150153.1|  PREDICTED: dnaJ homolog subfamily A member 1       129   8e-32   
ref|NP_001119620.1|  DnaJ-like                                          129   9e-32   
ref|XP_007520454.1|  PREDICTED: dnaJ homolog subfamily A member 4       129   1e-31   
ref|XP_003754938.1|  PREDICTED: dnaJ homolog subfamily A member 4       129   1e-31   
ref|XP_004704755.1|  PREDICTED: dnaJ homolog subfamily A member 2       129   1e-31   
ref|XP_003224682.1|  PREDICTED: dnaJ homolog subfamily A member 1       129   1e-31   
ref|XP_004664889.1|  PREDICTED: dnaJ homolog subfamily A member 2       129   1e-31   
ref|XP_008583923.1|  PREDICTED: dnaJ homolog subfamily A member 2       129   1e-31   
ref|XP_010980930.1|  PREDICTED: dnaJ homolog subfamily A member 2       129   1e-31   
ref|XP_003937295.1|  PREDICTED: dnaJ homolog subfamily A member 2       129   1e-31   
ref|XP_005401468.1|  PREDICTED: dnaJ homolog subfamily A member 2       129   1e-31   
ref|XP_006872627.1|  PREDICTED: dnaJ homolog subfamily A member 2       129   1e-31   
sp|O35824.1|DNJA2_RAT  RecName: Full=DnaJ homolog subfamily A mem...    129   1e-31   
ref|XP_007537773.1|  PREDICTED: dnaJ homolog subfamily A member 2       129   1e-31   
dbj|BAE40948.1|  unnamed protein product                                129   1e-31   
ref|XP_010948491.1|  PREDICTED: dnaJ homolog subfamily A member 2       129   1e-31   
ref|XP_007945027.1|  PREDICTED: dnaJ homolog subfamily A member 2       129   1e-31   
ref|XP_004629252.1|  PREDICTED: dnaJ homolog subfamily A member 2       129   1e-31   
ref|XP_002721610.1|  PREDICTED: dnaJ homolog subfamily A member 2       129   1e-31   
ref|NP_062768.1|  dnaJ homolog subfamily A member 2                     129   1e-31   
ref|XP_005079250.1|  PREDICTED: dnaJ homolog subfamily A member 2       129   1e-31   
ref|XP_004403732.1|  PREDICTED: dnaJ homolog subfamily A member 2       129   1e-31   
ref|XP_004889812.1|  PREDICTED: dnaJ homolog subfamily A member 2       129   1e-31   
ref|XP_002760963.1|  PREDICTED: dnaJ homolog subfamily A member 2       129   1e-31   
gb|ELT95443.1|  hypothetical protein CAPTEDRAFT_160845                  128   1e-31   
ref|NP_005871.1|  dnaJ homolog subfamily A member 2                     128   1e-31   
ref|XP_001082094.1|  PREDICTED: dnaJ homolog subfamily A member 2       128   1e-31   
gb|EJU05619.1|  hypothetical protein DACRYDRAFT_20055                   128   1e-31   
ref|XP_007167701.1|  PREDICTED: dnaJ homolog subfamily A member 2       128   1e-31   
ref|XP_004479738.1|  PREDICTED: dnaJ homolog subfamily A member 2...    128   1e-31   
ref|XP_003792569.1|  PREDICTED: dnaJ homolog subfamily A member 2       128   1e-31   
ref|XP_535319.4|  PREDICTED: dnaJ homolog subfamily A member 2          128   1e-31   
ref|XP_008552261.1|  PREDICTED: dnaJ homolog subfamily A member 1       128   1e-31   
ref|NP_998658.1|  dnaJ homolog subfamily A member 2                     128   1e-31   
ref|XP_011334056.1|  PREDICTED: dnaJ homolog subfamily A member 4       128   1e-31   
gb|KDD76066.1|  hypothetical protein H632_c371p1                        129   1e-31   
ref|XP_010896063.1|  PREDICTED: dnaJ homolog subfamily A member 2       128   1e-31   
gb|KIM30531.1|  hypothetical protein M408DRAFT_15510                    128   1e-31   
ref|XP_007862829.1|  hypothetical protein GLOTRDRAFT_35434              128   1e-31   
ref|XP_004371689.1|  PREDICTED: dnaJ homolog subfamily A member 2       128   1e-31   
ref|XP_007339008.1|  hypothetical protein AURDEDRAFT_111041             128   2e-31   
ref|XP_001507642.1|  PREDICTED: dnaJ homolog subfamily A member 2       128   2e-31   
ref|XP_003469394.2|  PREDICTED: dnaJ homolog subfamily A member 2       129   2e-31   
ref|XP_002782044.1|  molecular chaperone, putative                      125   2e-31   
ref|XP_004443484.1|  PREDICTED: dnaJ homolog subfamily A member 2       128   2e-31   
emb|CEF67628.1|  DnaJ-like-2                                            128   2e-31   
gb|KFM76618.1|  DnaJ-like protein subfamily A member 1                  128   2e-31   
ref|XP_004313490.1|  PREDICTED: dnaJ homolog subfamily A member 2...    128   2e-31   
ref|XP_003387983.1|  PREDICTED: dnaJ homolog subfamily A member 1...    128   2e-31   
ref|XP_011252179.1|  PREDICTED: dnaJ homolog subfamily A member 1       128   2e-31   
gb|AFX73009.1|  pDJA1 chaperone                                         128   2e-31   
ref|XP_008816960.1|  DnaJ like subfamily A member 2                     128   2e-31   
ref|NP_001035581.1|  dnaJ homolog subfamily A member 2                  128   2e-31   
ref|XP_001363277.1|  PREDICTED: dnaJ homolog subfamily A member 2       128   2e-31   
ref|XP_766227.1|  chaperone protein DnaJ                                128   2e-31   
ref|XP_006888325.1|  PREDICTED: dnaJ homolog subfamily A member 4...    127   3e-31   
ref|XP_005822285.1|  hypothetical protein GUITHDRAFT_97880              127   3e-31   
emb|CDR94440.1|  DnaJ chaperone, putative                               127   3e-31   
dbj|BAN66103.1|  DnaJ chaperone, putative                               127   3e-31   
gb|AAC27389.1|  DnaJ homolog                                            127   3e-31   
gb|KDN47527.1|  putative YDJ1-mitochondrial and ER import protein       127   4e-31   
ref|XP_003222964.1|  PREDICTED: dnaJ homolog subfamily A member 2       127   4e-31   
ref|XP_001610911.1|  DnaJ chaperone                                     127   4e-31   
ref|XP_010618179.1|  PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog...    127   4e-31   
ref|XP_002426657.1|  protein tumorous imaginal discs, putative          126   4e-31   
ref|XP_006458405.1|  hypothetical protein AGABI2DRAFT_190689            127   4e-31   
gb|EMP27743.1|  DnaJ like protein subfamily A member 4                  125   4e-31   
ref|NP_001079772.1|  DnaJ (Hsp40) homolog, subfamily A, member 4,...    127   5e-31   
ref|XP_003694595.1|  PREDICTED: dnaJ homolog subfamily A member 1...    127   5e-31   
ref|XP_954074.1|  molecular chaperone                                   127   5e-31   
ref|XP_002591298.1|  hypothetical protein BRAFLDRAFT_264103             127   5e-31   
ref|XP_008827854.1|  PREDICTED: dnaJ homolog subfamily A member 2       127   5e-31   
gb|AGK45627.1|  heat shock protein 40                                   127   5e-31   
ref|XP_007439805.1|  PREDICTED: dnaJ homolog subfamily A member 2       126   6e-31   
ref|XP_006261714.1|  PREDICTED: dnaJ homolog subfamily A member 2       126   6e-31   
ref|XP_004647344.1|  PREDICTED: dnaJ homolog subfamily A member 2...    126   7e-31   
gb|KFO30113.1|  DnaJ like protein subfamily A member 1                  120   8e-31   
ref|XP_005318528.1|  PREDICTED: dnaJ homolog subfamily A member 2       126   8e-31   
ref|XP_005289904.1|  PREDICTED: dnaJ homolog subfamily A member 2       126   8e-31   
gb|KIO13237.1|  hypothetical protein M404DRAFT_992794                   126   8e-31   
gb|AAB69313.1|  Dnj3/Cpr3                                               126   8e-31   
ref|XP_008150572.1|  PREDICTED: dnaJ homolog subfamily A member 2       126   8e-31   
gb|AHA86298.1|  DnaJ                                                    126   9e-31   
gb|KDQ33681.1|  hypothetical protein PLEOSDRAFT_1099644                 126   9e-31   
ref|XP_005715007.1|  unnamed protein product                            126   9e-31   
ref|XP_004833174.1|  DnaJ domain containing protein                     126   1e-30   



>ref|NP_001051497.1| Os03g0787300 [Oryza sativa Japonica Group]
 gb|AAT75262.1| putative DnaJ like protein [Oryza sativa Japonica Group]
 gb|ABF99246.1| DnaJ protein, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF13411.1| Os03g0787300 [Oryza sativa Japonica Group]
 gb|EAZ28837.1| hypothetical protein OsJ_12871 [Oryza sativa Japonica Group]
 dbj|BAG87697.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96593.1| unnamed protein product [Oryza sativa Japonica Group]
Length=417

 Score =   237 bits (604),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 141/155 (91%), Gaps = 2/155 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+T+YYE+LGVPKDASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEVLGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG GGGMHDPFDI           GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGPGGGMHDPFDI--FSSFFGGGFGGGSSRGRRQRRGED  118

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSLE+LYNGTSKKLS SRNVLC+KC GKG
Sbjct  119  VVHPLKVSLEELYNGTSKKLSLSRNVLCSKCNGKG  153



>gb|AAD12055.1| DnaJ protein [Hevea brasiliensis]
Length=415

 Score =   236 bits (603),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 138/155 (89%), Gaps = 1/155 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYEILGV K+ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMGSGGG HDPFDI    F G    GGG S   R++ GED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGSGGGAHDPFDI-FQSFFGGNPFGGGGSSRGRRKEGED  119

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            V+HPLKVSLEDLYNGTSKKLS SRNV+C+KCKGKG
Sbjct  120  VIHPLKVSLEDLYNGTSKKLSLSRNVICSKCKGKG  154



>ref|XP_002466747.1| hypothetical protein SORBIDRAFT_01g013390 [Sorghum bicolor]
 gb|EER93745.1| hypothetical protein SORBIDRAFT_01g013390 [Sorghum bicolor]
Length=419

 Score =   236 bits (601),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYEILGVPK ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG GG   DPFDIF SFFG S  GGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGAHVDPFDIFSSFFGPSFGGGGGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSLEDLYNGTSKKLS SRNV+C+KCKGKG
Sbjct  121  VVHPLKVSLEDLYNGTSKKLSLSRNVICSKCKGKG  155



>ref|NP_001130317.1| chaperone DNA J2 [Zea mays]
 gb|AAC08009.1| DnaJ-related protein ZMDJ1 [Zea mays]
 gb|ACF78499.1| unknown [Zea mays]
 gb|ACG32917.1| dnaJ protein [Zea mays]
 gb|ACL53813.1| unknown [Zea mays]
 gb|ACN34490.1| unknown [Zea mays]
 gb|ACR38444.1| unknown [Zea mays]
 tpg|DAA50285.1| TPA: chaperone DNA J2 [Zea mays]
Length=419

 Score =   235 bits (599),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYEILGVPK ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG GG   DPFDIF SFFG S  GGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGSHVDPFDIFSSFFGPSFGGGGGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSLEDLYNGTSKKLS SRNV+C+KCKGKG
Sbjct  121  VVHPLKVSLEDLYNGTSKKLSLSRNVICSKCKGKG  155



>gb|EAY92107.1| hypothetical protein OsI_13813 [Oryza sativa Indica Group]
Length=417

 Score =   234 bits (598),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 140/155 (90%), Gaps = 2/155 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+T+YYE+LGVPKDASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEVLGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG GGGMHDP DI           GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGPGGGMHDPLDI--CSSFFGGGFGGGSSRGRRQRRGED  118

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSLE+LYNGTSKKLS SRNVLC+KC GKG
Sbjct  119  VVHPLKVSLEELYNGTSKKLSLSRNVLCSKCNGKG  153



>ref|XP_006650701.1| PREDICTED: dnaJ protein homolog 2-like [Oryza brachyantha]
Length=418

 Score =   234 bits (598),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 144/155 (93%), Gaps = 1/155 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+T+YYE+LGVPKDASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEVLGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG GGGMHDPFDI  S F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGPGGGMHDPFDI-FSSFFGGGGFGGGSSRGRRQRRGED  119

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSL++LYNGTSKKLS SRNV+C+KC GKG
Sbjct  120  VVHPLKVSLDELYNGTSKKLSLSRNVICSKCNGKG  154



>gb|AAX95135.1| DnaJ protein, putative [Oryza sativa Japonica Group]
 gb|ABF97900.1| DnaJ protein, putative, expressed [Oryza sativa Japonica Group]
Length=416

 Score =   233 bits (593),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 139/155 (90%), Gaps = 2/155 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYEILGVPK ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKTASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG GG   DPFDI        P  GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGSHVDPFDI--FSSFFGPSFGGGSSRGRRQRRGED  118

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            V+HPLKVSLEDLYNGTSKKLS SRNVLCAKCKGKG
Sbjct  119  VIHPLKVSLEDLYNGTSKKLSLSRNVLCAKCKGKG  153



>ref|NP_001050779.1| Os03g0648400 [Oryza sativa Japonica Group]
 gb|AAO72551.1| DNAJ-like protein [Oryza sativa Japonica Group]
 gb|AAU89194.1| DnaJ protein, putative [Oryza sativa Japonica Group]
 gb|ABF97899.1| DnaJ protein, putative, expressed [Oryza sativa Japonica Group]
 gb|ABF97901.1| DnaJ protein, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF12693.1| Os03g0648400 [Oryza sativa Japonica Group]
 gb|EAY94672.1| hypothetical protein OsI_16451 [Oryza sativa Indica Group]
 gb|EAZ27951.1| hypothetical protein OsJ_11911 [Oryza sativa Japonica Group]
 gb|ACA50510.1| DnaJ protein [Oryza sativa Japonica Group]
 dbj|BAG97073.1| unnamed protein product [Oryza sativa Japonica Group]
Length=417

 Score =   233 bits (593),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 143/155 (92%), Gaps = 1/155 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYEILGVPK ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKTASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG GG   DPFDI  S F G  FGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGSHVDPFDI-FSSFFGPSFGGGGSSRGRRQRRGED  119

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            V+HPLKVSLEDLYNGTSKKLS SRNVLCAKCKGKG
Sbjct  120  VIHPLKVSLEDLYNGTSKKLSLSRNVLCAKCKGKG  154



>gb|ABG78615.1| J-domain protein [Triticum aestivum]
Length=420

 Score =   232 bits (592),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 142/157 (90%), Positives = 149/157 (95%), Gaps = 3/157 (2%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSDST+YYEILGVPKDASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDSTRYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfq--sffggspfggggssrgrrqrrg  470
            LSDPEKREIYDQYGE+ALKEGMG GGGMHDPFDIFQ     GG+PFGGGGSSRGRRQRRG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMG-GGGMHDPFDIFQSFFGGGGNPFGGGGSSRGRRQRRG  119

Query  471  EDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            EDVVHPLKVSLE+LYNGTSKKLS +RNVLC+KC GKG
Sbjct  120  EDVVHPLKVSLEELYNGTSKKLSLARNVLCSKCNGKG  156



>ref|NP_001146715.1| uncharacterized protein LOC100280317 [Zea mays]
 gb|ACL54611.1| unknown [Zea mays]
Length=419

 Score =   230 bits (587),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 138/155 (89%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYEILGVPK ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG GG   DPFDIF SFFG S  GGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGSHADPFDIFSSFFGPSFGGGGGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVH LKVSLEDLYNG SKKLS SRNV+C+KCKGKG
Sbjct  121  VVHSLKVSLEDLYNGISKKLSLSRNVICSKCKGKG  155



>gb|AFW68140.1| putative dnaJ chaperone family protein isoform 1 [Zea mays]
 gb|AFW68141.1| putative dnaJ chaperone family protein isoform 2 [Zea mays]
Length=419

 Score =   230 bits (587),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 138/155 (89%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYEILGVPK ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG GG   DPFDIF SFFG S  GGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGSHADPFDIFSSFFGPSFGGGGGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVH LKVSLEDLYNG SKKLS SRNV+C+KCKGKG
Sbjct  121  VVHSLKVSLEDLYNGISKKLSLSRNVICSKCKGKG  155



>dbj|BAA35121.1| DnaJ homolog [Salix gilgiana]
Length=420

 Score =   229 bits (584),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 146/157 (93%), Gaps = 2/157 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYE+LGV K ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEVLGVSKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGG-GMHDPFDI-fqsffggspfggggssrgrrqrrg  470
            LSDPEKREIYDQYGE+ALKEGMGSGG G HDPFDI    F GG+PFGGGGSSRGRRQRRG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGSGGSGAHDPFDIFQSFFGGGNPFGGGGSSRGRRQRRG  120

Query  471  EDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            EDV+HPLKVS EDLYNGTSKKLS SRNV+C+KCKGKG
Sbjct  121  EDVIHPLKVSFEDLYNGTSKKLSLSRNVICSKCKGKG  157



>ref|XP_006650350.1| PREDICTED: dnaJ protein homolog 2-like [Oryza brachyantha]
Length=417

 Score =   229 bits (583),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 138/155 (89%), Positives = 142/155 (92%), Gaps = 1/155 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYEILGVPK ASQDDLKKAYRKAAIK+ PDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKSASQDDLKKAYRKAAIKNPPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG GG   DPFDI  S F G  FGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGSHADPFDI-FSSFFGPSFGGGGSSRGRRQRRGED  119

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            V+HPLKVSLEDLYNGTSKKLS SRNVLCAKCKGKG
Sbjct  120  VIHPLKVSLEDLYNGTSKKLSLSRNVLCAKCKGKG  154



>gb|EMT10718.1| DnaJ protein-like protein [Aegilops tauschii]
Length=421

 Score =   226 bits (577),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 141/158 (89%), Positives = 148/158 (94%), Gaps = 4/158 (3%)
 Frame = +3

Query  117  MFGRAP-KKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYE  293
            MFGR P KKSDST+YYEILGVPKDASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGPPKKSDSTRYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  294  VLSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfq--sffggspfggggssrgrrqrr  467
            VLSDPEKREIYDQYGE+ALKEGMG GGGMHDPFDIFQ     GG+PFGGGGSSRGRRQRR
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMG-GGGMHDPFDIFQSFFGGGGNPFGGGGSSRGRRQRR  119

Query  468  gEDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            GEDVVHPLKVSLE+LYNGTSKKLS +RNVLC+KC GKG
Sbjct  120  GEDVVHPLKVSLEELYNGTSKKLSLARNVLCSKCNGKG  157



>gb|KJB84163.1| hypothetical protein B456_N007500 [Gossypium raimondii]
Length=248

 Score =   221 bits (562),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD++KYYEILGV K+ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNSKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMGSGGG HDPFDIFQSFFGG+PFG GGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGSGGGGHDPFDIFQSFFGGNPFGAGGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            V+HPLKVSLEDLYNGTSKKLS SRNV+C+KCKGKG
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLSRNVICSKCKGKG  155



>dbj|BAJ91943.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=421

 Score =   226 bits (576),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 141/158 (89%), Positives = 148/158 (94%), Gaps = 4/158 (3%)
 Frame = +3

Query  117  MFGRAP-KKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYE  293
            MFGR P KKSDST+YYEILGVPKDASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGPPKKSDSTRYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  294  VLSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfq--sffggspfggggssrgrrqrr  467
            VLSDPEKREIYDQYGE+ALKEGMG GGGMHDPFDIFQ     GG+PFGGGGSSRGRRQRR
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMG-GGGMHDPFDIFQSFFGGGGNPFGGGGSSRGRRQRR  119

Query  468  gEDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            GEDVVHPLKVSLE+LYNGTSKKLS +RNVLC+KC GKG
Sbjct  120  GEDVVHPLKVSLEELYNGTSKKLSLARNVLCSKCNGKG  157



>gb|KJB60379.1| hypothetical protein B456_009G302500 [Gossypium raimondii]
 gb|KJB60380.1| hypothetical protein B456_009G302500 [Gossypium raimondii]
 gb|KJB60381.1| hypothetical protein B456_009G302500 [Gossypium raimondii]
 gb|KJB60382.1| hypothetical protein B456_009G302500 [Gossypium raimondii]
 gb|KJB60383.1| hypothetical protein B456_009G302500 [Gossypium raimondii]
Length=418

 Score =   226 bits (575),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYEILGVPK ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKTASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGG+PFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGAHDPFDIFQSFFGGNPFGGGGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            V+HPLKVSLEDLYNGTSKKLS SRN++C+KCKGKG
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLSRNIICSKCKGKG  155



>ref|XP_007052233.1| DNAJ [Theobroma cacao]
 gb|EOX96390.1| DNAJ [Theobroma cacao]
Length=421

 Score =   225 bits (573),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGR PKKSD+TKYYE+LGV K ASQD+LKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRVPKKSDNTKYYEVLGVSKTASQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG G   H+PFDIF+SFFGG  FGGGGSSRGRRQ+RGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGASSHNPFDIFESFFGGGAFGGGGSSRGRRQKRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVH LKVSLEDLYNGT+KKLS SRN LC+KCKGKG
Sbjct  121  VVHSLKVSLEDLYNGTTKKLSLSRNALCSKCKGKG  155



>gb|ABX57881.1| DnaJ [Viola baoshanensis]
Length=417

 Score =   224 bits (572),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYEILGV K+ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGG+PFGGGGSSRGRRQR+GED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGNPFGGGGSSRGRRQRKGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSLEDLYNGTSKKLS SRNV+C+KCKGKG
Sbjct  121  VVHPLKVSLEDLYNGTSKKLSLSRNVICSKCKGKG  155



>ref|XP_009600920.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
 ref|XP_009600921.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
Length=417

 Score =   224 bits (571),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGR PKKSD+TKYYEILGVPK ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRTPKKSDNTKYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKR+IYDQYGE+ALKEGMG GGG HDPFDIFQSFFGGSPFGGGGSSRGRRQR+GED
Sbjct  61   LSDPEKRDIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGSPFGGGGSSRGRRQRKGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSLED+YNGTSKKLS SRNVLCAKCKGKG
Sbjct  121  VVHPLKVSLEDVYNGTSKKLSLSRNVLCAKCKGKG  155



>ref|XP_010907982.1| PREDICTED: dnaJ protein homolog [Elaeis guineensis]
Length=417

 Score =   223 bits (569),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGR PKKSD+T+YYEILGVPK+ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRPPKKSDNTRYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGG+PFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGNPFGGGGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            V+HPLKVSLEDLYNGTSKKLS SRNV+C KCKGKG
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLSRNVICQKCKGKG  155



>gb|KDO85584.1| hypothetical protein CISIN_1g014800mg [Citrus sinensis]
Length=247

 Score =   218 bits (555),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGR P++S++TKYYEILGV K A++D+LKKAYRKAA+K+HPDKGGDPEKFKEL QAYEV
Sbjct  1    MFGRTPRRSNNTKYYEILGVSKSATEDELKKAYRKAAMKNHPDKGGDPEKFKELGQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKR+IYDQYGE+ALKEGMG  G  H+PFDIF+SFFGG  FG GGSSRGRR+++GED
Sbjct  61   LSDPEKRDIYDQYGEDALKEGMGGAGAAHNPFDIFESFFGGGTFGAGGSSRGRRRKQGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVH LKVSLEDLYNGT+KKLS SRN+LC KCKGKG
Sbjct  121  VVHTLKVSLEDLYNGTTKKLSLSRNILCPKCKGKG  155



>gb|KJB84165.1| hypothetical protein B456_N007500 [Gossypium raimondii]
Length=333

 Score =   221 bits (562),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD++KYYEILGV K+ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNSKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMGSGGG HDPFDIFQSFFGG+PFG GGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGSGGGGHDPFDIFQSFFGGNPFGAGGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            V+HPLKVSLEDLYNGTSKKLS SRNV+C+KCKGKG
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLSRNVICSKCKGKG  155



>gb|AGY48885.1| MIP1.3 [Nicotiana benthamiana]
Length=418

 Score =   223 bits (568),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 142/156 (91%), Gaps = 1/156 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYEILGVPK ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrg-E  473
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGG    GGG S   R++R  E
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGAHDPFDIFQSFFGGGSPFGGGGSSRGRRQRKGE  120

Query  474  DVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            DVVHPLKVSLED+YNGTSKKLS SRNVLCAKCKGKG
Sbjct  121  DVVHPLKVSLEDVYNGTSKKLSLSRNVLCAKCKGKG  156



>emb|CDO99946.1| unnamed protein product [Coffea canephora]
Length=416

 Score =   223 bits (567),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPK+SD+TKYYE+LGV K+ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKRSDNTKYYEVLGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG GGG+HDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGVHDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            V+HPLKVSLEDLYNGTSKKLS SRNVLC KCKGKG
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLSRNVLCPKCKGKG  155



>ref|XP_010248011.1| PREDICTED: dnaJ protein homolog 2-like [Nelumbo nucifera]
 ref|XP_010248012.1| PREDICTED: dnaJ protein homolog 2-like [Nelumbo nucifera]
Length=417

 Score =   223 bits (567),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 140/155 (90%), Gaps = 1/155 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAP+KSD+TKYYEILGV K+ASQD+LKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPRKSDNTKYYEILGVSKNASQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSD EKREIYDQYGE+ALKEGMG GG  H+PFDI    F G  FGGGGSSRGRRQ++GED
Sbjct  61   LSDTEKREIYDQYGEDALKEGMGGGGASHNPFDI-FESFFGGGFGGGGSSRGRRQKQGED  119

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVH LKVSLEDLYNGTSKKLS SRN+LC KCKGKG
Sbjct  120  VVHTLKVSLEDLYNGTSKKLSLSRNILCPKCKGKG  154



>ref|XP_007010484.1| DNAJ [Theobroma cacao]
 gb|EOY19294.1| DNAJ [Theobroma cacao]
Length=417

 Score =   222 bits (566),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYEILGV K+ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGG+PFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGNPFGGGGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            V+HPLKVSLEDLYNGTSKKLS SRN++C KCKGKG
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLSRNIICFKCKGKG  155



>ref|XP_004982304.1| PREDICTED: dnaJ protein homolog 2-like [Setaria italica]
Length=419

 Score =   222 bits (565),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYEILGVPK ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG GGG  DPFDIF SFFG S  GGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGHVDPFDIFSSFFGPSFGGGGGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSLEDLYNGTSKKLS SRNV+C+KCKGKG
Sbjct  121  VVHPLKVSLEDLYNGTSKKLSLSRNVICSKCKGKG  155



>gb|ABI83623.1| DnaJ-like protein [Setaria italica]
Length=419

 Score =   222 bits (565),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYEILGVPK ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG GGG  DPFDIF SFFG S  GGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGHVDPFDIFSSFFGPSFGGGGGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSLEDLYNGTSKKLS SRNV+C+KCKGKG
Sbjct  121  VVHPLKVSLEDLYNGTSKKLSLSRNVICSKCKGKG  155



>gb|AGY48884.1| MIP1.2 [Nicotiana benthamiana]
Length=419

 Score =   221 bits (564),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD++KYYEILGVPK ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNSKYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGG  FGGGGSSRGRRQR+GED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGAHDPFDIFQSFFGGGGFGGGGSSRGRRQRKGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSLEDLY+GTSKKLS SRNVLC+KCKG G
Sbjct  121  VVHPLKVSLEDLYSGTSKKLSLSRNVLCSKCKGVG  155



>gb|AFW67421.1| putative dnaJ chaperone family protein [Zea mays]
Length=417

 Score =   221 bits (564),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+T+YYEILGV KDASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG GGGMHDPFDIFQSFFGG    GGGSSRGRRQRRG+D
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGMHDPFDIFQSFFGGGSPFGGGSSRGRRQRRGDD  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSLEDLYNGTSKKLS SRNVLC+KC GKG
Sbjct  121  VVHPLKVSLEDLYNGTSKKLSLSRNVLCSKCNGKG  155



>ref|XP_007211787.1| hypothetical protein PRUPE_ppa006330mg [Prunus persica]
 gb|EMJ12986.1| hypothetical protein PRUPE_ppa006330mg [Prunus persica]
Length=417

 Score =   221 bits (563),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYEILGV K ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKTASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            V+HPLKVSLEDLYNGTSKKLS SRN++C+KC+GKG
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLSRNIICSKCRGKG  155



>ref|XP_003561819.1| PREDICTED: dnaJ protein homolog [Brachypodium distachyon]
Length=420

 Score =   221 bits (563),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYEILGVPK+ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG GGG  DPFDIF SFFG S  GGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGVDPFDIFSSFFGPSFGGGGGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            V+HPLK SLEDLYNGTSKKLS SRNVLC+KCKGKG
Sbjct  121  VIHPLKASLEDLYNGTSKKLSLSRNVLCSKCKGKG  155



>ref|XP_008231805.1| PREDICTED: dnaJ protein homolog [Prunus mume]
Length=417

 Score =   221 bits (563),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYEILGV K ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKTASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            V+HPLKVSLEDLYNGTSKKLS SRN++C+KC+GKG
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLSRNIICSKCRGKG  155



>ref|XP_010090486.1| DnaJ-like protein [Morus notabilis]
 gb|EXB39585.1| DnaJ-like protein [Morus notabilis]
Length=417

 Score =   221 bits (563),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGR PKKSD+TKYYE+LGV K+ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRGPKKSDNTKYYEVLGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            V+HPLKVSLEDLYNGT+KKLS SRNVLC+KCKGKG
Sbjct  121  VIHPLKVSLEDLYNGTAKKLSLSRNVLCSKCKGKG  155



>ref|XP_010933633.1| PREDICTED: dnaJ protein homolog 2-like isoform X2 [Elaeis guineensis]
Length=416

 Score =   221 bits (562),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 138/155 (89%), Gaps = 1/155 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGR P++SD+TKYYEILGV K+ASQD+LKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRGPRRSDNTKYYEILGVSKNASQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYD+YGE+ALKEGMG GG  H+PFDI    F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDEYGEDALKEGMGGGGTSHNPFDI-FEQFFGGSAFGGGSSRGRRQRRGED  119

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVH LKVSLEDLYNGT+KKLS SRN LCAKCKGKG
Sbjct  120  VVHSLKVSLEDLYNGTTKKLSLSRNALCAKCKGKG  154



>ref|XP_004249937.1| PREDICTED: dnaJ protein homolog [Solanum lycopersicum]
Length=419

 Score =   221 bits (562),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 140/157 (89%), Gaps = 2/157 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYEILGVPK ASQ+DLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKAASQEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrg--  470
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGG     GG    R +R+   
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGGGNPFGGGGSSRARRQRRG  120

Query  471  EDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            EDV+HPLKVSLEDLYNGTSKKLS SRNVLC+KCKGKG
Sbjct  121  EDVIHPLKVSLEDLYNGTSKKLSLSRNVLCSKCKGKG  157



>gb|KJB84164.1| hypothetical protein B456_N007500 [Gossypium raimondii]
Length=418

 Score =   221 bits (562),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD++KYYEILGV K+ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNSKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMGSGGG HDPFDIFQSFFGG+PFG GGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGSGGGGHDPFDIFQSFFGGNPFGAGGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            V+HPLKVSLEDLYNGTSKKLS SRNV+C+KCKGKG
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLSRNVICSKCKGKG  155



>gb|KJB84159.1| hypothetical protein B456_N007500 [Gossypium raimondii]
 gb|KJB84160.1| hypothetical protein B456_N007500 [Gossypium raimondii]
 gb|KJB84161.1| hypothetical protein B456_N007500 [Gossypium raimondii]
 gb|KJB84162.1| hypothetical protein B456_N007500 [Gossypium raimondii]
 gb|KJB84166.1| hypothetical protein B456_N007500 [Gossypium raimondii]
Length=418

 Score =   221 bits (562),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD++KYYEILGV K+ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNSKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMGSGGG HDPFDIFQSFFGG+PFG GGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGSGGGGHDPFDIFQSFFGGNPFGAGGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            V+HPLKVSLEDLYNGTSKKLS SRNV+C+KCKGKG
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLSRNVICSKCKGKG  155



>ref|XP_006365672.1| PREDICTED: dnaJ protein homolog isoform X1 [Solanum tuberosum]
Length=419

 Score =   221 bits (562),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 140/157 (89%), Gaps = 2/157 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYEILGVPK ASQ+DLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKAASQEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrg--  470
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGG     GG    R +R+   
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGGGSPFGGGGSSRARRQRRG  120

Query  471  EDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            EDV+HPLKVSLEDLYNGTSKKLS SRNVLC+KCKGKG
Sbjct  121  EDVIHPLKVSLEDLYNGTSKKLSLSRNVLCSKCKGKG  157



>ref|XP_009766164.1| PREDICTED: dnaJ protein homolog 2-like [Nicotiana sylvestris]
 ref|XP_009766166.1| PREDICTED: dnaJ protein homolog 2-like [Nicotiana sylvestris]
Length=419

 Score =   221 bits (562),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD++KYYEILGVPK ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNSKYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGG  FGGGGSSRGRRQR+GED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGAHDPFDIFQSFFGGGGFGGGGSSRGRRQRKGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVH LKVSLEDLYNGTSKKLS SRNVLC+KCKG G
Sbjct  121  VVHSLKVSLEDLYNGTSKKLSLSRNVLCSKCKGVG  155



>ref|XP_002263156.1| PREDICTED: dnaJ protein homolog [Vitis vinifera]
 ref|XP_010658892.1| PREDICTED: dnaJ protein homolog [Vitis vinifera]
 emb|CBI24994.3| unnamed protein product [Vitis vinifera]
Length=416

 Score =   220 bits (561),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYY++LGV K+ASQ+DLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYDVLGVSKNASQEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGG+PFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGNPFGGGGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            V+HPLKVSLEDLYNGTSKKLS SRNV+C+KCKGKG
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLSRNVICSKCKGKG  155



>ref|XP_006365673.1| PREDICTED: dnaJ protein homolog isoform X2 [Solanum tuberosum]
Length=412

 Score =   220 bits (560),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 142/155 (92%), Gaps = 5/155 (3%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYEILGVPK ASQ+DLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKAASQEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDI       S FGGGGSSR RRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDI-----FQSFFGGGGSSRARRQRRGED  115

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            V+HPLKVSLEDLYNGTSKKLS SRNVLC+KCKGKG
Sbjct  116  VIHPLKVSLEDLYNGTSKKLSLSRNVLCSKCKGKG  150



>ref|XP_009418972.1| PREDICTED: dnaJ protein homolog isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=416

 Score =   220 bits (560),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 138/155 (89%), Positives = 145/155 (94%), Gaps = 1/155 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+T+YYEILGVPK ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKRE+YDQYGE+ALKE    GGG HDPFDIF SFFGG PFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREVYDQYGEDALKE-GMGGGGGHDPFDIFSSFFGGGPFGGGGSSRGRRQRRGED  119

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            V+HPLKVSLEDLYNGTSKKLS SRNV+C KCKGKG
Sbjct  120  VIHPLKVSLEDLYNGTSKKLSLSRNVICQKCKGKG  154



>ref|XP_009793841.1| PREDICTED: dnaJ protein homolog isoform X1 [Nicotiana sylvestris]
Length=418

 Score =   220 bits (560),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 140/156 (90%), Gaps = 1/156 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGR PKKSD+TKYYEILGVPK ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRTPKKSDNTKYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrg-E  473
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGG    GGG S   R++R  E
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGGSPFGGGGSSRGRRQRKGE  120

Query  474  DVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            DVVHPLKVSLED+YNGTSKKLS SRNVLC KCKGKG
Sbjct  121  DVVHPLKVSLEDVYNGTSKKLSLSRNVLCTKCKGKG  156



>ref|XP_010031320.1| PREDICTED: dnaJ protein homolog [Eucalyptus grandis]
 ref|XP_010031321.1| PREDICTED: dnaJ protein homolog [Eucalyptus grandis]
 gb|KCW50579.1| hypothetical protein EUGRSUZ_J00292 [Eucalyptus grandis]
Length=417

 Score =   220 bits (560),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYY++LGV K+ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYDVLGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            V+HPLKVSLEDLYNGTSKKL+ SRNV+C+KCKGKG
Sbjct  121  VIHPLKVSLEDLYNGTSKKLALSRNVICSKCKGKG  155



>ref|XP_009793842.1| PREDICTED: dnaJ protein homolog isoform X2 [Nicotiana sylvestris]
Length=412

 Score =   219 bits (559),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 141/155 (91%), Gaps = 5/155 (3%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGR PKKSD+TKYYEILGVPK ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRTPKKSDNTKYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDI       S FGGGGSSRGRRQR+GED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDI-----FQSFFGGGGSSRGRRQRKGED  115

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSLED+YNGTSKKLS SRNVLC KCKGKG
Sbjct  116  VVHPLKVSLEDVYNGTSKKLSLSRNVLCTKCKGKG  150



>ref|XP_006445792.1| hypothetical protein CICLE_v10015385mg [Citrus clementina]
 gb|ESR59032.1| hypothetical protein CICLE_v10015385mg [Citrus clementina]
Length=416

 Score =   219 bits (559),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 141/155 (91%), Gaps = 1/155 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYEILGV K+ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDI    F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGAHDPFDI-FQSFFGGSPFGGGSSRGRRQRRGED  119

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            V+HPLKVSLEDLYNGTSKKLS SRNV+C KCKGKG
Sbjct  120  VIHPLKVSLEDLYNGTSKKLSLSRNVICTKCKGKG  154



>ref|XP_009623415.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
 ref|XP_009623416.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
Length=420

 Score =   219 bits (559),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGR PKKSD++KYYEILGVPK ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYE+
Sbjct  1    MFGRTPKKSDNSKYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEI  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGG  FGGGGSSRGRRQR+GED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGAHDPFDIFQSFFGGGGFGGGGSSRGRRQRKGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSLEDLY+GTSKKLS SRNVLC+KCKG G
Sbjct  121  VVHPLKVSLEDLYSGTSKKLSLSRNVLCSKCKGVG  155



>ref|XP_006485485.1| PREDICTED: dnaJ protein homolog [Citrus sinensis]
Length=416

 Score =   219 bits (559),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 141/155 (91%), Gaps = 1/155 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYEILGV K+ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDI    F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGAHDPFDI-FQSFFGGSPFGGGSSRGRRQRRGED  119

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            V+HPLKVSLEDLYNGTSKKLS SRNV+C KCKGKG
Sbjct  120  VIHPLKVSLEDLYNGTSKKLSLSRNVICTKCKGKG  154



>gb|ACN39991.1| unknown [Picea sitchensis]
Length=421

 Score =   219 bits (559),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 139/158 (88%), Gaps = 3/158 (2%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYY+ILGV K A+ D+LKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYDILGVSKSATPDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDI---fqsffggspfggggssrgrrqrr  467
            LSDPEKREIYDQYGE+ALKEGMG GG  H+PFDI   F     G    GGGSSRGRRQ++
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGASHNPFDIFESFFGGSFGGSSFGGGSSRGRRQKQ  120

Query  468  gEDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            GEDVVHPLKVSL+DLYNGTS+KLS SRNV+C+KCKGKG
Sbjct  121  GEDVVHPLKVSLDDLYNGTSRKLSLSRNVICSKCKGKG  158



>ref|XP_004239737.1| PREDICTED: dnaJ protein homolog [Solanum lycopersicum]
Length=419

 Score =   219 bits (558),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 137/156 (88%), Positives = 142/156 (91%), Gaps = 1/156 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYEILGVPK A+Q+DLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKTAAQEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDI-fqsffggspfggggssrgrrqrrgE  473
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDI    F G    GGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGSPFGGGGGSSRGRRQRRGE  120

Query  474  DVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            DVVHPLKVSLEDLYNGTSKKLS SRNVLC KCKGKG
Sbjct  121  DVVHPLKVSLEDLYNGTSKKLSLSRNVLCPKCKGKG  156



>ref|XP_002514419.1| Chaperone protein dnaJ, putative [Ricinus communis]
 gb|ABH06547.1| molecular chaperone [Ricinus communis]
 gb|EEF47915.1| Chaperone protein dnaJ, putative [Ricinus communis]
Length=418

 Score =   219 bits (558),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 142/156 (91%), Positives = 149/156 (96%), Gaps = 1/156 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYEILGV K+ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKE-GMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgE  473
            LSDPEKREIYDQYGE+ALKE   G GGG HDPFDIFQSFFGGSPFGGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGGHDPFDIFQSFFGGSPFGGGGSSRGRRQRRGE  120

Query  474  DVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            DV+HPLKVSLEDLYNGTSKKLS SRNV+C+KCKGKG
Sbjct  121  DVIHPLKVSLEDLYNGTSKKLSLSRNVICSKCKGKG  156



>ref|XP_010933632.1| PREDICTED: dnaJ protein homolog isoform X1 [Elaeis guineensis]
Length=421

 Score =   219 bits (558),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 139/159 (87%), Gaps = 4/159 (3%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGR P++SD+TKYYEILGV K+ASQD+LKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRGPRRSDNTKYYEILGVSKNASQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqs----ffggspfggggssrgrrqr  464
            LSDPEKREIYD+YGE+ALKEGMG GG  H+PFDIF+        G    GGGSSRGRRQR
Sbjct  61   LSDPEKREIYDEYGEDALKEGMGGGGTSHNPFDIFEQFFGGSAFGGGAFGGGSSRGRRQR  120

Query  465  rgEDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            RGEDVVH LKVSLEDLYNGT+KKLS SRN LCAKCKGKG
Sbjct  121  RGEDVVHSLKVSLEDLYNGTTKKLSLSRNALCAKCKGKG  159



>ref|XP_008354864.1| PREDICTED: dnaJ protein homolog [Malus domestica]
Length=322

 Score =   216 bits (550),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD++KYYEILGV K ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNSKYYEILGVSKTASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGG+PFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGNPFGGGGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            V+HPLKVSLEDLYNGTSKKLS +RN +C+KCKGKG
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLARNKICSKCKGKG  155



>ref|NP_001234241.1| DnaJ-like protein [Solanum lycopersicum]
 gb|AAF28382.1|AF124139_1 DnaJ-like protein [Solanum lycopersicum]
Length=419

 Score =   219 bits (558),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 140/157 (89%), Gaps = 2/157 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYEILGVPK ASQ+DLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKAASQEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrg--  470
            LSDPEKREIYDQYGE+ALKEGMG GGG H+PFDIFQSFFGG     GG    R +R+   
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHEPFDIFQSFFGGGGNPFGGGGSSRVRRQRRG  120

Query  471  EDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            EDV+HPLKVSLEDLYNGTSKKLS SRNVLC+KCKGKG
Sbjct  121  EDVIHPLKVSLEDLYNGTSKKLSLSRNVLCSKCKGKG  157



>ref|XP_011017419.1| PREDICTED: dnaJ protein homolog 2-like isoform X1 [Populus euphratica]
Length=423

 Score =   219 bits (558),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 130/156 (83%), Positives = 146/156 (94%), Gaps = 1/156 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAP++SD+ KYYE+LGV K ASQD+LKKAYRKAAIK+HPDKGGDPEKFKEL+QAYEV
Sbjct  1    MFGRAPRRSDNNKYYEVLGVSKGASQDELKKAYRKAAIKNHPDKGGDPEKFKELSQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGG-MHDPFDIfqsffggspfggggssrgrrqrrgE  473
            LSDP+KR+IYDQYGE+ALKEGMG GG   H+P+DIF+SFFGG  FGGGGSSRGRRQ++GE
Sbjct  61   LSDPDKRDIYDQYGEDALKEGMGPGGSDGHNPYDIFESFFGGGGFGGGGSSRGRRQKQGE  120

Query  474  DVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            DVVHPLKVSLEDLYNGTSKKLS SRN+LCAKCKGKG
Sbjct  121  DVVHPLKVSLEDLYNGTSKKLSLSRNILCAKCKGKG  156



>ref|XP_004981504.1| PREDICTED: dnaJ protein homolog [Setaria italica]
Length=418

 Score =   219 bits (557),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 143/156 (92%), Gaps = 1/156 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+T+YYEILGVPKDASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrg-E  473
            LSDPEKREIYDQYGE+ALKEGMG GGGMHDPFDIFQSFFGG    GGG S   R++R  E
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGMHDPFDIFQSFFGGGSPFGGGGSSRGRRQRKGE  120

Query  474  DVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            DVVHPLKVSL++LYNGTSKKLS SRNVLC+KC GKG
Sbjct  121  DVVHPLKVSLDELYNGTSKKLSLSRNVLCSKCNGKG  156



>gb|KDO85583.1| hypothetical protein CISIN_1g014800mg [Citrus sinensis]
Length=334

 Score =   216 bits (551),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGR P++S++TKYYEILGV K A++D+LKKAYRKAA+K+HPDKGGDPEKFKEL QAYEV
Sbjct  1    MFGRTPRRSNNTKYYEILGVSKSATEDELKKAYRKAAMKNHPDKGGDPEKFKELGQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKR+IYDQYGE+ALKEGMG  G  H+PFDIF+SFFGG  FG GGSSRGRR+++GED
Sbjct  61   LSDPEKRDIYDQYGEDALKEGMGGAGAAHNPFDIFESFFGGGTFGAGGSSRGRRRKQGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVH LKVSLEDLYNGT+KKLS SRN+LC KCKGKG
Sbjct  121  VVHTLKVSLEDLYNGTTKKLSLSRNILCPKCKGKG  155



>ref|XP_009398344.1| PREDICTED: dnaJ protein homolog 2-like [Musa acuminata subsp. 
malaccensis]
Length=418

 Score =   219 bits (557),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+T+YYEILGV K+ASQ+DLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMGSGGG H+PFDIF+SFFGGS FGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGSGGGGHNPFDIFESFFGGSTFGGGGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            V+HPLKVSLEDLYNGTSKKLS SRNV+C KCKGKG
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLSRNVICQKCKGKG  155



>emb|CAA63965.1| DnaJ protein [Solanum tuberosum]
Length=419

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 143/156 (92%), Gaps = 1/156 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAP+KSD+TKYYEILGVPK A+Q+DLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPEKSDNTKYYEILGVPKTAAQEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDI-fqsffggspfggggssrgrrqrrgE  473
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDI    F G    GGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGSPFGGGGGSSRGRRQRRGE  120

Query  474  DVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            DVVHPLKVSLEDLYNGTSKKLS SRNVLC+KCKGKG
Sbjct  121  DVVHPLKVSLEDLYNGTSKKLSLSRNVLCSKCKGKG  156



>gb|AAF64454.1|AF239932_1 DnaJ protein [Euphorbia esula]
Length=418

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD++KYYEILGV K ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNSKYYEILGVSKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKR+IYDQYGE+ALKEGMG GGG HDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKRDIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            V HPLKVSLEDLYNGTSKKLS SRNV+C+KCKGKG
Sbjct  121  VTHPLKVSLEDLYNGTSKKLSLSRNVICSKCKGKG  155



>ref|XP_008375557.1| PREDICTED: dnaJ protein homolog [Malus domestica]
Length=417

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD++KYYEILGV K ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNSKYYEILGVSKTASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGG+PFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGNPFGGGGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            V+HPLKVSLEDLYNGTSKKLS SRN +C+KCKGKG
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLSRNKICSKCKGKG  155



>ref|XP_009397426.1| PREDICTED: dnaJ protein homolog [Musa acuminata subsp. malaccensis]
Length=416

 Score =   218 bits (555),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 138/155 (89%), Positives = 148/155 (95%), Gaps = 1/155 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYEILGVPK+ASQ+DLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKNASQEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKE    GGG H+PFDIF+SFFGG+PFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKE-GMGGGGGHNPFDIFESFFGGNPFGGGGSSRGRRQRRGED  119

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            V+HPLKVSLEDLYNGTSKKLS SRNV+C KCKGKG
Sbjct  120  VIHPLKVSLEDLYNGTSKKLSLSRNVICQKCKGKG  154



>gb|ABI18985.1| molecular chaperone DjA2 [Allium ampeloprasum]
Length=418

 Score =   218 bits (554),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYEILGVPK+AS DDLKKAYRKAAIK+HPDKGGDPEKFKELAQAY+V
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKNASPDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYDV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGG  FGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGDHDPFDIFQSFFGGGGFGGGGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSLE+LYNGTSKKLS SRNV+C+KC GKG
Sbjct  121  VVHPLKVSLEELYNGTSKKLSLSRNVICSKCNGKG  155



>gb|KDP22008.1| hypothetical protein JCGZ_03128 [Jatropha curcas]
Length=326

 Score =   215 bits (547),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 140/153 (92%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGR PKKSD+TKYYEILGV K+ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRGPKKSDNTKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LS PEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED
Sbjct  61   LSAPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKG  575
            V+HPLKVSLEDLYNGTSKKLS SRNV+C+KCKG
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLSRNVICSKCKG  153



>ref|XP_010258832.1| PREDICTED: dnaJ protein homolog 2-like isoform X1 [Nelumbo nucifera]
Length=413

 Score =   217 bits (553),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 138/155 (89%), Gaps = 5/155 (3%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MF  AP+KSD+TKYYEILGV K+ASQD+LKKAYRKAAIK+HPDKGGDPEKFK+LAQAYEV
Sbjct  1    MFSCAPRKSDNTKYYEILGVSKNASQDELKKAYRKAAIKNHPDKGGDPEKFKDLAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKR+IYDQYGE+ALKEGMG GG  H+PFDI       S FGGGGSSRGRRQ++GED
Sbjct  61   LSDPEKRDIYDQYGEDALKEGMGVGGASHNPFDI-----FESFFGGGGSSRGRRQKQGED  115

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVH LKVSLEDLYNGTSKKLS SRN+LC KCKGKG
Sbjct  116  VVHTLKVSLEDLYNGTSKKLSLSRNILCPKCKGKG  150



>ref|XP_009341572.1| PREDICTED: dnaJ protein homolog [Pyrus x bretschneideri]
Length=417

 Score =   217 bits (553),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD++KYYEILGV K ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNSKYYEILGVSKTASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGG+PFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGNPFGGGGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            V+HPLKVSLEDLYNGTSKKLS +RN +C+KCKGKG
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLARNKICSKCKGKG  155



>gb|AFW67420.1| putative dnaJ chaperone family protein [Zea mays]
Length=415

 Score =   217 bits (553),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 136/155 (88%), Gaps = 2/155 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+T+YYEILGV KDASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG GGGMHDPFDI             G  RGRRQRRG+D
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGMHDPFDI--FQSFFGGGSPFGGIRGRRQRRGDD  118

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSLEDLYNGTSKKLS SRNVLC+KC GKG
Sbjct  119  VVHPLKVSLEDLYNGTSKKLSLSRNVLCSKCNGKG  153



>ref|XP_002270362.1| PREDICTED: dnaJ protein homolog isoform X1 [Vitis vinifera]
 emb|CAN64692.1| hypothetical protein VITISV_030671 [Vitis vinifera]
Length=417

 Score =   217 bits (553),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+T+YYE LGV K+ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYETLGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG  GG HDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGSGGGHDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSLEDLY GTSKKLS SRNV+C+KC GKG
Sbjct  121  VVHPLKVSLEDLYIGTSKKLSLSRNVICSKCNGKG  155



>emb|CBI28261.3| unnamed protein product [Vitis vinifera]
Length=394

 Score =   216 bits (551),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+T+YYE LGV K+ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYETLGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG  GG HDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGSGGGHDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSLEDLY GTSKKLS SRNV+C+KC GKG
Sbjct  121  VVHPLKVSLEDLYIGTSKKLSLSRNVICSKCNGKG  155



>ref|XP_008345828.1| PREDICTED: dnaJ protein homolog [Malus domestica]
Length=417

 Score =   217 bits (552),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD++KYYEILGV K ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNSKYYEILGVSKTASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGG+PFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGNPFGGGGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            V+HPLKVSLEDLYNGTSKKLS +RN +C+KCKGKG
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLARNKICSKCKGKG  155



>ref|XP_006345881.1| PREDICTED: dnaJ protein homolog [Solanum tuberosum]
 gb|ABB16989.1| DnaJ-like protein [Solanum tuberosum]
Length=419

 Score =   217 bits (552),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 142/156 (91%), Gaps = 1/156 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYEILGVPK A+ +DLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKTAAPEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDI-fqsffggspfggggssrgrrqrrgE  473
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDI    F G    GGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGSPFGGGGGSSRGRRQRRGE  120

Query  474  DVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            DVVHPLKVSLEDLYNGTSKKLS SRNVLC+KCKGKG
Sbjct  121  DVVHPLKVSLEDLYNGTSKKLSLSRNVLCSKCKGKG  156



>gb|ABB16980.1| DnaJ-like protein [Solanum tuberosum]
Length=419

 Score =   216 bits (551),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 142/156 (91%), Gaps = 1/156 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYEILGVPK A+ +DLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKTAAPEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDI-fqsffggspfggggssrgrrqrrgE  473
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDI    F G    GGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGSPFGGGGGSSRGRRQRRGE  120

Query  474  DVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            DVVHPLKVSLEDLYNGTSKKLS SRNVLC+KCKGKG
Sbjct  121  DVVHPLKVSLEDLYNGTSKKLSLSRNVLCSKCKGKG  156



>ref|NP_001168650.1| putative dnaJ chaperone family protein [Zea mays]
 gb|ACN29044.1| unknown [Zea mays]
 tpg|DAA51803.1| TPA: putative dnaJ chaperone family protein [Zea mays]
Length=418

 Score =   216 bits (551),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 141/156 (90%), Positives = 147/156 (94%), Gaps = 1/156 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+T+YYEILGV KDASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDI-fqsffggspfggggssrgrrqrrgE  473
            LSDPEKREIYDQYGE+ALKEGMG GGGMHDPFDI    F GGSPFGGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGMHDPFDIFQSFFGGGSPFGGGGSSRGRRQRRGE  120

Query  474  DVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            DVVHPLKVSLEDLYNGTSKKLS SR+VLC+KC GKG
Sbjct  121  DVVHPLKVSLEDLYNGTSKKLSLSRSVLCSKCNGKG  156



>gb|ABA46776.1| DnaJ-like protein [Solanum tuberosum]
Length=443

 Score =   217 bits (552),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 142/156 (91%), Gaps = 1/156 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYEILGVPK A+ +DLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKTAAPEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDI-fqsffggspfggggssrgrrqrrgE  473
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDI    F G    GGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGSPFGGGGGSSRGRRQRRGE  120

Query  474  DVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            DVVHPLKVSLEDLYNGTSKKLS SRNVLC+KCKGKG
Sbjct  121  DVVHPLKVSLEDLYNGTSKKLSLSRNVLCSKCKGKG  156



>ref|XP_010651845.1| PREDICTED: dnaJ protein homolog isoform X2 [Vitis vinifera]
Length=417

 Score =   216 bits (550),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+T+YYE LGV K+ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYETLGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG  GG HDPFDIFQSFFGGSPF GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGSGGGHDPFDIFQSFFGGSPFAGGGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSLEDLY GTSKKLS SRNV+C+KC GKG
Sbjct  121  VVHPLKVSLEDLYIGTSKKLSLSRNVICSKCNGKG  155



>ref|XP_004510114.1| PREDICTED: dnaJ protein homolog 2-like [Cicer arietinum]
Length=421

 Score =   216 bits (550),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGR P+KSD+TKYY+ILGV K+AS+D++KKAYRKAA+K+HPDKGGDPEKFKEL QAYEV
Sbjct  1    MFGRGPRKSDNTKYYDILGVAKNASEDEIKKAYRKAAMKNHPDKGGDPEKFKELGQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEK+E+YDQYGE+ALKEGMG G   H+PFDIF+SFFGG+ FGGGG SRGRRQ++GED
Sbjct  61   LSDPEKKEMYDQYGEDALKEGMGGGSSFHNPFDIFESFFGGAGFGGGGPSRGRRQKQGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVH LKVSLED+YNGT+KKLS SRNVLC KCKGKG
Sbjct  121  VVHSLKVSLEDVYNGTTKKLSLSRNVLCPKCKGKG  155



>gb|AGY48883.1| MIP1.1b [Nicotiana benthamiana]
Length=418

 Score =   216 bits (550),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 135/156 (87%), Positives = 143/156 (92%), Gaps = 1/156 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYEILGVPK AS +DLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKSASPEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrg-E  473
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIF SFFGGSPFGGGG S   R+++  E
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGSPFGGGGGSSRGRRQKRGE  120

Query  474  DVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            DVVHPLKVSL+DLYNGTSKKLS SRNVLC KCKGKG
Sbjct  121  DVVHPLKVSLDDLYNGTSKKLSLSRNVLCPKCKGKG  156



>ref|XP_006445376.1| hypothetical protein CICLE_v10020330mg [Citrus clementina]
 ref|XP_006464459.1| PREDICTED: dnaJ protein homolog 2-like [Citrus sinensis]
 gb|ESR58616.1| hypothetical protein CICLE_v10020330mg [Citrus clementina]
 gb|KDO85581.1| hypothetical protein CISIN_1g014800mg [Citrus sinensis]
 gb|KDO85582.1| hypothetical protein CISIN_1g014800mg [Citrus sinensis]
Length=418

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGR P++S++TKYYEILGV K A++D+LKKAYRKAA+K+HPDKGGDPEKFKEL QAYEV
Sbjct  1    MFGRTPRRSNNTKYYEILGVSKSATEDELKKAYRKAAMKNHPDKGGDPEKFKELGQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKR+IYDQYGE+ALKEGMG  G  H+PFDIF+SFFGG  FG GGSSRGRR+++GED
Sbjct  61   LSDPEKRDIYDQYGEDALKEGMGGAGAAHNPFDIFESFFGGGTFGAGGSSRGRRRKQGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVH LKVSLEDLYNGT+KKLS SRN+LC KCKGKG
Sbjct  121  VVHTLKVSLEDLYNGTTKKLSLSRNILCPKCKGKG  155



>ref|XP_006367020.1| PREDICTED: dnaJ protein homolog 2-like isoform X1 [Solanum tuberosum]
Length=419

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYEILGVP  AS DDLKKAYRKAAIK+HPDKGGDPEKFKE+AQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPNTASPDDLKKAYRKAAIKNHPDKGGDPEKFKEIAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            L+DPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGG  FGGGGSSRGRRQRRGED
Sbjct  61   LNDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGGGFGGGGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSLEDLYNG SKKLS SRNVLC KCKG G
Sbjct  121  VVHPLKVSLEDLYNGISKKLSLSRNVLCTKCKGAG  155



>ref|XP_004236804.1| PREDICTED: dnaJ protein homolog isoform X1 [Solanum lycopersicum]
Length=418

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYEILGVP  AS DDLKKAYRKAAIK+HPDKGGDPEKFKE+AQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPNTASPDDLKKAYRKAAIKNHPDKGGDPEKFKEIAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            L+DPEKREIYDQYGE+ALKEGMG GGG HDPFDIFQSFFGG  FGGGGSSRGRRQRRGED
Sbjct  61   LNDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGGGFGGGGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSLEDLYNG SKKLS SRNVLC+KCKG G
Sbjct  121  VVHPLKVSLEDLYNGISKKLSLSRNVLCSKCKGVG  155



>ref|NP_001275059.1| DnaJ-like protein [Solanum tuberosum]
 gb|ABB55383.1| DnaJ-like protein-like [Solanum tuberosum]
Length=445

 Score =   216 bits (551),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 142/156 (91%), Gaps = 1/156 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYEILGVPK A+ +DLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKTAAPEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDI-fqsffggspfggggssrgrrqrrgE  473
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDI    F G    GGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGSPFGGGGGSSRGRRQRRGE  120

Query  474  DVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            DVVHPLKVSLEDLYNGTSKKLS SRNVLC+KCKGKG
Sbjct  121  DVVHPLKVSLEDLYNGTSKKLSLSRNVLCSKCKGKG  156



>ref|XP_009418971.1| PREDICTED: dnaJ protein homolog isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=417

 Score =   215 bits (548),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 133/156 (85%), Positives = 140/156 (90%), Gaps = 2/156 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+T+YYEILGVPK ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDI-fqsffggspfggggssrgrrqrrgE  473
            LSDPEKRE+YDQYGE+ALKE    GGG HDPFDI    F GG   GGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREVYDQYGEDALKE-GMGGGGGHDPFDIFSSFFGGGPFGGGGGSSRGRRQRRGE  119

Query  474  DVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            DV+HPLKVSLEDLYNGTSKKLS SRNV+C KCKGKG
Sbjct  120  DVIHPLKVSLEDLYNGTSKKLSLSRNVICQKCKGKG  155



>ref|XP_010053981.1| PREDICTED: dnaJ protein homolog [Eucalyptus grandis]
 gb|KCW78355.1| hypothetical protein EUGRSUZ_D02530 [Eucalyptus grandis]
Length=433

 Score =   216 bits (549),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 139/164 (85%), Gaps = 9/164 (5%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGR P+KSD+TKYYE+LGVPK+ASQD+LKKAYRK+AIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRVPRKSDNTKYYEVLGVPKNASQDELKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfgg---------ggssr  449
            LSDPEKR++YDQYGE+ALKEGMG G   HDPFDIF+SFFGG  F G           SSR
Sbjct  61   LSDPEKRDMYDQYGEDALKEGMGGGSAGHDPFDIFESFFGGDSFFGGGFGGRFGGASSSR  120

Query  450  grrqrrgEDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
             RRQ++GEDVV  LKVSLEDLYNGT KKLS SRNVLC KCKGKG
Sbjct  121  RRRQKQGEDVVQVLKVSLEDLYNGTMKKLSLSRNVLCPKCKGKG  164



>ref|XP_009588725.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
 ref|XP_009588726.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
Length=420

 Score =   215 bits (547),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 140/158 (89%), Gaps = 3/158 (2%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYEILGVPK AS +DLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKTASPEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrg--  470
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIF SFFGGSPFGGG      R RR   
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGSPFGGGMGGGSSRGRRQKR  120

Query  471  -EDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
             EDVVHPLKVSL+DLYNGTSKKLS SRNVLC KCKGKG
Sbjct  121  GEDVVHPLKVSLDDLYNGTSKKLSLSRNVLCPKCKGKG  158



>gb|AFR66645.1| MIP1.1a [Nicotiana benthamiana]
Length=420

 Score =   215 bits (547),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 140/158 (89%), Gaps = 3/158 (2%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYEILGVPK AS +DLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKTASPEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrg--  470
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIF SFFGGSPFGGG      R RR   
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGSPFGGGMGGGSSRGRRQKR  120

Query  471  -EDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
             EDVVHPLKVSL+DLYNGTSKKLS SRNVLC KCKGKG
Sbjct  121  GEDVVHPLKVSLDDLYNGTSKKLSLSRNVLCPKCKGKG  158



>ref|XP_011084248.1| PREDICTED: dnaJ protein homolog [Sesamum indicum]
 ref|XP_011084249.1| PREDICTED: dnaJ protein homolog [Sesamum indicum]
Length=418

 Score =   215 bits (547),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 146/156 (94%), Gaps = 1/156 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYEILGV K+ASQDDLKKAYRK+AIK+HPDKGGDPEKFKE+AQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKNASQDDLKKAYRKSAIKNHPDKGGDPEKFKEIAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKE-GMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgE  473
            LSDPEKREIYDQYGE+ALKE     GG  H+PFDIF+SFFGG+PFGGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGSGGGAGHNPFDIFESFFGGNPFGGGGSSRGRRQRRGE  120

Query  474  DVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            DV+HPLKVSLEDLYNGTSKKLS SRNVLC KCKGKG
Sbjct  121  DVIHPLKVSLEDLYNGTSKKLSLSRNVLCPKCKGKG  156



>gb|AAG24642.1|AF308737_1 J1P [Daucus carota]
 gb|AAG24643.1|AF308738_1 J2P [Daucus carota]
Length=418

 Score =   214 bits (546),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 141/156 (90%), Positives = 147/156 (94%), Gaps = 1/156 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYEILGVPK AS DDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKTASPDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKE-GMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgE  473
            LSDPEKREIYDQYGE+ALKE   G GGG HDPFDIFQSFFGGSPFGGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGGHDPFDIFQSFFGGSPFGGGGSSRGRRQRRGE  120

Query  474  DVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            DV+HPLKVSLEDL NGTSKKLS SRNV+C+KCKGKG
Sbjct  121  DVIHPLKVSLEDLCNGTSKKLSLSRNVICSKCKGKG  156



>ref|XP_009406563.1| PREDICTED: dnaJ protein homolog [Musa acuminata subsp. malaccensis]
Length=414

 Score =   214 bits (546),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 139/155 (90%), Gaps = 2/155 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKS++TKYYE+LGVPK ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSNNTKYYEVLGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKE    GGG HDPFDI  S F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKE-GMGGGGGHDPFDI-FSSFFGGSPFGGGSSRGRRQRRGED  118

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            V+HPLKVSLEDLYNGTSKKLS SRNV+C KCKGKG
Sbjct  119  VIHPLKVSLEDLYNGTSKKLSLSRNVICRKCKGKG  153



>ref|XP_010685460.1| PREDICTED: dnaJ protein homolog ANJ1 [Beta vulgaris subsp. vulgaris]
Length=417

 Score =   214 bits (545),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSDST+YYEILGVPKDAS +DLK+AY+KAAIK+HPDKGGDPEKFKELA AYEV
Sbjct  1    MFGRAPKKSDSTRYYEILGVPKDASPEDLKRAYKKAAIKNHPDKGGDPEKFKELAHAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG GGGMHDPFDIF SFFGGSPFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGMHDPFDIFSSFFGGSPFGGGGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            V+HPLKVSLEDL+ GTSKKLS SRNVLC+KC GKG
Sbjct  121  VIHPLKVSLEDLFMGTSKKLSLSRNVLCSKCSGKG  155



>ref|XP_007015642.1| DNAJ isoform 3 [Theobroma cacao]
 gb|EOY33261.1| DNAJ isoform 3 [Theobroma cacao]
Length=320

 Score =   211 bits (536),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 137/155 (88%), Gaps = 2/155 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+T+YYEILGV K+ASQDDLKKAY+K A K+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQDDLKKAYKKTAFKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALK+GMG+ G  HDPFDI  S F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKDGMGATGA-HDPFDI-FSSFFGGSPFGGGSSRGRRQRRGED  118

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            V+H +KVSLEDLY GTSKKLS SRN+LC+KC GKG
Sbjct  119  VIHNMKVSLEDLYLGTSKKLSLSRNILCSKCNGKG  153



>ref|XP_009408520.1| PREDICTED: dnaJ protein homolog isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=417

 Score =   213 bits (543),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPK SDST+YYEILGV K+ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKTSDSTRYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGM  GGG H+PFDIF+SFFGGSPFG GGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMRGGGGGHNPFDIFESFFGGSPFGVGGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
             +HPLKVSLEDLY+G SKKLS S+ V+C KCKGKG
Sbjct  121  AIHPLKVSLEDLYSGISKKLSLSQKVICQKCKGKG  155



>ref|XP_003558043.1| PREDICTED: dnaJ protein homolog [Brachypodium distachyon]
Length=420

 Score =   213 bits (543),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 142/156 (91%), Positives = 151/156 (97%), Gaps = 1/156 (1%)
 Frame = +3

Query  117  MFGRAP-KKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYE  293
            MFGR P KKSD+T+YYEILGVPK+ASQDDLKKAYRK+AIK+HPDKGGDPEKFKE+AQAYE
Sbjct  1    MFGRGPPKKSDNTRYYEILGVPKEASQDDLKKAYRKSAIKNHPDKGGDPEKFKEIAQAYE  60

Query  294  VLSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgE  473
            VLSDPEKREIYDQYGE+ALKEGMG GGGMHDPFDIFQSFFGGSPFGGGGSSRGRRQRRGE
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGGGGGMHDPFDIFQSFFGGSPFGGGGSSRGRRQRRGE  120

Query  474  DVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            DVVHPLKVSLE+LYNGTSKKLS SRNVLC+KC GKG
Sbjct  121  DVVHPLKVSLEELYNGTSKKLSLSRNVLCSKCNGKG  156



>ref|XP_011008852.1| PREDICTED: dnaJ protein homolog isoform X1 [Populus euphratica]
Length=415

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 139/155 (90%), Gaps = 1/155 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+T+YYEILGV K+ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGEEALKEGMG GGG H+PFDI    F G    GGG SRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEEALKEGMGGGGGGHNPFDI-FESFFGGNPFGGGGSRGRRQRRGED  119

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSLEDLY GTSKKLS +RNV+C+KC GKG
Sbjct  120  VVHPLKVSLEDLYLGTSKKLSLTRNVICSKCNGKG  154



>ref|XP_002313505.1| seed maturation protein PM37 [Populus trichocarpa]
 gb|EEE87460.1| seed maturation protein PM37 [Populus trichocarpa]
Length=415

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 138/155 (89%), Gaps = 1/155 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+T+YYEILGV K+ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGEEALKEGMG GG  H+PFDI    F G    GGG SRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEEALKEGMGGGGAGHNPFDI-FESFFGGNPFGGGGSRGRRQRRGED  119

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSLEDLY GTSKKLS +RNV+C+KC GKG
Sbjct  120  VVHPLKVSLEDLYLGTSKKLSLTRNVICSKCNGKG  154



>ref|XP_008446732.1| PREDICTED: dnaJ protein homolog [Cucumis melo]
Length=413

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 147/155 (95%), Gaps = 2/155 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGR PKKSD+TKYYEILGV K+ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGR-PKKSDNTKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  59

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKE    GGG HDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED
Sbjct  60   LSDPEKREIYDQYGEDALKE-GMGGGGGHDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED  118

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            V+HPLKVSLEDLYNGTSKKLS SRNV+C+KCKGKG
Sbjct  119  VIHPLKVSLEDLYNGTSKKLSLSRNVICSKCKGKG  153



>ref|XP_011008853.1| PREDICTED: dnaJ protein homolog isoform X2 [Populus euphratica]
Length=409

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 137/155 (88%), Gaps = 7/155 (5%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+T+YYEILGV K+ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGEEALKEGMG GGG H+PFDI            GGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEEALKEGMGGGGGGHNPFDI-------FESFFGGSSRGRRQRRGED  113

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSLEDLY GTSKKLS +RNV+C+KC GKG
Sbjct  114  VVHPLKVSLEDLYLGTSKKLSLTRNVICSKCNGKG  148



>ref|XP_004169945.1| PREDICTED: dnaJ protein homolog [Cucumis sativus]
 sp|Q04960.1|DNJH_CUCSA RecName: Full=DnaJ protein homolog; AltName: Full=DNAJ-1; Flags: 
Precursor [Cucumis sativus]
 emb|CAA47925.1| cs DnaJ-1 [Cucumis sativus]
 gb|KGN52169.1| hypothetical protein Csa_5G613470 [Cucumis sativus]
Length=413

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 147/155 (95%), Gaps = 2/155 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGR PKKSD+TKYYEILGV K+ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGR-PKKSDNTKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  59

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKE    GGG HDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED
Sbjct  60   LSDPEKREIYDQYGEDALKE-GMGGGGGHDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED  118

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            V+HPLKVSLEDLYNGTSKKLS SRNV+C+KCKGKG
Sbjct  119  VIHPLKVSLEDLYNGTSKKLSLSRNVICSKCKGKG  153



>ref|XP_002515865.1| Chaperone protein dnaJ, putative [Ricinus communis]
 gb|EEF46534.1| Chaperone protein dnaJ, putative [Ricinus communis]
Length=418

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYEILGV K+A+QDDLKKAY++AAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKNATQDDLKKAYKRAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG GG  H+PFDIF+SFFGGSPFGGG S  GRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGAGHNPFDIFESFFGGSPFGGGSSRGGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSLEDLY GT KKLS SRN++CAKC GKG
Sbjct  121  VVHPLKVSLEDLYLGTIKKLSLSRNMICAKCNGKG  155



>ref|XP_011024143.1| PREDICTED: dnaJ protein homolog [Populus euphratica]
 ref|XP_011024144.1| PREDICTED: dnaJ protein homolog [Populus euphratica]
Length=422

 Score =   213 bits (541),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 145/158 (92%), Gaps = 3/158 (2%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYEILGV K ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGM--HDPFDI-fqsffggspfggggssrgrrqrr  467
            LSDPEKREIYDQYGE+ALKEGMG  GG   HDPFDI    F GG+PFGGGGSSRGRRQRR
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGSGGGGAHDPFDIFQSFFGGGNPFGGGGSSRGRRQRR  120

Query  468  gEDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            GEDV+HPLKVSLED+YNGTSKKLS SRNV+C+KCKGKG
Sbjct  121  GEDVIHPLKVSLEDIYNGTSKKLSLSRNVICSKCKGKG  158



>ref|XP_002316479.1| DnaJ family protein [Populus trichocarpa]
 gb|ABK95315.1| unknown [Populus trichocarpa]
 gb|EEF02650.1| DnaJ family protein [Populus trichocarpa]
Length=422

 Score =   213 bits (541),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 146/158 (92%), Gaps = 3/158 (2%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYEILGV K ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGM--HDPFDI-fqsffggspfggggssrgrrqrr  467
            LSDPEKREIYDQYGE+ALKEGMG GGG   HDPFDI    F GG+PFGGGGSSRGRRQRR
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGGAHDPFDIFQSFFGGGNPFGGGGSSRGRRQRR  120

Query  468  gEDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            GEDV+HPLKVSLED+YNGTSKKLS SRNV+C+KCKGKG
Sbjct  121  GEDVIHPLKVSLEDIYNGTSKKLSLSRNVICSKCKGKG  158



>ref|XP_010907714.1| PREDICTED: dnaJ protein homolog [Elaeis guineensis]
Length=415

 Score =   213 bits (541),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 138/155 (89%), Gaps = 2/155 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+T+YYEILGV K+ASQ+DLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKE    GGG HDPFDI    F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKE-GMGGGGGHDPFDI-FQSFFGGNPFGGGSSRGRRQRRGED  118

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            V+HPLKVSLEDLYNGTSKKLS SRNV+C KCKGKG
Sbjct  119  VIHPLKVSLEDLYNGTSKKLSLSRNVICQKCKGKG  153



>emb|CDP09461.1| unnamed protein product [Coffea canephora]
Length=416

 Score =   213 bits (541),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 129/155 (83%), Gaps = 4/155 (3%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAP++S+++KYYE+LGV K ASQD+LKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPRRSNNSKYYEVLGVSKSASQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKRE+YDQYGE+ALKEGMG GGG+HDPFDI   F               R+++GED
Sbjct  61   LSDPEKRELYDQYGEDALKEGMG-GGGVHDPFDI---FESFFSPLHRRDGFRGRKKQGED  116

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVH LKVSL+DLY GTSKKLS SRN LC KCKGKG
Sbjct  117  VVHTLKVSLDDLYKGTSKKLSLSRNKLCPKCKGKG  151



>ref|XP_008787761.1| PREDICTED: dnaJ protein homolog [Phoenix dactylifera]
Length=415

 Score =   212 bits (540),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 137/155 (88%), Gaps = 2/155 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+T+YYEILGV K ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKE    GGG HDPFDI    F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKE-GMGGGGGHDPFDI-FQSFFGGNPFGGGSSRGRRQRRGED  118

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            V+HPLKVSLEDLYNGT+KKLS SRNV+C KCKGKG
Sbjct  119  VIHPLKVSLEDLYNGTAKKLSLSRNVICQKCKGKG  153



>ref|XP_009760224.1| PREDICTED: dnaJ protein homolog [Nicotiana sylvestris]
 ref|XP_009760225.1| PREDICTED: dnaJ protein homolog [Nicotiana sylvestris]
Length=420

 Score =   212 bits (540),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 139/158 (88%), Gaps = 3/158 (2%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRA KKSD+TKYYEILGVPK AS +DLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRATKKSDNTKYYEILGVPKTASPEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrg--  470
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIF SFFGGSPFGGG      R RR   
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGSPFGGGMGGGSSRGRRQKR  120

Query  471  -EDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
             EDVVHPLKVSL+DLYNGTSKKLS SRNVLC KCKGKG
Sbjct  121  GEDVVHPLKVSLDDLYNGTSKKLSLSRNVLCPKCKGKG  158



>gb|EMS59985.1| Chaperone protein dnaJ 2 [Triticum urartu]
Length=317

 Score =   209 bits (531),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 133/157 (85%), Positives = 141/157 (90%), Gaps = 2/157 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYE+LGVPK+A+QDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEVLGVPKNAAQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMH-DPFDI-fqsffggspfggggssrgrrqrrg  470
            LSDPEKREIYDQYGE+ALKEGMG GGG   DPFDI    F      GGGGSSRGRRQRRG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGGVDPFDIFSSFFGPSFGGGGGGSSRGRRQRRG  120

Query  471  EDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            EDVVHPLK SLEDLYNGTSKKLS SR+VLC+KCKGKG
Sbjct  121  EDVVHPLKASLEDLYNGTSKKLSLSRSVLCSKCKGKG  157



>ref|XP_011032891.1| PREDICTED: dnaJ protein homolog [Populus euphratica]
 ref|XP_011032892.1| PREDICTED: dnaJ protein homolog [Populus euphratica]
Length=420

 Score =   212 bits (539),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 143/157 (91%), Gaps = 2/157 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYE+LGV K ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEVLGVSKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKE-GMGSGGGMHDPFDI-fqsffggspfggggssrgrrqrrg  470
            LSDPEKREIYDQYGE+ALKE   G GGG HDPFDI    F GG+PFGGGGSSRGRRQRRG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGGHDPFDIFQSFFGGGNPFGGGGSSRGRRQRRG  120

Query  471  EDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            EDV+HPLKVS EDLYNGTSKKLS SRNV+C+KCKGKG
Sbjct  121  EDVIHPLKVSFEDLYNGTSKKLSLSRNVICSKCKGKG  157



>ref|XP_010089281.1| DnaJ-like protein [Morus notabilis]
 gb|EXB37606.1| DnaJ-like protein [Morus notabilis]
Length=419

 Score =   211 bits (538),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 137/156 (88%), Gaps = 2/156 (1%)
 Frame = +3

Query  117  MFGRAPKKS-DSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYE  293
            MFGR P++S D+TKYYE+LGV K ASQ++LKKAYRKAAIK+HPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRMPRRSSDNTKYYEVLGVSKSASQEELKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  294  VLSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgE  473
            VL+DPEKREIYDQYGE+ALKEGMG GG  H PFDI    F G  FGGG SSRGRR+++GE
Sbjct  61   VLNDPEKREIYDQYGEDALKEGMGGGGPSHSPFDI-FESFFGGGFGGGPSSRGRRKKQGE  119

Query  474  DVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            DVVH LKVSLEDLYNGT+KKLS SRN+LC KCKGKG
Sbjct  120  DVVHTLKVSLEDLYNGTTKKLSLSRNILCPKCKGKG  155



>ref|XP_004306421.1| PREDICTED: dnaJ protein homolog [Fragaria vesca subsp. vesca]
Length=410

 Score =   211 bits (538),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 133/156 (85%), Gaps = 10/156 (6%)
 Frame = +3

Query  117  MFGR-APKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYE  293
            MFGR  PKKSD++KYYEILGVPK ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGVPKKSDNSKYYEILGVPKTASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  294  VLSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgE  473
            VLSDPEKREIYDQYGE+ALKEGMG GGG HDPFDI         F        RRQRRGE
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGGGGGAHDPFDI---------FQSFFGGGSRRQRRGE  111

Query  474  DVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            DV+HPLKVSLEDLY+GTSKKLS SRN++C+KCKGKG
Sbjct  112  DVIHPLKVSLEDLYSGTSKKLSLSRNIICSKCKGKG  147



>gb|EMS60670.1| DnaJ protein-like protein [Triticum urartu]
Length=446

 Score =   212 bits (540),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 148/183 (81%), Gaps = 29/183 (16%)
 Frame = +3

Query  117  MFGRAP-KKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEK---------  266
            MFGR P KKSDST+YYEILGVPKDASQDDLKKAYRKAAIK+HPDKGGDPEK         
Sbjct  1    MFGRGPPKKSDSTRYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKVSARRISHP  60

Query  267  ----------------FKELAQAYEVLSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDI  398
                            FKELAQAYEVLSDPEKREIYDQYGE+ALKEGMG GGGMHDPFDI
Sbjct  61   STTDLFPIGITRLVDLFKELAQAYEVLSDPEKREIYDQYGEDALKEGMG-GGGMHDPFDI  119

Query  399  fq--sffggspfggggssrgrrqrrgEDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCK  572
            FQ     GG+PFGGGGSSRGRRQRRGEDVVHPLKVSLE+LYNGTSKKLS +RNVLC+KC 
Sbjct  120  FQSFFGGGGNPFGGGGSSRGRRQRRGEDVVHPLKVSLEELYNGTSKKLSLARNVLCSKCN  179

Query  573  GKG  581
            GKG
Sbjct  180  GKG  182



>ref|XP_007015641.1| DNAJ isoform 2 [Theobroma cacao]
 gb|EOY33260.1| DNAJ isoform 2 [Theobroma cacao]
Length=414

 Score =   211 bits (538),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 137/155 (88%), Gaps = 2/155 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+T+YYEILGV K+ASQDDLKKAY+K A K+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQDDLKKAYKKTAFKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALK+GMG+ G  HDPFDI  S F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKDGMGATGA-HDPFDI-FSSFFGGSPFGGGSSRGRRQRRGED  118

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            V+H +KVSLEDLY GTSKKLS SRN+LC+KC GKG
Sbjct  119  VIHNMKVSLEDLYLGTSKKLSLSRNILCSKCNGKG  153



>ref|XP_002310999.1| DnaJ family protein [Populus trichocarpa]
 gb|EEE88366.1| DnaJ family protein [Populus trichocarpa]
Length=420

 Score =   211 bits (537),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 133/157 (85%), Positives = 142/157 (90%), Gaps = 2/157 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYE+LGV K ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEVLGVSKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKE-GMGSGGGMHDPFDI-fqsffggspfggggssrgrrqrrg  470
            LSDPEKREIYDQYGE+ALKE   G G G HDPFDI    F GG+PFGGGGSSRGRRQRRG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGSGAHDPFDIFQSFFGGGNPFGGGGSSRGRRQRRG  120

Query  471  EDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            EDV+HPLKVS ED+YNGTSKKLS SRNV+C+KCKGKG
Sbjct  121  EDVIHPLKVSFEDIYNGTSKKLSLSRNVICSKCKGKG  157



>ref|XP_002446897.1| hypothetical protein SORBIDRAFT_06g024520 [Sorghum bicolor]
 gb|EES11225.1| hypothetical protein SORBIDRAFT_06g024520 [Sorghum bicolor]
Length=418

 Score =   211 bits (537),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 132/155 (85%), Gaps = 1/155 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAP++S++TKYYE+LGV   ASQD+LKKAYRKAAIK HPDKGGDPEKFKEL+QAYEV
Sbjct  1    MFGRAPRRSNNTKYYEVLGVSNTASQDELKKAYRKAAIKSHPDKGGDPEKFKELSQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ LKEGMG G   H+PFDI    F G    GG SSR RRQ+RG+D
Sbjct  61   LSDPEKREIYDQYGEDGLKEGMGGGSDYHNPFDI-FEQFFGGGAFGGSSSRVRRQKRGDD  119

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVH LKVSLED+YNG +K+LS SRNVLC+KCKGKG
Sbjct  120  VVHSLKVSLEDVYNGATKRLSLSRNVLCSKCKGKG  154



>ref|XP_007015640.1| DNAJ isoform 1 [Theobroma cacao]
 gb|EOY33259.1| DNAJ isoform 1 [Theobroma cacao]
Length=431

 Score =   211 bits (537),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 137/155 (88%), Gaps = 2/155 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+T+YYEILGV K+ASQDDLKKAY+K A K+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQDDLKKAYKKTAFKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALK+GMG+ G  HDPFDI  S F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKDGMGATGA-HDPFDI-FSSFFGGSPFGGGSSRGRRQRRGED  118

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            V+H +KVSLEDLY GTSKKLS SRN+LC+KC GKG
Sbjct  119  VIHNMKVSLEDLYLGTSKKLSLSRNILCSKCNGKG  153



>ref|XP_009408521.1| PREDICTED: dnaJ protein homolog isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=416

 Score =   211 bits (536),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 136/155 (88%), Gaps = 1/155 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPK SDST+YYEILGV K+ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKTSDSTRYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGM  GGG H+PFDI    F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMRGGGGGHNPFDI-FESFFGGSPFGGGSSRGRRQRRGED  119

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
             +HPLKVSLEDLY+G SKKLS S+ V+C KCKGKG
Sbjct  120  AIHPLKVSLEDLYSGISKKLSLSQKVICQKCKGKG  154



>ref|XP_001768102.1| predicted protein [Physcomitrella patens]
 gb|EDQ66975.1| predicted protein [Physcomitrella patens]
Length=419

 Score =   211 bits (536),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 139/157 (89%), Gaps = 2/157 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGR PKKSD+TKYYE LGV K ASQD+LKKAYRKAAIK+HPDKGGDPEKFKEL+QAYEV
Sbjct  1    MFGRMPKKSDNTKYYETLGVSKSASQDELKKAYRKAAIKNHPDKGGDPEKFKELSQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDI--fqsffggspfggggssrgrrqrrg  470
            LSDPEKRE+YDQYGE+ALKEGMG GGG H+PFDI       GGSPFGG G   GRRQRRG
Sbjct  61   LSDPEKRELYDQYGEDALKEGMGGGGGGHNPFDIFESFFGGGGSPFGGNGRGGGRRQRRG  120

Query  471  EDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            EDVVHPLKVSLEDLYNGTSKKLS SRNVLC+KCKGKG
Sbjct  121  EDVVHPLKVSLEDLYNGTSKKLSLSRNVLCSKCKGKG  157



>ref|NP_001267695.1| dnaJ protein homolog [Cucumis sativus]
 gb|ADF30255.1| heat shock protein [Cucumis sativus]
Length=413

 Score =   210 bits (534),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 138/155 (89%), Positives = 145/155 (94%), Gaps = 2/155 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGR PKKSD+TKYYEILGV K+ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAY V
Sbjct  1    MFGR-PKKSDNTKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYGV  59

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKE    GGG HDPFDIFQSFFGGSPFGGGGSSRGRRQR GED
Sbjct  60   LSDPEKREIYDQYGEDALKE-GMGGGGGHDPFDIFQSFFGGSPFGGGGSSRGRRQRGGED  118

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            V+HPLKVSLEDLYNGTSKKLS SRNV+C+KCKGKG
Sbjct  119  VIHPLKVSLEDLYNGTSKKLSLSRNVICSKCKGKG  153



>ref|XP_004953339.1| PREDICTED: dnaJ protein homolog 2-like [Setaria italica]
Length=421

 Score =   210 bits (534),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 139/158 (88%), Gaps = 3/158 (2%)
 Frame = +3

Query  117  MFGRAPKK-SDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYE  293
            MFGR P+K S++TKYYE+LGV K ASQD+LKKAYRKAAIK+HPDKGGDPEKFKEL+QAYE
Sbjct  1    MFGRMPRKTSNNTKYYEVLGVSKSASQDELKKAYRKAAIKNHPDKGGDPEKFKELSQAYE  60

Query  294  VLSDPEKREIYDQYGEEALKEGMGSGGG--MHDPFDIfqsffggspfggggssrgrrqrr  467
            VLSDPEKREIYDQYGE+ALKEGMG G     H PFDIF+  F GS   GGGSSRGRRQ+R
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGGGSSSDFHSPFDIFEQLFPGSGTFGGGSSRGRRQKR  120

Query  468  gEDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            GEDVVH +KVSLEDLYNGT+KKLS SR+VLC+KCKGKG
Sbjct  121  GEDVVHTMKVSLEDLYNGTTKKLSLSRSVLCSKCKGKG  158



>ref|XP_008803820.1| PREDICTED: dnaJ protein homolog 2-like [Phoenix dactylifera]
Length=417

 Score =   209 bits (533),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 136/156 (87%), Gaps = 2/156 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAP+KS++TKYYEILGV K+ASQD+LKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPRKSNNTKYYEILGVSKNASQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKE-GMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgE  473
            LSDPEKREIYDQYGE+ALKE   G GG  H+PFDI    F G    GG SSRG RQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGASHNPFDI-FEQFFGGGAFGGSSSRGHRQRRGE  119

Query  474  DVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            DVVH LKVSLEDLYNGTSKKLS SRNVLCAKCKGKG
Sbjct  120  DVVHTLKVSLEDLYNGTSKKLSLSRNVLCAKCKGKG  155



>ref|XP_010031575.1| PREDICTED: dnaJ protein homolog [Eucalyptus grandis]
 gb|KCW50935.1| hypothetical protein EUGRSUZ_J00583 [Eucalyptus grandis]
Length=416

 Score =   209 bits (533),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 139/155 (90%), Gaps = 1/155 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+T+YYE+LGV K+ASQ+DLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEVLGVSKNASQEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDI  S F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDI-FSSFFGGSGFGGGSSRGRRQRRGED  119

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLK SLEDLY GT+KKLS SRNV+C KC GKG
Sbjct  120  VVHPLKASLEDLYLGTTKKLSLSRNVICVKCNGKG  154



>ref|XP_003521084.1| PREDICTED: dnaJ protein homolog 2-like [Glycine max]
 gb|KHN43746.1| Chaperone protein dnaJ 2 [Glycine soja]
Length=420

 Score =   209 bits (532),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 144/156 (92%), Gaps = 1/156 (1%)
 Frame = +3

Query  117  MFGRA-PKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYE  293
            MFGR  P++SD++KYY+ILG+ K+AS+D++KKAYRKAA+K+HPDKGGDPEKFKEL QAYE
Sbjct  1    MFGRGGPRRSDNSKYYDILGISKNASEDEIKKAYRKAAMKNHPDKGGDPEKFKELGQAYE  60

Query  294  VLSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgE  473
            VLSDPEK+E+YDQYGE+ALKEGMG GG  H+PFDIF+SFFGG+ FGGGGSSRGRRQ+ GE
Sbjct  61   VLSDPEKKELYDQYGEDALKEGMGGGGSFHNPFDIFESFFGGASFGGGGSSRGRRQKHGE  120

Query  474  DVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            DVVH LKVSLED+YNGT+KKLS SRN+LC KCKGKG
Sbjct  121  DVVHSLKVSLEDVYNGTTKKLSLSRNILCPKCKGKG  156



>gb|ACU24346.1| unknown [Glycine max]
Length=420

 Score =   209 bits (532),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 144/156 (92%), Gaps = 1/156 (1%)
 Frame = +3

Query  117  MFGRA-PKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYE  293
            MFGR  P++SD++KYY+ILG+ K+AS+D++KKAYRKAA+K+HPDKGGDPEKFKEL QAYE
Sbjct  1    MFGRGGPRRSDNSKYYDILGISKNASEDEIKKAYRKAAMKNHPDKGGDPEKFKELGQAYE  60

Query  294  VLSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgE  473
            VLSDPEK+E+YDQYGE+ALKEGMG GG  H+PFDIF+SFFGG+ FGGGGSSRGRRQ+ GE
Sbjct  61   VLSDPEKKELYDQYGEDALKEGMGGGGSFHNPFDIFESFFGGASFGGGGSSRGRRQKHGE  120

Query  474  DVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            DVVH LKVSLED+YNGT+KKLS SRN+LC KCKGKG
Sbjct  121  DVVHSLKVSLEDVYNGTTKKLSLSRNILCPKCKGKG  156



>ref|XP_009622737.1| PREDICTED: dnaJ protein homolog 2-like [Nicotiana tomentosiformis]
 ref|XP_009622738.1| PREDICTED: dnaJ protein homolog 2-like [Nicotiana tomentosiformis]
Length=421

 Score =   209 bits (532),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 137/157 (87%), Gaps = 2/157 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAP++SD++KYYE+LGV K ASQD+LKKAYRKAAI++HPDKGGDPEKFK LAQAY+V
Sbjct  1    MFGRAPRRSDNSKYYEVLGVSKSASQDELKKAYRKAAIRNHPDKGGDPEKFKGLAQAYDV  60

Query  297  LSDPEKREIYDQYGEEALKEGMG-SGGGMHDPFDIfqsffggspfggggssrgrrqrrg-  470
            LSDPEKR+IYDQYGE+ALKEGMG SGGG+H  FDIF+SFFGG  FGGG S     +++  
Sbjct  61   LSDPEKRDIYDQYGEDALKEGMGSSGGGVHSHFDIFESFFGGGSFGGGSSRFRASRQKQG  120

Query  471  EDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            EDVVH L+VSLEDLYNGT+KKLS SRN LC+KC GKG
Sbjct  121  EDVVHTLRVSLEDLYNGTTKKLSLSRNRLCSKCNGKG  157



>gb|EMT20603.1| DnaJ protein-like protein [Aegilops tauschii]
Length=421

 Score =   209 bits (532),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 133/157 (85%), Positives = 141/157 (90%), Gaps = 2/157 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYE+LGVPK+A+QDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEVLGVPKNAAQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMH-DPFDI-fqsffggspfggggssrgrrqrrg  470
            LSDPEKREIYDQYGE+ALKEGMG GGG   DPFDI    F      GGGGSSRGRRQRRG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGGVDPFDIFSSFFGPSFGGGGGGSSRGRRQRRG  120

Query  471  EDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            EDVVHPLK SLEDLYNGTSKKLS SR+VLC+KCKGKG
Sbjct  121  EDVVHPLKASLEDLYNGTSKKLSLSRSVLCSKCKGKG  157



>ref|XP_003529049.1| PREDICTED: dnaJ protein homolog 2-like [Glycine max]
 gb|KHN34491.1| Chaperone protein dnaJ 2 [Glycine soja]
Length=420

 Score =   209 bits (531),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 144/156 (92%), Gaps = 1/156 (1%)
 Frame = +3

Query  117  MFGRA-PKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYE  293
            MFGR  P++SD++KYY+ILGV K+AS+D++KKAYRKAA+K+HPDKGGDPEKFKEL QAYE
Sbjct  1    MFGRGGPRRSDNSKYYDILGVSKNASEDEIKKAYRKAAMKNHPDKGGDPEKFKELGQAYE  60

Query  294  VLSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgE  473
            VLSDPEK+++YDQYGE+ALKEGMG GG  H+PFDIF+SFFGG+ FGGGGSSRGRRQ+ GE
Sbjct  61   VLSDPEKKDLYDQYGEDALKEGMGGGGSFHNPFDIFESFFGGASFGGGGSSRGRRQKHGE  120

Query  474  DVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            DVVH LKVSLED+YNGT+KKLS SRNV C+KCKGKG
Sbjct  121  DVVHSLKVSLEDVYNGTTKKLSLSRNVFCSKCKGKG  156



>ref|NP_001047626.1| Os02g0656500 [Oryza sativa Japonica Group]
 emb|CAC39071.1| DnaJ-like protein [Oryza sativa]
 dbj|BAF09540.1| Os02g0656500 [Oryza sativa Japonica Group]
Length=420

 Score =   208 bits (530),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 129/157 (82%), Gaps = 5/157 (3%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            M+GR PKKS++TKYYE+LGV K A+QD+LKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MYGRMPKKSNNTKYYEVLGVSKTATQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGG--MHDPFDIfqsffggspfggggssrgrrqrrg  470
            L+DPEKREIYDQYGE+ALKEGMG G     H PFD+   F       GG   RG RQ+RG
Sbjct  61   LNDPEKREIYDQYGEDALKEGMGGGSSSDFHSPFDL---FEQIFQNRGGFGGRGHRQKRG  117

Query  471  EDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            EDVVH +KVSLEDLYNGT+KKLS SRN LC KCKGKG
Sbjct  118  EDVVHTMKVSLEDLYNGTTKKLSLSRNALCTKCKGKG  154



>gb|EEC73725.1| hypothetical protein OsI_08334 [Oryza sativa Indica Group]
Length=420

 Score =   208 bits (530),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 129/157 (82%), Gaps = 5/157 (3%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            M+GR PKKS++TKYYE+LGV K A+QD+LKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MYGRMPKKSNNTKYYEVLGVSKTATQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGG--MHDPFDIfqsffggspfggggssrgrrqrrg  470
            L+DPEKREIYDQYGE+ALKEGMG G     H PFD+   F       GG   RG RQ+RG
Sbjct  61   LNDPEKREIYDQYGEDALKEGMGGGSSSDFHSPFDL---FEQIFQNRGGFGGRGHRQKRG  117

Query  471  EDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            EDVVH +KVSLEDLYNGT+KKLS SRN LC KCKGKG
Sbjct  118  EDVVHTMKVSLEDLYNGTTKKLSLSRNALCTKCKGKG  154



>ref|XP_006378828.1| hypothetical protein POPTR_0010s24930g [Populus trichocarpa]
 gb|ERP56625.1| hypothetical protein POPTR_0010s24930g [Populus trichocarpa]
Length=459

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 144/156 (92%), Gaps = 3/156 (2%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYEILGV K ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGM--HDPFDI-fqsffggspfggggssrgrrqrr  467
            LSDPEKREIYDQYGE+ALKEGMG GGG   HDPFDI    F GG+PFGGGGSSRGRRQRR
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGGAHDPFDIFQSFFGGGNPFGGGGSSRGRRQRR  120

Query  468  gEDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKG  575
            GEDV+HPLKVSLED+YNGTSKKLS SRNV+C+KCKG
Sbjct  121  GEDVIHPLKVSLEDIYNGTSKKLSLSRNVICSKCKG  156



>ref|XP_006386554.1| hypothetical protein POPTR_0002s14200g [Populus trichocarpa]
 gb|ERP64351.1| hypothetical protein POPTR_0002s14200g [Populus trichocarpa]
Length=424

 Score =   208 bits (530),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 147/157 (94%), Gaps = 2/157 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAP++SD+TKYYE+LGV K ASQD+LKKAYRKAAIK+HPDKGGDPEKFKEL+QAYEV
Sbjct  1    MFGRAPRRSDNTKYYEVLGVSKGASQDELKKAYRKAAIKNHPDKGGDPEKFKELSQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKE--GMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrg  470
            LSDP+KR+IYDQYGE+ALKE  G G GGG H+P+DIF+SFFGG  FGGGGSSRGRRQ++G
Sbjct  61   LSDPDKRDIYDQYGEDALKEGMGPGGGGGGHNPYDIFESFFGGGGFGGGGSSRGRRQKQG  120

Query  471  EDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            EDVVHPLKVSLEDLYNGTSKKLS SRN+LCAKCKGKG
Sbjct  121  EDVVHPLKVSLEDLYNGTSKKLSLSRNILCAKCKGKG  157



>gb|KJB35427.1| hypothetical protein B456_006G117100 [Gossypium raimondii]
Length=248

 Score =   203 bits (516),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 138/155 (89%), Gaps = 1/155 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKS +T+YYEILGV  +ASQDDLKKAY+KAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSTNTRYYEILGVSNNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG G G HDPFDI  S F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGAGAHDPFDI-FSSFFGGSPFGGGSSRGRRQRRGED  119

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSLEDLY GTSKKLS SRNV+C+KC GKG
Sbjct  120  VVHPLKVSLEDLYLGTSKKLSLSRNVICSKCNGKG  154



>ref|XP_002301248.1| DnaJ family protein [Populus trichocarpa]
 gb|EEE80521.1| DnaJ family protein [Populus trichocarpa]
Length=425

 Score =   208 bits (530),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 147/157 (94%), Gaps = 2/157 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAP++SD+TKYYE+LGV K ASQD+LKKAYRKAAIK+HPDKGGDPEKFKEL+QAYEV
Sbjct  1    MFGRAPRRSDNTKYYEVLGVSKGASQDELKKAYRKAAIKNHPDKGGDPEKFKELSQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKE--GMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrg  470
            LSDP+KR+IYDQYGE+ALKE  G G GGG H+P+DIF+SFFGG  FGGGGSSRGRRQ++G
Sbjct  61   LSDPDKRDIYDQYGEDALKEGMGPGGGGGGHNPYDIFESFFGGGGFGGGGSSRGRRQKQG  120

Query  471  EDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            EDVVHPLKVSLEDLYNGTSKKLS SRN+LCAKCKGKG
Sbjct  121  EDVVHPLKVSLEDLYNGTSKKLSLSRNILCAKCKGKG  157



>gb|AGY48887.1| MIP1.4b [Nicotiana benthamiana]
Length=418

 Score =   207 bits (528),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGR PKKSD+T+YYEILGVPK+AS+D++KKAYRKAA+K+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRGPKKSDNTRYYEILGVPKNASEDEIKKAYRKAAMKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSD +KREIYDQYGE+ALKEGMG GGGMHDPFDIF+SFFGG+PFGGGGSSRGRRQRRGED
Sbjct  61   LSDSQKREIYDQYGEDALKEGMGGGGGMHDPFDIFESFFGGNPFGGGGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSLEDLY+G +KKLS SRNV+C+KC GKG
Sbjct  121  VVHPLKVSLEDLYSGITKKLSLSRNVICSKCSGKG  155



>ref|XP_001755408.1| predicted protein [Physcomitrella patens]
 gb|EDQ79888.1| predicted protein [Physcomitrella patens]
Length=419

 Score =   207 bits (527),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 143/158 (91%), Gaps = 3/158 (2%)
 Frame = +3

Query  117  MFGRAP-KKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYE  293
            MFGRAP KKSD++KYY++LGVPK ASQD+LKKAYRKAAIK+HPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRAPSKKSDNSKYYDVLGVPKSASQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  294  VLSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsff--ggspfggggssrgrrqrr  467
            VLSDPEKREIYDQYGE+ALKEGMG GGG H+PFDIF+SFF    +PFGG     GRRQRR
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGGGGGGHNPFDIFESFFGGASNPFGGSSGRGGRRQRR  120

Query  468  gEDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            GEDVVHPLKVSL+DLYNGTSKKLS SRNV+C KCKGKG
Sbjct  121  GEDVVHPLKVSLDDLYNGTSKKLSLSRNVICQKCKGKG  158



>gb|EEE57509.1| hypothetical protein OsJ_07792 [Oryza sativa Japonica Group]
Length=452

 Score =   208 bits (529),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 129/157 (82%), Gaps = 5/157 (3%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            M+GR PKKS++TKYYE+LGV K A+QD+LKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  33   MYGRMPKKSNNTKYYEVLGVSKTATQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  92

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGG--MHDPFDIfqsffggspfggggssrgrrqrrg  470
            L+DPEKREIYDQYGE+ALKEGMG G     H PFD+   F       GG   RG RQ+RG
Sbjct  93   LNDPEKREIYDQYGEDALKEGMGGGSSSDFHSPFDL---FEQIFQNRGGFGGRGHRQKRG  149

Query  471  EDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            EDVVH +KVSLEDLYNGT+KKLS SRN LC KCKGKG
Sbjct  150  EDVVHTMKVSLEDLYNGTTKKLSLSRNALCTKCKGKG  186



>ref|XP_006826444.1| hypothetical protein AMTR_s00004p00172570 [Amborella trichopoda]
 gb|ERM93681.1| hypothetical protein AMTR_s00004p00172570 [Amborella trichopoda]
Length=419

 Score =   207 bits (526),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 129/156 (83%), Positives = 140/156 (90%), Gaps = 2/156 (1%)
 Frame = +3

Query  117  MFGRA-PKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYE  293
            MFGRA PKKSD+T+YYEILGV K+ASQ+DLK+AYRKAAIK+HPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRAAPKKSDNTRYYEILGVSKNASQEDLKRAYRKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  294  VLSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgE  473
            VLSD EKREIYDQYGE+ALKEGMG G G HDPFDI    F G    GGGSSRGRRQRRGE
Sbjct  61   VLSDREKREIYDQYGEDALKEGMGGGAGGHDPFDI-FQSFFGGNPFGGGSSRGRRQRRGE  119

Query  474  DVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            DVVHPLKVSLE+LYNGTSKKLS SRN++C+KCKGKG
Sbjct  120  DVVHPLKVSLEELYNGTSKKLSLSRNIICSKCKGKG  155



>ref|XP_010919645.1| PREDICTED: dnaJ protein homolog [Elaeis guineensis]
 ref|XP_010919646.1| PREDICTED: dnaJ protein homolog [Elaeis guineensis]
Length=417

 Score =   206 bits (524),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 126/156 (81%), Positives = 135/156 (87%), Gaps = 2/156 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRA ++S++TKYYEILGV K+ASQD+LKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAQRRSNNTKYYEILGVSKNASQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKE-GMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgE  473
            LSDPEKREIYDQYGE+ALKE   G GG  H+PFDI    F G    GG SSRG RQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGASHNPFDI-FEQFFGGGAFGGSSSRGHRQRRGE  119

Query  474  DVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            DVVH LKVSLEDLYNGTSKKLS SRNVLCAKCKGKG
Sbjct  120  DVVHTLKVSLEDLYNGTSKKLSLSRNVLCAKCKGKG  155



>ref|XP_001782829.1| predicted protein [Physcomitrella patens]
 gb|EDQ52343.1| predicted protein [Physcomitrella patens]
Length=415

 Score =   206 bits (523),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 133/155 (86%), Gaps = 2/155 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGR PKKSD+TKYY++LGV K ASQD+LK+AYRKAAIK+HPDKGGDPEKFKEL+QAYEV
Sbjct  1    MFGRMPKKSDNTKYYDVLGVSKSASQDELKRAYRKAAIKNHPDKGGDPEKFKELSQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKR++YDQYGE+ALKEGMG GGG H+PFDI          G G     RRQRRGED
Sbjct  61   LSDPEKRDLYDQYGEDALKEGMGGGGGGHNPFDI--FESFFGGGGSGSGRGSRRQRRGED  118

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSLE+LYNGTSKKLS SRN++C+KCKGKG
Sbjct  119  VVHPLKVSLEELYNGTSKKLSLSRNIICSKCKGKG  153



>gb|KJB35428.1| hypothetical protein B456_006G117100 [Gossypium raimondii]
Length=318

 Score =   202 bits (515),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 138/155 (89%), Gaps = 1/155 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKS +T+YYEILGV  +ASQDDLKKAY+KAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSTNTRYYEILGVSNNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG G G HDPFDI  S F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGAGAHDPFDI-FSSFFGGSPFGGGSSRGRRQRRGED  119

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSLEDLY GTSKKLS SRNV+C+KC GKG
Sbjct  120  VVHPLKVSLEDLYLGTSKKLSLSRNVICSKCNGKG  154



>gb|KHG01500.1| Chaperone dnaJ 3 -like protein [Gossypium arboreum]
 gb|KHG06497.1| Chaperone dnaJ 3 -like protein [Gossypium arboreum]
Length=318

 Score =   202 bits (515),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYEILGV K+ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMGSGGG HDPFDIFQSFFGG+PFG  GSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGSGGGGHDPFDIFQSFFGGNPFGASGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRN  551
            V+HPLKVSLEDLYNGTSKKLS SRN
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLSRN  145



>gb|KHG17902.1| Chaperone dnaJ 3 -like protein [Gossypium arboreum]
Length=417

 Score =   205 bits (522),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 140/155 (90%), Gaps = 1/155 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKS++T+YYEILGV K+ASQDDLKKAY+KAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSNNTRYYEILGVSKNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG G G HDPFDI  S F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGAGAHDPFDI-FSSFFGGSPFGGGSSRGRRQRRGED  119

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSLEDLY GTSKKLS SRNV+C+KC GKG
Sbjct  120  VVHPLKVSLEDLYLGTSKKLSLSRNVICSKCNGKG  154



>ref|NP_001136581.1| putative dnaJ chaperone family protein [Zea mays]
 gb|ACF82216.1| unknown [Zea mays]
 gb|AFW72634.1| putative dnaJ chaperone family protein [Zea mays]
Length=422

 Score =   205 bits (522),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 138/158 (87%), Gaps = 3/158 (2%)
 Frame = +3

Query  117  MFGRAPKKS-DSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYE  293
            MFGR P+KS ++TKYYE+LGV K ASQD+LKKAYRKAAIK+HPDKGGDPEKFKEL+QAY+
Sbjct  1    MFGRMPRKSSNNTKYYEVLGVSKTASQDELKKAYRKAAIKNHPDKGGDPEKFKELSQAYD  60

Query  294  VLSDPEKREIYDQYGEEALKEGMGSGGG--MHDPFDIfqsffggspfggggssrgrrqrr  467
            VLSDPEKREIYDQYGE+ALKEGMG G     H PFDIF+  F GS   GGGSSRGRRQ+R
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGGGSSSDFHSPFDIFEQLFPGSSTFGGGSSRGRRQKR  120

Query  468  gEDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            GEDVVH +KVSL+DLYNGT+KKLS SR+ LC+KCKGKG
Sbjct  121  GEDVVHTMKVSLDDLYNGTTKKLSLSRSALCSKCKGKG  158



>ref|XP_006647626.1| PREDICTED: dnaJ protein homolog 2-like isoform X1 [Oryza brachyantha]
Length=423

 Score =   205 bits (521),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 128/157 (82%), Gaps = 4/157 (3%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGR PKKS++TKYYE+LGV K A+QD+LKKAYRKAAIK+HPDKGGDPEKFKE++QAYEV
Sbjct  1    MFGRMPKKSNNTKYYEVLGVSKTATQDELKKAYRKAAIKNHPDKGGDPEKFKEISQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGG--MHDPFDIfqsffggspfggggssrgrrqrrg  470
            L+DPEKR+IYDQYGE+ALKEGMG G     H PFD+           G G  RG RQ+RG
Sbjct  61   LNDPEKRDIYDQYGEDALKEGMGGGSSSDFHSPFDL--FEQLFQGRSGFGVGRGHRQKRG  118

Query  471  EDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            EDVVH +KVSLEDLYNGT+KKLS SRN LC KCKGKG
Sbjct  119  EDVVHTMKVSLEDLYNGTTKKLSLSRNALCTKCKGKG  155



>ref|XP_006647627.1| PREDICTED: dnaJ protein homolog 2-like isoform X2 [Oryza brachyantha]
Length=422

 Score =   205 bits (521),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 128/157 (82%), Gaps = 5/157 (3%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGR PKKS++TKYYE+LGV K A+QD+LKKAYRKAAIK+HPDKGGDPEKFKE++QAYEV
Sbjct  1    MFGRMPKKSNNTKYYEVLGVSKTATQDELKKAYRKAAIKNHPDKGGDPEKFKEISQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGG--MHDPFDIfqsffggspfggggssrgrrqrrg  470
            L+DPEKR+IYDQYGE+ALKEGMG G     H PFD+   F        G   RG RQ+RG
Sbjct  61   LNDPEKRDIYDQYGEDALKEGMGGGSSSDFHSPFDL---FEQLFQGRSGFGGRGHRQKRG  117

Query  471  EDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            EDVVH +KVSLEDLYNGT+KKLS SRN LC KCKGKG
Sbjct  118  EDVVHTMKVSLEDLYNGTTKKLSLSRNALCTKCKGKG  154



>emb|CAC12824.1| putative DNAJ protein [Nicotiana tabacum]
Length=418

 Score =   204 bits (520),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGR PKKSD+T+YYEILGV K+AS D++KKAYRKAA+K+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRGPKKSDNTRYYEILGVSKNASDDEIKKAYRKAAMKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSD +KREIYDQYGE+ALKEGMG GGGMHDPFDIF+SFFGG+PFGGGGSSRGRRQRRGED
Sbjct  61   LSDSQKREIYDQYGEDALKEGMGGGGGMHDPFDIFESFFGGNPFGGGGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSLEDLY+G +KKLS SRNV+C+KC GKG
Sbjct  121  VVHPLKVSLEDLYSGITKKLSLSRNVICSKCSGKG  155



>emb|CAH67501.1| OSIGBa0134H18.3 [Oryza sativa Indica Group]
 gb|EAY95074.1| hypothetical protein OsI_16890 [Oryza sativa Indica Group]
Length=416

 Score =   204 bits (519),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 133/155 (86%), Gaps = 2/155 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGR P+ S++TKYYE+LGVPK AS+D+LKKAYRKAAIK+HPDKGGDPEKFKEL+QAYEV
Sbjct  1    MFGRVPR-SNNTKYYEVLGVPKTASKDELKKAYRKAAIKNHPDKGGDPEKFKELSQAYEV  59

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            L+DPEKR+IYDQYGE+ALK+GMG G   H+PFDI    F G    GG SSR RRQRRGED
Sbjct  60   LTDPEKRDIYDQYGEDALKDGMGGGSDFHNPFDI-FEQFFGGGAFGGSSSRVRRQRRGED  118

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVH LKVSLED+YNG+ KKLS SRN+LC KCKGKG
Sbjct  119  VVHTLKVSLEDVYNGSMKKLSLSRNILCPKCKGKG  153



>ref|XP_001774283.1| predicted protein [Physcomitrella patens]
 gb|EDQ60919.1| predicted protein [Physcomitrella patens]
Length=417

 Score =   204 bits (518),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 138/156 (88%), Gaps = 2/156 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGR PKKSD+TKYYE LGV K ASQD+LK+AYRKAAIK+HPDKGGDPEKFKE++QAYEV
Sbjct  1    MFGRMPKKSDNTKYYEALGVSKSASQDELKRAYRKAAIKNHPDKGGDPEKFKEISQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspf-ggggssrgrrqrrgE  473
            LSDPEKRE+YDQYGE+ALKE    GGG H+PFDIF+SFFGG  F GG G    RRQRRGE
Sbjct  61   LSDPEKRELYDQYGEDALKE-GMGGGGGHNPFDIFESFFGGDSFPGGSGRGGSRRQRRGE  119

Query  474  DVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            DVVHPLKVSLEDLYNGTSKKLS SRNVLC+KCKGKG
Sbjct  120  DVVHPLKVSLEDLYNGTSKKLSLSRNVLCSKCKGKG  155



>ref|XP_002454540.1| hypothetical protein SORBIDRAFT_04g032970 [Sorghum bicolor]
 gb|EES07516.1| hypothetical protein SORBIDRAFT_04g032970 [Sorghum bicolor]
Length=420

 Score =   204 bits (518),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 133/158 (84%), Gaps = 4/158 (3%)
 Frame = +3

Query  117  MFGRAPKKS-DSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYE  293
            MFGR P+KS ++TKYYE+LGV K ASQD+LKKAYRKAAIK+HPDKGGDPEKFKEL+QAY+
Sbjct  1    MFGRMPRKSSNNTKYYEVLGVSKTASQDELKKAYRKAAIKNHPDKGGDPEKFKELSQAYD  60

Query  294  VLSDPEKREIYDQYGEEALKEGMGSGGG--MHDPFDIfqsffggspfggggssrgrrqrr  467
            VLSDPEKREIYDQYGE+ALKEGMG GG    H PFDI          G GG SRGRRQ+R
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGGGGSSDFHSPFDI-FEQLFPGSSGFGGGSRGRRQKR  119

Query  468  gEDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            GEDVVH +KVSLEDLYNGT+KKLS SR+ LC+KCKGKG
Sbjct  120  GEDVVHTMKVSLEDLYNGTTKKLSLSRSALCSKCKGKG  157



>ref|XP_009789005.1| PREDICTED: dnaJ protein homolog [Nicotiana sylvestris]
Length=418

 Score =   203 bits (517),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGR PKKSD+T+YYEILGV K+AS D++KKAYRKAA+K+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRGPKKSDNTRYYEILGVSKNASDDEIKKAYRKAAMKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSD +KREIYDQYGE+ALKEGMG GGGMHDPFDIF+SFFGG+PFGGGGSSRGRRQRRGED
Sbjct  61   LSDSQKREIYDQYGEDALKEGMGGGGGMHDPFDIFESFFGGNPFGGGGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSLEDLY+G +KKLS SRNV+C+KC GKG
Sbjct  121  VVHPLKVSLEDLYSGITKKLSLSRNVICSKCSGKG  155



>gb|KJB41003.1| hypothetical protein B456_007G087000 [Gossypium raimondii]
 gb|KJB41005.1| hypothetical protein B456_007G087000 [Gossypium raimondii]
Length=423

 Score =   203 bits (517),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGR PKKSD+TK+YE+LGVPK ASQD+LKKAY+KAAIK+HPDKGGDPEKFKELA AYEV
Sbjct  1    MFGRVPKKSDNTKFYEVLGVPKSASQDELKKAYKKAAIKNHPDKGGDPEKFKELAHAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG GG  H+PFDIF+SFFGG  FGGGGSSRGRRQ+RGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGSSHNPFDIFESFFGGGAFGGGGSSRGRRQKRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVH LKVSLE+LYNGT+KKLS SRN +C+KCKGKG
Sbjct  121  VVHALKVSLEELYNGTTKKLSLSRNAICSKCKGKG  155



>gb|ACJ84518.1| unknown [Medicago truncatula]
Length=423

 Score =   203 bits (517),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 137/158 (87%), Gaps = 4/158 (3%)
 Frame = +3

Query  117  MFGRAP-KKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYE  293
            MFGR P +KSD+TKYY+ILGV K AS+D++KKAYRKAA+K+HPDKGGDPEKFKEL QAYE
Sbjct  1    MFGRGPTRKSDNTKYYDILGVSKSASEDEIKKAYRKAAMKNHPDKGGDPEKFKELGQAYE  60

Query  294  VLSDPEKREIYDQYGEEALKEGMGSGGG--MHDPFDIfqsffggspfggggssrgrrqrr  467
            VLSDPEK+E+YDQYGE+ALKEGMG G G   H+PFDI    F G+ FGGGG SR RRQ++
Sbjct  61   VLSDPEKKELYDQYGEDALKEGMGGGAGSSFHNPFDI-FESFFGAGFGGGGPSRARRQKQ  119

Query  468  gEDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            GEDVVH +KVSLED+YNGT+KKLS SRN LC+KCKGKG
Sbjct  120  GEDVVHSIKVSLEDVYNGTTKKLSLSRNALCSKCKGKG  157



>ref|XP_003626730.1| DnaJ protein-like protein [Medicago truncatula]
 gb|AET01206.1| DnaJ-class molecular chaperone [Medicago truncatula]
Length=423

 Score =   203 bits (517),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 137/158 (87%), Gaps = 4/158 (3%)
 Frame = +3

Query  117  MFGRAP-KKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYE  293
            MFGR P +KSD+TKYY+ILGV K AS+D++KKAYRKAA+K+HPDKGGDPEKFKEL QAYE
Sbjct  1    MFGRGPTRKSDNTKYYDILGVSKSASEDEIKKAYRKAAMKNHPDKGGDPEKFKELGQAYE  60

Query  294  VLSDPEKREIYDQYGEEALKEGMGSGGG--MHDPFDIfqsffggspfggggssrgrrqrr  467
            VLSDPEK+E+YDQYGE+ALKEGMG G G   H+PFDI    F G+ FGGGG SR RRQ++
Sbjct  61   VLSDPEKKELYDQYGEDALKEGMGGGAGSSFHNPFDI-FESFFGAGFGGGGPSRARRQKQ  119

Query  468  gEDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            GEDVVH +KVSLED+YNGT+KKLS SRN LC+KCKGKG
Sbjct  120  GEDVVHSIKVSLEDVYNGTTKKLSLSRNALCSKCKGKG  157



>gb|KJB35426.1| hypothetical protein B456_006G117100 [Gossypium raimondii]
Length=417

 Score =   203 bits (516),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 138/155 (89%), Gaps = 1/155 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKS +T+YYEILGV  +ASQDDLKKAY+KAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSTNTRYYEILGVSNNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG G G HDPFDI  S F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGAGAHDPFDI-FSSFFGGSPFGGGSSRGRRQRRGED  119

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSLEDLY GTSKKLS SRNV+C+KC GKG
Sbjct  120  VVHPLKVSLEDLYLGTSKKLSLSRNVICSKCNGKG  154



>emb|CAA04447.1| DnaJ-like protein [Medicago sativa]
 gb|AAC19391.1| DnaJ-like protein MsJ1 [Medicago sativa]
Length=423

 Score =   203 bits (517),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 137/158 (87%), Gaps = 4/158 (3%)
 Frame = +3

Query  117  MFGRAP-KKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYE  293
            MFGR P +KSD+TKYY+ILGV K AS+D++KKAYRKAA+K+HPDKGGDPEKFKEL QAYE
Sbjct  1    MFGRGPTRKSDNTKYYDILGVSKSASEDEIKKAYRKAAMKNHPDKGGDPEKFKELGQAYE  60

Query  294  VLSDPEKREIYDQYGEEALKEGMGSGGG--MHDPFDIfqsffggspfggggssrgrrqrr  467
            VLSDPEK+E+YDQYGE+ALKEGMG G G   H+PFDI    F G+ FGGGG SR RRQ++
Sbjct  61   VLSDPEKKELYDQYGEDALKEGMGGGAGSSFHNPFDI-FESFFGAGFGGGGPSRARRQKQ  119

Query  468  gEDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            GEDVVH +KVSLED+YNGT+KKLS SRN LC+KCKGKG
Sbjct  120  GEDVVHSIKVSLEDVYNGTTKKLSLSRNALCSKCKGKG  157



>ref|NP_001053485.1| Os04g0549600 [Oryza sativa Japonica Group]
 dbj|BAF15399.1| Os04g0549600 [Oryza sativa Japonica Group]
 dbj|BAG95310.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE61449.1| hypothetical protein OsJ_15688 [Oryza sativa Japonica Group]
Length=416

 Score =   202 bits (515),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 132/155 (85%), Gaps = 2/155 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGR P+ S++TKYYE+LGVPK AS+D+LKKAYRKAAIK+HPDKGGDPEKFKEL+QAYEV
Sbjct  1    MFGRVPR-SNNTKYYEVLGVPKTASKDELKKAYRKAAIKNHPDKGGDPEKFKELSQAYEV  59

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            L+DPEKR+IYDQYGE+ALK+GMG G   H+PFDI    F G    GG SSR RRQRRGED
Sbjct  60   LTDPEKRDIYDQYGEDALKDGMGGGSDFHNPFDI-FEQFFGGGAFGGSSSRVRRQRRGED  118

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            V H LKVSLED+YNG+ KKLS SRN+LC KCKGKG
Sbjct  119  VAHTLKVSLEDVYNGSMKKLSLSRNILCPKCKGKG  153



>gb|ABY52936.1| DnaJ family heat shock protein [Oryza sativa Japonica Group]
Length=416

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 132/155 (85%), Gaps = 2/155 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGR P+ S++TKYYE+LGVPK AS+D+LKKAYRKAAIK+HPDKGGDPEKFKEL+QAYEV
Sbjct  1    MFGRVPR-SNNTKYYEVLGVPKTASKDELKKAYRKAAIKNHPDKGGDPEKFKELSQAYEV  59

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            L+DPEKR+IYDQYGE+ALK+GMG G   H+PFDI    F G    GG SSR RRQRRGED
Sbjct  60   LTDPEKRDIYDQYGEDALKDGMGGGSDFHNPFDI-FEQFFGGGAFGGSSSRVRRQRRGED  118

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            V H LKVSLED+YNG+ KKLS SRN+LC KCKGKG
Sbjct  119  VAHTLKVSLEDVYNGSMKKLSLSRNILCPKCKGKG  153



>sp|P42824.1|DNJH2_ALLPO RecName: Full=DnaJ protein homolog 2; Flags: Precursor [Allium 
ampeloprasum]
 emb|CAA54720.1| LDJ2 [Allium ampeloprasum]
Length=418

 Score =   202 bits (514),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYE+LGV K+A+ +DLKKAYRKAAIK+HPDKGGDPEKFKE+ QAYEV
Sbjct  1    MFGRAPKKSDNTKYYEVLGVSKNATPEDLKKAYRKAAIKNHPDKGGDPEKFKEIGQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            L+DPEKREIYDQYGEE LKEGMG GGG+HDPFDIFQSFFGG  FGGGGSSRGRRQRRGED
Sbjct  61   LNDPEKREIYDQYGEEGLKEGMGGGGGVHDPFDIFQSFFGGGGFGGGGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSLEDLYNGTSKKLS SRNVLC KCKGKG
Sbjct  121  VVHPLKVSLEDLYNGTSKKLSLSRNVLCTKCKGKG  155



>gb|KJB35429.1| hypothetical protein B456_006G117100 [Gossypium raimondii]
Length=444

 Score =   203 bits (516),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 138/155 (89%), Gaps = 1/155 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKS +T+YYEILGV  +ASQDDLKKAY+KAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSTNTRYYEILGVSNNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG G G HDPFDI  S F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGAGAHDPFDI-FSSFFGGSPFGGGSSRGRRQRRGED  119

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSLEDLY GTSKKLS SRNV+C+KC GKG
Sbjct  120  VVHPLKVSLEDLYLGTSKKLSLSRNVICSKCNGKG  154



>gb|EPS59846.1| hypothetical protein M569_14958, partial [Genlisea aurea]
Length=247

 Score =   197 bits (500),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 143/157 (91%), Gaps = 2/157 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+++YY+ILGVPK AS DDLK+AYRKAAIK+HPDKGGDPEKFKEL+ AY+V
Sbjct  2    MFGRAPKKSDNSRYYDILGVPKSASPDDLKRAYRKAAIKNHPDKGGDPEKFKELSHAYDV  61

Query  297  LSDPEKREIYDQYGEEALKE--GMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrg  470
            LSDPEKREIY+QYGE+ALKE  G G GGGMHDPFDIF SFFGGS FG GGSSRGRRQR+G
Sbjct  62   LSDPEKREIYNQYGEDALKEGMGGGGGGGMHDPFDIFSSFFGGSHFGAGGSSRGRRQRKG  121

Query  471  EDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            +D+V PLKVSLEDLY GTSKKLS SRNV+C+KC GKG
Sbjct  122  DDLVQPLKVSLEDLYTGTSKKLSLSRNVICSKCGGKG  158



>ref|XP_009592511.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
Length=418

 Score =   201 bits (512),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGR PKKSD+T+YYEILGV K+AS D++KKAYRKAA+K+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRGPKKSDNTRYYEILGVSKNASDDEIKKAYRKAAMKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSD +KREIYDQYGE+ALKEGMG GGGMHDPFDIF+SFFGG+PFGGGGSSRGRRQRRGED
Sbjct  61   LSDSQKREIYDQYGEDALKEGMGGGGGMHDPFDIFESFFGGNPFGGGGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVH LKVSLEDLY+G +KKLS SRNV+C+KC GKG
Sbjct  121  VVHTLKVSLEDLYSGITKKLSLSRNVICSKCSGKG  155



>gb|AFK48766.1| unknown [Medicago truncatula]
Length=423

 Score =   201 bits (512),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 136/158 (86%), Gaps = 4/158 (3%)
 Frame = +3

Query  117  MFGRAP-KKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYE  293
            MFGR P +KSD+ KYY+ILGV K AS+D++KKAYRKAA+K+HPDKGGDPEKFKEL QAYE
Sbjct  1    MFGRGPTRKSDNAKYYDILGVSKSASEDEIKKAYRKAAMKNHPDKGGDPEKFKELGQAYE  60

Query  294  VLSDPEKREIYDQYGEEALKEGMGSGGG--MHDPFDIfqsffggspfggggssrgrrqrr  467
            VLSDPEK+E+YDQYGE+ALKEGMG G G   H+PFDI    F G+ FGGGG SR RRQ++
Sbjct  61   VLSDPEKKELYDQYGEDALKEGMGGGAGSSFHNPFDI-FESFFGAGFGGGGPSRARRQKQ  119

Query  468  gEDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            GEDVVH +KVSLED+YNGT+KKLS SRN LC+KCKGKG
Sbjct  120  GEDVVHSIKVSLEDVYNGTTKKLSLSRNALCSKCKGKG  157



>gb|KJB09149.1| hypothetical protein B456_001G126200 [Gossypium raimondii]
Length=416

 Score =   201 bits (511),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 137/155 (88%), Gaps = 1/155 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+T+YYEILGV K+AS DDLKKAY+KAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASHDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG G   HDPFDI  S F G    GG SSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGAAAHDPFDI-FSSFFGGSPFGGASSRGRRQRRGED  119

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSLEDLY GTSKKLS SRNV+C+KC GKG
Sbjct  120  VVHPLKVSLEDLYLGTSKKLSLSRNVICSKCSGKG  154



>dbj|BAD25681.1| putative DnaJ-like protein MsJ1 [Oryza sativa Japonica Group]
Length=416

 Score =   201 bits (511),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 125/152 (82%), Gaps = 5/152 (3%)
 Frame = +3

Query  132  PKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEVLSDPE  311
            PKKS++TKYYE+LGV K A+QD+LKKAYRKAAIK+HPDKGGDPEKFKELAQAYEVL+DPE
Sbjct  2    PKKSNNTKYYEVLGVSKTATQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLNDPE  61

Query  312  KREIYDQYGEEALKEGMGSGGG--MHDPFDIfqsffggspfggggssrgrrqrrgEDVVH  485
            KREIYDQYGE+ALKEGMG G     H PFD+   F       GG   RG RQ+RGEDVVH
Sbjct  62   KREIYDQYGEDALKEGMGGGSSSDFHSPFDL---FEQIFQNRGGFGGRGHRQKRGEDVVH  118

Query  486  PLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
             +KVSLEDLYNGT+KKLS SRN LC KCKGKG
Sbjct  119  TMKVSLEDLYNGTTKKLSLSRNALCTKCKGKG  150



>gb|KHF97331.1| Chaperone dnaJ 3 -like protein [Gossypium arboreum]
Length=422

 Score =   201 bits (511),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGR PKKSD+TK+YE+LGVPK ASQD+LKKAY+KAAIK+HPDKGGDPEKFKELA AYEV
Sbjct  1    MFGRVPKKSDNTKFYEVLGVPKSASQDELKKAYKKAAIKNHPDKGGDPEKFKELAHAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKR+IYDQYGE+ALKEGMG GG  H+PFDIF+SFFGG  FGGGGSSRGRRQ+RGED
Sbjct  61   LSDPEKRDIYDQYGEDALKEGMGGGGSSHNPFDIFESFFGGGAFGGGGSSRGRRQKRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVH LKVSLE+LYNGT+KKLS SRN +C+KCKGKG
Sbjct  121  VVHALKVSLEELYNGTAKKLSLSRNAICSKCKGKG  155



>ref|XP_006347934.1| PREDICTED: dnaJ protein homolog 2-like isoform X1 [Solanum tuberosum]
 ref|XP_006347935.1| PREDICTED: dnaJ protein homolog 2-like isoform X2 [Solanum tuberosum]
Length=420

 Score =   201 bits (510),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 137/156 (88%), Gaps = 1/156 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAP++SD++KYYE+LGV K ASQD+LKKAYRKAAI++HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPRRSDNSKYYEVLGVSKSASQDELKKAYRKAAIRNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKE-GMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgE  473
            LSDPEKR+IYDQYGE+ALKE     GGG+H+ FDIF+SFF GS  GGG   R  RQ+RGE
Sbjct  61   LSDPEKRDIYDQYGEDALKEGMGSGGGGVHNHFDIFESFFSGSFGGGGSRFRASRQKRGE  120

Query  474  DVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            DVVH L+VSLEDLYNGT+KKLS SR++LC KCKGKG
Sbjct  121  DVVHTLRVSLEDLYNGTTKKLSLSRSILCPKCKGKG  156



>ref|XP_003570021.1| PREDICTED: dnaJ protein homolog 2-like [Brachypodium distachyon]
Length=423

 Score =   201 bits (510),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 131/158 (83%), Gaps = 3/158 (2%)
 Frame = +3

Query  117  MFGRAPKK-SDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYE  293
            MFGR PKK S++TKYYE+LGV K A+ D+LKKAYRKAAIK+HPDKGGDPEKFKELA AY+
Sbjct  1    MFGRMPKKTSNNTKYYEVLGVSKTATPDELKKAYRKAAIKNHPDKGGDPEKFKELAHAYD  60

Query  294  VLSDPEKREIYDQYGEEALKEGMGSGGG-MHDPFDIfqsffggspfggggssrgrrqrrg  470
            VL+DPEKREIYDQYGE+ALKEGMG G   MH PFDIF+  FGG   G GG S   R+++ 
Sbjct  61   VLNDPEKREIYDQYGEDALKEGMGGGSSDMHSPFDIFEQLFGGGGGGFGGGSSRGRRQKR  120

Query  471  -EDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
             EDVVH +KVSLEDLYNG +KKLS SRNVLC KCKGKG
Sbjct  121  GEDVVHTMKVSLEDLYNGATKKLSLSRNVLCGKCKGKG  158



>ref|XP_006424068.1| hypothetical protein CICLE_v10028531mg [Citrus clementina]
 ref|XP_006487844.1| PREDICTED: dnaJ protein homolog ANJ1-like [Citrus sinensis]
 gb|ESR37308.1| hypothetical protein CICLE_v10028531mg [Citrus clementina]
 gb|KDO48965.1| hypothetical protein CISIN_1g014903mg [Citrus sinensis]
Length=416

 Score =   201 bits (510),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 139/155 (90%), Gaps = 1/155 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKS++T+YYEILGV K+AS +DLKKAY+KAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSNNTRYYEILGVSKNASAEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG G G HDPFDI  S F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGAGAHDPFDI-FSSFFGGSPFGGGSSRGRRQRRGED  119

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSLEDLY GTSKKLS SRNV+C+KC GKG
Sbjct  120  VVHPLKVSLEDLYLGTSKKLSLSRNVICSKCSGKG  154



>ref|XP_010263053.1| PREDICTED: dnaJ protein homolog [Nelumbo nucifera]
Length=417

 Score =   201 bits (510),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+T+YYEILGV K+ASQ+DLKKAY+KAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDP+KR+IYDQYGE+ALKEGM  GGG HDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED
Sbjct  61   LSDPDKRDIYDQYGEDALKEGMSGGGGGHDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            V+HPLKVSLEDLY GTSKKLS SRNV+C+KCKGKG
Sbjct  121  VIHPLKVSLEDLYMGTSKKLSLSRNVICSKCKGKG  155



>ref|XP_004976432.1| PREDICTED: dnaJ protein homolog 2-like [Setaria italica]
Length=419

 Score =   200 bits (509),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 131/155 (85%), Gaps = 1/155 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGR P++S++TKYYE+LGV   ASQD+LKKAYRKAAIK HPDKGGDPEKFKEL+QAYEV
Sbjct  1    MFGRVPRRSNNTKYYEVLGVSSTASQDELKKAYRKAAIKSHPDKGGDPEKFKELSQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ LKEGMG GG  H+PFDI    F G    GG  SR RRQ+RGED
Sbjct  61   LSDPEKREIYDQYGEDGLKEGMGGGGDFHNPFDI-FEQFFGGGSFGGSRSRVRRQKRGED  119

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVH LKVSLED+YNG +KKLS SRNVLC+KCKGKG
Sbjct  120  VVHSLKVSLEDVYNGATKKLSLSRNVLCSKCKGKG  154



>ref|XP_007134513.1| hypothetical protein PHAVU_010G053900g [Phaseolus vulgaris]
 gb|ESW06507.1| hypothetical protein PHAVU_010G053900g [Phaseolus vulgaris]
Length=423

 Score =   200 bits (509),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 122/157 (78%), Positives = 143/157 (91%), Gaps = 2/157 (1%)
 Frame = +3

Query  117  MFGRA-PKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYE  293
            MFGR  P+KSD++KYY+ILGV K+A++D++KKAYRKAA+K+HPDKGGDPEKFKEL QAYE
Sbjct  1    MFGRGGPRKSDNSKYYDILGVSKNATEDEIKKAYRKAAMKNHPDKGGDPEKFKELGQAYE  60

Query  294  VLSDPEKREIYDQYGEEALKEGMGSGG-GMHDPFDIfqsffggspfggggssrgrrqrrg  470
            VL DPEK+E+YDQYGE+ALK+GMG GG   H+PFDIF+SFFGGS FGGGGSSRGRRQ++G
Sbjct  61   VLGDPEKKEMYDQYGEDALKDGMGGGGSSFHNPFDIFESFFGGSSFGGGGSSRGRRQKQG  120

Query  471  EDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            EDVVH LKVSLED+YNG +KKLS SRNVLC KCKGKG
Sbjct  121  EDVVHSLKVSLEDVYNGANKKLSLSRNVLCPKCKGKG  157



>ref|XP_010692097.1| PREDICTED: dnaJ protein homolog 2-like [Beta vulgaris subsp. 
vulgaris]
Length=420

 Score =   200 bits (508),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 135/157 (86%), Gaps = 3/157 (2%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYE+LGV K ASQD+LKKAYRK+AIK+HPDKGGDPEKFKEL QAYEV
Sbjct  1    MFGRAPKKSDNTKYYEVLGVSKSASQDELKKAYRKSAIKNHPDKGGDPEKFKELGQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGG--MHDPFDIfqsffggspfggggssrgrrqrrg  470
            LSDPEKREIYDQYGE+ALKEGMG GGG   H+PFDI    F  +   GGGSS  RRQ++G
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGPFHNPFDI-FEQFFSTSGFGGGSSSRRRQQQG  119

Query  471  EDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            EDV+H +KVSLEDLYNGT+KK+S SRN+LC +CKG G
Sbjct  120  EDVIHTMKVSLEDLYNGTTKKVSISRNILCPRCKGTG  156



>gb|EYU36024.1| hypothetical protein MIMGU_mgv1a007013mg [Erythranthe guttata]
Length=422

 Score =   199 bits (507),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 143/158 (91%), Gaps = 3/158 (2%)
 Frame = +3

Query  117  MFGRAP-KKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYE  293
            MFGRAP  KSD+TKYYE+LGVPK AS DDLKKAYRKAAIK+HPDKGGDPEKFKELA AYE
Sbjct  1    MFGRAPPSKSDNTKYYEVLGVPKTASPDDLKKAYRKAAIKNHPDKGGDPEKFKELAHAYE  60

Query  294  VLSDPEKREIYDQYGEEALKE--GMGSGGGMHDPFDIfqsffggspfggggssrgrrqrr  467
            VLSDPEKREIYDQYGE+ALKE  G G GGGMHDPFDIF SFFGGSPFGGGGSSRGRRQRR
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGGGGGGGMHDPFDIFSSFFGGSPFGGGGSSRGRRQRR  120

Query  468  gEDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            GEDVVH LKVSLEDLY GTSKKLS SRNVLC KC GKG
Sbjct  121  GEDVVHALKVSLEDLYLGTSKKLSLSRNVLCKKCNGKG  158



>ref|XP_009382439.1| PREDICTED: dnaJ protein homolog [Musa acuminata subsp. malaccensis]
Length=423

 Score =   198 bits (504),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 136/161 (84%), Gaps = 6/161 (4%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MF RA +KSD+TKYYEILGVPK ASQD+LKKAYRKAAI++HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFARAQRKSDNTKYYEILGVPKSASQDELKKAYRKAAIRNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKE--GMGSGGGMHDPFDIfqs----ffggspfggggssrgrr  458
            LSDPEKREIYD+YGE+ALKE  G G GG  H+PF+IF+        G    GGGSSRGRR
Sbjct  61   LSDPEKREIYDKYGEDALKEGIGGGGGGSFHNPFEIFEQFFGGSSFGGGSFGGGSSRGRR  120

Query  459  qrrgEDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            Q+RGEDVVH LKVSLEDLYNGTSKKLS SRN LC KCKGKG
Sbjct  121  QKRGEDVVHSLKVSLEDLYNGTSKKLSLSRNALCQKCKGKG  161



>ref|XP_002983333.1| hypothetical protein SELMODRAFT_118063 [Selaginella moellendorffii]
 ref|XP_002987616.1| hypothetical protein SELMODRAFT_426414 [Selaginella moellendorffii]
 gb|EFJ11191.1| hypothetical protein SELMODRAFT_426414 [Selaginella moellendorffii]
 gb|EFJ15675.1| hypothetical protein SELMODRAFT_118063 [Selaginella moellendorffii]
Length=419

 Score =   198 bits (503),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 138/155 (89%), Gaps = 1/155 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGR PKKSD++KYY+ILGV K AS D+LKKAYRKAAIK+HPDKGGDPEKFKE++QAYEV
Sbjct  1    MFGRPPKKSDNSKYYDILGVSKSASADELKKAYRKAAIKNHPDKGGDPEKFKEISQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEK+EIYDQYGE+ALKE    GGG H+PFDIF SFFGG PFGGG S  GRRQRRGED
Sbjct  61   LSDPEKKEIYDQYGEDALKE-GMGGGGGHNPFDIFDSFFGGKPFGGGSSRGGRRQRRGED  119

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSLEDLYNG+ KKLS SRN +C+KCKGKG
Sbjct  120  VVHPLKVSLEDLYNGSVKKLSLSRNAICSKCKGKG  154



>gb|AES67168.2| DnaJ-class molecular chaperone [Medicago truncatula]
Length=327

 Score =   195 bits (496),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYEILGV K+AS DDLKKAY+KAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKNASPDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKRE+YDQYGE+ALKEGMG GGG HDPFDIF SFFGG  F GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREVYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGGGFPGGGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSLEDLY GTSKKLS SRNVLC+KC GKG
Sbjct  121  VVHPLKVSLEDLYLGTSKKLSLSRNVLCSKCNGKG  155



>ref|XP_002969107.1| hypothetical protein SELMODRAFT_267228 [Selaginella moellendorffii]
 ref|XP_002973957.1| hypothetical protein SELMODRAFT_149573 [Selaginella moellendorffii]
 gb|EFJ24912.1| hypothetical protein SELMODRAFT_149573 [Selaginella moellendorffii]
 gb|EFJ30223.1| hypothetical protein SELMODRAFT_267228 [Selaginella moellendorffii]
Length=414

 Score =   197 bits (500),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 127/155 (82%), Gaps = 5/155 (3%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGR P++S+ TKYY+ILGV KD S +DLKKAYRKAAIK+HPDKGGDPE+FKE++QAYEV
Sbjct  1    MFGRGPRRSNETKYYDILGVSKDVSPEDLKKAYRKAAIKNHPDKGGDPEQFKEISQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEK+EIYDQYGEE LKEGMG G     PFDI    F     GGGGS  G R+RRGED
Sbjct  61   LSDPEKKEIYDQYGEEGLKEGMG-GPSAGSPFDI----FESLFSGGGGSRGGSRKRRGED  115

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVH LKVSLEDLYNGTSKKL+ SRN+LC  CKGKG
Sbjct  116  VVHTLKVSLEDLYNGTSKKLTLSRNILCPSCKGKG  150



>ref|XP_009411580.1| PREDICTED: dnaJ protein homolog [Musa acuminata subsp. malaccensis]
Length=425

 Score =   197 bits (500),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 137/163 (84%), Gaps = 8/163 (5%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYE+LGVP  A+QD+LKKAYRKAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEVLGVPNSANQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKE----GMGSGGGMHDPFDIfqs----ffggspfggggssrg  452
            LSDPEKREIYD+YGE+ALKE    G G GGG H PFDIF+        G    GGGSSRG
Sbjct  61   LSDPEKREIYDKYGEDALKEGMGGGSGGGGGFHSPFDIFEQFFGGSTFGGGSFGGGSSRG  120

Query  453  rrqrrgEDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            RRQ++GEDVVH LKVSLED+YNGTSKKLS SR+ LC KCKGKG
Sbjct  121  RRQKQGEDVVHSLKVSLEDVYNGTSKKLSLSRSALCQKCKGKG  163



>ref|XP_006345526.1| PREDICTED: dnaJ protein homolog isoform X1 [Solanum tuberosum]
 ref|XP_006345527.1| PREDICTED: dnaJ protein homolog isoform X2 [Solanum tuberosum]
 ref|XP_006345528.1| PREDICTED: dnaJ protein homolog isoform X3 [Solanum tuberosum]
 ref|XP_006345529.1| PREDICTED: dnaJ protein homolog isoform X4 [Solanum tuberosum]
Length=419

 Score =   197 bits (500),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 135/155 (87%), Gaps = 2/155 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGR  ++SD++KYYE+LGV K++SQD+LKKAYRK+AIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRGARRSDNSKYYEVLGVSKNSSQDELKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKRE+YDQYGE+ALKE    GGG H+PFDI    F G  FGGGGS RG R+++GED
Sbjct  61   LSDPEKRELYDQYGEDALKE-GMGGGGGHNPFDI-FESFFGGAFGGGGSFRGSRKKKGED  118

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVH L+VSLEDLYNGT+KKLS SRN+LC KCKGKG
Sbjct  119  VVHTLRVSLEDLYNGTTKKLSLSRNILCPKCKGKG  153



>gb|AGY48888.1| MIP1L1 [Nicotiana benthamiana]
Length=423

 Score =   197 bits (500),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 132/158 (84%), Gaps = 3/158 (2%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGR  ++SD++KYYE+LGVPK++SQD+LKKAYRKAAIK+HPDKGGDPEKFKELA AYEV
Sbjct  1    MFGRGARRSDNSKYYEVLGVPKNSSQDELKKAYRKAAIKNHPDKGGDPEKFKELAHAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrg--  470
            +SDPEKREIYDQYGE+AL EGMG GGG H+PFDIF+SFFGG   G  G     R  R   
Sbjct  61   ISDPEKREIYDQYGEDALNEGMGGGGGGHNPFDIFESFFGGGFDGAFGGGGSFRGSRKKQ  120

Query  471  -EDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
             E+ VH L+VSLEDLYNGT+KKLS SRN+LC KCKGKG
Sbjct  121  GENAVHTLRVSLEDLYNGTTKKLSLSRNILCPKCKGKG  158



>ref|XP_004487721.1| PREDICTED: dnaJ protein homolog [Cicer arietinum]
Length=343

 Score =   194 bits (493),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 136/155 (88%), Gaps = 1/155 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAP KSD+TKYYEILGV K ASQDDLKKAY+KAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPTKSDNTKYYEILGVSKSASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDI  S F G     GG  R RRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDI-FSSFFGGGGFSGGGGRVRRQRRGED  119

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSLEDLY GTSKKLS SRNVLC+KCKGKG
Sbjct  120  VVHPLKVSLEDLYLGTSKKLSLSRNVLCSKCKGKG  154



>gb|EYU37228.1| hypothetical protein MIMGU_mgv1a006942mg [Erythranthe guttata]
Length=425

 Score =   196 bits (498),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 135/160 (84%), Gaps = 5/160 (3%)
 Frame = +3

Query  117  MFGRAP-KKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYE  293
            MFGR P KKS++TKYYEILGV K+AS DDLKKAYRK AIK+HPDKGGDPEKFKE+AQAYE
Sbjct  1    MFGRGPPKKSNNTKYYEILGVEKNASPDDLKKAYRKLAIKNHPDKGGDPEKFKEIAQAYE  60

Query  294  VLSDPEKREIYDQYGEEALKE-GMGSGGGMHDPFDIfqs---ffggspfggggssrgrrq  461
            VL+DPEKREIYDQYGE+ALKE   G GGG H+PFDIF+S     G    GGGGS   RR 
Sbjct  61   VLNDPEKREIYDQYGEDALKEGMGGGGGGGHNPFDIFESFFGASGNPFGGGGGSRGQRRV  120

Query  462  rrgEDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            RRGEDVVHPLKVSL+DLYNGTSKKLS SRNVLC KCKGKG
Sbjct  121  RRGEDVVHPLKVSLDDLYNGTSKKLSLSRNVLCPKCKGKG  160



>ref|XP_004506241.1| PREDICTED: dnaJ protein homolog ANJ1-like [Cicer arietinum]
Length=418

 Score =   196 bits (498),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGR PKKSDST+YYEILGV K+ASQDDLKKAY+KAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRQPKKSDSTRYYEILGVSKNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYD YGE+ALKEGMG GGG HDPFDIF SFFGG+ FGGGG SRGRRQRRGED
Sbjct  61   LSDPEKREIYDTYGEDALKEGMGGGGGGHDPFDIFSSFFGGNHFGGGGGSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSLEDLY GTSKKLS SRNVLC+KC GKG
Sbjct  121  VVHPLKVSLEDLYLGTSKKLSLSRNVLCSKCSGKG  155



>ref|XP_002511620.1| Chaperone protein dnaJ, putative [Ricinus communis]
 gb|EEF50289.1| Chaperone protein dnaJ, putative [Ricinus communis]
Length=391

 Score =   195 bits (496),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 135/154 (88%), Gaps = 0/154 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFG  P++SD+TKYYE+LGVPK+ASQD++KKAYRKAAIK+HPDKGGD EKFKEL+ AYEV
Sbjct  1    MFGYGPRRSDNTKYYEVLGVPKNASQDEMKKAYRKAAIKNHPDKGGDSEKFKELSHAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDP+KREIYDQYGE ALKEGMG GG  H+PFDIF S FG   FGGGGSSRGRRQ+RGED
Sbjct  61   LSDPQKREIYDQYGEAALKEGMGGGGSGHNPFDIFDSLFGRGAFGGGGSSRGRRQKRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGK  578
            V+H  KVSLEDLYNGT++KLS SRNV C KC GK
Sbjct  121  VLHATKVSLEDLYNGTTRKLSLSRNVFCPKCNGK  154



>ref|XP_003596916.1| DnaJ [Medicago truncatula]
 gb|AES67167.1| DnaJ-class molecular chaperone [Medicago truncatula]
Length=417

 Score =   196 bits (497),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYEILGV K+AS DDLKKAY+KAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKNASPDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKRE+YDQYGE+ALKEGMG GGG HDPFDIF SFFGG  F GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREVYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGGGFPGGGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSLEDLY GTSKKLS SRNVLC+KC GKG
Sbjct  121  VVHPLKVSLEDLYLGTSKKLSLSRNVLCSKCNGKG  155



>ref|XP_007150008.1| hypothetical protein PHAVU_005G118100g [Phaseolus vulgaris]
 gb|ESW22002.1| hypothetical protein PHAVU_005G118100g [Phaseolus vulgaris]
Length=418

 Score =   196 bits (497),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSDST+YYEILGV K+AS +DLKKAY+KAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDSTRYYEILGVAKNASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSD EKREIYD YGE+ALKEGM  GGG HDPFDIF SFFGG+PFGGGGSSRGRRQRRGED
Sbjct  61   LSDAEKREIYDTYGEDALKEGMSGGGGGHDPFDIFSSFFGGNPFGGGGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSLEDLY GTSKKLS SRNVLC+KC GKG
Sbjct  121  VVHPLKVSLEDLYLGTSKKLSLSRNVLCSKCNGKG  155



>ref|XP_006340318.1| PREDICTED: dnaJ protein homolog ANJ1-like isoform X1 [Solanum 
tuberosum]
Length=419

 Score =   195 bits (496),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 141/156 (90%), Gaps = 1/156 (1%)
 Frame = +3

Query  117  MFGRA-PKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYE  293
            MFGR   KKSD+T++YEILGV K+AS+D++KKAYRKAA+K+HPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGGKKKSDNTRFYEILGVSKNASEDEIKKAYRKAAMKNHPDKGGDPEKFKELAQAYE  60

Query  294  VLSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgE  473
            VLSD +KREIYDQYGEEALKEGMG GGG HDPFD+F SFF GSPFGGGG  RG+R+RRG+
Sbjct  61   VLSDSQKREIYDQYGEEALKEGMGGGGGTHDPFDLFNSFFSGSPFGGGGGRRGQRERRGD  120

Query  474  DVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            DVVHPLKVSLEDLY G +KKLS SRNV+C+KC GKG
Sbjct  121  DVVHPLKVSLEDLYTGITKKLSLSRNVICSKCSGKG  156



>gb|AGR45906.1| DnaJ protein 2-like protein [Triticum aestivum]
Length=421

 Score =   195 bits (496),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 127/152 (84%), Gaps = 3/152 (2%)
 Frame = +3

Query  135  KKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEVLSDPEK  314
            K S++TKYYE+LGV K A+ D+LKKAYRKAAIK+HPDKGGDPEKFKELAQAY+VL+DPEK
Sbjct  4    KTSNNTKYYEVLGVSKTATPDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYDVLNDPEK  63

Query  315  REIYDQYGEEALKEGMGSGGG--MHDPFDIfqsffggspfggggssrgrrqrrg-EDVVH  485
            REIYDQYGE+A+KEGMG  GG  MH PFDIF+  FGG   G GG S   R+++  EDVVH
Sbjct  64   REIYDQYGEDAIKEGMGGSGGADMHSPFDIFEQLFGGGGGGFGGGSSRGRRQKRGEDVVH  123

Query  486  PLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
             +KVSLEDLYNG +KKLS SRNVLC KCKGKG
Sbjct  124  TMKVSLEDLYNGATKKLSLSRNVLCGKCKGKG  155



>ref|NP_001240264.1| uncharacterized protein LOC100818805 [Glycine max]
 gb|ACU23708.1| unknown [Glycine max]
Length=417

 Score =   195 bits (495),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSDST+YYEILGV K+AS DDLKKAY+KAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDSTRYYEILGVSKNASPDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYD YGE+ALKEGMG GGG HDPFDIF SFFGGSPFG GGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDTYGEDALKEGMGGGGGGHDPFDIFSSFFGGSPFGSGGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSLEDLY GTSKKLS SRNVLC+KC GKG
Sbjct  121  VVHPLKVSLEDLYLGTSKKLSLSRNVLCSKCNGKG  155



>gb|KHN17991.1| DnaJ protein like [Glycine soja]
Length=417

 Score =   195 bits (495),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSDST+YYEILGV K+AS DDLKKAY+KAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDSTRYYEILGVSKNASPDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYD YGE+ALKEGMG GGG HDPFDIF SFFGGSPFG GGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDTYGEDALKEGMGGGGGGHDPFDIFSSFFGGSPFGSGGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSLEDLY GTSKKLS SRNVLC+KC GKG
Sbjct  121  VVHPLKVSLEDLYLGTSKKLSLSRNVLCSKCNGKG  155



>ref|XP_003540271.1| PREDICTED: dnaJ protein homolog [Glycine max]
Length=417

 Score =   195 bits (495),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSDST+YYEILGV K+AS DDLKKAY+KAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDSTRYYEILGVSKNASPDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYD YGE+ALKEGMG GGG HDPFDIF SFFGGSPFG GGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDTYGEDALKEGMGGGGGGHDPFDIFSSFFGGSPFGSGGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSLEDLY GTSKKLS SRNVLC+KC GKG
Sbjct  121  VVHPLKVSLEDLYLGTSKKLSLSRNVLCSKCNGKG  155



>ref|XP_009779099.1| PREDICTED: dnaJ protein homolog [Nicotiana sylvestris]
 ref|XP_009779100.1| PREDICTED: dnaJ protein homolog [Nicotiana sylvestris]
Length=423

 Score =   195 bits (495),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 135/158 (85%), Gaps = 3/158 (2%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGR  ++S+++KYYE+LGVPK++SQD+LKKAYRKAAIK+HPDKGGDPEKFKELA AYEV
Sbjct  1    MFGRGARRSENSKYYEVLGVPKNSSQDELKKAYRKAAIKNHPDKGGDPEKFKELAHAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDI---fqsffggspfggggssrgrrqrr  467
            LSDPEKREIYDQYGE+AL EGMG GGG H PFDI   F     G  FGGGGS RG R+++
Sbjct  61   LSDPEKREIYDQYGEDALNEGMGGGGGGHSPFDIFESFFGGGFGGAFGGGGSFRGSRKKQ  120

Query  468  gEDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            GE+ VH L+VSLEDLYNGT+KKLS SRN+LC KCKGKG
Sbjct  121  GENAVHALRVSLEDLYNGTTKKLSLSRNILCPKCKGKG  158



>gb|EYU37227.1| hypothetical protein MIMGU_mgv1a006922mg [Erythranthe guttata]
Length=426

 Score =   194 bits (494),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 135/160 (84%), Gaps = 5/160 (3%)
 Frame = +3

Query  117  MFGRAP-KKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYE  293
            MFGRAP KKSD+ KYYEILGV K AS DDLKKAYRK AIK+HPDKGGDPEKFKE+AQAYE
Sbjct  1    MFGRAPPKKSDNNKYYEILGVEKTASPDDLKKAYRKLAIKNHPDKGGDPEKFKEIAQAYE  60

Query  294  VLSDPEKREIYDQYGEEALKE-GMGSGGGMHDPFDIfqs---ffggspfggggssrgrrq  461
            VL+DPEKREIYDQYGE+ALKE   G GGG H+PFDIF+S     G    GGGGS   RRQ
Sbjct  61   VLNDPEKREIYDQYGEDALKEGMGGGGGGGHNPFDIFESFFGGSGHPFGGGGGSRGQRRQ  120

Query  462  rrgEDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            RRGEDVVHPLKVSL++LYNGTSKKLS SRNVLC KCKGKG
Sbjct  121  RRGEDVVHPLKVSLDNLYNGTSKKLSLSRNVLCPKCKGKG  160



>ref|XP_006837307.1| hypothetical protein AMTR_s00111p00054240 [Amborella trichopoda]
 gb|ERN00161.1| hypothetical protein AMTR_s00111p00054240 [Amborella trichopoda]
Length=304

 Score =   191 bits (485),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 137/155 (88%), Gaps = 1/155 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAP++ D+++YY+ILGV K+ASQD+LKKAY+KAAIK+HPDKGGDPEKFKELAQAY+V
Sbjct  1    MFGRAPRRGDNSRYYDILGVSKNASQDELKKAYKKAAIKNHPDKGGDPEKFKELAQAYDV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKRE+YDQYGE+ALKEGMG  G  H+PFDI    F G    GGGSSRGRRQ++G+D
Sbjct  61   LSDPEKREVYDQYGEDALKEGMGGAGPSHNPFDI-FESFFGGGGFGGGSSRGRRQKQGDD  119

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVH LKVSLEDLYNGTSKKLS SRNVLC KCKGKG
Sbjct  120  VVHSLKVSLEDLYNGTSKKLSLSRNVLCPKCKGKG  154



>gb|KDP42967.1| hypothetical protein JCGZ_23909 [Jatropha curcas]
Length=418

 Score =   194 bits (492),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 138/155 (89%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+T+YYEILGV K+ASQDDLKKAY+KAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG GGG H PFDIF+SFFGGSPFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHSPFDIFESFFGGSPFGGGGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSLEDLY GT+KKLS SRNV+C+KC GKG
Sbjct  121  VVHPLKVSLEDLYLGTTKKLSLSRNVICSKCNGKG  155



>sp|P43644.1|DNJH_ATRNU RecName: Full=DnaJ protein homolog ANJ1; Flags: Precursor [Atriplex 
nummularia]
Length=417

 Score =   194 bits (492),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSDST+YYEILGVPKDAS +DLKKAY+KAAIK+HPDKGGDPEKFKELA AYEV
Sbjct  1    MFGRAPKKSDSTRYYEILGVPKDASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAHAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG GGGMHDPFDIFQSFFGGSPFGG GSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGMHDPFDIFQSFFGGSPFGGVGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSLEDL+ GT+KKLS SRNV+C+KC GKG
Sbjct  121  VVHPLKVSLEDLFTGTTKKLSLSRNVICSKCTGKG  155



>ref|XP_004251216.1| PREDICTED: dnaJ protein homolog [Solanum lycopersicum]
Length=418

 Score =   194 bits (492),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 135/156 (87%), Gaps = 2/156 (1%)
 Frame = +3

Query  117  MFGRA-PKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYE  293
            MFGR   KKSD+TK+YEILGV K+AS+D++KKAYRKAA+K+HPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGGKKKSDNTKFYEILGVSKNASEDEIKKAYRKAAMKNHPDKGGDPEKFKELAQAYE  60

Query  294  VLSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgE  473
            VLSD +KREIYDQYGEEALKEGMG GGG HDPFD+  + F      GGG  RG+R+RRG+
Sbjct  61   VLSDSQKREIYDQYGEEALKEGMGGGGGTHDPFDL-FNSFFSGSPFGGGGRRGQRERRGD  119

Query  474  DVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            DVVHPLKVSLEDLYNG +KKLS SRNV+C+KC GKG
Sbjct  120  DVVHPLKVSLEDLYNGMTKKLSLSRNVICSKCSGKG  155



>ref|XP_009596179.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
 ref|XP_009596180.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
 ref|XP_009596181.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
 ref|XP_009596182.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
 ref|XP_009596183.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
Length=421

 Score =   193 bits (491),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 132/158 (84%), Gaps = 3/158 (2%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGR  ++SD++KYYE+LGV K++SQD+LKKAYRKAAIK+HPDKGGDPEKFKELA AYEV
Sbjct  1    MFGRGARRSDNSKYYEVLGVSKNSSQDELKKAYRKAAIKNHPDKGGDPEKFKELAHAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrg--  470
            LSDPEKREIYDQYGE+ALKEGMG GGG H+PFDIF+SFFGG   G  G     R  R   
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHNPFDIFESFFGGGFGGAFGGGGSFRGSRKKQ  120

Query  471  -EDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
             E+ VH L+VSLEDLY+GT+KKLS SRN+LC KCKGKG
Sbjct  121  GENAVHTLRVSLEDLYSGTTKKLSLSRNILCPKCKGKG  158



>ref|XP_004229763.1| PREDICTED: dnaJ protein homolog 2-like [Solanum lycopersicum]
Length=424

 Score =   193 bits (490),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 138/160 (86%), Gaps = 5/160 (3%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFG+AP++SD++KYYE+LGV K ASQD+LKKAYRKAAI++HPDKGGDPEKFKEL QAYEV
Sbjct  1    MFGQAPRRSDNSKYYEVLGVSKSASQDELKKAYRKAAIRNHPDKGGDPEKFKELGQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKE-----GMGSGGGMHDPFDIfqsffggspfggggssrgrrq  461
            L DPEKR+IYDQYGE+ALKE     G G GGG+H+ FDIF+SFFGGS  GGG   R  RQ
Sbjct  61   LIDPEKRDIYDQYGEDALKEGMGSGGGGGGGGVHNHFDIFESFFGGSFGGGGSHFRASRQ  120

Query  462  rrgEDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            +RGEDVVH L+VSLEDLYNGT+KKLS SR++LC KCKGKG
Sbjct  121  KRGEDVVHTLRVSLEDLYNGTTKKLSLSRSILCPKCKGKG  160



>gb|AFK37703.1| unknown [Medicago truncatula]
Length=417

 Score =   192 bits (489),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+TKYYEI GV K+AS DDLKKAY+KAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEIPGVSKNASPDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKRE+YDQYGE+ALKEGMG GGG HDPFDIF SFFGG  F GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREVYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGGGFPGGGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSLEDLY GTSKKLS SRNVLC+KC GKG
Sbjct  121  VVHPLKVSLEDLYLGTSKKLSLSRNVLCSKCNGKG  155



>ref|XP_010694477.1| PREDICTED: dnaJ protein homolog [Beta vulgaris subsp. vulgaris]
Length=419

 Score =   192 bits (488),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 131/156 (84%), Positives = 141/156 (90%), Gaps = 1/156 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGR PKKSDST+YYEILGVPK+AS +DLKKAY+KAAIK+HPDKGGDPEKFKELA AYEV
Sbjct  1    MFGRPPKKSDSTRYYEILGVPKNASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAHAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDI-fqsffggspfggggssrgrrqrrgE  473
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDI    F G    GGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGAHDPFDIFSSFFGGSPFGGGGGSSRGRRQRRGE  120

Query  474  DVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            DV+HPLKVSLED+YNGTSKKLS SRNV+C+KCKGKG
Sbjct  121  DVIHPLKVSLEDIYNGTSKKLSLSRNVICSKCKGKG  156



>ref|XP_011090296.1| PREDICTED: dnaJ protein homolog [Sesamum indicum]
Length=417

 Score =   192 bits (487),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 138/155 (89%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+T+YY+ILGVPK AS DDLKKAY+KAAIK+HPDKGGDPEKFKELA AYEV
Sbjct  1    MFGRAPKKSDNTRYYDILGVPKTASPDDLKKAYKKAAIKNHPDKGGDPEKFKELAHAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG GGGMHDPFDIF SFFGGSPFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGMHDPFDIFSSFFGGSPFGGGGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSLEDLY GT+KKLS SRNV+C+KC GKG
Sbjct  121  VVHPLKVSLEDLYLGTTKKLSLSRNVICSKCSGKG  155



>ref|XP_011088982.1| PREDICTED: dnaJ protein homolog [Sesamum indicum]
Length=413

 Score =   191 bits (486),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 138/155 (89%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+++YYEILGVPK AS DDLKKAY+KAAIK+HPDKGGDPEKFKELA AYEV
Sbjct  1    MFGRAPKKSDNSRYYEILGVPKTASPDDLKKAYKKAAIKNHPDKGGDPEKFKELAHAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG GGGMHDPFDIF SFFGGSPFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGMHDPFDIFSSFFGGSPFGGGGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSLEDLY GT+KKLS SRNV+C+KC GKG
Sbjct  121  VVHPLKVSLEDLYLGTTKKLSLSRNVICSKCSGKG  155



>ref|XP_010263054.1| PREDICTED: dnaJ protein homolog [Nelumbo nucifera]
Length=416

 Score =   191 bits (485),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 146/155 (94%), Gaps = 1/155 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGR PKKSD+T+YYEILGVPK+AS +DLKKAY+KAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRQPKKSDNTRYYEILGVPKNASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKE    GGG HDPFDIFQSFFGG+PFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKE-GMGGGGGHDPFDIFQSFFGGNPFGGGGSSRGRRQRRGED  119

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            V+HPLKVSLEDLY GTSKKLS SRNV+C+KCKGKG
Sbjct  120  VIHPLKVSLEDLYVGTSKKLSLSRNVICSKCKGKG  154



>ref|XP_010089798.1| DnaJ-like protein [Morus notabilis]
 gb|EXB38414.1| DnaJ-like protein [Morus notabilis]
Length=440

 Score =   191 bits (486),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 132/151 (87%), Gaps = 1/151 (1%)
 Frame = +3

Query  129  APKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEVLSDP  308
            APKKSD+T+YY+ILGV K+ASQDDLKKAY+KAAIK+HPDKGGDPEKFKELAQAYEVLSDP
Sbjct  28   APKKSDNTRYYDILGVSKNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEVLSDP  87

Query  309  EKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgEDVVHP  488
            EKREIYDQYGE+ALKEGMG G   HDPFDI    F G    GG S  GRRQRRGED+VHP
Sbjct  88   EKREIYDQYGEDALKEGMGGGADGHDPFDI-FQSFFGGNPFGGSSKGGRRQRRGEDIVHP  146

Query  489  LKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            LKVSLEDLY GT+KKLS SRNV+C+KCKGKG
Sbjct  147  LKVSLEDLYLGTTKKLSLSRNVICSKCKGKG  177



>gb|ACJ85577.1| unknown [Medicago truncatula]
Length=263

 Score =   186 bits (473),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 131/156 (84%), Positives = 136/156 (87%), Gaps = 4/156 (3%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSDST+YYEILGV K ASQDDLKKAY+KAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDSTRYYEILGVSKTASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKE-GMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgE  473
            LSDPEKREIYD YGE+ALKE   G GGG HDPFDI   F      GGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDTYGEDALKEGMGGGGGGGHDPFDI---FSSFFGGGGGGSSRGRRQRRGE  117

Query  474  DVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            DVVHPLKVSLEDLY GTSKKLS SRNVLC+KC GKG
Sbjct  118  DVVHPLKVSLEDLYLGTSKKLSLSRNVLCSKCSGKG  153



>ref|XP_004139085.1| PREDICTED: dnaJ protein homolog [Cucumis sativus]
 gb|KGN66611.1| DnaJ [Cucumis sativus]
Length=413

 Score =   191 bits (484),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 137/155 (88%), Gaps = 2/155 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSDST+YYEILGV K+ASQDDLKKAY+KAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDSTRYYEILGVSKNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKE    GGG HDPFDI    F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKE-GMGGGGGHDPFDI-FQSFFGGSPFGGGSSRGRRQRRGED  118

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSLEDLY GTSKKLS SRNV+C+KC GKG
Sbjct  119  VVHPLKVSLEDLYLGTSKKLSLSRNVICSKCNGKG  153



>emb|CAI64493.1| OSJNBa0065H10.16 [Oryza sativa Japonica Group]
Length=439

 Score =   191 bits (484),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 125/146 (86%), Gaps = 1/146 (1%)
 Frame = +3

Query  138  KSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEVLSDPEKR  317
            +S++TKYYE+LGVPK AS+D+LKKAYRKAAIK+HPDKGGDPEKFKEL+QAYEVL+DPEKR
Sbjct  295  ESNNTKYYEVLGVPKTASKDELKKAYRKAAIKNHPDKGGDPEKFKELSQAYEVLTDPEKR  354

Query  318  EIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgEDVVHPLKV  497
            +IYDQYGE+ALK+GMG G   H+PFDI    F G    GG SSR RRQRRGEDV H LKV
Sbjct  355  DIYDQYGEDALKDGMGGGSDFHNPFDI-FEQFFGGGAFGGSSSRVRRQRRGEDVAHTLKV  413

Query  498  SLEDLYNGTSKKLSPSRNVLCAKCKG  575
            SLED+YNG+ KKLS SRN+LC KCKG
Sbjct  414  SLEDVYNGSMKKLSLSRNILCPKCKG  439



>ref|XP_008230416.1| PREDICTED: dnaJ protein homolog [Prunus mume]
Length=418

 Score =   190 bits (482),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+T+YYEILGV ++AS DDLKKAY+KAAIK+HPDKGGDPEKFKELAQAY+V
Sbjct  1    MFGRAPKKSDNTRYYEILGVSQNASHDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYDV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIF SFFGGSPFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGSPFGGGGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVH LKVSLED+Y GTSKKLS SRNVLC+KC GKG
Sbjct  121  VVHSLKVSLEDIYLGTSKKLSLSRNVLCSKCNGKG  155



>ref|XP_007205259.1| hypothetical protein PRUPE_ppa006299mg [Prunus persica]
 gb|EMJ06458.1| hypothetical protein PRUPE_ppa006299mg [Prunus persica]
Length=418

 Score =   190 bits (482),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+T+YYEILGV ++AS DDLKKAY+KAAIK+HPDKGGDPEKFKELAQAY+V
Sbjct  1    MFGRAPKKSDNTRYYEILGVSQNASHDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYDV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIF SFFGGSPFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGSPFGGGGSSRGRRQRRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVH LKVSLED+Y GTSKKLS SRNVLC+KC GKG
Sbjct  121  VVHSLKVSLEDIYLGTSKKLSLSRNVLCSKCNGKG  155



>ref|XP_008443634.1| PREDICTED: dnaJ protein homolog [Cucumis melo]
Length=413

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 137/155 (88%), Gaps = 2/155 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+T+YYEILGV K+ASQDDLKKAY+KAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKE    GGG HDPFDI    F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKE-GMGGGGGHDPFDI-FQSFFGGSPFGGGSSRGRRQRRGED  118

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSLEDLY GTSKKLS SRNV+C+KC GKG
Sbjct  119  VVHPLKVSLEDLYLGTSKKLSLSRNVICSKCNGKG  153



>emb|CAD41609.2| OSJNBb0034G17.1 [Oryza sativa Japonica Group]
Length=704

 Score =   194 bits (493),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 127/148 (86%), Gaps = 1/148 (1%)
 Frame = +3

Query  138  KSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEVLSDPEKR  317
            +S++TKYYE+LGVPK AS+D+LKKAYRKAAIK+HPDKGGDPEKFKEL+QAYEVL+DPEKR
Sbjct  295  ESNNTKYYEVLGVPKTASKDELKKAYRKAAIKNHPDKGGDPEKFKELSQAYEVLTDPEKR  354

Query  318  EIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgEDVVHPLKV  497
            +IYDQYGE+ALK+GMG G   H+PFDI    F G    GG SSR RRQRRGEDV H LKV
Sbjct  355  DIYDQYGEDALKDGMGGGSDFHNPFDI-FEQFFGGGAFGGSSSRVRRQRRGEDVAHTLKV  413

Query  498  SLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            SLED+YNG+ KKLS SRN+LC KCKGKG
Sbjct  414  SLEDVYNGSMKKLSLSRNILCPKCKGKG  441



>ref|XP_006590333.1| PREDICTED: uncharacterized protein LOC100808604 isoform X1 [Glycine 
max]
 gb|KHN13055.1| DnaJ protein like [Glycine soja]
Length=417

 Score =   189 bits (479),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 133/156 (85%), Positives = 141/156 (90%), Gaps = 2/156 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+T+YYEILGV K+ASQDDLKKAY+KAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDI-fqsffggspfggggssrgrrqrrgE  473
            LSDPEKREIYDQYGE+ALKE    GGG HDPFDI    F GGSPFG GGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKE-GMGGGGGHDPFDIFSSFFGGGSPFGSGGSSRGRRQRRGE  119

Query  474  DVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            DVVHPLKVSLEDLY GTSKKLS SRNV+C+KC GKG
Sbjct  120  DVVHPLKVSLEDLYLGTSKKLSLSRNVICSKCTGKG  155



>ref|NP_001238341.1| seed maturation protein PM37 [Glycine max]
 gb|AAD51625.1|AF169022_1 seed maturation protein PM37 [Glycine max]
 gb|KHN21201.1| DnaJ protein like [Glycine soja]
Length=417

 Score =   188 bits (478),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 133/156 (85%), Positives = 141/156 (90%), Gaps = 2/156 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+T+YYEILGV K+ASQDDLKKAY+KAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDI-fqsffggspfggggssrgrrqrrgE  473
            LSDPEKREIYDQYGE+ALKE    GGG HDPFDI    F GGSPFG GGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKE-GMGGGGGHDPFDIFSSFFGGGSPFGSGGSSRGRRQRRGE  119

Query  474  DVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            DVVHPLKVSLEDLY GTSKKLS SRNV+C+KC GKG
Sbjct  120  DVVHPLKVSLEDLYLGTSKKLSLSRNVICSKCSGKG  155



>ref|XP_007132506.1| hypothetical protein PHAVU_011G100000g [Phaseolus vulgaris]
 gb|ESW04500.1| hypothetical protein PHAVU_011G100000g [Phaseolus vulgaris]
Length=418

 Score =   188 bits (477),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 141/156 (90%), Gaps = 2/156 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+T+YYEILGV K+ASQDDLKKAY+KAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDI-fqsffggspfggggssrgrrqrrgE  473
            LSDPEKRE+YDQYGE+ALKE    GGG HDPFDI    F GGSPFG GGSSRGRRQRRGE
Sbjct  61   LSDPEKREVYDQYGEDALKE-GMGGGGGHDPFDIFSSFFGGGSPFGSGGSSRGRRQRRGE  119

Query  474  DVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            DVVHPLKVSLEDLY GTSKKLS SRNV+C+KC GKG
Sbjct  120  DVVHPLKVSLEDLYLGTSKKLSLSRNVICSKCTGKG  155



>gb|AHA84223.1| seed maturation protein PM37 [Phaseolus vulgaris]
Length=418

 Score =   188 bits (477),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 141/156 (90%), Gaps = 2/156 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+T+YYEILGV K+ASQDDLKKAY+KAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDI-fqsffggspfggggssrgrrqrrgE  473
            LSDPEKRE+YDQYGE+ALKE    GGG HDPFDI    F GGSPFG GGSSRGRRQRRGE
Sbjct  61   LSDPEKREVYDQYGEDALKE-GMGGGGGHDPFDIFSSFFGGGSPFGSGGSSRGRRQRRGE  119

Query  474  DVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            DVVHPLKVSLEDLY GTSKKLS SRNV+C+KC GKG
Sbjct  120  DVVHPLKVSLEDLYLGTSKKLSLSRNVICSKCTGKG  155



>gb|EYU36023.1| hypothetical protein MIMGU_mgv1a007093mg [Erythranthe guttata]
Length=420

 Score =   188 bits (477),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 138/156 (88%), Positives = 143/156 (92%), Gaps = 1/156 (1%)
 Frame = +3

Query  117  MFGRAP-KKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYE  293
            MFGRAP  KSD+TKYYEILGVPK AS DDLKKAY+KAAIK+HPDKGGDPEKFKELA AYE
Sbjct  1    MFGRAPPSKSDNTKYYEILGVPKTASPDDLKKAYKKAAIKNHPDKGGDPEKFKELAHAYE  60

Query  294  VLSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgE  473
            VLSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIF SFFGGSPFGGGGS RG+RQRRGE
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGSPFGGGGSGRGQRQRRGE  120

Query  474  DVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            DVVHPLKVSLEDLY GTSKKLS SRNVLC KC GKG
Sbjct  121  DVVHPLKVSLEDLYLGTSKKLSLSRNVLCKKCSGKG  156



>dbj|BAK03083.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=153

 Score =   180 bits (456),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 124/152 (82%), Gaps = 4/152 (3%)
 Frame = +3

Query  117  MFGRAPKK-SDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYE  293
            MFGR P+K S++TKYYE+LGV K A+ D+LKKAYRKAAIK+HPDKGGDPEKFKELAQAY+
Sbjct  1    MFGRMPRKTSNNTKYYEVLGVSKTATPDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYD  60

Query  294  VLSDPEKREIYDQYGEEALKE--GMGSGGGMHDPFDIfqsffggspfggggssrgrrqrr  467
            VL+DPEKREIYDQYGE+ALKE  G G    MH PFDIF+  FGG   G GG S   R+++
Sbjct  61   VLNDPEKREIYDQYGEDALKEGMGGGGSSDMHSPFDIFEQLFGGGGGGFGGGSSRGRRQK  120

Query  468  g-EDVVHPLKVSLEDLYNGTSKKLSPSRNVLC  560
              EDVVH +KVSLEDLYNG +KKLS SRNVLC
Sbjct  121  RGEDVVHTMKVSLEDLYNGATKKLSLSRNVLC  152



>ref|XP_011093285.1| PREDICTED: chaperone protein dnaJ 3-like [Sesamum indicum]
 ref|XP_011093286.1| PREDICTED: chaperone protein dnaJ 3-like [Sesamum indicum]
Length=421

 Score =   187 bits (476),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 129/157 (82%), Gaps = 2/157 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKS+  K+YEILGVP  ASQD+LKKAY+KAAIK+HPDKGGDPEKFKELA AYE+
Sbjct  1    MFGRAPKKSNDLKFYEILGVPISASQDELKKAYKKAAIKNHPDKGGDPEKFKELAHAYEI  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDI--fqsffggspfggggssrgrrqrrg  470
            LSDPEKREIYD+YGE+A+KEGMG G   +DPF+I       G     GGG S   R+R+G
Sbjct  61   LSDPEKREIYDEYGEDAVKEGMGGGSHSYDPFNIFESFFGGGFGGGFGGGRSSRSRKRQG  120

Query  471  EDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            EDVVHPL+VSLEDLYNGT++KLS SRN LC KCKGKG
Sbjct  121  EDVVHPLRVSLEDLYNGTTRKLSISRNALCNKCKGKG  157



>ref|NP_001242510.1| uncharacterized protein LOC100808604 [Glycine max]
 gb|ACU21221.1| unknown [Glycine max]
Length=410

 Score =   187 bits (475),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 137/155 (88%), Gaps = 7/155 (5%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+T++YEILGV K+ASQDDLKKAY+KAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRHYEILGVSKNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKE    GGG HDPFDI       S F GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKE-GMGGGGGHDPFDI------FSSFFGGGSSRGRRQRRGED  113

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSLEDLY GTSKKLS SRNV+C+KC GKG
Sbjct  114  VVHPLKVSLEDLYLGTSKKLSLSRNVICSKCTGKG  148



>ref|XP_009368443.1| PREDICTED: dnaJ protein homolog [Pyrus x bretschneideri]
Length=420

 Score =   187 bits (476),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 137/156 (88%), Positives = 143/156 (92%), Gaps = 1/156 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+T+YYEILGV K AS DDLKKAY+KAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKSASPDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKE-GMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgE  473
            LSDPEKREIYDQYGE+ALKE   G GGG HDPFDIF SFFGGSPFGGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGGHDPFDIFSSFFGGSPFGGGGSSRGRRQRRGE  120

Query  474  DVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            DVVH LKVSLEDLY GTSKKLS SRNVLC+KC GKG
Sbjct  121  DVVHALKVSLEDLYLGTSKKLSLSRNVLCSKCNGKG  156



>ref|XP_003605981.1| DnaJ [Medicago truncatula]
Length=413

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 131/156 (84%), Positives = 136/156 (87%), Gaps = 7/156 (4%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSDST+YYEILGV K ASQDDLKKAY+KAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDSTRYYEILGVSKTASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKE-GMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgE  473
            LSDPEKREIYD YGE+ALKE   G GGG HDPFDI       S F GGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDTYGEDALKEGMGGGGGGGHDPFDI------FSSFFGGGSSRGRRQRRGE  114

Query  474  DVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            DVVHPLKVSLEDLY GTSKKLS SRNVLC+KC GKG
Sbjct  115  DVVHPLKVSLEDLYLGTSKKLSLSRNVLCSKCSGKG  150



>ref|XP_010493266.1| PREDICTED: chaperone protein dnaJ 2-like isoform X1 [Camelina 
sativa]
 ref|XP_010493267.1| PREDICTED: chaperone protein dnaJ 2-like isoform X2 [Camelina 
sativa]
Length=420

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 135/157 (86%), Gaps = 2/157 (1%)
 Frame = +3

Query  117  MFGRAP-KKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYE  293
            MFGR P +KSD+TK+YEILGVPK AS +DLKKAY+KAAIK+HPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGPSRKSDNTKFYEILGVPKTASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  294  VLSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDI-fqsffggspfggggssrgrrqrrg  470
            VLSDPEKREIYDQYGE+ALKEGMG   G HDPFDI    F GG    GGGSSRGRRQRRG
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGPASGGHDPFDIFSSFFGGGGHPFGGGSSRGRRQRRG  120

Query  471  EDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            EDVVHPLKVSLED+Y GT+KKLS SR  LC+KC GKG
Sbjct  121  EDVVHPLKVSLEDVYLGTTKKLSLSRKALCSKCNGKG  157



>gb|AHA84264.1| seed maturation protein PM37 [Phaseolus vulgaris]
Length=418

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 141/156 (90%), Gaps = 2/156 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+T+YYEILGV K+ASQDDLKKAY+KAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDI-fqsffggspfggggssrgrrqrrgE  473
            LSDPEKRE+YDQYGE+ALKE    GGG HDPFDI    F GGSPFG GGSSRGRRQRRGE
Sbjct  61   LSDPEKREVYDQYGEDALKE-GMGGGGGHDPFDIFSSFFGGGSPFGSGGSSRGRRQRRGE  119

Query  474  DVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            DVVHPLKVSLEDLY GTSKKLS SRNV+C+KC GKG
Sbjct  120  DVVHPLKVSLEDLYLGTSKKLSLSRNVICSKCTGKG  155



>ref|XP_003605980.1| DnaJ [Medicago truncatula]
 gb|AES88177.1| DnaJ-class molecular chaperone [Medicago truncatula]
Length=416

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 131/156 (84%), Positives = 136/156 (87%), Gaps = 4/156 (3%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSDST+YYEILGV K ASQDDLKKAY+KAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDSTRYYEILGVSKTASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKE-GMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgE  473
            LSDPEKREIYD YGE+ALKE   G GGG HDPFDI   F      GGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDTYGEDALKEGMGGGGGGGHDPFDI---FSSFFGGGGGGSSRGRRQRRGE  117

Query  474  DVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            DVVHPLKVSLEDLY GTSKKLS SRNVLC+KC GKG
Sbjct  118  DVVHPLKVSLEDLYLGTSKKLSLSRNVLCSKCSGKG  153



>emb|CDX70980.1| BnaC03g10640D [Brassica napus]
Length=407

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 120/156 (77%), Gaps = 14/156 (9%)
 Frame = +3

Query  117  MFGRAPK-KSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYE  293
            MF R P  KSD+TK+YEILGVPK AS +DLKKAY++AAIK+HPDKGGDPEKFKEL +AY 
Sbjct  1    MFRRGPSSKSDNTKFYEILGVPKSASPEDLKKAYKRAAIKNHPDKGGDPEKFKELGEAYG  60

Query  294  VLSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgE  473
            VLSDPEKREIYDQYGEE +K+G+      HDPFDI         F        RRQRRGE
Sbjct  61   VLSDPEKREIYDQYGEEGIKDGIDR----HDPFDI---------FSSFFGRNERRQRRGE  107

Query  474  DVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            DVVHPL+VSLEDLY GT+KKLS SRN LC+KC GKG
Sbjct  108  DVVHPLRVSLEDLYLGTTKKLSLSRNALCSKCSGKG  143



>ref|XP_008385581.1| PREDICTED: dnaJ protein homolog [Malus domestica]
Length=420

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 137/156 (88%), Positives = 143/156 (92%), Gaps = 1/156 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+T+YYEILGV K AS DDLKKAY+KAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKSASPDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKE-GMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgE  473
            LSDPEKREIYDQYGE+ALKE   G GGG HDPFDIF SFFGGSPFGGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGGHDPFDIFSSFFGGSPFGGGGSSRGRRQRRGE  120

Query  474  DVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            DVVH LKVSLEDLY GTSKKLS SRNVLC+KC GKG
Sbjct  121  DVVHALKVSLEDLYLGTSKKLSLSRNVLCSKCNGKG  156



>tpg|DAA41207.1| TPA: putative dnaJ chaperone family protein [Zea mays]
Length=581

 Score =   190 bits (483),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = +3

Query  132  PKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEVLSDPE  311
            P+    ++YYEILGV KDASQDDLKKAYRKAAIKDHP+KGGDPEKFKELAQAYEV SDPE
Sbjct  329  PEFRWPSRYYEILGVSKDASQDDLKKAYRKAAIKDHPNKGGDPEKFKELAQAYEVPSDPE  388

Query  312  KREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgEDVVHPL  491
            KREIYDQYGE+ALKEGMG GGGMHDPFD+FQSFFGG    GGGSSRGR QR G+DVVHPL
Sbjct  389  KREIYDQYGEDALKEGMGGGGGMHDPFDLFQSFFGGGSPFGGGSSRGRTQRWGDDVVHPL  448

Query  492  KVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            KVSLEDLYNGTSKKLS S NVL +KC GKG
Sbjct  449  KVSLEDLYNGTSKKLSLSHNVLSSKCNGKG  478



>dbj|BAA76883.1| DnaJ homolog protein [Salix gilgiana]
 dbj|BAA76888.1| DnaJ homolog protein [Salix gilgiana]
Length=423

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 144/157 (92%), Gaps = 2/157 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAP++SD+TKYYE+L V K ASQD+LKKAY+KAAIK+HPDKGGDPEKFKEL+QAYEV
Sbjct  1    MFGRAPRRSDNTKYYEVLAVSKGASQDELKKAYKKAAIKNHPDKGGDPEKFKELSQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKE--GMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrg  470
            LSDP+KREIYDQYGE+ALKE  G G GGG H+PFDIF+SFFGG  FGGG SSRGRRQ++G
Sbjct  61   LSDPDKREIYDQYGEDALKEGMGPGGGGGGHNPFDIFESFFGGGGFGGGSSSRGRRQKQG  120

Query  471  EDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            EDV HPLKVSLEDLYNGTSKKLS SRN+LCAKCKGKG
Sbjct  121  EDVAHPLKVSLEDLYNGTSKKLSLSRNILCAKCKGKG  157



>emb|CDP15561.1| unnamed protein product [Coffea canephora]
Length=417

 Score =   185 bits (470),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 136/155 (88%), Gaps = 1/155 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+T+YYEILGV K+AS +DLKKAY+KAAIK+HPDKGGDPEKFKELA AYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAHAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ALKEGMG GGGMHDPFDI    F        GSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGMHDPFDI-FQTFFNGDPFNRGSSRGRRQRRGED  119

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVHPLKVSLEDLY+GT+KKLS SRNV+C KC GKG
Sbjct  120  VVHPLKVSLEDLYSGTTKKLSLSRNVICTKCSGKG  154



>ref|XP_010535721.1| PREDICTED: chaperone protein dnaJ 3 [Tarenaya hassleriana]
Length=423

 Score =   186 bits (471),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 129/156 (83%), Positives = 139/156 (89%), Gaps = 2/156 (1%)
 Frame = +3

Query  117  MFGRAP-KKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYE  293
            MFGR P KKSD+TK+YEILGVPK+ASQ+DLKKAY+KAAIK+HPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGPSKKSDNTKFYEILGVPKNASQEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  294  VLSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgE  473
            VLSDPEKREIYDQYGE+ALKEGMG  GG HDPFDI  S F G    GGGSSRGRRQRRGE
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGGPGGGHDPFDI-FSSFFGGGPFGGGSSRGRRQRRGE  119

Query  474  DVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            DVVHPLKVSLEDLY GT+KKLS +RN LC+KC GKG
Sbjct  120  DVVHPLKVSLEDLYLGTTKKLSLTRNALCSKCNGKG  155



>ref|XP_006404506.1| hypothetical protein EUTSA_v10010407mg [Eutrema salsugineum]
 gb|ESQ45959.1| hypothetical protein EUTSA_v10010407mg [Eutrema salsugineum]
Length=421

 Score =   185 bits (469),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 145/156 (93%), Gaps = 1/156 (1%)
 Frame = +3

Query  117  MFGRAP-KKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYE  293
            MFGR P KKSD+TK+YEILGVPK AS +DLKKAY+KAAIK+HPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGPSKKSDNTKFYEILGVPKTASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  294  VLSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgE  473
            VLSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIF SFFGGSPFGGGGSSRGRRQRRGE
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGSPFGGGGSSRGRRQRRGE  120

Query  474  DVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            DVVHPLKVSLED+Y GT+KKLS SRN LC+KC GKG
Sbjct  121  DVVHPLKVSLEDVYLGTTKKLSLSRNALCSKCNGKG  156



>ref|XP_002874044.1| hypothetical protein ARALYDRAFT_489058 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50303.1| hypothetical protein ARALYDRAFT_489058 [Arabidopsis lyrata subsp. 
lyrata]
Length=419

 Score =   184 bits (467),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 129/156 (83%), Positives = 139/156 (89%), Gaps = 1/156 (1%)
 Frame = +3

Query  117  MFGRAP-KKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYE  293
            MFGR P +KSD+TK+YEILGVPK AS +DLKKAY+KAAIK+HPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGPSRKSDNTKFYEILGVPKTASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  294  VLSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgE  473
            VLSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIF SFFGG     GG SRGRRQRRGE
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGGGNPFGGHSRGRRQRRGE  120

Query  474  DVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            DVVHPLKVSLED+Y GT+KKLS SR VLC+KC GKG
Sbjct  121  DVVHPLKVSLEDVYLGTTKKLSLSRKVLCSKCNGKG  156



>ref|XP_010544327.1| PREDICTED: dnaJ protein homolog [Tarenaya hassleriana]
 ref|XP_010544328.1| PREDICTED: dnaJ protein homolog [Tarenaya hassleriana]
Length=419

 Score =   184 bits (466),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 136/157 (87%), Gaps = 7/157 (4%)
 Frame = +3

Query  117  MFGRA--PKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAY  290
            MFGR    KKSD++++YEILGV KDA+Q+DLKKAY+KAAIK+HPDKGGDPEKFKE+AQAY
Sbjct  1    MFGRGGQQKKSDNSRFYEILGVTKDATQEDLKKAYKKAAIKNHPDKGGDPEKFKEIAQAY  60

Query  291  EVLSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrg  470
            EVLSDPEKREIYDQYGEEALKEGMG  G   DPFDI       S FGGGGSSRGRR+RRG
Sbjct  61   EVLSDPEKREIYDQYGEEALKEGMGGSGPTIDPFDI-----FSSFFGGGGSSRGRRERRG  115

Query  471  EDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            EDVVHPLKVSLEDLY GT+KKLS SRNV+C+KC GKG
Sbjct  116  EDVVHPLKVSLEDLYLGTTKKLSLSRNVICSKCNGKG  152



>ref|XP_008232370.1| PREDICTED: dnaJ protein homolog 2-like [Prunus mume]
Length=415

 Score =   183 bits (465),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 125/155 (81%), Gaps = 5/155 (3%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFG A +KSD+TKYY +LGV K++S D+LKKAY+KAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGHASRKSDNTKYYGVLGVSKNSSADELKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDPEKREIYDQYGE+ LKEG G G   H+PFD+       +       S  RRQ++GED
Sbjct  61   LSDPEKREIYDQYGEDGLKEGAGGGSTSHNPFDL-----FEAFLNPRYRSHVRRQKQGED  115

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVH L+VSLEDLYNGT+KKLS SRN+LC KCKGKG
Sbjct  116  VVHTLRVSLEDLYNGTTKKLSLSRNILCLKCKGKG  150



>ref|XP_002877319.1| hypothetical protein ARALYDRAFT_905503 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53578.1| hypothetical protein ARALYDRAFT_905503 [Arabidopsis lyrata subsp. 
lyrata]
Length=421

 Score =   183 bits (465),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 143/156 (92%), Gaps = 1/156 (1%)
 Frame = +3

Query  117  MFGRAP-KKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYE  293
            MFGR P KKSD+TK+YEILGVPK+AS +DLKKAY+KAAIK+HPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGPSKKSDNTKFYEILGVPKNASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  294  VLSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgE  473
            VLSDPEKREIYDQYGE+ALKEGMG GGG HDPFDIF SFFG SPFG GGSSRGRRQRRGE
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGRSPFGDGGSSRGRRQRRGE  120

Query  474  DVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            DVVHPLKVSLED+Y GT KKLS SRN LC+KC GKG
Sbjct  121  DVVHPLKVSLEDVYLGTMKKLSLSRNALCSKCNGKG  156



>ref|XP_004291531.1| PREDICTED: dnaJ protein homolog [Fragaria vesca subsp. vesca]
Length=423

 Score =   183 bits (464),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 134/161 (83%), Gaps = 8/161 (5%)
 Frame = +3

Query  117  MFG--RAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAY  290
            MFG  RAPKKSD++KYYEILGV K AS +D+KKAY+KAAIK+HPDKGGDPEKFKELAQAY
Sbjct  1    MFGGGRAPKKSDNSKYYEILGVSKTASPEDVKKAYKKAAIKNHPDKGGDPEKFKELAQAY  60

Query  291  EVLSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDI----fqsffggspfggggssrgrr  458
            EVLSDPEKREIYD+YGE+ LKE M SGG  HDPFDI    F           GGSSRGRR
Sbjct  61   EVLSDPEKREIYDRYGEDGLKEEMQSGG--HDPFDIFSSFFGGGGSPFGGMPGGSSRGRR  118

Query  459  qrrgEDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            QRRGEDVVHPLKVSLEDLY GTSKKLS SRNVLC+KCKGKG
Sbjct  119  QRRGEDVVHPLKVSLEDLYLGTSKKLSLSRNVLCSKCKGKG  159



>gb|KDO48715.1| hypothetical protein CISIN_1g015695mg [Citrus sinensis]
Length=315

 Score =   180 bits (457),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 121/134 (90%), Gaps = 1/134 (1%)
 Frame = +3

Query  180  KDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEEALKEG  359
            K+ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGE+ALKEG
Sbjct  8    KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEG  67

Query  360  MGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgEDVVHPLKVSLEDLYNGTSKKLS  539
            MG GGG HDPFDI    F G    GGGSSRGRRQRRGEDV+HPLKVSLEDLYNGTSKKLS
Sbjct  68   MGGGGGAHDPFDI-FQSFFGGSPFGGGSSRGRRQRRGEDVIHPLKVSLEDLYNGTSKKLS  126

Query  540  PSRNVLCAKCKGKG  581
             SRNV+C KCKGKG
Sbjct  127  LSRNVICTKCKGKG  140



>ref|XP_002275918.1| PREDICTED: dnaJ protein homolog 2 [Vitis vinifera]
Length=419

 Score =   182 bits (463),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGR P++SDSTKYY+ILGV K+A+QD+LKKAY+KAAIK+HPDKGGDPEKFKEL+QAY+V
Sbjct  1    MFGRPPRRSDSTKYYDILGVSKNANQDELKKAYKKAAIKNHPDKGGDPEKFKELSQAYDV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDP+KREIYDQYGE+ LKEGMG GGG H+P DIF+SFFGG  FGGGGSSRGRRQ+RGED
Sbjct  61   LSDPDKREIYDQYGEDGLKEGMGGGGGFHNPVDIFESFFGGGAFGGGGSSRGRRQKRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVH LKVSLEDLYNGTSKKLS SRNV+C KCKGKG
Sbjct  121  VVHTLKVSLEDLYNGTSKKLSLSRNVMCPKCKGKG  155



>emb|CAN64325.1| hypothetical protein VITISV_005641 [Vitis vinifera]
Length=403

 Score =   182 bits (462),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGR P++SDSTKYY+ILGV K+A+QD+LKKAY+KAAIK+HPDKGGDPEKFKEL+QAY+V
Sbjct  1    MFGRPPRRSDSTKYYDILGVSKNANQDELKKAYKKAAIKNHPDKGGDPEKFKELSQAYDV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgED  476
            LSDP+KREIYDQYGE+ LKEGMG GGG H+P DIF+SFFGG  FGGGGSSRGRRQ+RGED
Sbjct  61   LSDPDKREIYDQYGEDGLKEGMGGGGGFHNPVDIFESFFGGGAFGGGGSSRGRRQKRGED  120

Query  477  VVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            VVH LKVSLEDLYNGTSKKLS SRNV+C KCKGKG
Sbjct  121  VVHTLKVSLEDLYNGTSKKLSLSRNVMCPKCKGKG  155



>ref|XP_008361658.1| PREDICTED: dnaJ protein homolog [Malus domestica]
 ref|XP_008355256.1| PREDICTED: dnaJ protein homolog [Malus domestica]
Length=420

 Score =   182 bits (463),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 141/156 (90%), Gaps = 1/156 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+T+YYEILGV + AS DDLKKAY+KAAIK+HPDKGGDPEKFKELA AYE 
Sbjct  1    MFGRAPKKSDNTRYYEILGVSQSASSDDLKKAYKKAAIKNHPDKGGDPEKFKELAHAYEX  60

Query  297  LSDPEKREIYDQYGEEALKE-GMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgE  473
            LSDPEKREIYDQYGE+ALKE   G GGG HDPFDIF SFFGGSPFGGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGGHDPFDIFSSFFGGSPFGGGGSSRGRRQRRGE  120

Query  474  DVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            DVVH LKVSLEDLY GTSKKLS SRNVLC+KC GKG
Sbjct  121  DVVHALKVSLEDLYLGTSKKLSLSRNVLCSKCNGKG  156



>ref|NP_850653.1| chaperone protein dnaJ 3 [Arabidopsis thaliana]
 gb|AEE77864.1| chaperone protein dnaJ 3 [Arabidopsis thaliana]
Length=343

 Score =   181 bits (458),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 126/156 (81%), Positives = 135/156 (87%), Gaps = 2/156 (1%)
 Frame = +3

Query  117  MFGRAP-KKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYE  293
            MFGR P KKSD+TK+YEILGVPK AS +DLKKAY+KAAIK+HPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGPSKKSDNTKFYEILGVPKSASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  294  VLSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgE  473
            VLSDPEKREIYDQYGE+ALKEGMG GGG HDPFDI  S F G    GG +SR RRQRRGE
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDI-FSSFFGGGPFGGNTSRQRRQRRGE  119

Query  474  DVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            DVVHPLKVSLED+Y GT KKLS SRN LC+KC GKG
Sbjct  120  DVVHPLKVSLEDVYLGTMKKLSLSRNALCSKCNGKG  155



>ref|XP_010521621.1| PREDICTED: dnaJ protein homolog ANJ1-like [Tarenaya hassleriana]
Length=423

 Score =   182 bits (463),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 140/158 (89%), Gaps = 3/158 (2%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+T+YYEILGV K+AS +DLKKAY+KAAIK+HPDKGGDPEKFKELA AYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAHAYEV  60

Query  297  LSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDI---fqsffggspfggggssrgrrqrr  467
            LSDPEKR+IYDQYGE+ALKEGMG G G HDPFDI   F    GG  FGGGGSSRGRRQRR
Sbjct  61   LSDPEKRDIYDQYGEDALKEGMGGGPGGHDPFDIFSSFFGGGGGGGFGGGGSSRGRRQRR  120

Query  468  gEDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            GEDVVHPLKVSLEDLY  T+KKLS SRNVLC+KCKGKG
Sbjct  121  GEDVVHPLKVSLEDLYLSTTKKLSLSRNVLCSKCKGKG  158



>ref|XP_009336413.1| PREDICTED: dnaJ protein homolog [Pyrus x bretschneideri]
Length=420

 Score =   182 bits (462),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 141/156 (90%), Gaps = 1/156 (1%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+T+YYEILGV + AS DDLKKAY+KAAIK+HPDKGGDPEKFKELA AYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSQSASSDDLKKAYKKAAIKNHPDKGGDPEKFKELAHAYEV  60

Query  297  LSDPEKREIYDQYGEEALKE-GMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgE  473
            LSDPEKREIYDQYGE+ALKE   G GGG HDPFDIF SFFGGSPFGGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGGHDPFDIFSSFFGGSPFGGGGSSRGRRQRRGE  120

Query  474  DVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            DVVH LKVSLEDL  GTSKKLS SRNVLC+KC GKG
Sbjct  121  DVVHALKVSLEDLCLGTSKKLSLSRNVLCSKCNGKG  156



>gb|AAB49030.1| DnaJ homolog [Arabidopsis thaliana]
Length=420

 Score =   181 bits (459),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 126/156 (81%), Positives = 135/156 (87%), Gaps = 2/156 (1%)
 Frame = +3

Query  117  MFGRAP-KKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYE  293
            MFGR P KKSD+TK+YEILGVPK AS +DLKKAY+KAAIK+HPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGPSKKSDNTKFYEILGVPKSASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  294  VLSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgE  473
            VLSDPEKREIYDQYGE+ALKEGMG GGG HDPFDI  S F G    GG +SR RRQRRGE
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDI-FSSFFGGGPFGGNTSRQRRQRRGE  119

Query  474  DVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            DVVHPLKVSLED+Y GT KKLS SRN LC+KC GKG
Sbjct  120  DVVHPLKVSLEDVYLGTMKKLSLSRNALCSKCNGKG  155



>ref|NP_189997.1| chaperone protein dnaJ 3 [Arabidopsis thaliana]
 sp|Q94AW8.2|DNAJ3_ARATH RecName: Full=Chaperone protein dnaJ 3; Short=AtDjA3; Short=AtJ3; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAB86892.1| AtJ3 [Arabidopsis thaliana]
 emb|CAB88419.1| dnaJ protein homolog atj3 [Arabidopsis thaliana]
 gb|AAK59592.1| putative dnaJ protein homolog atj3 [Arabidopsis thaliana]
 gb|AAM44926.1| putative DnaJ-like protein atj3 [Arabidopsis thaliana]
 gb|AAM65624.1| dnaJ protein homolog atj3 [Arabidopsis thaliana]
 dbj|BAE98606.1| dnaJ protein homolog atj3 [Arabidopsis thaliana]
 gb|AEE77863.1| chaperone protein dnaJ 3 [Arabidopsis thaliana]
Length=420

 Score =   181 bits (459),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 126/156 (81%), Positives = 135/156 (87%), Gaps = 2/156 (1%)
 Frame = +3

Query  117  MFGRAP-KKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYE  293
            MFGR P KKSD+TK+YEILGVPK AS +DLKKAY+KAAIK+HPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGPSKKSDNTKFYEILGVPKSASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  294  VLSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgE  473
            VLSDPEKREIYDQYGE+ALKEGMG GGG HDPFDI  S F G    GG +SR RRQRRGE
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDI-FSSFFGGGPFGGNTSRQRRQRRGE  119

Query  474  DVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            DVVHPLKVSLED+Y GT KKLS SRN LC+KC GKG
Sbjct  120  DVVHPLKVSLEDVYLGTMKKLSLSRNALCSKCNGKG  155



>gb|AAK74013.1| AT3g44110/F26G5_60 [Arabidopsis thaliana]
Length=420

 Score =   181 bits (459),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 126/156 (81%), Positives = 135/156 (87%), Gaps = 2/156 (1%)
 Frame = +3

Query  117  MFGRAP-KKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYE  293
            MFGR P KKSD+TK+YEILGVPK AS +DLKKAY+KAAIK+HPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGPSKKSDNTKFYEILGVPKSASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  294  VLSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgE  473
            VLSDPEKREIYDQYGE+ALKEGMG GGG HDPFDI  S F G    GG +SR RRQRRGE
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDI-FSSFFGGGPFGGNTSRQRRQRRGE  119

Query  474  DVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            DVVHPLKVSLED+Y GT KKLS SRN LC+KC GKG
Sbjct  120  DVVHPLKVSLEDVYLGTMKKLSLSRNALCSKCNGKG  155



>gb|KDO48711.1| hypothetical protein CISIN_1g015695mg [Citrus sinensis]
 gb|KDO48712.1| hypothetical protein CISIN_1g015695mg [Citrus sinensis]
 gb|KDO48713.1| hypothetical protein CISIN_1g015695mg [Citrus sinensis]
Length=402

 Score =   180 bits (457),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 121/134 (90%), Gaps = 1/134 (1%)
 Frame = +3

Query  180  KDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEEALKEG  359
            K+ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGE+ALKEG
Sbjct  8    KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEG  67

Query  360  MGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgEDVVHPLKVSLEDLYNGTSKKLS  539
            MG GGG HDPFDI    F G    GGGSSRGRRQRRGEDV+HPLKVSLEDLYNGTSKKLS
Sbjct  68   MGGGGGAHDPFDI-FQSFFGGSPFGGGSSRGRRQRRGEDVIHPLKVSLEDLYNGTSKKLS  126

Query  540  PSRNVLCAKCKGKG  581
             SRNV+C KCKGKG
Sbjct  127  LSRNVICTKCKGKG  140



>ref|XP_008359180.1| PREDICTED: dnaJ protein homolog [Malus domestica]
Length=424

 Score =   181 bits (458),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 136/160 (85%), Gaps = 5/160 (3%)
 Frame = +3

Query  117  MFGRAPKKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEV  296
            MFGRAPKKSD+T+YYEILGV K AS DDLKKAY+KAAIK+HPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKSASPDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  297  LSDPEKREIYDQYGEEALKE-GMGSGGGMHDPFDIfqs----ffggspfggggssrgrrq  461
            LSDPEKREIYDQYGE+ALKE   G GGG HDPFDIF S       G    GGGSSRGRRQ
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGGHDPFDIFSSFFGGSPFGXKNPGGGSSRGRRQ  120

Query  462  rrgEDVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            RRGEDVVH LKVSLEDLY GTSKKLS SRNVLC+KC GKG
Sbjct  121  RRGEDVVHALKVSLEDLYLGTSKKLSLSRNVLCSKCNGKG  160



>ref|XP_010427107.1| PREDICTED: chaperone protein dnaJ 3 isoform X1 [Camelina sativa]
 ref|XP_010427108.1| PREDICTED: chaperone protein dnaJ 3 isoform X2 [Camelina sativa]
Length=420

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 137/156 (88%), Gaps = 2/156 (1%)
 Frame = +3

Query  117  MFGRAP-KKSDSTKYYEILGVPKDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYE  293
            MFGR P KKSD+TK+YEILGVPK AS +DLKKAY+KAAIK+HPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGPSKKSDNTKFYEILGVPKSASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  294  VLSDPEKREIYDQYGEEALKEGMGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgE  473
            VLSDPEKREIYDQYGE+ALKEG+G GGG HDPFDI  S F G    GGGSSRGRRQRRGE
Sbjct  61   VLSDPEKREIYDQYGEDALKEGLGGGGGGHDPFDI-FSSFFGGSPFGGGSSRGRRQRRGE  119

Query  474  DVVHPLKVSLEDLYNGTSKKLSPSRNVLCAKCKGKG  581
            DVVHPLKVSLED+Y GT KKLS SRN LC+KC GKG
Sbjct  120  DVVHPLKVSLEDVYLGTMKKLSLSRNTLCSKCNGKG  155



>gb|KDO48710.1| hypothetical protein CISIN_1g015695mg [Citrus sinensis]
Length=401

 Score =   179 bits (454),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 118/134 (88%), Gaps = 2/134 (1%)
 Frame = +3

Query  180  KDASQDDLKKAYRKAAIKDHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEEALKEG  359
            K+ASQDDLKKAYRKAAIK+HPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGE+ALKEG
Sbjct  8    KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEG  67

Query  360  MGSGGGMHDPFDIfqsffggspfggggssrgrrqrrgEDVVHPLKVSLEDLYNGTSKKLS  539
            MG GGG HDPFDI            GGSSRGRRQRRGEDV+HPLKVSLEDLYNGTSKKLS
Sbjct  68   MGGGGGAHDPFDI--FQSFFGGSPFGGSSRGRRQRRGEDVIHPLKVSLEDLYNGTSKKLS  125

Query  540  PSRNVLCAKCKGKG  581
             SRNV+C KCKGKG
Sbjct  126  LSRNVICTKCKGKG  139



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 723952452455