BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001D03

Length=593
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ADV57637.1|  copper binding protein 2                                145   6e-40   Gossypium hirsutum [American cotton]
gb|KHG23308.1|  hypothetical protein F383_28880                         145   7e-40   Gossypium arboreum [tree cotton]
ref|XP_009617386.1|  PREDICTED: mavicyanin-like isoform X1              144   2e-39   Nicotiana tomentosiformis
gb|ADV57636.1|  copper binding protein 1                                144   2e-39   Gossypium hirsutum [American cotton]
ref|XP_009759380.1|  PREDICTED: mavicyanin-like isoform X1              143   4e-39   Nicotiana sylvestris
ref|XP_004250256.1|  PREDICTED: early nodulin-like protein 1            137   5e-37   Solanum lycopersicum
ref|XP_007026253.1|  Copper binding protein 9, putative                 137   1e-36   
ref|XP_002520566.1|  Cucumber peeling cupredoxin, putative              136   2e-36   Ricinus communis
ref|XP_006449853.1|  hypothetical protein CICLE_v10018260mg             134   3e-36   
ref|XP_006467342.1|  PREDICTED: early nodulin-like protein 2-like       134   1e-35   Citrus sinensis [apfelsine]
gb|ADV57644.1|  copper binding protein 9                                130   2e-34   Gossypium hirsutum [American cotton]
ref|XP_002528414.1|  Cucumber peeling cupredoxin, putative              131   2e-34   Ricinus communis
emb|CDP04475.1|  unnamed protein product                                130   3e-34   Coffea canephora [robusta coffee]
emb|CAN65487.1|  hypothetical protein VITISV_003681                     130   3e-34   Vitis vinifera
ref|XP_002271669.2|  PREDICTED: mavicyanin                              130   4e-34   Vitis vinifera
ref|XP_003594205.1|  Cucumber peeling cupredoxin                        129   6e-34   Medicago truncatula
ref|XP_010252614.1|  PREDICTED: early nodulin-like protein 1            129   7e-34   Nelumbo nucifera [Indian lotus]
ref|XP_010928149.1|  PREDICTED: mavicyanin-like                         129   1e-33   Elaeis guineensis
ref|XP_010928884.1|  PREDICTED: mavicyanin-like isoform X1              129   1e-33   Elaeis guineensis
gb|KDP37784.1|  hypothetical protein JCGZ_06463                         129   1e-33   Jatropha curcas
ref|XP_010052912.1|  PREDICTED: mavicyanin-like                         128   3e-33   Eucalyptus grandis [rose gum]
ref|XP_010270093.1|  PREDICTED: mavicyanin-like                         127   7e-33   Nelumbo nucifera [Indian lotus]
ref|XP_002323163.2|  hypothetical protein POPTR_0016s01690g             126   2e-32   
gb|KJB57835.1|  hypothetical protein B456_009G182800                    125   3e-32   Gossypium raimondii
ref|XP_002307869.1|  hypothetical protein POPTR_0006s01060g             125   4e-32   Populus trichocarpa [western balsam poplar]
gb|KJB67327.1|  hypothetical protein B456_010G186200                    125   5e-32   Gossypium raimondii
ref|XP_011001012.1|  PREDICTED: umecyanin-like                          125   5e-32   Populus euphratica
ref|XP_008776646.1|  PREDICTED: mavicyanin-like                         124   8e-32   Phoenix dactylifera
ref|XP_008227489.1|  PREDICTED: umecyanin-like                          125   8e-32   Prunus mume [ume]
gb|KHN40835.1|  Blue copper protein                                     124   8e-32   Glycine soja [wild soybean]
ref|XP_004486213.1|  PREDICTED: early nodulin-like protein 2-like       124   9e-32   Cicer arietinum [garbanzo]
gb|KDP40451.1|  hypothetical protein JCGZ_03951                         124   1e-31   Jatropha curcas
gb|KHG13583.1|  hypothetical protein F383_18778                         124   1e-31   Gossypium arboreum [tree cotton]
ref|XP_003546178.1|  PREDICTED: early nodulin-like protein 2-like       123   3e-31   Glycine max [soybeans]
ref|XP_009617387.1|  PREDICTED: mavicyanin-like isoform X2              122   3e-31   Nicotiana tomentosiformis
gb|ACU19792.1|  unknown                                                 122   3e-31   Glycine max [soybeans]
ref|XP_011008637.1|  PREDICTED: umecyanin-like                          123   3e-31   Populus euphratica
gb|AFK33572.1|  unknown                                                 122   5e-31   Lotus japonicus
ref|XP_009759387.1|  PREDICTED: mavicyanin-like isoform X2              122   5e-31   Nicotiana sylvestris
ref|XP_004293353.1|  PREDICTED: mavicyanin-like                         122   7e-31   Fragaria vesca subsp. vesca
ref|XP_007212115.1|  hypothetical protein PRUPE_ppa011974mg             122   8e-31   Prunus persica
ref|XP_007147661.1|  hypothetical protein PHAVU_006G143700g             120   3e-30   Phaseolus vulgaris [French bean]
ref|XP_008384126.1|  PREDICTED: chemocyanin-like                        119   1e-29   
ref|XP_009354404.1|  PREDICTED: early nodulin-like protein 2            119   1e-29   Pyrus x bretschneideri [bai li]
ref|XP_010665738.1|  PREDICTED: mavicyanin-like                         119   1e-29   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009357544.1|  PREDICTED: early nodulin-like protein 2 isof...    118   1e-29   Pyrus x bretschneideri [bai li]
ref|XP_009357543.1|  PREDICTED: early nodulin-like protein 2 isof...    119   2e-29   
emb|CBI33124.3|  unnamed protein product                                118   2e-29   Vitis vinifera
ref|XP_002265268.1|  PREDICTED: uclacyanin-3                            119   2e-29   Vitis vinifera
ref|XP_008371022.1|  PREDICTED: early nodulin-like protein 2            118   2e-29   
ref|XP_010090966.1|  Early nodulin-like protein 2                       118   2e-29   Morus notabilis
ref|XP_004164369.1|  PREDICTED: early nodulin-like protein 2-like       117   3e-29   
ref|XP_004139544.1|  PREDICTED: early nodulin-like protein 2-like       117   4e-29   Cucumis sativus [cucumbers]
ref|XP_008458947.1|  PREDICTED: cucumber peeling cupredoxin-like        117   4e-29   Cucumis melo [Oriental melon]
gb|AAO86692.1|  small blue copper protein Bcp1                          117   6e-29   Paraboea crassifolia
ref|XP_006839071.1|  hypothetical protein AMTR_s00090p00096100          114   6e-28   Amborella trichopoda
ref|XP_009394528.1|  PREDICTED: blue copper protein-like                114   1e-27   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAZ24418.1|  hypothetical protein OsJ_08171                          112   5e-27   Oryza sativa Japonica Group [Japonica rice]
gb|EAY87318.1|  hypothetical protein OsI_08722                          112   6e-27   Oryza sativa Indica Group [Indian rice]
ref|NP_001047949.1|  Os02g0720100                                       111   1e-26   
gb|EYU27713.1|  hypothetical protein MIMGU_mgv1a013383mg                111   2e-26   Erythranthe guttata [common monkey flower]
ref|XP_011095968.1|  PREDICTED: cucumber peeling cupredoxin-like        110   6e-26   Sesamum indicum [beniseed]
dbj|BAK03667.1|  predicted protein                                      108   3e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ADE76474.1|  unknown                                                 106   1e-24   Picea sitchensis
ref|XP_009388141.1|  PREDICTED: early nodulin-like protein 2          99.4    6e-23   
ref|XP_010928885.1|  PREDICTED: uncharacterized protein LOC105050...  96.7    2e-21   
ref|XP_008783093.1|  PREDICTED: uncharacterized protein LOC103702431  92.4    6e-20   
ref|XP_006648997.1|  PREDICTED: uncharacterized protein LOC102713333  92.0    3e-19   
ref|XP_008811152.1|  PREDICTED: pollen allergen Amb a 3-like          89.0    4e-19   Phoenix dactylifera
ref|XP_006848436.1|  hypothetical protein AMTR_s00013p00238100        89.7    1e-18   Amborella trichopoda
ref|XP_007151532.1|  hypothetical protein PHAVU_004G054700g           87.0    1e-17   Phaseolus vulgaris [French bean]
gb|EPS57437.1|  copper binding protein 1                              85.1    2e-17   Genlisea aurea
ref|XP_007161746.1|  hypothetical protein PHAVU_001G095100g           85.9    2e-17   Phaseolus vulgaris [French bean]
ref|NP_001237236.1|  uncharacterized protein LOC100306337 precursor   85.5    6e-17   Glycine max [soybeans]
ref|XP_011003937.1|  PREDICTED: mavicyanin                            84.7    6e-17   Populus euphratica
ref|XP_002509536.1|  Blue copper protein precursor, putative          84.3    8e-17   Ricinus communis
ref|XP_010670421.1|  PREDICTED: basic blue protein-like               84.0    2e-16   Beta vulgaris subsp. vulgaris [field beet]
gb|EPS61406.1|  hypothetical protein M569_13394                       84.0    2e-16   Genlisea aurea
ref|NP_001237874.1|  uncharacterized protein LOC100305865 precursor   82.4    3e-16   Glycine max [soybeans]
ref|XP_004489604.1|  PREDICTED: blue copper protein-like              82.4    5e-16   Cicer arietinum [garbanzo]
gb|KJB11652.1|  hypothetical protein B456_001G270000                  82.0    6e-16   Gossypium raimondii
ref|XP_002298616.2|  hypothetical protein POPTR_0001s33960g           82.0    6e-16   Populus trichocarpa [western balsam poplar]
gb|AFK46705.1|  unknown                                               81.6    7e-16   Lotus japonicus
gb|KHF97412.1|  Blue copper                                           81.6    8e-16   Gossypium arboreum [tree cotton]
ref|XP_006395473.1|  hypothetical protein EUTSA_v10005008mg           80.9    2e-15   Eutrema salsugineum [saltwater cress]
emb|CDX83667.1|  BnaC07g24070D                                        80.5    2e-15   
gb|EAY95049.1|  hypothetical protein OsI_16864                        80.9    2e-15   Oryza sativa Indica Group [Indian rice]
emb|CAH67255.1|  OSIGBa0101C23.7                                      80.9    2e-15   Oryza sativa [red rice]
ref|XP_009129442.1|  PREDICTED: mavicyanin-like                       80.5    2e-15   Brassica rapa
ref|XP_003618846.1|  Plastocyanin-like domain-containing protein      80.9    2e-15   Medicago truncatula
ref|XP_009151984.1|  PREDICTED: mavicyanin                            80.9    2e-15   Brassica rapa
emb|CDY13690.1|  BnaA06g32330D                                        80.5    3e-15   Brassica napus [oilseed rape]
gb|EMT03840.1|  Blue copper protein                                   80.1    3e-15   
ref|NP_001053468.1|  Os04g0545600                                     80.1    4e-15   
emb|CAD41463.3|  OSJNBa0079A21.7                                      79.7    5e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010514410.1|  PREDICTED: mavicyanin-like                       79.3    6e-15   Camelina sativa [gold-of-pleasure]
gb|KFK33640.1|  hypothetical protein AALP_AA5G039900                  79.3    6e-15   Arabis alpina [alpine rockcress]
ref|XP_006291939.1|  hypothetical protein CARUB_v10018126mg           79.3    6e-15   Capsella rubella
gb|AAM62707.1|  blue copper protein, putative                         79.3    7e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010502682.1|  PREDICTED: mavicyanin-like                       79.0    7e-15   Camelina sativa [gold-of-pleasure]
gb|ABK26728.1|  unknown                                               79.0    8e-15   Picea sitchensis
gb|EMS55483.1|  Blue copper protein                                   78.2    1e-14   Triticum urartu
ref|XP_007031840.1|  Cupredoxin superfamily protein                   79.3    1e-14   
ref|XP_010106325.1|  Early nodulin-like protein 1                     79.0    1e-14   Morus notabilis
ref|XP_010528169.1|  PREDICTED: mavicyanin                            78.6    1e-14   Tarenaya hassleriana [spider flower]
ref|XP_010029008.1|  PREDICTED: mavicyanin                            78.6    1e-14   Eucalyptus grandis [rose gum]
gb|KDO57287.1|  hypothetical protein CISIN_1g042916mg                 78.6    1e-14   Citrus sinensis [apfelsine]
ref|XP_006421510.1|  hypothetical protein CICLE_v10005983mg           78.6    2e-14   Citrus clementina [clementine]
ref|XP_007144187.1|  hypothetical protein PHAVU_007G135500g           78.2    2e-14   Phaseolus vulgaris [French bean]
ref|XP_010109138.1|  Blue copper protein                              78.2    2e-14   Morus notabilis
gb|ACR77748.1|  plastocyanin-like domain-containing protein           78.2    2e-14   Astragalus sinicus
ref|XP_011098865.1|  PREDICTED: mavicyanin                            77.8    2e-14   Sesamum indicum [beniseed]
gb|KFK31132.1|  hypothetical protein AALP_AA6G072100                  79.0    2e-14   Arabis alpina [alpine rockcress]
ref|XP_006653637.1|  PREDICTED: blue copper protein-like              77.0    2e-14   Oryza brachyantha
ref|XP_010523261.1|  PREDICTED: stellacyanin                          77.8    2e-14   Tarenaya hassleriana [spider flower]
ref|XP_002297929.1|  hypothetical protein POPTR_0001s11680g           77.8    2e-14   Populus trichocarpa [western balsam poplar]
gb|KDP46298.1|  hypothetical protein JCGZ_10138                       77.4    3e-14   Jatropha curcas
ref|XP_011032393.1|  PREDICTED: mavicyanin-like                       77.8    3e-14   Populus euphratica
ref|XP_002877026.1|  hypothetical protein ARALYDRAFT_484503           77.4    3e-14   
ref|XP_004138792.1|  PREDICTED: blue copper protein-like              77.0    3e-14   
ref|XP_011026746.1|  PREDICTED: mavicyanin                            77.4    3e-14   Populus euphratica
gb|KJB19644.1|  hypothetical protein B456_003G111800                  77.4    4e-14   Gossypium raimondii
ref|XP_004168663.1|  PREDICTED: blue copper protein-like              77.0    4e-14   
emb|CDY28484.1|  BnaC02g36760D                                        77.0    4e-14   Brassica napus [oilseed rape]
ref|XP_010425458.1|  PREDICTED: mavicyanin-like                       77.0    4e-14   Camelina sativa [gold-of-pleasure]
ref|NP_566810.1|  plastocyanin-like domain-containing protein         77.0    4e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009130995.1|  PREDICTED: mavicyanin-like                       77.0    6e-14   Brassica rapa
ref|XP_006490068.1|  PREDICTED: blue copper protein-like              76.6    7e-14   Citrus sinensis [apfelsine]
ref|XP_006289951.1|  hypothetical protein CARUB_v10003579mg           76.6    7e-14   Capsella rubella
ref|XP_011022375.1|  PREDICTED: stellacyanin-like                     76.6    7e-14   Populus euphratica
ref|XP_008231138.1|  PREDICTED: mavicyanin                            76.3    8e-14   Prunus mume [ume]
ref|XP_006399230.1|  hypothetical protein EUTSA_v10014745mg           76.3    8e-14   Eutrema salsugineum [saltwater cress]
ref|XP_006385823.1|  hypothetical protein POPTR_0003s15000g           75.9    9e-14   
ref|XP_006385822.1|  hypothetical protein POPTR_0003s15000g           75.9    1e-13   Populus trichocarpa [western balsam poplar]
emb|CDP16681.1|  unnamed protein product                              75.9    1e-13   Coffea canephora [robusta coffee]
ref|XP_007216268.1|  hypothetical protein PRUPE_ppa017323mg           75.9    1e-13   Prunus persica
ref|XP_004231787.1|  PREDICTED: mavicyanin                            75.9    1e-13   Solanum lycopersicum
gb|KJB79910.1|  hypothetical protein B456_013G071700                  76.6    1e-13   Gossypium raimondii
ref|XP_006338690.1|  PREDICTED: blue copper protein-like              75.5    1e-13   Solanum tuberosum [potatoes]
ref|XP_004287916.1|  PREDICTED: blue copper protein                   76.3    1e-13   Fragaria vesca subsp. vesca
ref|XP_010522318.1|  PREDICTED: blue copper protein                   76.3    2e-13   Tarenaya hassleriana [spider flower]
emb|CDP05527.1|  unnamed protein product                              75.5    2e-13   Coffea canephora [robusta coffee]
emb|CDX81058.1|  BnaC03g03120D                                        75.5    2e-13   
ref|XP_008441346.1|  PREDICTED: mavicyanin-like                       75.1    2e-13   Cucumis melo [Oriental melon]
gb|KHN25766.1|  Early nodulin-like protein 1                          75.5    2e-13   Glycine soja [wild soybean]
ref|XP_003540323.1|  PREDICTED: blue copper protein-like              75.5    2e-13   Glycine max [soybeans]
gb|ACU23845.1|  unknown                                               75.5    2e-13   Glycine max [soybeans]
ref|XP_009612608.1|  PREDICTED: uclacyanin-2-like                     75.5    4e-13   Nicotiana tomentosiformis
ref|XP_002281286.1|  PREDICTED: mavicyanin                            74.3    4e-13   Vitis vinifera
ref|XP_009371662.1|  PREDICTED: mavicyanin                            74.3    4e-13   Pyrus x bretschneideri [bai li]
gb|KHN30685.1|  Blue copper protein                                   73.9    4e-13   Glycine soja [wild soybean]
ref|XP_007149946.1|  hypothetical protein PHAVU_005G112600g           74.3    5e-13   Phaseolus vulgaris [French bean]
ref|XP_004956416.1|  PREDICTED: blue copper protein-like              73.9    6e-13   Setaria italica
ref|XP_009626225.1|  PREDICTED: stellacyanin-like                     73.6    7e-13   Nicotiana tomentosiformis
gb|KHN36563.1|  Early nodulin-like protein 1                          73.9    8e-13   Glycine soja [wild soybean]
ref|XP_003543376.1|  PREDICTED: blue copper protein-like              73.9    8e-13   
gb|ACU19678.1|  unknown                                               73.9    8e-13   Glycine max [soybeans]
emb|CDX70043.1|  BnaA10g23920D                                        73.6    8e-13   
ref|XP_008793738.1|  PREDICTED: blue copper protein-like              73.9    8e-13   Phoenix dactylifera
gb|AAR15424.1|  Cu2+ plastocyanin-like                                73.6    9e-13   Sisymbrium irio
gb|EYU45397.1|  hypothetical protein MIMGU_mgv1a014864mg              73.2    9e-13   Erythranthe guttata [common monkey flower]
dbj|BAJ90938.1|  predicted protein                                    73.2    1e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008379120.1|  PREDICTED: mavicyanin                            72.8    1e-12   
ref|NP_001235329.1|  uncharacterized protein LOC100500505 precursor   73.2    1e-12   Glycine max [soybeans]
ref|XP_010258753.1|  PREDICTED: stellacyanin-like                     73.2    1e-12   Nelumbo nucifera [Indian lotus]
ref|XP_009614877.1|  PREDICTED: basic blue protein-like               72.8    1e-12   Nicotiana tomentosiformis
ref|XP_009122335.1|  PREDICTED: blue copper protein                   73.2    1e-12   Brassica rapa
ref|XP_009764625.1|  PREDICTED: uclacyanin-3-like                     73.6    1e-12   Nicotiana sylvestris
ref|XP_006338895.1|  PREDICTED: blue copper protein-like              72.4    1e-12   Solanum tuberosum [potatoes]
gb|KJB50019.1|  hypothetical protein B456_008G150100                  72.8    1e-12   Gossypium raimondii
ref|XP_009803778.1|  PREDICTED: basic blue protein-like               72.4    2e-12   Nicotiana sylvestris
ref|XP_004307775.1|  PREDICTED: mavicyanin                            72.4    2e-12   Fragaria vesca subsp. vesca
ref|XP_008437239.1|  PREDICTED: chemocyanin-like                      72.8    2e-12   Cucumis melo [Oriental melon]
ref|XP_004137571.1|  PREDICTED: early nodulin-55-2-like               72.8    2e-12   Cucumis sativus [cucumbers]
ref|XP_006299468.1|  hypothetical protein CARUB_v10015633mg           72.4    2e-12   
ref|XP_004303985.1|  PREDICTED: basic blue protein                    72.4    2e-12   Fragaria vesca subsp. vesca
ref|XP_010111589.1|  Blue copper protein                              72.0    2e-12   Morus notabilis
ref|XP_010034982.1|  PREDICTED: blue copper protein                   72.0    2e-12   Eucalyptus grandis [rose gum]
ref|XP_004953983.1|  PREDICTED: blue copper protein-like              72.4    2e-12   Setaria italica
emb|CDY65237.1|  BnaC09g47900D                                        72.0    3e-12   Brassica napus [oilseed rape]
gb|AAR15473.1|  Cu2+ plastocyanin-like                                72.0    3e-12   Olimarabidopsis pumila
ref|XP_006295920.1|  hypothetical protein CARUB_v10025057mg           72.8    3e-12   Capsella rubella
ref|XP_006301030.1|  hypothetical protein CARUB_v10021421mg           73.6    3e-12   Capsella rubella
ref|XP_002511023.1|  Blue copper protein precursor, putative          71.6    3e-12   Ricinus communis
ref|XP_010693462.1|  PREDICTED: stellacyanin-like                     71.6    3e-12   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006301575.1|  hypothetical protein CARUB_v10022013mg           73.6    3e-12   
ref|XP_010247016.1|  PREDICTED: uclacyanin-3                          72.0    3e-12   Nelumbo nucifera [Indian lotus]
ref|XP_004248538.1|  PREDICTED: mavicyanin-like                       71.2    3e-12   Solanum lycopersicum
gb|AFK42126.1|  unknown                                               71.6    4e-12   Lotus japonicus
gb|ABK26526.1|  unknown                                               71.6    4e-12   Picea sitchensis
ref|XP_010052796.1|  PREDICTED: mavicyanin-like                       71.2    4e-12   Eucalyptus grandis [rose gum]
ref|XP_010469615.1|  PREDICTED: blue copper protein                   72.0    4e-12   Camelina sativa [gold-of-pleasure]
ref|XP_011083962.1|  PREDICTED: early nodulin-like protein 1          71.2    5e-12   Sesamum indicum [beniseed]
ref|XP_003597041.1|  Blue copper protein                              71.6    5e-12   Medicago truncatula
gb|AFK38402.1|  unknown                                               71.6    5e-12   Medicago truncatula
ref|XP_010445415.1|  PREDICTED: early nodulin-20-like                 72.4    5e-12   
gb|KDO48731.1|  hypothetical protein CISIN_1g042393mg                 71.2    5e-12   Citrus sinensis [apfelsine]
ref|XP_008230134.1|  PREDICTED: blue copper protein                   71.6    5e-12   Prunus mume [ume]
ref|XP_003556323.1|  PREDICTED: blue copper protein-like              70.9    6e-12   Glycine max [soybeans]
gb|KHN00992.1|  Blue copper protein                                   70.9    6e-12   Glycine soja [wild soybean]
tpg|DAA36598.1|  TPA: hypothetical protein ZEAMMB73_027469            70.9    6e-12   
ref|XP_009771215.1|  PREDICTED: stellacyanin-like                     70.9    6e-12   Nicotiana sylvestris
ref|XP_009370414.1|  PREDICTED: mavicyanin                            70.9    6e-12   Pyrus x bretschneideri [bai li]
ref|NP_001149787.1|  blue copper protein precursor                    70.9    6e-12   Zea mays [maize]
ref|XP_008436972.1|  PREDICTED: stellacyanin                          70.9    7e-12   Cucumis melo [Oriental melon]
ref|XP_009386042.1|  PREDICTED: stellacyanin                          70.9    7e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_680152.1|  cupredoxin superfamily protein                      70.9    7e-12   Arabidopsis thaliana [mouse-ear cress]
gb|KDO55610.1|  hypothetical protein CISIN_1g030729mg                 70.5    7e-12   Citrus sinensis [apfelsine]
ref|XP_006447099.1|  hypothetical protein CICLE_v10016947mg           70.5    7e-12   Citrus clementina [clementine]
gb|KHN24517.1|  Blue copper protein                                   70.5    7e-12   Glycine soja [wild soybean]
ref|XP_006301015.1|  hypothetical protein CARUB_v10021406mg           72.4    8e-12   
ref|XP_006396340.1|  hypothetical protein EUTSA_v10029326mg           72.4    8e-12   
gb|AFK47720.1|  unknown                                               70.9    8e-12   Medicago truncatula
ref|XP_010510046.1|  PREDICTED: blue copper protein-like              71.2    8e-12   Camelina sativa [gold-of-pleasure]
ref|XP_009143966.1|  PREDICTED: blue copper protein-like              71.2    8e-12   Brassica rapa
gb|AAR13691.1|  Cu2+ plastocyanin-like protein                        70.5    8e-12   Brassica oleracea
gb|KDP22478.1|  hypothetical protein JCGZ_26309                       70.5    9e-12   Jatropha curcas
ref|XP_006396338.1|  hypothetical protein EUTSA_v10029173mg           71.2    9e-12   
gb|KCW46231.1|  hypothetical protein EUGRSUZ_K00120                   69.3    9e-12   Eucalyptus grandis [rose gum]
dbj|BAF01024.1|  uclacyanin I - like predicted GPI-anchored protein   71.2    1e-11   Arabidopsis thaliana [mouse-ear cress]
ref|NP_180789.1|  uclacyanin 1                                        70.9    1e-11   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD03006.1|  putative blue copper binding protein                 70.5    1e-11   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ05531.1|  hypothetical protein OsI_27747                        70.5    1e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_008341310.1|  PREDICTED: basic blue protein-like               70.1    1e-11   
emb|CDY19128.1|  BnaA04g18680D                                        70.9    1e-11   Brassica napus [oilseed rape]
gb|EYU20166.1|  hypothetical protein MIMGU_mgv1a022640mg              70.1    1e-11   Erythranthe guttata [common monkey flower]
ref|XP_010429499.1|  PREDICTED: early nodulin-like protein 1          70.1    1e-11   Camelina sativa [gold-of-pleasure]
ref|XP_009117087.1|  PREDICTED: early nodulin-like protein 1          70.1    1e-11   Brassica rapa
emb|CDY34741.1|  BnaA09g41080D                                        70.1    1e-11   Brassica napus [oilseed rape]
ref|XP_009363718.1|  PREDICTED: mavicyanin-like                       69.7    1e-11   Pyrus x bretschneideri [bai li]
ref|XP_010414015.1|  PREDICTED: blue copper protein-like              70.9    1e-11   Camelina sativa [gold-of-pleasure]
gb|KGN50322.1|  hypothetical protein Csa_5G167140                     70.1    1e-11   Cucumis sativus [cucumbers]
dbj|BAB02115.1|  unnamed protein product                              69.7    1e-11   Arabidopsis thaliana [mouse-ear cress]
emb|CDX69514.1|  BnaA10g18630D                                        69.3    1e-11   
ref|XP_010431323.1|  PREDICTED: early nodulin-20-like                 71.6    1e-11   
ref|XP_006441403.1|  hypothetical protein CICLE_v10023892mg           70.5    1e-11   
ref|XP_002303318.2|  hypothetical protein POPTR_0003s04580g           70.1    1e-11   
ref|XP_006599708.1|  PREDICTED: blue copper protein-like              70.1    1e-11   
ref|XP_010506975.1|  PREDICTED: early nodulin-20-like                 71.2    1e-11   Camelina sativa [gold-of-pleasure]
ref|XP_006396274.1|  hypothetical protein EUTSA_v10029152mg           70.9    1e-11   
emb|CDY12217.1|  BnaC04g12470D                                        70.5    1e-11   Brassica napus [oilseed rape]
emb|CDX77822.1|  BnaC07g20760D                                        70.9    1e-11   
ref|XP_004158120.1|  PREDICTED: LOW QUALITY PROTEIN: blue copper ...  69.7    2e-11   
ref|XP_009119630.1|  PREDICTED: early nodulin-55-2-like               70.9    2e-11   Brassica rapa
ref|XP_002515714.1|  Early nodulin 20 precursor, putative             70.5    2e-11   Ricinus communis
ref|XP_010473859.1|  PREDICTED: early nodulin-20-like                 71.2    2e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010417263.1|  PREDICTED: early nodulin-like protein 1          69.3    2e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010491367.1|  PREDICTED: stellacyanin-like                     69.7    2e-11   Camelina sativa [gold-of-pleasure]
dbj|BAJ90875.1|  predicted protein                                    70.1    2e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY65457.1|  BnaC03g71950D                                        70.1    2e-11   Brassica napus [oilseed rape]
gb|KDO59873.1|  hypothetical protein CISIN_1g043413mg                 69.3    2e-11   Citrus sinensis [apfelsine]
ref|XP_006487069.1|  PREDICTED: mavicyanin-like                       69.3    2e-11   
ref|XP_009121559.1|  PREDICTED: uncharacterized protein LOC103846399  70.5    2e-11   Brassica rapa
ref|XP_009386091.1|  PREDICTED: mavicyanin-like                       69.3    2e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001149663.1|  uclacyanin-2 precursor                           68.9    2e-11   
ref|XP_010430622.1|  PREDICTED: early nodulin-20-like                 70.9    2e-11   Camelina sativa [gold-of-pleasure]
ref|XP_008661974.1|  PREDICTED: uclacyanin-2 isoform X1               68.9    2e-11   
emb|CDX93648.1|  BnaA06g04000D                                        70.1    2e-11   
ref|XP_007216249.1|  hypothetical protein PRUPE_ppa017076mg           69.7    2e-11   Prunus persica
ref|XP_010266815.1|  PREDICTED: blue copper protein-like              69.3    2e-11   Nelumbo nucifera [Indian lotus]
ref|XP_009132835.1|  PREDICTED: blue copper protein-like              70.1    2e-11   Brassica rapa
ref|XP_010514244.1|  PREDICTED: early nodulin-20-like                 70.9    2e-11   Camelina sativa [gold-of-pleasure]
ref|XP_009147991.1|  PREDICTED: uncharacterized protein LOC103871491  70.1    3e-11   Brassica rapa
ref|XP_008341968.1|  PREDICTED: blue copper protein-like              69.7    3e-11   Malus domestica [apple tree]
ref|XP_010248962.1|  PREDICTED: mavicyanin                            68.9    3e-11   Nelumbo nucifera [Indian lotus]
ref|XP_006410363.1|  hypothetical protein EUTSA_v10017076mg           70.1    3e-11   Eutrema salsugineum [saltwater cress]
ref|XP_010431319.1|  PREDICTED: early nodulin-20-like                 70.5    3e-11   
ref|XP_006838549.1|  hypothetical protein AMTR_s00002p00202700        68.9    3e-11   Amborella trichopoda
ref|XP_009104069.1|  PREDICTED: early nodulin-20-like                 70.1    3e-11   Brassica rapa
emb|CDY43296.1|  BnaC06g01720D                                        69.7    3e-11   Brassica napus [oilseed rape]
ref|XP_007219230.1|  hypothetical protein PRUPE_ppa017806mg           68.9    3e-11   Prunus persica
ref|XP_010426986.1|  PREDICTED: early nodulin-20-like                 70.5    3e-11   Camelina sativa [gold-of-pleasure]
emb|CDX89970.1|  BnaA10g01120D                                        70.1    3e-11   
ref|XP_002262831.1|  PREDICTED: mavicyanin                            68.6    3e-11   Vitis vinifera
emb|CDY15243.1|  BnaC05g01220D                                        69.3    3e-11   Brassica napus [oilseed rape]
ref|XP_008379078.1|  PREDICTED: early nodulin-like protein 1          68.9    3e-11   Malus domestica [apple tree]
ref|XP_011012945.1|  PREDICTED: chemocyanin-like                      68.9    3e-11   Populus euphratica
ref|XP_002448273.1|  hypothetical protein SORBIDRAFT_06g024270        68.9    3e-11   Sorghum bicolor [broomcorn]
ref|XP_007161082.1|  hypothetical protein PHAVU_001G041400g           68.9    3e-11   Phaseolus vulgaris [French bean]
ref|XP_002887565.1|  hypothetical protein ARALYDRAFT_895360           69.3    3e-11   
ref|XP_010431324.1|  PREDICTED: early nodulin-20-like                 70.5    3e-11   
gb|EAZ41457.1|  hypothetical protein OsJ_25979                        68.9    3e-11   
ref|XP_010426985.1|  PREDICTED: early nodulin-20-like                 70.5    3e-11   
emb|CDX77821.1|  BnaC07g20750D                                        69.7    3e-11   
ref|NP_001060958.2|  Os08g0138200                                     68.6    3e-11   
gb|EAZ05532.1|  hypothetical protein OsI_27748                        68.6    3e-11   
ref|XP_010423489.1|  PREDICTED: uncharacterized protein LOC104708588  69.3    4e-11   
ref|XP_010431322.1|  PREDICTED: early nodulin-20-like                 70.5    4e-11   
gb|AAD23007.1|  similar to early nodulins                             68.6    4e-11   
ref|XP_002876201.1|  hypothetical protein ARALYDRAFT_906720           71.2    4e-11   
ref|NP_180078.2|  early nodulin-like protein 14                       68.6    4e-11   
ref|XP_010424736.1|  PREDICTED: mavicyanin-like                       68.6    4e-11   
ref|XP_010035616.1|  PREDICTED: blue copper protein-like              68.9    4e-11   
gb|KFK32598.1|  hypothetical protein AALP_AA6G264700                  68.2    4e-11   
ref|XP_006447468.1|  hypothetical protein CICLE_v10018339mg           68.6    4e-11   
gb|AAD10251.1|  blue copper-binding protein homolog                   68.2    4e-11   
ref|XP_010258754.1|  PREDICTED: uclacyanin-2-like                     67.8    4e-11   
emb|CDX77818.1|  BnaC07g20720D                                        69.3    5e-11   
ref|XP_008220668.1|  PREDICTED: early nodulin-like protein 1          68.2    5e-11   
ref|XP_002272263.1|  PREDICTED: uclacyanin-3                          68.2    5e-11   
emb|CAN66310.1|  hypothetical protein VITISV_027162                   68.2    5e-11   
ref|XP_006647616.1|  PREDICTED: blue copper protein-like              68.2    5e-11   
ref|XP_006469730.1|  PREDICTED: early nodulin-20-like                 68.6    6e-11   
ref|XP_004487369.1|  PREDICTED: blue copper protein-like              68.6    6e-11   
ref|XP_006659099.1|  PREDICTED: blue copper protein-like              67.8    6e-11   
ref|XP_007152571.1|  hypothetical protein PHAVU_004G141300g           68.2    6e-11   
ref|XP_004152622.1|  PREDICTED: blue copper protein-like              68.2    6e-11   
ref|XP_002879382.1|  hypothetical protein ARALYDRAFT_482160           68.9    6e-11   
emb|CDY26442.1|  BnaC09g42260D                                        68.9    6e-11   
ref|XP_008232494.1|  PREDICTED: uclacyanin-2-like                     67.8    7e-11   
ref|NP_001047603.2|  Os02g0653200                                     67.8    7e-11   
ref|XP_003575446.1|  PREDICTED: stellacyanin-like                     67.8    7e-11   
gb|EMS56683.1|  Blue copper protein                                   66.6    7e-11   
ref|XP_004498804.1|  PREDICTED: early nodulin-like protein 3-like     67.4    8e-11   
ref|XP_010507426.1|  PREDICTED: early nodulin-20-like                 69.3    8e-11   
ref|XP_006653638.1|  PREDICTED: blue copper protein-like              67.8    9e-11   
ref|XP_006295087.1|  hypothetical protein CARUB_v10024160mg           67.4    9e-11   
ref|NP_001152678.1|  blue copper protein precursor                    67.8    9e-11   
ref|XP_010507425.1|  PREDICTED: early nodulin-20-like                 69.3    9e-11   
emb|CDX83276.1|  BnaA03g22300D                                        68.6    9e-11   
ref|XP_010468655.1|  PREDICTED: uncharacterized protein LOC104748756  68.9    1e-10   
ref|XP_006493407.1|  PREDICTED: blue copper protein-like              67.8    1e-10   
ref|XP_009402874.1|  PREDICTED: mavicyanin-like                       67.8    1e-10   
ref|XP_011467067.1|  PREDICTED: mavicyanin-like                       67.0    1e-10   
ref|XP_003570004.1|  PREDICTED: mavicyanin                            67.4    1e-10   
emb|CDY19056.1|  BnaC01g20120D                                        68.9    1e-10   
ref|XP_009342269.1|  PREDICTED: blue copper protein                   67.8    1e-10   
ref|XP_010513183.1|  PREDICTED: mavicyanin-like                       67.4    1e-10   
ref|XP_010437986.1|  PREDICTED: early nodulin-like protein 1          67.0    1e-10   
ref|XP_010101008.1|  Blue copper protein                              67.4    1e-10   
ref|XP_004496082.1|  PREDICTED: blue copper protein-like              67.0    1e-10   
ref|XP_002459877.1|  hypothetical protein SORBIDRAFT_02g012910        67.0    1e-10   
ref|XP_002452517.1|  hypothetical protein SORBIDRAFT_04g027290        67.4    1e-10   
ref|NP_001150898.1|  blue copper protein precursor                    67.0    1e-10   
gb|EMS58904.1|  Mavicyanin                                            66.6    1e-10   
gb|KDO47972.1|  hypothetical protein CISIN_1g046887mg                 66.6    1e-10   
ref|XP_007023289.1|  Cupredoxin superfamily protein, putative         66.6    1e-10   
ref|XP_010931419.1|  PREDICTED: uclacyanin-3-like                     67.4    1e-10   
gb|AAR15487.1|  Cu2+ plastocyanin-like                                67.0    1e-10   
ref|XP_008643784.1|  PREDICTED: blue copper protein isoform X1        67.4    1e-10   
ref|XP_010919749.1|  PREDICTED: blue copper protein-like              67.0    1e-10   
emb|CDY04812.1|  BnaC05g17770D                                        67.0    1e-10   
ref|XP_010456844.1|  PREDICTED: blue copper protein-like              67.4    1e-10   
ref|NP_001168456.1|  uncharacterized protein LOC100382230 precursor   67.0    1e-10   
ref|NP_180240.1|  plastocyanin-like domain-containing protein         67.0    1e-10   
emb|CDX77823.1|  BnaC07g20770D                                        67.4    1e-10   
emb|CDM84499.1|  unnamed protein product                              67.4    2e-10   
ref|XP_010412753.1|  PREDICTED: early nodulin-20-like                 68.6    2e-10   
ref|XP_006390706.1|  hypothetical protein EUTSA_v10019002mg           67.8    2e-10   
ref|XP_008356719.1|  PREDICTED: early nodulin-like protein 2          68.2    2e-10   
ref|XP_007219192.1|  hypothetical protein PRUPE_ppa016927mg           66.6    2e-10   
ref|XP_003588864.1|  Early nodulin-like protein                       66.6    2e-10   
ref|XP_006422904.1|  hypothetical protein CICLE_v10030206mg           66.6    2e-10   
ref|XP_006490063.1|  PREDICTED: blue copper protein-like              67.0    2e-10   
gb|EMS47632.1|  Blue copper protein                                   67.0    2e-10   
ref|XP_002878823.1|  hypothetical protein ARALYDRAFT_481360           66.6    2e-10   
gb|KDO40616.1|  hypothetical protein CISIN_1g039191mg                 67.0    2e-10   
ref|XP_002873311.1|  hypothetical protein ARALYDRAFT_487581           66.6    2e-10   
gb|EMT33683.1|  Blue copper protein                                   66.2    2e-10   
ref|XP_007223558.1|  hypothetical protein PRUPE_ppa012204mg           66.6    2e-10   
ref|XP_004956273.1|  PREDICTED: blue copper protein-like              66.2    2e-10   
dbj|BAK00577.1|  predicted protein                                    66.6    2e-10   
emb|CDX67701.1|  BnaA07g17410D                                        67.8    2e-10   
gb|ADV57638.1|  copper binding protein 3                              66.2    2e-10   
ref|XP_006347977.1|  PREDICTED: uclacyanin-2-like                     66.6    2e-10   
gb|AFK38628.1|  unknown                                               66.6    2e-10   
gb|EMT04532.1|  Mavicyanin                                            66.2    2e-10   
emb|CAC39044.1|  uclacyanin 3-like protein                            66.6    2e-10   
ref|XP_010470172.1|  PREDICTED: early nodulin-20-like                 68.2    2e-10   
ref|XP_010456992.1|  PREDICTED: blue copper protein-like              67.0    2e-10   
ref|XP_010447549.1|  PREDICTED: early nodulin-like protein 1          66.2    2e-10   
ref|NP_194912.1|  early nodulin-like protein 15                       66.2    2e-10   
ref|XP_010234087.1|  PREDICTED: mavicyanin-like                       66.2    2e-10   
emb|CDY31187.1|  BnaC03g47040D                                        67.4    2e-10   
gb|EMT18024.1|  Blue copper protein                                   65.9    2e-10   
ref|XP_004239759.1|  PREDICTED: stellacyanin-like                     66.2    3e-10   
ref|XP_006396515.1|  hypothetical protein EUTSA_v10029200mg           67.4    3e-10   
ref|XP_007038255.1|  Cupredoxin superfamily protein, putative         67.4    3e-10   
ref|XP_010265566.1|  PREDICTED: early nodulin-like protein 1          66.2    3e-10   
ref|XP_007018694.1|  Cupredoxin superfamily protein, putative         66.2    3e-10   
ref|XP_004133765.1|  PREDICTED: blue copper protein-like              65.9    3e-10   
ref|XP_006588272.1|  PREDICTED: blue copper protein-like              66.6    3e-10   
ref|XP_006421526.1|  hypothetical protein CICLE_v10006935mg           66.2    3e-10   
gb|EEC82872.1|  hypothetical protein OsI_27745                        65.9    3e-10   
ref|XP_004955556.1|  PREDICTED: blue copper protein-like              65.9    3e-10   
ref|NP_001060959.1|  Os08g0138400                                     65.9    3e-10   
ref|XP_006483485.1|  PREDICTED: early nodulin-like protein 3-like     65.9    3e-10   
ref|XP_006405200.1|  hypothetical protein EUTSA_v10000583mg           67.0    3e-10   
ref|XP_006284591.1|  hypothetical protein CARUB_v10005819mg           65.9    3e-10   
ref|XP_007132728.1|  hypothetical protein PHAVU_011G119900g           65.9    3e-10   
gb|EEE68013.1|  hypothetical protein OsJ_25976                        65.9    3e-10   
ref|XP_006409778.1|  hypothetical protein EUTSA_v10017601mg           67.0    3e-10   
ref|XP_004301745.2|  PREDICTED: mavicyanin-like                       65.5    3e-10   
ref|NP_001060957.1|  Os08g0137800                                     65.9    3e-10   
ref|XP_006450277.1|  hypothetical protein CICLE_v10009649mg           65.9    3e-10   
ref|XP_010412755.1|  PREDICTED: early nodulin-20-like                 67.8    3e-10   
gb|EMT12765.1|  Mavicyanin                                            65.5    3e-10   
ref|XP_006405205.1|  hypothetical protein EUTSA_v10000654mg           65.1    3e-10   
dbj|BAD03003.1|  putative blue copper binding protein                 65.9    3e-10   
gb|KJB22859.1|  hypothetical protein B456_004G069900                  65.5    4e-10   
ref|XP_011076445.1|  PREDICTED: stellacyanin                          65.5    4e-10   
ref|XP_002884059.1|  hypothetical protein ARALYDRAFT_343365           67.8    4e-10   
ref|XP_003571364.1|  PREDICTED: mavicyanin-like                       65.5    4e-10   
ref|XP_010419426.1|  PREDICTED: mavicyanin-like                       65.9    4e-10   
ref|XP_009359114.1|  PREDICTED: early nodulin-like protein 1          65.5    4e-10   
ref|XP_010421962.1|  PREDICTED: uclacyanin-3-like                     67.4    4e-10   
gb|KHN28111.1|  Early nodulin-like protein 2                          65.5    4e-10   
ref|XP_006409739.1|  hypothetical protein EUTSA_v10017558mg           66.6    4e-10   
ref|XP_006360596.1|  PREDICTED: early nodulin-20-like                 66.6    4e-10   
gb|KJB22860.1|  hypothetical protein B456_004G069900                  65.5    4e-10   
ref|XP_009373210.1|  PREDICTED: uclacyanin-3                          65.5    4e-10   
gb|KHN01118.1|  Early nodulin-like protein 2                          65.1    4e-10   
ref|XP_002869310.1|  hypothetical protein ARALYDRAFT_491553           65.5    4e-10   
ref|NP_001236959.1|  uncharacterized protein LOC100305551 precursor   65.5    4e-10   
gb|KHN29633.1|  Early nodulin-like protein 1                          65.1    5e-10   
emb|CDY18975.1|  BnaC01g20930D                                        65.5    5e-10   
dbj|BAK00202.1|  predicted protein                                    65.1    5e-10   
ref|XP_004291964.1|  PREDICTED: early nodulin-like protein 3          65.5    5e-10   
gb|KHN15298.1|  Early nodulin-like protein 1                          65.1    5e-10   
emb|CDY49660.1|  BnaC09g41380D                                        65.5    5e-10   
gb|KDP33508.1|  hypothetical protein JCGZ_07079                       65.1    5e-10   
ref|XP_003620297.1|  Blue copper protein                              65.5    5e-10   
gb|EYU35332.1|  hypothetical protein MIMGU_mgv1a014570mg              65.5    5e-10   
ref|XP_003591647.1|  Blue copper protein                              65.1    5e-10   
ref|XP_003540921.2|  PREDICTED: early nodulin-like protein 2-like     65.1    5e-10   
ref|XP_002452820.1|  hypothetical protein SORBIDRAFT_04g033180        65.5    5e-10   
ref|XP_008454534.1|  PREDICTED: early nodulin-like protein 3          65.9    5e-10   
ref|XP_008375772.1|  PREDICTED: uclacyanin-2                          64.7    5e-10   
emb|CDX89240.1|  BnaA01g16530D                                        67.0    6e-10   
ref|XP_006412965.1|  hypothetical protein EUTSA_v10026231mg           65.5    6e-10   
ref|XP_009143549.1|  PREDICTED: early nodulin-like protein 2          67.0    6e-10   
ref|NP_001238529.1|  uncharacterized protein LOC100527857 precursor   65.1    6e-10   
ref|XP_011081974.1|  PREDICTED: early nodulin-like protein 1          65.1    6e-10   
ref|XP_006658198.1|  PREDICTED: blue copper protein-like              65.1    6e-10   
ref|XP_002285736.1|  PREDICTED: blue copper protein-like              65.1    6e-10   
ref|XP_010513176.1|  PREDICTED: mavicyanin-like                       65.1    6e-10   
gb|KHG09054.1|  hypothetical protein F383_14449                       65.1    6e-10   
gb|AAO37971.1|  putative blue copper-binding protein                  64.7    6e-10   
ref|XP_002874973.1|  copper ion binding protein                       66.2    7e-10   
gb|EAY92135.1|  hypothetical protein OsI_13846                        64.7    7e-10   
gb|KFK29784.1|  hypothetical protein AALP_AA7G178800                  64.7    7e-10   
ref|NP_001152010.1|  blue copper protein precursor                    64.7    7e-10   
ref|NP_001154404.1|  copper ion binding / electron carrier protein    65.9    7e-10   
gb|EMS50846.1|  Blue copper protein                                   64.7    8e-10   
dbj|BAK00909.1|  predicted protein                                    64.3    8e-10   
emb|CDX76776.1|  BnaC08g33620D                                        64.7    8e-10   
dbj|BAN63377.1|  BnENODL4                                             65.1    9e-10   
ref|XP_003576631.1|  PREDICTED: blue copper protein-like              64.3    9e-10   
ref|XP_010041449.1|  PREDICTED: early nodulin-like protein 1          64.7    9e-10   
ref|XP_004986193.1|  PREDICTED: blue copper protein-like              64.3    9e-10   
gb|KEH19526.1|  plastocyanin-like domain protein                      66.2    9e-10   
gb|EMT12127.1|  Blue copper protein                                   64.3    9e-10   
ref|XP_004310211.1|  PREDICTED: early nodulin-like protein 2          66.6    9e-10   
gb|EMS67148.1|  Early nodulin-like protein 1                          64.3    9e-10   
ref|XP_010536973.1|  PREDICTED: early nodulin-like protein 3          64.3    1e-09   
ref|XP_010242081.1|  PREDICTED: uclacyanin-2-like                     65.5    1e-09   
ref|XP_009353238.1|  PREDICTED: blue copper protein-like              65.1    1e-09   
ref|XP_002275206.1|  PREDICTED: early nodulin-like protein 1          64.7    1e-09   
ref|XP_003526274.1|  PREDICTED: early nodulin-like protein 2-like     64.3    1e-09   
ref|XP_004957077.1|  PREDICTED: blue copper protein-like              63.9    1e-09   
ref|XP_002515421.1|  Early nodulin 55-2 precursor, putative           64.3    1e-09   
ref|XP_004986192.1|  PREDICTED: blue copper protein-like              63.9    1e-09   
ref|XP_010275468.1|  PREDICTED: stellacyanin-like                     64.3    1e-09   
ref|NP_190901.1|  plastocyanin-like domain-containing protein         65.9    1e-09   
ref|XP_004243830.1|  PREDICTED: uclacyanin-2-like                     65.5    1e-09   
ref|XP_009341435.1|  PREDICTED: blue copper protein-like              65.1    1e-09   
ref|XP_009116825.1|  PREDICTED: early nodulin-55-2-like               65.9    1e-09   
ref|XP_002309845.1|  UCLACYANIN 1 family protein                      65.1    1e-09   
ref|XP_010524439.1|  PREDICTED: uclacyanin-2                          64.3    1e-09   
ref|XP_004229737.1|  PREDICTED: uclacyanin-3-like                     64.3    1e-09   
ref|XP_009604686.1|  PREDICTED: uclacyanin-3-like                     63.9    1e-09   
gb|EMT26506.1|  Blue copper protein                                   63.5    1e-09   
ref|XP_010265564.1|  PREDICTED: early nodulin-like protein 1          64.3    1e-09   
ref|XP_003610310.1|  Early nodulin                                    64.3    1e-09   
ref|XP_009126596.1|  PREDICTED: early nodulin-like protein 1          63.9    1e-09   
ref|XP_007050608.1|  Cupredoxin superfamily protein, putative         64.3    1e-09   
sp|P93328.1|NO16_MEDTR  RecName: Full=Early nodulin-16; Short=N-1...  64.3    1e-09   
ref|XP_010467655.1|  PREDICTED: uncharacterized protein LOC104747677  65.5    1e-09   
ref|XP_002443828.1|  hypothetical protein SORBIDRAFT_07g002870        63.9    1e-09   
ref|XP_009133886.1|  PREDICTED: uncharacterized protein LOC103858308  65.5    1e-09   
ref|XP_010484775.1|  PREDICTED: mavicyanin-like                       64.3    1e-09   
ref|XP_006375159.1|  hypothetical protein POPTR_0014s04850g           64.3    1e-09   
ref|XP_003575447.1|  PREDICTED: mavicyanin-like                       64.3    1e-09   
ref|XP_006289948.1|  hypothetical protein CARUB_v10003576mg           65.9    1e-09   
ref|XP_010513178.1|  PREDICTED: mavicyanin-like                       64.3    1e-09   
ref|XP_010473933.1|  PREDICTED: mavicyanin-like                       64.3    1e-09   
ref|XP_004139303.1|  PREDICTED: blue copper protein-like              64.7    1e-09   
ref|XP_004953310.1|  PREDICTED: blue copper protein-like              64.3    1e-09   
ref|XP_006289239.1|  hypothetical protein CARUB_v10002695mg           65.9    1e-09   
ref|XP_011464698.1|  PREDICTED: blue copper protein-like              64.7    1e-09   
ref|XP_006837021.1|  hypothetical protein AMTR_s00098p00173330        63.9    1e-09   
emb|CBI28975.3|  unnamed protein product                              64.3    1e-09   
ref|XP_009137942.1|  PREDICTED: early nodulin-like protein 3          63.9    1e-09   
ref|XP_002459878.1|  hypothetical protein SORBIDRAFT_02g012920        63.9    1e-09   
gb|EMS58906.1|  Blue copper protein                                   63.5    1e-09   
emb|CBI19206.3|  unnamed protein product                              64.3    1e-09   
ref|XP_007136938.1|  hypothetical protein PHAVU_009G086700g           63.9    1e-09   
ref|XP_009408029.1|  PREDICTED: early nodulin-like protein 1          63.9    1e-09   
ref|XP_006289559.1|  hypothetical protein CARUB_v10003105mg           65.5    1e-09   
ref|XP_009797132.1|  PREDICTED: uclacyanin-3-like                     63.5    1e-09   



>gb|ADV57637.1| copper binding protein 2 [Gossypium hirsutum]
Length=171

 Score =   145 bits (366),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D+GW+VS+D+ASWS+ R F VGD IWF Y+AAQESIAE+ S EEY SCD+SNPIR+YT+G
Sbjct  33   DRGWDVSSDVASWSSGRSFRVGDKIWFAYAAAQESIAEVNSPEEYESCDVSNPIRMYTDG  92

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQ  503
            ID IPLDGEG+RYFVSG   SCKNGLKL + V 
Sbjct  93   IDGIPLDGEGIRYFVSGKEESCKNGLKLHVEVM  125



>gb|KHG23308.1| hypothetical protein F383_28880 [Gossypium arboreum]
Length=171

 Score =   145 bits (366),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D+GW+VS+D+ASWS+ R F VGD IWF Y+AAQESIAE+ S EEY SCD+SNPIR+YT+G
Sbjct  33   DRGWDVSSDVASWSSGRSFRVGDKIWFAYAAAQESIAEVNSPEEYESCDVSNPIRMYTDG  92

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQ  503
            ID IPLDGEG+RYFVSG   SCKNGLKL + V 
Sbjct  93   IDGIPLDGEGIRYFVSGKEESCKNGLKLHVEVM  125



>ref|XP_009617386.1| PREDICTED: mavicyanin-like isoform X1 [Nicotiana tomentosiformis]
Length=173

 Score =   144 bits (363),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D+GW+ S+D+ASWS+ R+F VGD IWFTYSAAQES+ EL + EE  SCD++NPI++YT+G
Sbjct  35   DRGWDPSSDVASWSSGRVFRVGDKIWFTYSAAQESVVELRNEEELASCDVTNPIKMYTDG  94

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQ  503
            +DKI L+GEG+RYF SGN  SCKNGLK+P+ +Q
Sbjct  95   LDKISLEGEGIRYFASGNTESCKNGLKIPVKIQ  127



>gb|ADV57636.1| copper binding protein 1 [Gossypium hirsutum]
 gb|KJB57834.1| hypothetical protein B456_009G182800 [Gossypium raimondii]
Length=171

 Score =   144 bits (362),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D+GW++S+D+ASWS+ R F VGD IWF Y+AAQESIAE+ S EEY SCD+SNPIR+YT+G
Sbjct  33   DRGWDLSSDVASWSSGRSFRVGDKIWFAYAAAQESIAEVNSPEEYESCDVSNPIRMYTDG  92

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQ  503
            ID IPLDGEG+RYFVSG   SCKNGLKL + V 
Sbjct  93   IDGIPLDGEGIRYFVSGKEESCKNGLKLHVEVM  125



>ref|XP_009759380.1| PREDICTED: mavicyanin-like isoform X1 [Nicotiana sylvestris]
Length=175

 Score =   143 bits (361),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 83/101 (82%), Gaps = 2/101 (2%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D+GW+ S+D+ASWS+ RIF VGD IWFTYSAAQES+ EL + EE+ SCD++NPI++YT+G
Sbjct  37   DRGWDPSSDVASWSSGRIFRVGDKIWFTYSAAQESVVELRNEEEFTSCDVTNPIKMYTDG  96

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNAI  527
            +DKI L+GEG+RYF SGN  SCK+GLK+P+ +Q  PK   +
Sbjct  97   LDKISLEGEGIRYFASGNTESCKHGLKIPVKIQ--PKEQNV  135



>ref|XP_004250256.1| PREDICTED: early nodulin-like protein 1 [Solanum lycopersicum]
Length=172

 Score =   137 bits (346),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D+GW+ S DI SW + R+F VGD IWFTYS  QES+ EL + E++ SCDLSNPI++YT+G
Sbjct  33   DRGWDPSTDITSWYSQRVFRVGDKIWFTYSTTQESLVELRNEEDFTSCDLSNPIKMYTDG  92

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNA  524
            +D I L+GEG+RYFVSGN  SCKNGLK+P+ +Q   +  A
Sbjct  93   LDTISLEGEGIRYFVSGNTESCKNGLKIPVKIQPKEQIMA  132



>ref|XP_007026253.1| Copper binding protein 9, putative [Theobroma cacao]
 gb|EOY28875.1| Copper binding protein 9, putative [Theobroma cacao]
Length=183

 Score =   137 bits (345),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D+GW+ S+D+ASWS+ R F VGD IWF YSAAQESI EL S++EY SCD+SNPIR+YT+G
Sbjct  33   DRGWDPSSDVASWSSGRSFRVGDKIWFAYSAAQESIIELKSQDEYESCDVSNPIRMYTDG  92

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSS  509
            +D IPLDGEG RYFVS    SCKNGLK+ + V  S
Sbjct  93   LDGIPLDGEGTRYFVSSKPESCKNGLKVNVEVLPS  127



>ref|XP_002520566.1| Cucumber peeling cupredoxin, putative [Ricinus communis]
 gb|EEF41799.1| Cucumber peeling cupredoxin, putative [Ricinus communis]
Length=178

 Score =   136 bits (343),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 78/104 (75%), Gaps = 2/104 (2%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D+GW+ S D+ASW A R F VGD +WF YSA+  +IAEL + EEYMSCD+SNPI+I T+G
Sbjct  35   DRGWDPSTDVASWLAGRTFRVGDKLWFAYSASHGAIAELKTEEEYMSCDVSNPIKILTDG  94

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTV--QSSPKTNAIW  530
            +D I LDGEG+RYFVS NL SCK GL+LP+ V  Q +P    I+
Sbjct  95   LDSILLDGEGIRYFVSSNLESCKKGLRLPVDVISQDAPDAPKIY  138



>ref|XP_006449853.1| hypothetical protein CICLE_v10018260mg, partial [Citrus clementina]
 gb|ESR63093.1| hypothetical protein CICLE_v10018260mg, partial [Citrus clementina]
Length=126

 Score =   134 bits (337),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D+GW+ S+D+ASWSA R+F  GD IW  YS AQESIAEL S+EEY SCD+SNPIR+YT+G
Sbjct  38   DRGWDSSSDVASWSAGRVFRAGDKIWLAYSPAQESIAELQSKEEYESCDVSNPIRMYTDG  97

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKL  488
            +D IPLDGEG+RYF S    +CKNGL L
Sbjct  98   LDVIPLDGEGIRYFASSKYDNCKNGLTL  125



>ref|XP_006467342.1| PREDICTED: early nodulin-like protein 2-like [Citrus sinensis]
 gb|KDO78430.1| hypothetical protein CISIN_1g030047mg [Citrus sinensis]
Length=183

 Score =   134 bits (338),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D+GW+ S+D+ASWSA R+F  GD I   YS AQESIAEL S+EEY SC++SNPIR+YT+G
Sbjct  38   DRGWDSSSDVASWSAGRVFRAGDKILLAYSPAQESIAELQSKEEYESCNVSNPIRMYTDG  97

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNA  524
            +D IPLDGEG+ YFVS    +CKNGLKL + V   P  ++
Sbjct  98   LDVIPLDGEGIHYFVSSKYDNCKNGLKLHVNVLPQPHQSS  137



>gb|ADV57644.1| copper binding protein 9 [Gossypium hirsutum]
Length=149

 Score =   130 bits (327),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 76/105 (72%), Gaps = 5/105 (5%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D+GW+ S D+ASWS+ RIF VGD I F YSAAQESI E+ S++EY SCD+ NPIR+YT G
Sbjct  32   DRGWDPSFDVASWSSGRIFRVGDKICFPYSAAQESIVEVKSKDEYESCDVGNPIRMYTVG  91

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKL-----PLTVQSSPKTNA  524
            +D I LDGEG+RYF+S    SCK GLKL     P   Q+SPK + 
Sbjct  92   LDGIELDGEGIRYFMSSKPESCKKGLKLRVELMPCRAQNSPKRHC  136



>ref|XP_002528414.1| Cucumber peeling cupredoxin, putative [Ricinus communis]
 gb|EEF33956.1| Cucumber peeling cupredoxin, putative [Ricinus communis]
Length=183

 Score =   131 bits (329),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D+GW+ S D+ SWSAAR F VGD IWFTYS  Q  IAEL ++EEY SCD+SNPIR+YT+G
Sbjct  42   DRGWDSSTDMGSWSAARTFRVGDRIWFTYSMVQGRIAELRTKEEYESCDVSNPIRMYTDG  101

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNA  524
            +D I L+ EG+RYFVS + +SCKNGLKL + V     T++
Sbjct  102  LDAISLEQEGIRYFVSSDSNSCKNGLKLHVEVLPHQTTDS  141



>emb|CDP04475.1| unnamed protein product [Coffea canephora]
Length=160

 Score =   130 bits (327),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 71/101 (70%), Gaps = 0/101 (0%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D GW  S D+ SW   R+F VGD IWF Y A +E I EL + EE+ +CDLSNPIR+YT+G
Sbjct  29   DNGWTPSTDLGSWLTGRVFRVGDKIWFAYPATEERILELQTSEEFFTCDLSNPIRMYTSG  88

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNAI  527
            +DKIPL+ EGVR+F SG+  SCKNGLKLP+ V    K   +
Sbjct  89   LDKIPLESEGVRFFTSGSSDSCKNGLKLPVKVHPQVKNETL  129



>emb|CAN65487.1| hypothetical protein VITISV_003681 [Vitis vinifera]
Length=171

 Score =   130 bits (327),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 77/101 (76%), Gaps = 0/101 (0%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D+GW  S+++  W + ++F VGD IWF YSAAQE +AEL S+EE+ SCD+SNPI++YT+G
Sbjct  30   DRGWAKSSEVRDWLSDKVFRVGDKIWFIYSAAQEGVAELRSKEEFESCDVSNPIKMYTDG  89

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNAI  527
            +D +PLDGEG+RYF S    SCK+GLKL + VQ + +  ++
Sbjct  90   LDSVPLDGEGIRYFTSSKTESCKDGLKLHVDVQPTSEVGSV  130



>ref|XP_002271669.2| PREDICTED: mavicyanin [Vitis vinifera]
Length=171

 Score =   130 bits (327),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 77/101 (76%), Gaps = 0/101 (0%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D+GW  S+++  W + ++F VGD IWF YSAAQE +AEL S+EE+ SCD+SNPI++YT+G
Sbjct  30   DRGWAKSSEVRDWLSDKVFRVGDKIWFIYSAAQEGVAELRSKEEFESCDVSNPIKMYTDG  89

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNAI  527
            +D +PLDGEG+RYF S    SCK+GLKL + VQ + +  ++
Sbjct  90   LDSVPLDGEGIRYFTSSKTESCKDGLKLHVDVQPTSEIGSV  130



>ref|XP_003594205.1| Cucumber peeling cupredoxin [Medicago truncatula]
 gb|ABD33017.1| Blue (type 1) copper domain [Medicago truncatula]
 gb|AES64456.1| blue copper-like protein [Medicago truncatula]
Length=171

 Score =   129 bits (325),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 78/104 (75%), Gaps = 2/104 (2%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D GW+ ++DI SWS+ R+F VGD IWF YSAAQ  +AEL SREEY SC++SNPI++YT G
Sbjct  32   DHGWDPNSDILSWSSGRVFRVGDQIWFAYSAAQGLVAELKSREEYESCNMSNPIKMYTEG  91

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNAIWPL  536
            +  IPL+ EG+RYFVS +  +CKNGLKL + VQ  PK + +  L
Sbjct  92   LHTIPLEKEGIRYFVSSDSENCKNGLKLNVEVQ--PKDSPLHAL  133



>ref|XP_010252614.1| PREDICTED: early nodulin-like protein 1 [Nelumbo nucifera]
Length=178

 Score =   129 bits (325),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 70/99 (71%), Gaps = 0/99 (0%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D GW+ S++I +WS+ RIF VGD IWF YS AQESIAEL S+EE+ SCD SNPIR+YT+G
Sbjct  38   DHGWDPSSNIGAWSSGRIFRVGDKIWFAYSVAQESIAELKSKEEFDSCDTSNPIRMYTDG  97

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTN  521
            +D I  D EG  YF SG   SCK GLK  + V   PKT 
Sbjct  98   LDSISFDAEGTHYFTSGRPESCKKGLKFNVEVLPQPKTK  136



>ref|XP_010928149.1| PREDICTED: mavicyanin-like [Elaeis guineensis]
Length=196

 Score =   129 bits (325),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D GW+  +DIA+W+  RIF VGD+IWF YS A+ESIAEL SREE+ SCDL NPIR++T G
Sbjct  46   DPGWDAKSDIAAWAVNRIFRVGDSIWFAYSTAEESIAELQSREEFESCDLRNPIRMFTEG  105

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQ  503
            ++K+ LD EG RYF S N ++CKNGLKL + VQ
Sbjct  106  LNKVSLDVEGSRYFTSSNPNNCKNGLKLHVEVQ  138



>ref|XP_010928884.1| PREDICTED: mavicyanin-like isoform X1 [Elaeis guineensis]
Length=184

 Score =   129 bits (324),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 78/100 (78%), Gaps = 2/100 (2%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D+GW+ ++D+A+WS  R+F VGD IWFTYSA++ESI  LGS+EE+ SC+LSNPI++YT+G
Sbjct  44   DQGWDAASDVAAWSTDRVFRVGDNIWFTYSASRESIIRLGSKEEFESCELSNPIKMYTSG  103

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNA  524
            +D++ LDG G  YF SG L +C+NGLKL   VQ  P+  A
Sbjct  104  LDRVRLDGAGALYFSSGKLENCQNGLKLH--VQVVPQVEA  141



>gb|KDP37784.1| hypothetical protein JCGZ_06463 [Jatropha curcas]
Length=179

 Score =   129 bits (324),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 74/98 (76%), Gaps = 2/98 (2%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D+GW+ S+D+ASWS+ + F VGD IWF YS A   IAELG++EE+ SCD+ NPI++Y +G
Sbjct  36   DRGWDPSSDVASWSSGKTFRVGDKIWFAYSTAHGKIAELGTKEEFESCDVRNPIKLYNDG  95

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTV--QSSP  512
            +  I LDGEG+RYFVS NL SCK GLKLP+ V  Q  P
Sbjct  96   LFNIVLDGEGIRYFVSSNLESCKKGLKLPVEVIPQQQP  133



>ref|XP_010052912.1| PREDICTED: mavicyanin-like [Eucalyptus grandis]
 gb|KCW77054.1| hypothetical protein EUGRSUZ_D01394 [Eucalyptus grandis]
Length=179

 Score =   128 bits (321),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 72/100 (72%), Gaps = 0/100 (0%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D+GW+ S+ + SWSA R+F VGD +WF YSAAQESI EL SR EY SCD+ NPIR+YT+G
Sbjct  34   DRGWDPSSGVGSWSAGRVFRVGDKLWFAYSAAQESIVELTSRAEYESCDVRNPIRMYTDG  93

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNA  524
            +D IPL+  G RYF S    SCK GLKL + VQ S   +A
Sbjct  94   LDGIPLEDRGARYFASSREESCKLGLKLHVEVQPSGAPDA  133



>ref|XP_010270093.1| PREDICTED: mavicyanin-like [Nelumbo nucifera]
Length=186

 Score =   127 bits (319),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 76/107 (71%), Gaps = 1/107 (1%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D+GW+ S+DI +WS+ RIF VGD +WF YS AQESI EL S+EE  SCD+SNPIR+YTNG
Sbjct  38   DRGWDSSSDIGAWSSGRIFRVGDNLWFAYSIAQESIVELRSKEELESCDVSNPIRMYTNG  97

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKT-NAIWPLVL  542
            +D + LD EG RYF SG   +CK GLKL + V     T N   P+++
Sbjct  98   LDSVSLDVEGTRYFTSGRPENCKQGLKLNVEVLPQQNTENQQQPMII  144



>ref|XP_002323163.2| hypothetical protein POPTR_0016s01690g [Populus trichocarpa]
 gb|EEF04924.2| hypothetical protein POPTR_0016s01690g [Populus trichocarpa]
Length=177

 Score =   126 bits (316),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 71/92 (77%), Gaps = 0/92 (0%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D+GW   +DI SWS+AR F VGD IWFT+SAAQ  IAE+ ++EEY++CD+SNPIR+YT+ 
Sbjct  33   DRGWHPYSDIGSWSSARTFRVGDKIWFTHSAAQGRIAEVETKEEYLTCDVSNPIRMYTDD  92

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
             D I LDGEGVRYF S +   CKNGLKL + V
Sbjct  93   SDGITLDGEGVRYFTSSSSDKCKNGLKLHVEV  124



>gb|KJB57835.1| hypothetical protein B456_009G182800 [Gossypium raimondii]
Length=165

 Score =   125 bits (313),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 73/93 (78%), Gaps = 6/93 (6%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D+GW++S+D+ASWS+ R F VGD I      +QESIAE+ S EEY SCD+SNPIR+YT+G
Sbjct  33   DRGWDLSSDVASWSSGRSFRVGDKI------SQESIAEVNSPEEYESCDVSNPIRMYTDG  86

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQ  503
            ID IPLDGEG+RYFVSG   SCKNGLKL + V 
Sbjct  87   IDGIPLDGEGIRYFVSGKEESCKNGLKLHVEVM  119



>ref|XP_002307869.1| hypothetical protein POPTR_0006s01060g [Populus trichocarpa]
 gb|EEE91392.1| hypothetical protein POPTR_0006s01060g [Populus trichocarpa]
Length=177

 Score =   125 bits (314),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 74/99 (75%), Gaps = 0/99 (0%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            ++GW+   D+  WS+AR F VGD IWFT+SAAQ  IAE+ ++EEY++CD+SNPIR+YT+ 
Sbjct  31   ERGWDPYADLGLWSSARTFRVGDKIWFTHSAAQGKIAEVETKEEYLTCDVSNPIRMYTDD  90

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTN  521
            ID I LDGEG+RYF S N   CK+GLKL + V    KT+
Sbjct  91   IDSISLDGEGIRYFTSSNSGKCKSGLKLHVEVVPEGKTD  129



>gb|KJB67327.1| hypothetical protein B456_010G186200 [Gossypium raimondii]
Length=184

 Score =   125 bits (314),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D+GW+ S D+ASWS+ RIF VGD I F YSAAQESI E+ S++EY SCD+ NPIR+YT G
Sbjct  34   DRGWDPSFDVASWSSGRIFRVGDKICFPYSAAQESIVEVKSKDEYESCDVGNPIRMYTVG  93

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKL  488
            +D I LDGEG+RYF+S    SCK GLKL
Sbjct  94   LDGIELDGEGIRYFMSSKPESCKRGLKL  121



>ref|XP_011001012.1| PREDICTED: umecyanin-like [Populus euphratica]
Length=177

 Score =   125 bits (313),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 69/92 (75%), Gaps = 0/92 (0%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D+GW    DI SWS+AR F VGD IWFT SAAQ SIAE+ ++EEY++CD+SNPIR+YT+ 
Sbjct  33   DRGWHPYTDIGSWSSARTFRVGDKIWFTRSAAQGSIAEVETKEEYLTCDVSNPIRMYTDD  92

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
             D I LDGEG RYF S +   CKNGLKL + V
Sbjct  93   SDGITLDGEGARYFTSSSSDKCKNGLKLHVEV  124



>ref|XP_008776646.1| PREDICTED: mavicyanin-like [Phoenix dactylifera]
Length=185

 Score =   124 bits (312),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 75/100 (75%), Gaps = 2/100 (2%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D+GW+ ++D+A+WS  ++F VGD +WFTY AA+ SI ELGS +E+ SCDLSNPIR+Y++G
Sbjct  45   DQGWDAASDMAAWSLDKLFRVGDNLWFTYPAARGSIMELGSSKEFESCDLSNPIRMYSSG  104

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNA  524
            +D++ LD  G RYF SG L  C+NGLK  L VQ  P+  A
Sbjct  105  LDRVSLDAAGARYFSSGKLEDCRNGLK--LHVQVVPQVEA  142



>ref|XP_008227489.1| PREDICTED: umecyanin-like [Prunus mume]
Length=189

 Score =   125 bits (313),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D+GW+ S+D+ASWS+ + F VGD IW  YSAA   IAE+ S+EE+ SCD+SNPIR++T+G
Sbjct  38   DRGWDPSSDLASWSSNKTFRVGDNIWLAYSAAHGYIAEVKSKEEFESCDVSNPIRMFTDG  97

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNAIWP  533
            +D I +D EG+RYF S N+ SCKNGLKL + V      N   P
Sbjct  98   LDSISMDQEGLRYFASSNVESCKNGLKLHVQVMPQSHQNPETP  140



>gb|KHN40835.1| Blue copper protein [Glycine soja]
Length=177

 Score =   124 bits (311),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 71/92 (77%), Gaps = 0/92 (0%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D+GW+ ++D+ SWSA+R+F VGD IW TYS AQ  +AEL SREEY +C++SNPI +YT G
Sbjct  34   DRGWDQTSDLVSWSASRVFRVGDQIWLTYSVAQGLVAELKSREEYEACNVSNPINVYTEG  93

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
            +  IPL+ EG+RYFVS    +CKNGLKL + V
Sbjct  94   LHTIPLESEGMRYFVSSEPENCKNGLKLHVEV  125



>ref|XP_004486213.1| PREDICTED: early nodulin-like protein 2-like [Cicer arietinum]
Length=176

 Score =   124 bits (311),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D+GW+ ++DI SWS+ R+F VGD IW  YSAA+  +AEL SREEY SC++SNPI +YT G
Sbjct  36   DRGWDPNSDIKSWSSGRVFRVGDQIWLAYSAAEGLVAELESREEYESCNVSNPIMMYTEG  95

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNAIWPL  536
            +  IPL+ EG+RYFVS +  +CKNGLKL + VQ     +   P+
Sbjct  96   LHTIPLEREGIRYFVSSDSENCKNGLKLHVDVQPKASPSRASPI  139



>gb|KDP40451.1| hypothetical protein JCGZ_03951 [Jatropha curcas]
Length=186

 Score =   124 bits (311),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D+GW+ S D+ SWS+ R F VGD IWFTYS    +IAEL ++EEY SCD++NPIR+YT+G
Sbjct  37   DRGWDPSTDVGSWSSGRTFRVGDKIWFTYSMVHGNIAELKTKEEYESCDVTNPIRMYTDG  96

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQ  503
            +D I L+ EG+RYFVS N  SCK GLKL + V 
Sbjct  97   LDNILLEEEGIRYFVSSNSKSCKKGLKLHVEVM  129



>gb|KHG13583.1| hypothetical protein F383_18778 [Gossypium arboreum]
Length=179

 Score =   124 bits (310),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 73/103 (71%), Gaps = 5/103 (5%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D+GW+ S D+ASWS+ RIF VGD I F  SAAQESI E+ S++EY SCD+ NPIRIYT G
Sbjct  34   DRGWDPSFDVASWSSGRIFRVGDKICFPSSAAQESIVEVKSKDEYESCDVGNPIRIYTVG  93

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKL-----PLTVQSSPKT  518
            +D I LDGEG+RYF+S    SCK GLKL     PL     P+T
Sbjct  94   LDGIELDGEGIRYFMSSKPESCKKGLKLHVELMPLQSPEFPQT  136



>ref|XP_003546178.1| PREDICTED: early nodulin-like protein 2-like [Glycine max]
 gb|KHN32973.1| Blue copper protein [Glycine soja]
Length=175

 Score =   123 bits (308),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 70/92 (76%), Gaps = 0/92 (0%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D+GW+ ++D+ SW+A R+F VGD IW TYS  Q  +AEL S+EEY +CD+SNPI++YT G
Sbjct  34   DRGWDQTSDLVSWAAGRVFRVGDQIWLTYSVTQGLVAELKSKEEYEACDVSNPIKMYTEG  93

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
            +  IPL+ EG+RYFVS    +CKNGLKL + V
Sbjct  94   LHTIPLESEGMRYFVSSEPENCKNGLKLHIEV  125



>ref|XP_009617387.1| PREDICTED: mavicyanin-like isoform X2 [Nicotiana tomentosiformis]
Length=167

 Score =   122 bits (307),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 73/93 (78%), Gaps = 6/93 (6%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D+GW+ S+D+ASWS+ R+F VGD I      +QES+ EL + EE  SCD++NPI++YT+G
Sbjct  35   DRGWDPSSDVASWSSGRVFRVGDKI------SQESVVELRNEEELASCDVTNPIKMYTDG  88

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQ  503
            +DKI L+GEG+RYF SGN  SCKNGLK+P+ +Q
Sbjct  89   LDKISLEGEGIRYFASGNTESCKNGLKIPVKIQ  121



>gb|ACU19792.1| unknown [Glycine max]
Length=140

 Score =   122 bits (305),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 70/92 (76%), Gaps = 0/92 (0%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D+GW+ ++D  SWSA+R+F VGD IW TYS AQ  +AEL SREEY +C++SNPI +YT G
Sbjct  34   DRGWDQTSDPVSWSASRVFRVGDQIWLTYSVAQGLVAELKSREEYEACNVSNPINVYTEG  93

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
            +  IPL+ EG+RYFVS    +CKNGLKL + V
Sbjct  94   LHTIPLESEGMRYFVSSEPENCKNGLKLHVEV  125



>ref|XP_011008637.1| PREDICTED: umecyanin-like [Populus euphratica]
Length=181

 Score =   123 bits (308),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 71/92 (77%), Gaps = 0/92 (0%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            ++GW+   D+  WS+AR F VGD IWFT+SAAQ  IAE+ ++EEY++CD+SNPIR+YT+ 
Sbjct  31   ERGWDPYADLGLWSSARTFRVGDKIWFTHSAAQGKIAEVETKEEYLTCDVSNPIRMYTDD  90

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
            ID I LDGEG+RYF S N   CK+GLKL + V
Sbjct  91   IDSISLDGEGIRYFTSSNSDKCKSGLKLHVEV  122



>gb|AFK33572.1| unknown [Lotus japonicus]
Length=189

 Score =   122 bits (307),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 79/104 (76%), Gaps = 0/104 (0%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D GW++++D+ +WS+ R+F VGD IW TYSAAQ  +AE+ S+EEY +CD+SNPI++YT+G
Sbjct  40   DPGWDLASDLRAWSSGRVFRVGDQIWLTYSAAQGLVAEVKSKEEYEACDVSNPIKMYTDG  99

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNAIWPL  536
            +  IPL+ EG+RYFVS  + +C +GLKL + V    K+++  P+
Sbjct  100  LHTIPLEREGIRYFVSSEVENCNSGLKLHVEVLPKSKSSSPNPI  143



>ref|XP_009759387.1| PREDICTED: mavicyanin-like isoform X2 [Nicotiana sylvestris]
Length=169

 Score =   122 bits (306),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 77/101 (76%), Gaps = 8/101 (8%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D+GW+ S+D+ASWS+ RIF VGD I      +QES+ EL + EE+ SCD++NPI++YT+G
Sbjct  37   DRGWDPSSDVASWSSGRIFRVGDKI------SQESVVELRNEEEFTSCDVTNPIKMYTDG  90

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNAI  527
            +DKI L+GEG+RYF SGN  SCK+GLK+P+ +Q  PK   +
Sbjct  91   LDKISLEGEGIRYFASGNTESCKHGLKIPVKIQ--PKEQNV  129



>ref|XP_004293353.1| PREDICTED: mavicyanin-like [Fragaria vesca subsp. vesca]
Length=182

 Score =   122 bits (305),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 79/109 (72%), Gaps = 6/109 (6%)
 Frame = +3

Query  225  DKGWEVSN-DIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTN  401
            D+GW+ +N D+ SWS+ + F VGDTIWF YSAA   IAE+ S+EE+ SCD+SNPIR++ +
Sbjct  33   DRGWDPANSDLTSWSSGKSFMVGDTIWFAYSAAHGFIAEVKSKEEFDSCDVSNPIRMFKD  92

Query  402  GIDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTV---QSSPKTNAIWPLV  539
            G+D  P+D EG+RYF S N  SCKNGLKL + V   Q  P+T  + P+V
Sbjct  93   GLDSTPMDKEGLRYFTSSNPESCKNGLKLHVQVVPRQDRPQT--VMPVV  139



>ref|XP_007212115.1| hypothetical protein PRUPE_ppa011974mg [Prunus persica]
 gb|EMJ13314.1| hypothetical protein PRUPE_ppa011974mg [Prunus persica]
Length=189

 Score =   122 bits (306),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 73/103 (71%), Gaps = 0/103 (0%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D+GW+ S+D+ASWS+ + F VGD IW  YSAA   IAE+ S+EE+ SCD+ NPIR++T+G
Sbjct  38   DRGWDPSSDLASWSSNKTFRVGDNIWLAYSAAHGYIAEVKSKEEFESCDVGNPIRMFTDG  97

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNAIWP  533
            +D I +D EG+RYF S N+ SCKNGLKL + V      N   P
Sbjct  98   LDSISMDQEGLRYFASSNVESCKNGLKLHVQVMPQSYQNPETP  140



>ref|XP_007147661.1| hypothetical protein PHAVU_006G143700g [Phaseolus vulgaris]
 gb|ESW19655.1| hypothetical protein PHAVU_006G143700g [Phaseolus vulgaris]
Length=178

 Score =   120 bits (301),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 73/101 (72%), Gaps = 2/101 (2%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D+GW+ ++D+ SWS+ R+F VGD IW TYS A+  +AE+ S+EEY +CD+ NPI++YT G
Sbjct  32   DRGWDPTSDLVSWSSGRLFRVGDQIWLTYSVAEGLVAEVESKEEYEACDVRNPIKMYTEG  91

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNAI  527
            +  IPL+ EG+RYFVS    +CKNGLKL + V   PK   I
Sbjct  92   LHAIPLESEGMRYFVSSEAQNCKNGLKLHIEVL--PKGQGI  130



>ref|XP_008384126.1| PREDICTED: chemocyanin-like [Malus domestica]
Length=175

 Score =   119 bits (297),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D+GW+ S+D+ASWS+ + F  GD +W  YS A   IAE+ S+EE+ SCD++NPIR++T+G
Sbjct  39   DRGWDPSSDLASWSSDKTFRAGDKMWLAYSTAHGYIAEVKSKEEFESCDVTNPIRMFTDG  98

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQ  503
            +D I +D EG+RYF S N+ SCKNGLKL + V 
Sbjct  99   LDSISMDKEGLRYFASSNVESCKNGLKLHVEVM  131



>ref|XP_009354404.1| PREDICTED: early nodulin-like protein 2 [Pyrus x bretschneideri]
 ref|XP_009351254.1| PREDICTED: early nodulin-like protein 2 [Pyrus x bretschneideri]
Length=186

 Score =   119 bits (297),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 70/92 (76%), Gaps = 0/92 (0%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D+GW+ S+D+ASWS+ + F  GD +W  YSAA   IAE+ S+EE+ SCD++NPIR++T+G
Sbjct  39   DRGWDPSSDLASWSSGKTFRAGDKMWLAYSAAHGYIAEVKSKEEFESCDVTNPIRMFTDG  98

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
            +D I +D EG+RYF S N+ SCK GLKL + V
Sbjct  99   LDSISMDKEGLRYFASSNVDSCKKGLKLHVEV  130



>ref|XP_010665738.1| PREDICTED: mavicyanin-like [Beta vulgaris subsp. vulgaris]
Length=182

 Score =   119 bits (297),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 74/96 (77%), Gaps = 2/96 (2%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAA--QESIAELGSREEYMSCDLSNPIRIYT  398
            D+GWE+++DI SW   R F VGD +WF YS+   +++I EL S++E+ SCD+SNPI++YT
Sbjct  37   DRGWELASDIGSWVEGRTFIVGDFLWFAYSSGLDKDNIVELKSKDEFESCDVSNPIKMYT  96

Query  399  NGIDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQS  506
            NG+D+I L+ EG+RYF S +  SCK GLKLP+ ++S
Sbjct  97   NGVDQIALEQEGIRYFTSASSESCKKGLKLPVEIKS  132



>ref|XP_009357544.1| PREDICTED: early nodulin-like protein 2 isoform X2 [Pyrus x bretschneideri]
Length=175

 Score =   118 bits (296),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D+GW+ S+D+ASWS+ + F  GD +W  YS A   IAE+ S+EE+ SCD++NPIR++T+G
Sbjct  39   DRGWDPSSDLASWSSDKTFRAGDKMWLAYSTAHGYIAEVKSKEEFESCDVTNPIRMFTDG  98

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQ  503
            +D I +D EG+RYF S N+ SCKNGLKL + V 
Sbjct  99   LDTISMDKEGLRYFASSNVESCKNGLKLHVEVM  131



>ref|XP_009357543.1| PREDICTED: early nodulin-like protein 2 isoform X1 [Pyrus x bretschneideri]
Length=186

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D+GW+ S+D+ASWS+ + F  GD +W  YS A   IAE+ S+EE+ SCD++NPIR++T+G
Sbjct  39   DRGWDPSSDLASWSSDKTFRAGDKMWLAYSTAHGYIAEVKSKEEFESCDVTNPIRMFTDG  98

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQ  503
            +D I +D EG+RYF S N+ SCKNGLKL + V 
Sbjct  99   LDTISMDKEGLRYFASSNVESCKNGLKLHVEVM  131



>emb|CBI33124.3| unnamed protein product [Vitis vinifera]
Length=186

 Score =   118 bits (296),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 68/94 (72%), Gaps = 0/94 (0%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D+GW+ S+D+ +W + ++F VGD IWF YS  QE + EL SREE+ SCD+SNPIR YT G
Sbjct  30   DRGWDTSSDVQAWLSNKVFRVGDKIWFIYSGGQEGVVELKSREEFDSCDVSNPIRTYTEG  89

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQS  506
            +D + +  EG+RYF S    SCK+GL+L + VQS
Sbjct  90   LDAVLMGSEGIRYFTSSKPKSCKDGLRLLVEVQS  123



>ref|XP_002265268.1| PREDICTED: uclacyanin-3 [Vitis vinifera]
Length=224

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 68/94 (72%), Gaps = 0/94 (0%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D+GW+ S+D+ +W + ++F VGD IWF YS  QE + EL SREE+ SCD+SNPIR YT G
Sbjct  30   DRGWDTSSDVQAWLSNKVFRVGDKIWFIYSGGQEGVVELKSREEFDSCDVSNPIRTYTEG  89

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQS  506
            +D + +  EG+RYF S    SCK+GL+L + VQS
Sbjct  90   LDAVLMGSEGIRYFTSSKPKSCKDGLRLLVEVQS  123



>ref|XP_008371022.1| PREDICTED: early nodulin-like protein 2 [Malus domestica]
Length=186

 Score =   118 bits (296),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 69/93 (74%), Gaps = 0/93 (0%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D+GW+ S+D+ASWS+ + F  GD +W  YSAA   IAE+ S+EE+ SCD++NPIR++T+G
Sbjct  39   DRGWDPSSDLASWSSGKTFRAGDKMWLAYSAAHGYIAEVTSKEEFESCDVTNPIRMFTDG  98

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQ  503
            +D I  D EG+RYF S N+ SCK GLKL + V 
Sbjct  99   LDSISXDNEGLRYFASSNVESCKKGLKLHVEVM  131



>ref|XP_010090966.1| Early nodulin-like protein 2 [Morus notabilis]
 gb|EXB41551.1| Early nodulin-like protein 2 [Morus notabilis]
Length=187

 Score =   118 bits (296),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 76/99 (77%), Gaps = 2/99 (2%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D GW+ S+D+ SWS+ + F VGD IWFTYSAAQ S+AELGSREEY +CDLSNPIR++T+G
Sbjct  35   DPGWDSSSDVPSWSSGKTFRVGDKIWFTYSAAQGSLAELGSREEYEACDLSNPIRLFTDG  94

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTN  521
            +D I L+ E VRYF S +   CKNGLKL + VQ  P+ N
Sbjct  95   LDVISLEAEEVRYFASSSTEHCKNGLKLHVDVQ--PQQN  131



>ref|XP_004164369.1| PREDICTED: early nodulin-like protein 2-like [Cucumis sativus]
Length=181

 Score =   117 bits (294),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 68/90 (76%), Gaps = 0/90 (0%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D+GW+V +DI SWSA RIF VGD IWF YS AQ +I E+  +EEY +C+++N  R+Y++G
Sbjct  36   DRGWDVDSDIGSWSAGRIFRVGDKIWFAYSVAQGNIVEVQRKEEYEACNVTNFSRMYSDG  95

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPL  494
            ID + L+GEG+RYF S    +CKNGLKL +
Sbjct  96   IDIVSLNGEGIRYFASSKAENCKNGLKLHI  125



>ref|XP_004139544.1| PREDICTED: early nodulin-like protein 2-like [Cucumis sativus]
 gb|KGN65059.1| hypothetical protein Csa_1G186640 [Cucumis sativus]
Length=179

 Score =   117 bits (294),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 67/88 (76%), Gaps = 0/88 (0%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D+GW+V +DI SWSA RIF VGD IWF YS AQ +I E+  +EEY +C+++N  R+Y++G
Sbjct  36   DRGWDVDSDIGSWSAGRIFRVGDKIWFAYSVAQGNIVEVQRKEEYEACNVTNFTRMYSDG  95

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKL  488
            ID + L+GEG+RYF S    +CKNGLKL
Sbjct  96   IDIVSLNGEGIRYFASSKAENCKNGLKL  123



>ref|XP_008458947.1| PREDICTED: cucumber peeling cupredoxin-like [Cucumis melo]
Length=179

 Score =   117 bits (293),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 66/88 (75%), Gaps = 0/88 (0%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D+GW+V +DI SWSA R F VGD IWF YS A  +I EL S+EEY +C++SN +R+Y++G
Sbjct  36   DRGWDVDSDIGSWSAGRTFRVGDKIWFAYSVAHGNIVELQSKEEYEACNVSNSMRMYSDG  95

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKL  488
            ID + L+GEG+RYF S    +CK GLKL
Sbjct  96   IDIVALNGEGIRYFASSKAENCKKGLKL  123



>gb|AAO86692.1| small blue copper protein Bcp1 [Paraboea crassifolia]
Length=201

 Score =   117 bits (294),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 70/94 (74%), Gaps = 0/94 (0%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            ++GW  +++I+SW + R+F VGD +WF+  A  +SI EL S EE  +CDL NPIR+Y +G
Sbjct  36   EEGWNSASNISSWLSGRVFRVGDKLWFSVPATADSIVELQSLEELATCDLRNPIRMYADG  95

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQS  506
             + + LD EG RYF SGNL SCKNG+KLP+TVQ+
Sbjct  96   SNHVTLDKEGTRYFSSGNLESCKNGMKLPVTVQN  129



>ref|XP_006839071.1| hypothetical protein AMTR_s00090p00096100 [Amborella trichopoda]
 gb|ERN01640.1| hypothetical protein AMTR_s00090p00096100 [Amborella trichopoda]
Length=168

 Score =   114 bits (285),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 73/99 (74%), Gaps = 2/99 (2%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D+GW+ S+D+ SWS  RIF  GD++WF YSAA+ESI EL S+EE+ SC+++NPIR+Y +G
Sbjct  31   DRGWDRSSDLQSWSQNRIFMPGDSLWFAYSAAEESIVELKSQEEFESCNVNNPIRMYADG  90

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTN  521
            ++++ L G G R+F S N  SC++GLK  L VQ  P T 
Sbjct  91   LNEVKLGGVGSRFFTSANTGSCRSGLK--LHVQVVPTTT  127



>ref|XP_009394528.1| PREDICTED: blue copper protein-like [Musa acuminata subsp. malaccensis]
Length=195

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 68/92 (74%), Gaps = 0/92 (0%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D GW++S+++A+WS  RIF VGD IWF Y+AA+E I EL S ++   CDL +PI +YT+G
Sbjct  55   DLGWDLSSNLAAWSKDRIFRVGDEIWFAYAAAEERILELRSSDKLEECDLDDPIGMYTSG  114

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
            +DK+ LDGEG RYF S    +CKNGLKL + V
Sbjct  115  VDKVRLDGEGARYFASSTSENCKNGLKLRVRV  146



>gb|EAZ24418.1| hypothetical protein OsJ_08171 [Oryza sativa Japonica Group]
Length=183

 Score =   112 bits (279),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 66/94 (70%), Gaps = 0/94 (0%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D GW V++D+ +WSA R+F VGDT+WF YSA    +AE+G  EE+ SCD  +P+R+YT G
Sbjct  39   DPGWAVASDVLAWSADRLFTVGDTLWFAYSAEDGGVAEVGGEEEFESCDAGSPVRMYTEG  98

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQS  506
            + ++ L GEG RYFVS +   C  GLKL + V++
Sbjct  99   LSRVDLGGEGSRYFVSADPDKCGGGLKLRVDVRA  132



>gb|EAY87318.1| hypothetical protein OsI_08722 [Oryza sativa Indica Group]
Length=183

 Score =   112 bits (279),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 66/94 (70%), Gaps = 0/94 (0%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D GW V++D+ +WSA R+F VGDT+WF YSA    +AE+G  EE+ SCD  +P+R+YT G
Sbjct  39   DPGWAVASDVLAWSADRLFTVGDTLWFAYSAEDGGVAEVGGEEEFESCDAGSPVRMYTEG  98

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQS  506
            + ++ L GEG RYFVS +   C  GLKL + V++
Sbjct  99   LSRVDLGGEGSRYFVSADPDKCGGGLKLRVDVRA  132



>ref|NP_001047949.1| Os02g0720100 [Oryza sativa Japonica Group]
 dbj|BAD12871.1| putative small blue copper protein Bcp1 [Oryza sativa Japonica 
Group]
 dbj|BAF09863.1| Os02g0720100 [Oryza sativa Japonica Group]
 dbj|BAG88841.1| unnamed protein product [Oryza sativa Japonica Group]
Length=218

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 66/94 (70%), Gaps = 0/94 (0%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D GW V++D+ +WSA R+F VGDT+WF YSA    +AE+G  EE+ SCD  +P+R+YT G
Sbjct  74   DPGWAVASDVLAWSADRLFTVGDTLWFAYSAEDGGVAEVGGEEEFESCDAGSPVRMYTEG  133

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQS  506
            + ++ L GEG RYFVS +   C  GLKL + V++
Sbjct  134  LSRVDLGGEGSRYFVSADPDKCGGGLKLRVDVRA  167



>gb|EYU27713.1| hypothetical protein MIMGU_mgv1a013383mg [Erythranthe guttata]
Length=222

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 66/88 (75%), Gaps = 1/88 (1%)
 Frame = +3

Query  249  DIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG-IDKIPLD  425
            +++SW + R+F VGD IWF YS  ++SI EL + EE++SC+ +NPIR+YT+     + LD
Sbjct  49   NVSSWLSGRVFKVGDKIWFNYSGTEDSIVELQNMEEFVSCNFTNPIRMYTDDPTSHVSLD  108

Query  426  GEGVRYFVSGNLHSCKNGLKLPLTVQSS  509
             EGVRYF SGNL SCKNGLKLP+ +Q S
Sbjct  109  EEGVRYFASGNLESCKNGLKLPVPIQPS  136



>ref|XP_011095968.1| PREDICTED: cucumber peeling cupredoxin-like [Sesamum indicum]
Length=217

 Score =   110 bits (274),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 72/105 (69%), Gaps = 1/105 (1%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSA-AQESIAELGSREEYMSCDLSNPIRIYTN  401
            + GW    +++SW A R+F VGD IWF +SA A+ESI E+ S EE+ SC+L NPIR+YT+
Sbjct  36   EGGWGPDFNVSSWLAGRVFRVGDKIWFKHSAGAEESIVEVESPEEFQSCNLKNPIRMYTD  95

Query  402  GIDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNAIWPL  536
             +  + L+ EGVRYF S N  SC NGLKLP+ V S  + +  +P+
Sbjct  96   PVSHVALEKEGVRYFTSANPDSCLNGLKLPVAVVSPSEFDPPFPV  140



>dbj|BAK03667.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=217

 Score =   108 bits (269),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 65/95 (68%), Gaps = 0/95 (0%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D GW V++D+ +WS  R+F VGDT+WF Y AA++ +AE+    E+ +C+    IR Y +G
Sbjct  75   DPGWHVASDVLAWSTGRLFTVGDTLWFAYEAAEDGVAEVAGEAEFEACEAGGAIRTYADG  134

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSS  509
            + ++ LDGEG RYF+S +   CK GLKL + V+++
Sbjct  135  VSRVGLDGEGARYFLSADPEKCKGGLKLRVDVRAT  169



>gb|ADE76474.1| unknown [Picea sitchensis]
Length=191

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 65/92 (71%), Gaps = 0/92 (0%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            DKGW+  ++   W++ +IF VGD +WF Y++  +S+ EL SR+E+ +CD+SNPIR+Y  G
Sbjct  40   DKGWDPHSNFHGWASRKIFRVGDNLWFAYASGDQSVLELKSRDEWEACDISNPIRLYKGG  99

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
            +D +PL   G R+F SG +  C+NG+KL + V
Sbjct  100  VDSVPLANVGSRFFSSGRVEDCQNGMKLHINV  131



>ref|XP_009388141.1| PREDICTED: early nodulin-like protein 2, partial [Musa acuminata 
subsp. malaccensis]
Length=108

 Score = 99.4 bits (246),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +3

Query  303  FTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGIDKIPLDGEGVRYFVSGNLHSCKNGL  482
            F YSAA+ES+ EL S+EEY SCDLSNPIR+Y NG+DK+ LDGEG RYF SG L +C+ GL
Sbjct  1    FAYSAAEESLMELQSKEEYESCDLSNPIRMYVNGLDKVSLDGEGTRYFSSGKLENCRKGL  60

Query  483  KLPLTVQ  503
            KL + V 
Sbjct  61   KLHVDVM  67



>ref|XP_010928885.1| PREDICTED: uncharacterized protein LOC105050522 isoform X2 [Elaeis 
guineensis]
Length=156

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D+GW+ ++D+A+WS  R+F VGD IWFTYSA++ESI  LGS+EE+ SC+LSNPI++YT+G
Sbjct  44   DQGWDAASDVAAWSTDRVFRVGDNIWFTYSASRESIIRLGSKEEFESCELSNPIKMYTSG  103

Query  405  IDKI  416
            +D++
Sbjct  104  LDRV  107



>ref|XP_008783093.1| PREDICTED: uncharacterized protein LOC103702431, partial [Phoenix 
dactylifera]
Length=150

 Score = 92.4 bits (228),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +3

Query  303  FTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGIDKIPLDGEGVRYFVSGNLHSCKNGL  482
            F YSA +ESI EL S+EE+ SC+L  PIR+YT+G+D++ LDG G RYF SG L SC+NGL
Sbjct  33   FAYSATRESIIELASKEEFESCELDKPIRMYTSGLDRVSLDGAGARYFSSGKLESCQNGL  92

Query  483  KLPLTV  500
            KL   V
Sbjct  93   KLHAEV  98



>ref|XP_006648997.1| PREDICTED: uncharacterized protein LOC102713333 [Oryza brachyantha]
Length=215

 Score = 92.0 bits (227),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 63/94 (67%), Gaps = 0/94 (0%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D GW V++D+ +WSA R+F VGD +WF YSA    +AE+G    + +C   +P+  YT+G
Sbjct  71   DPGWAVASDVLAWSADRLFTVGDVLWFAYSAEDGGVAEVGGEGGFEACAAGSPVGTYTDG  130

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQS  506
            + ++ LDGEG RYFVS +   C +GLKL + V++
Sbjct  131  LTRVALDGEGSRYFVSADAAKCGSGLKLRVDVRT  164



>ref|XP_008811152.1| PREDICTED: pollen allergen Amb a 3-like [Phoenix dactylifera]
Length=111

 Score = 89.0 bits (219),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D GW+ + DIA+W   RIF VGD IWF YSAA+ESI EL SREE+ SCDL NPI+++T G
Sbjct  46   DPGWDAATDIAAWPVNRIFRVGDRIWFAYSAAEESITELRSREEFESCDLRNPIKMFTEG  105

Query  405  IDK  413
            + +
Sbjct  106  LTR  108



>ref|XP_006848436.1| hypothetical protein AMTR_s00013p00238100 [Amborella trichopoda]
 gb|ERN10017.1| hypothetical protein AMTR_s00013p00238100 [Amborella trichopoda]
Length=173

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 61/94 (65%), Gaps = 0/94 (0%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            +GWE+S D+ SW++A+ F VGD + F Y+    S+ EL +++EY +CDLSN +   ++G 
Sbjct  34   QGWELSTDLDSWASAQTFRVGDQLVFKYTKGLHSVVELANKKEYDACDLSNALSSLSDGS  93

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSS  509
            D + LD  G +YF  G +  C+ G+KL + V S+
Sbjct  94   DVVKLDKPGHKYFTCGTMGHCQGGMKLKVKVLST  127



>ref|XP_007151532.1| hypothetical protein PHAVU_004G054700g [Phaseolus vulgaris]
 gb|ESW23526.1| hypothetical protein PHAVU_004G054700g [Phaseolus vulgaris]
Length=186

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 56/91 (62%), Gaps = 1/91 (1%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            +GW+ S D  SW++ + F VGD + F YS+   S+ ELG    Y +CD+S+PI+  +NG 
Sbjct  31   QGWDQSTDFNSWTSGQTFKVGDKLVFKYSSLH-SVVELGKESAYKNCDISSPIQSLSNGN  89

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
            D + LD  G RYF  G L  C  G+K+ +T+
Sbjct  90   DVVKLDKPGTRYFTCGTLGHCSQGMKMKITI  120



>gb|EPS57437.1| copper binding protein 1, partial [Genlisea aurea]
Length=123

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 59/94 (63%), Gaps = 3/94 (3%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQES-IAELGSREEYMSCDLSNPIRIYTN  401
            D G     ++ SW   R+F VGD +WF Y    E  I E+   +E  SCD+SNPI++Y +
Sbjct  32   DDGLGPDFNLTSWIEGRVFRVGDKLWFKYDGPDEDMIMEVNGPDELESCDVSNPIKMYVD  91

Query  402  GIDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQ  503
               ++PL+ EG+ YF SGN+ +C++GLKL + VQ
Sbjct  92   --RRVPLEREGLHYFASGNVENCRSGLKLIVPVQ  123



>ref|XP_007161746.1| hypothetical protein PHAVU_001G095100g [Phaseolus vulgaris]
 gb|ESW33740.1| hypothetical protein PHAVU_001G095100g [Phaseolus vulgaris]
Length=166

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 54/90 (60%), Gaps = 0/90 (0%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            +GW+ S +  SW + + FNVGD + F YS+   S+ ELGS  EY +CDL N +   ++G 
Sbjct  31   QGWDASTNFNSWVSGQTFNVGDQLVFKYSSGLHSVVELGSESEYKNCDLGNTVNSMSSGN  90

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLT  497
            D + L+  G RYF  G L  C  G+K+ +T
Sbjct  91   DVVKLNKPGARYFACGTLGHCGQGMKVKIT  120



>ref|NP_001237236.1| uncharacterized protein LOC100306337 precursor [Glycine max]
 gb|ACU14464.1| unknown [Glycine max]
 gb|KHN01530.1| Mavicyanin [Glycine soja]
Length=190

 Score = 85.5 bits (210),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 61/102 (60%), Gaps = 4/102 (4%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            +GW+ S D  SW++ + F VGD + F YS+   S+ ELG+   Y +CD+S+P++  + G 
Sbjct  31   QGWDQSTDFKSWTSGQTFKVGDKLVFKYSSFH-SVVELGNESAYKNCDISSPVQSLSTGN  89

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNAIWP  533
            D + LD  G RYF  G L  C  G+K+ +T++   K NA  P
Sbjct  90   DVVKLDKPGTRYFTCGTLGHCSQGMKVKITIR---KGNAPSP  128



>ref|XP_011003937.1| PREDICTED: mavicyanin [Populus euphratica]
Length=170

 Score = 84.7 bits (208),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            +GWE S D +SW++ + F VGD + F Y++   S+ ELG    Y SCDL   +     G 
Sbjct  30   QGWEESTDFSSWASGQKFKVGDQLVFKYTSGLHSVVELGGESAYKSCDLGTALNSMNTGN  89

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQS  506
            D + L+  G RYF  G L  C  G+K+ +TV+S
Sbjct  90   DVVKLNKPGTRYFACGTLGHCGQGMKVKITVES  122



>ref|XP_002509536.1| Blue copper protein precursor, putative [Ricinus communis]
 gb|EEF50923.1| Blue copper protein precursor, putative [Ricinus communis]
Length=166

 Score = 84.3 bits (207),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            +GW+ S D +SW++++ F VGD + F Y++   S+ EL S   Y +CDL +P+   + G 
Sbjct  30   QGWDESADFSSWTSSKKFKVGDQLAFKYTSGLHSVVELASESAYKNCDLGSPLDSLSTGN  89

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQS  506
            D + L  EG RYF  G L  C  G+K+ +T ++
Sbjct  90   DVVKLSKEGTRYFACGTLGHCDQGMKVKITTET  122



>ref|XP_010670421.1| PREDICTED: basic blue protein-like [Beta vulgaris subsp. vulgaris]
Length=177

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 52/95 (55%), Gaps = 0/95 (0%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW+ S D  SW+  + F VGDT+ F Y+    ++AELGS  EY SCD SN     + G D
Sbjct  33   GWDESTDYNSWAKGQTFKVGDTLVFKYTPGLHNVAELGSESEYKSCDTSNAANSMSTGND  92

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPK  515
             + LD  G RYF  G    C  G+KL + V +  K
Sbjct  93   VVKLDKAGSRYFACGTAGHCSAGMKLKVDVVAGDK  127



>gb|EPS61406.1| hypothetical protein M569_13394 [Genlisea aurea]
Length=205

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 58/101 (57%), Gaps = 4/101 (4%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQ-ESIAELGSREEYMSCDLSNPIRIYTNGI  407
            GW    ++ SW   R+F  GD +WF YS    + I E+   +E  +CDLSNPI++YT   
Sbjct  35   GWGPFFNVTSWLDGRVFRRGDKLWFYYSEPDGDMIVEVKGPKELEACDLSNPIQMYT---  91

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNAIW  530
            D +PLD  G+ YF S NL +C +GLKL + V+      + W
Sbjct  92   DHVPLDRRGMHYFASANLRNCNDGLKLAVPVEEEEYDQSEW  132



>ref|NP_001237874.1| uncharacterized protein LOC100305865 precursor [Glycine max]
 gb|ACU13756.1| unknown [Glycine max]
 gb|KHN24323.1| Blue copper protein [Glycine soja]
Length=162

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 56/97 (58%), Gaps = 1/97 (1%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            +GW+ S D  SW + + F VGD + F YS+   S+ ELGS  EY +CDL N +   ++G 
Sbjct  31   QGWDESTDFNSWVSGQTFKVGDQLVFKYSSLH-SVVELGSESEYKNCDLGNAVNSMSSGN  89

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKT  518
            D + L+  G RYF  G +  C  G+K+ +T  S  +T
Sbjct  90   DVVKLNKPGTRYFACGTMGHCDQGMKVKITTVSGSET  126



>ref|XP_004489604.1| PREDICTED: blue copper protein-like [Cicer arietinum]
Length=174

 Score = 82.4 bits (202),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 52/91 (57%), Gaps = 1/91 (1%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            +GW+ S D  SW++ + F VGD + F YS+   S+ EL +   Y  CD+S PI   + G 
Sbjct  31   QGWDQSTDFDSWTSGQTFKVGDQLVFKYSSLH-SVVELSNESTYKKCDISTPINTLSTGK  89

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
            D + LD  G RYF  G L  C  G+K+ +TV
Sbjct  90   DVVKLDKPGTRYFTCGTLGHCGQGMKVKITV  120



>gb|KJB11652.1| hypothetical protein B456_001G270000 [Gossypium raimondii]
Length=167

 Score = 82.0 bits (201),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 57/101 (56%), Gaps = 2/101 (2%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            +GWE S D+ SW++A+ F VGD + F YS+   S+ ELGS   Y +CDL   +     G 
Sbjct  36   QGWEESVDLNSWASAQTFKVGDQLVFKYSSGLHSVVELGSETAYKNCDLGTSLDSKNTGK  95

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQS--SPKTNA  524
            D + L+  G RYF  G L  C  G+K+ +T  +  +P T A
Sbjct  96   DVVKLNKVGTRYFACGTLGHCDQGMKMKVTTVAGNAPSTPA  136



>ref|XP_002298616.2| hypothetical protein POPTR_0001s33960g [Populus trichocarpa]
 gb|EEE83421.2| hypothetical protein POPTR_0001s33960g [Populus trichocarpa]
Length=168

 Score = 82.0 bits (201),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 52/94 (55%), Gaps = 0/94 (0%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
             +GWE S D +SW++ + F VGD + F Y++   S+ ELG    Y SC L   +     G
Sbjct  29   SQGWEESTDFSSWASGQKFKVGDQLVFKYTSGLHSVVELGGESAYKSCGLGTALNSMNTG  88

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQS  506
             D + L+  G RYF  G L  C  G+K+ +TV+S
Sbjct  89   NDVVKLNKPGTRYFACGTLGHCGQGMKVKITVES  122



>gb|AFK46705.1| unknown [Lotus japonicus]
Length=162

 Score = 81.6 bits (200),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 52/90 (58%), Gaps = 0/90 (0%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            +GW+ S D  SW + + FNVGD + F YS+   S+ ELGS  +Y +CD+ + +   ++G 
Sbjct  31   QGWDQSTDFNSWVSGKTFNVGDQLVFKYSSGLHSVVELGSESDYKNCDIGSAVNTMSSGN  90

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLT  497
            D + L   G RYF  G    C  G+K+ +T
Sbjct  91   DAVKLSKPGTRYFACGTSGHCSQGMKVKIT  120



>gb|KHF97412.1| Blue copper [Gossypium arboreum]
Length=167

 Score = 81.6 bits (200),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 57/101 (56%), Gaps = 2/101 (2%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            +GWE S D+ SW++A+ F VGD + F YS+   S+ ELGS   Y +CDL   +     G 
Sbjct  36   QGWEESVDLNSWASAQTFKVGDQLVFKYSSGLHSVVELGSETAYKNCDLGTSLDSKNTGN  95

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQS--SPKTNA  524
            D + L+  G RYF  G L  C  G+K+ +T  +  +P T A
Sbjct  96   DVVKLNKVGTRYFACGTLGHCDQGMKMKITTVAGNAPSTPA  136



>ref|XP_006395473.1| hypothetical protein EUTSA_v10005008mg [Eutrema salsugineum]
 gb|ESQ32759.1| hypothetical protein EUTSA_v10005008mg [Eutrema salsugineum]
Length=175

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 54/98 (55%), Gaps = 1/98 (1%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            +GWE S D  SWS+ + F VGD + F YS    S+ ELGS   Y SCDL  P+   ++G 
Sbjct  32   QGWEQSVDFDSWSSDQSFKVGDQLVFKYSGLH-SVVELGSETAYKSCDLGTPVNSLSSGN  90

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTN  521
            D + L   G RYF  G    C+ G+K+ + V SS  T 
Sbjct  91   DVVKLSKTGTRYFACGTPGHCEQGMKVKVNVVSSDSTT  128



>emb|CDX83667.1| BnaC07g24070D [Brassica napus]
Length=173

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 55/97 (57%), Gaps = 1/97 (1%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            +GWE S D  SWS+ + F VGD + F YS    S+ ELGS   Y SCDL  P+   ++G 
Sbjct  32   QGWEQSVDFDSWSSDKSFKVGDQLVFKYSGLH-SVVELGSEAAYKSCDLGTPVNSLSSGN  90

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKT  518
            D + L   G RYF  G    C++G+K+ + V S+  T
Sbjct  91   DVVKLSKTGTRYFACGTPGHCQSGMKVKVNVVSADST  127



>gb|EAY95049.1| hypothetical protein OsI_16864 [Oryza sativa Indica Group]
Length=181

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 54/92 (59%), Gaps = 1/92 (1%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW    D  +W+  + FN+GDT+ F Y++A  S+ E+ S  ++ SC  +NP+R Y +G  
Sbjct  33   GWTTGVDYTAWARGKTFNIGDTLLFQYTSAGHSVVEV-SEADHTSCSAANPLRSYKDGTT  91

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQS  506
             + L   G RYF+ G+   C  G+KL +TV S
Sbjct  92   IVTLTRSGTRYFICGSTGHCGAGMKLTVTVAS  123



>emb|CAH67255.1| OSIGBa0101C23.7 [Oryza sativa Indica Group]
Length=181

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 54/92 (59%), Gaps = 1/92 (1%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW    D  +W+  + FN+GDT+ F Y++A  S+ E+ S  ++ SC  +NP+R Y +G  
Sbjct  33   GWTTGVDYTAWARGKTFNIGDTLLFQYTSAGHSVVEV-SEADHTSCSAANPLRSYKDGTT  91

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQS  506
             + L   G RYF+ G+   C  G+KL +TV S
Sbjct  92   IVTLTRSGTRYFICGSTGHCGAGMKLTVTVAS  123



>ref|XP_009129442.1| PREDICTED: mavicyanin-like [Brassica rapa]
Length=168

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 54/97 (56%), Gaps = 1/97 (1%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            +GWE S D  SWS+ + F VGD + F YS    S+ ELGS   Y SCDL  P+   ++G 
Sbjct  30   QGWEESVDFDSWSSDQSFKVGDQLVFKYSGLH-SVVELGSETAYKSCDLGTPVNSLSSGN  88

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKT  518
            D + L   G RYF  G    C+ G+K+ + V SS  T
Sbjct  89   DVVKLSETGTRYFACGTPGHCEQGMKVKVNVVSSDST  125



>ref|XP_003618846.1| Plastocyanin-like domain-containing protein [Medicago truncatula]
 gb|AES75064.1| plastocyanin-like domain protein [Medicago truncatula]
 gb|AFK46467.1| unknown [Medicago truncatula]
Length=179

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 52/91 (57%), Gaps = 1/91 (1%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            +GW+ S+D  SWS+ + F VGD + F Y++   S+ EL     Y  CD+S P+   + G 
Sbjct  32   QGWDPSSDFDSWSSGQTFKVGDQLVFKYTS-MHSVVELSDESAYKKCDISTPLNSLSTGK  90

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
            D + LD  G RYF  G L  C  G+K+ +TV
Sbjct  91   DVVKLDKPGTRYFTCGTLGHCDQGMKVKITV  121



>ref|XP_009151984.1| PREDICTED: mavicyanin [Brassica rapa]
Length=187

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 55/97 (57%), Gaps = 1/97 (1%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            +GWE S D  SWS+ + F VGD + F YS    S+ ELGS   Y SCDL  P+   ++G 
Sbjct  32   QGWEQSVDFDSWSSDKSFKVGDQLVFKYSGLH-SVVELGSEAAYKSCDLGTPVNSLSSGN  90

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKT  518
            D + L   G RYF  G    C++G+K+ + V S+  T
Sbjct  91   DVVKLSKTGTRYFACGTPGHCQSGMKVKVNVVSADST  127



>emb|CDY13690.1| BnaA06g32330D [Brassica napus]
Length=187

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 55/97 (57%), Gaps = 1/97 (1%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            +GWE S D  SWS+ + F VGD + F YS    S+ ELGS   Y SCDL  P+   ++G 
Sbjct  32   QGWEQSVDFDSWSSDKSFKVGDQLVFKYSGLH-SVVELGSEAAYKSCDLGTPVNSLSSGN  90

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKT  518
            D + L   G RYF  G    C++G+K+ + V S+  T
Sbjct  91   DVVKLSKTGTRYFACGTPGHCQSGMKVKVNVVSADST  127



>gb|EMT03840.1| Blue copper protein [Aegilops tauschii]
Length=163

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 63/97 (65%), Gaps = 7/97 (7%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D GW V++D+ +WSA R+F VGDT+WF Y AA+ +        E+  C+  +PIR YT+G
Sbjct  24   DPGWAVASDVLAWSAGRLFTVGDTLWFAYEAAEVAGE-----AEFEPCEAGDPIRTYTDG  78

Query  405  IDKIP--LDGEGVRYFVSGNLHSCKNGLKLPLTVQSS  509
            + ++   LD EG RYF+S +   CK GLKL + V+++
Sbjct  79   LSRVRVGLDDEGTRYFLSADPAKCKGGLKLRVDVRAT  115



>ref|NP_001053468.1| Os04g0545600 [Oryza sativa Japonica Group]
 dbj|BAF15382.1| Os04g0545600 [Oryza sativa Japonica Group]
 dbj|BAG99604.1| unnamed protein product [Oryza sativa Japonica Group]
Length=191

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 54/92 (59%), Gaps = 1/92 (1%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW    D  +W+  + FN+GDT+ F Y++A  S+ E+ S  ++ SC  +NP+R Y +G  
Sbjct  43   GWTTGVDYTAWARGKTFNIGDTLLFQYTSAGHSVVEV-SEADHTSCSAANPLRSYKDGTT  101

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQS  506
             + L   G RYF+ G+   C  G+KL +TV +
Sbjct  102  IVTLTRSGTRYFICGSTGHCGAGMKLTVTVAT  133



>emb|CAD41463.3| OSJNBa0079A21.7 [Oryza sativa Japonica Group]
 gb|EAZ31523.1| hypothetical protein OsJ_15663 [Oryza sativa Japonica Group]
Length=181

 Score = 79.7 bits (195),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 54/92 (59%), Gaps = 1/92 (1%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW    D  +W+  + FN+GDT+ F Y++A  S+ E+ S  ++ SC  +NP+R Y +G  
Sbjct  33   GWTTGVDYTAWARGKTFNIGDTLLFQYTSAGHSVVEV-SEADHTSCSAANPLRSYKDGTT  91

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQS  506
             + L   G RYF+ G+   C  G+KL +TV +
Sbjct  92   IVTLTRSGTRYFICGSTGHCGAGMKLTVTVAT  123



>ref|XP_010514410.1| PREDICTED: mavicyanin-like [Camelina sativa]
Length=173

 Score = 79.3 bits (194),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 52/91 (57%), Gaps = 1/91 (1%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            +GWE S D  SWS+ + F VGD + F YS    S+ ELGS   Y SCDL  P+   ++G 
Sbjct  32   QGWEQSVDFDSWSSDQSFKVGDQLVFKYSGLH-SVVELGSETAYKSCDLGTPVNSLSSGN  90

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
            D + L   G RYF  G +  C+ G+K+ + V
Sbjct  91   DVVKLSKTGTRYFACGTVGHCEQGMKIKVNV  121



>gb|KFK33640.1| hypothetical protein AALP_AA5G039900 [Arabis alpina]
Length=181

 Score = 79.3 bits (194),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 54/99 (55%), Gaps = 1/99 (1%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            +GWE + D  SWS+ + F VGD + F YS    S+ ELGS   Y SCDL  P+   ++G 
Sbjct  32   QGWEQTIDFNSWSSDQSFKVGDQLVFKYSGLH-SVVELGSETAYKSCDLGTPVNSLSSGN  90

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNA  524
            D + L   G RYF  G    C+ G+K+ + V SS    A
Sbjct  91   DVVKLSKTGTRYFACGTPGHCEQGMKITVNVGSSDSKTA  129



>ref|XP_006291939.1| hypothetical protein CARUB_v10018126mg [Capsella rubella]
 gb|EOA24837.1| hypothetical protein CARUB_v10018126mg [Capsella rubella]
Length=171

 Score = 79.3 bits (194),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 52/91 (57%), Gaps = 1/91 (1%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            +GWE S D  SWS+ + F VGD + F YS    S+ ELGS   Y SCDL  P+   ++G 
Sbjct  32   QGWEQSVDFDSWSSDQSFKVGDQLVFKYSGLH-SVVELGSETAYKSCDLGTPVNSLSSGN  90

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
            D + L   G RYF  G +  C+ G+K+ + V
Sbjct  91   DVVKLSKTGTRYFACGTVGHCEQGMKIKVNV  121



>gb|AAM62707.1| blue copper protein, putative [Arabidopsis thaliana]
Length=172

 Score = 79.3 bits (194),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 52/91 (57%), Gaps = 1/91 (1%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            +GWE S D  SWS+ + F VGD I F YS    S+ ELGS   Y SCDL   +   ++G 
Sbjct  32   QGWEQSVDFDSWSSDQSFKVGDQIVFKYSGLH-SVVELGSETAYKSCDLGTSVNSLSSGN  90

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
            D + L   G RYFV G +  C+ G+K+ + V
Sbjct  91   DVVKLSKTGTRYFVCGTVGHCEQGMKIKVNV  121



>ref|XP_010502682.1| PREDICTED: mavicyanin-like [Camelina sativa]
Length=175

 Score = 79.0 bits (193),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 52/91 (57%), Gaps = 1/91 (1%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            +GWE S D  SWS+ + F VGD + F YS    S+ ELGS   Y SCDL  P+   ++G 
Sbjct  32   QGWEQSVDFDSWSSDQSFKVGDQLVFKYSGLH-SVVELGSETAYKSCDLGTPVNSLSSGN  90

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
            D + L   G RYF  G +  C+ G+K+ + V
Sbjct  91   DVLKLSKTGTRYFACGTVGHCEQGMKIKVNV  121



>gb|ABK26728.1| unknown [Picea sitchensis]
Length=184

 Score = 79.0 bits (193),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 55/94 (59%), Gaps = 0/94 (0%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            +GW++S D  +W + + F VGDT+ F Y+    S+ EL S ++Y +C++ NP+   + G 
Sbjct  44   QGWDLSTDFNTWESGKTFKVGDTLSFKYTTGLHSVVELASEKDYNACNIGNPVNSLSGGS  103

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSS  509
            + + L+  G RYF  G    C  G+K+ + V ++
Sbjct  104  NVVKLNKAGTRYFACGTPGHCSGGMKMKVKVVAA  137



>gb|EMS55483.1| Blue copper protein [Triticum urartu]
Length=151

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 62/105 (59%), Gaps = 6/105 (6%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW++S D+ SW+AA+IFNVGD + FTYS    ++ E+ +   + SC  +N +   ++G  
Sbjct  34   GWDISADLQSWAAAKIFNVGDVLVFTYS-KTHTLDEVDA-AGFKSCSAANALLSSSDGNT  91

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQ----SSPKTNAIWP  533
             +PL   G RYF+ G+   C  G+KL + V     S+P+   +WP
Sbjct  92   TVPLTAGGDRYFICGHQMHCLGGMKLHVHVTSPAGSTPRVGVVWP  136



>ref|XP_007031840.1| Cupredoxin superfamily protein [Theobroma cacao]
 gb|EOY02766.1| Cupredoxin superfamily protein [Theobroma cacao]
Length=206

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 50/91 (55%), Gaps = 0/91 (0%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            +GW+ S D+ SW++ + F VGD + F YS+   S+ ELGS   Y +CDL   +     G 
Sbjct  74   QGWDESVDLNSWASGQTFKVGDQLVFKYSSGLHSVVELGSETAYKNCDLGTALDSKNTGD  133

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
            D + L   G RYF  G L  C  G+K+ +T 
Sbjct  134  DVVKLSKVGTRYFACGTLGHCDQGMKMKITT  164



>ref|XP_010106325.1| Early nodulin-like protein 1 [Morus notabilis]
 gb|EXC10039.1| Early nodulin-like protein 1 [Morus notabilis]
Length=207

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 54/86 (63%), Gaps = 2/86 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW+++++I +W++   F+VGD + F+Y+   + +      E+Y SCD+S+PIR Y +G  
Sbjct  39   GWDLTSNIQAWASQTTFHVGDYLVFSYTPVHDVLEV--EEEDYKSCDISDPIRTYNDGET  96

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKL  488
             IPL  EG RYF+ G    C  GLKL
Sbjct  97   VIPLTQEGPRYFICGRQGHCSMGLKL  122



>ref|XP_010528169.1| PREDICTED: mavicyanin [Tarenaya hassleriana]
Length=184

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 52/94 (55%), Gaps = 1/94 (1%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            +GWE S D  SW++   F +GD + F YS    S+ ELGS   Y SCDL  P++  ++G 
Sbjct  31   QGWEESTDFDSWASGLTFKLGDQLVFKYSGLH-SVVELGSETAYKSCDLGTPVKSMSSGN  89

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSS  509
            D + L   G RYF  G    C  G+K+ + V SS
Sbjct  90   DVVKLTKPGARYFACGTPGHCDQGMKVKVNVVSS  123



>ref|XP_010029008.1| PREDICTED: mavicyanin [Eucalyptus grandis]
 gb|KCW55841.1| hypothetical protein EUGRSUZ_I01655 [Eucalyptus grandis]
Length=175

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 49/90 (54%), Gaps = 0/90 (0%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            +GW+ S +  SW++A+ F VGD + F YS    S+ EL S   Y SCD+   +   + G 
Sbjct  38   QGWDESTNFDSWTSAQTFKVGDQLVFKYSQGLHSVVELSSEAAYKSCDIGKSVNSLSTGN  97

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLT  497
            D + LD  G RYF  G    C  G+KL +T
Sbjct  98   DVVKLDKPGTRYFACGTTGHCGQGMKLKVT  127



>gb|KDO57287.1| hypothetical protein CISIN_1g042916mg [Citrus sinensis]
Length=189

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 61/90 (68%), Gaps = 2/90 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW++S+++ +W   ++F VGD + F+YSA+  S+ E+ +++ + +C++SNP++ Y+NG  
Sbjct  31   GWDISSNLDTWPDDKVFKVGDVLVFSYSAS-NSVTEV-TKQNFDTCNISNPLKTYSNGNT  88

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
             + L   G RYFVSGN   C  G+KL + V
Sbjct  89   TVTLSAPGDRYFVSGNRLYCFGGMKLHVHV  118



>ref|XP_006421510.1| hypothetical protein CICLE_v10005983mg [Citrus clementina]
 gb|ESR34750.1| hypothetical protein CICLE_v10005983mg [Citrus clementina]
Length=189

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 61/90 (68%), Gaps = 2/90 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW++S+++ +W   ++F VGD + F+YSA+  S+ E+ +++ + +C++SNP++ Y+NG  
Sbjct  31   GWDISSNLDTWPDDKVFKVGDVLVFSYSAS-NSVTEV-TKQNFDTCNISNPLKTYSNGNT  88

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
             + L   G RYFVSGN   C  G+KL + V
Sbjct  89   TVTLSAPGDRYFVSGNRLYCFGGMKLHVHV  118



>ref|XP_007144187.1| hypothetical protein PHAVU_007G135500g [Phaseolus vulgaris]
 gb|ESW16181.1| hypothetical protein PHAVU_007G135500g [Phaseolus vulgaris]
Length=185

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 62/98 (63%), Gaps = 2/98 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW++S ++ +W A ++F VGD + F YS+ Q S+ E+ ++E Y +C+++N +  Y NG  
Sbjct  34   GWDISTNLDTWIADKMFKVGDALVFQYSSGQ-SVEEV-TKENYDTCNITNVLATYGNGNT  91

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNA  524
             +PL   G RYFVSGN   C  G+KL + V+   K+ A
Sbjct  92   TVPLTRGGDRYFVSGNKLYCLGGMKLHVHVEGDDKSLA  129



>ref|XP_010109138.1| Blue copper protein [Morus notabilis]
 ref|XP_010113148.1| Blue copper protein [Morus notabilis]
 gb|EXC21067.1| Blue copper protein [Morus notabilis]
 gb|EXC67778.1| Blue copper protein [Morus notabilis]
Length=183

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 59/93 (63%), Gaps = 2/93 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW++S ++ SW   +IFNVGD + F YS+   S++E+ +RE + SC+ +N +  ++NG  
Sbjct  31   GWDISTNLDSWINGKIFNVGDILVFQYSSTH-SVSEV-TRESFNSCNTTNVLNTFSNGNT  88

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSS  509
             +PL   G  YFV GN   C  G+KL + V+S+
Sbjct  89   TVPLTKAGQMYFVCGNKLHCLGGMKLQMKVESN  121



>gb|ACR77748.1| plastocyanin-like domain-containing protein [Astragalus sinicus]
Length=191

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 53/91 (58%), Gaps = 1/91 (1%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            +GW+ S D  SW + + F VGD + F YS+   S+ ELG+  +Y +CD+S P+   ++G 
Sbjct  31   QGWDASTDFNSWISGKTFKVGDQLVFKYSSLH-SVVELGNESDYKNCDISTPLNSLSSGK  89

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
            D + LD    RY   G L  C  G+K+ +T+
Sbjct  90   DVVKLDKPSTRYLTCGTLGHCGQGMKVKITI  120



>ref|XP_011098865.1| PREDICTED: mavicyanin [Sesamum indicum]
Length=171

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 52/94 (55%), Gaps = 0/94 (0%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            +GW+ S D  SW++ARIF VGD + F Y+A   S+ EL     Y SCD+ + +     G 
Sbjct  35   QGWDESVDFDSWASARIFKVGDELEFKYTAGLHSVVELAGESAYKSCDIGSALDSLNGGS  94

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSS  509
            + + L   G RYF  G    C+ G+K+ +T  ++
Sbjct  95   NTVKLSKSGTRYFTCGTPGHCEQGMKVKITTAAA  128



>gb|KFK31132.1| hypothetical protein AALP_AA6G072100 [Arabis alpina]
Length=260

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 59/100 (59%), Gaps = 3/100 (3%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
             GW VS ++ +W+AA+ F+VGD + F+Y  A   + E+ ++ E+ SC   NP+  + NG 
Sbjct  32   SGWTVSANLRTWAAAQTFSVGDNLVFSYPTAFHDVVEV-TKPEFDSCQAVNPLTTFANGN  90

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNAI  527
              +PL   G RYF+ G+   C +G+KL + V   P  NA+
Sbjct  91   SIVPLTTPGKRYFICGSPGHCSSGMKLEVNVL--PNANAV  128



>ref|XP_006653637.1| PREDICTED: blue copper protein-like [Oryza brachyantha]
Length=135

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 55/93 (59%), Gaps = 1/93 (1%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW    D  +W+  + F VGD + F Y++ + S+AE+ S  ++ SC  SNP+R Y +G  
Sbjct  35   GWTTGVDYTAWARGKAFTVGDRLLFQYNSDRHSVAEV-SAADHGSCSPSNPLRSYRDGTA  93

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSS  509
             + L   G RYF+ G+   C +G+KL +TV S+
Sbjct  94   AVALTSPGTRYFICGSSGHCASGMKLTVTVASA  126



>ref|XP_010523261.1| PREDICTED: stellacyanin [Tarenaya hassleriana]
Length=187

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 57/91 (63%), Gaps = 2/91 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW++S D+ SW   + FNVGD + F YS+   S+ E+ +R+E+ SC+ + P+R ++ G  
Sbjct  36   GWDISTDLDSWLLGKAFNVGDVLVFQYSSPH-SVYEV-TRDEFQSCNTTKPLRTFSGGNT  93

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQ  503
             + L   G R+FV GN   C  G++LP+ +Q
Sbjct  94   TVSLSESGDRFFVCGNRLHCFAGMRLPVHIQ  124



>ref|XP_002297929.1| hypothetical protein POPTR_0001s11680g [Populus trichocarpa]
 gb|EEE82734.1| hypothetical protein POPTR_0001s11680g [Populus trichocarpa]
Length=184

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 59/93 (63%), Gaps = 2/93 (2%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            + GW++S D+ +W+ ++ F VGD + F YS++  S+ E+  +E++ SC+ +N  R +TNG
Sbjct  29   NSGWDISTDLDTWAQSKTFVVGDLLSFQYSSSH-SLEEV-KKEDFDSCNTTNVARTFTNG  86

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQ  503
               +PL   G RYFV GN   C  G+KL + V+
Sbjct  87   NTTVPLTEPGTRYFVCGNQLHCLGGMKLQVNVE  119



>gb|KDP46298.1| hypothetical protein JCGZ_10138 [Jatropha curcas]
Length=166

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 50/93 (54%), Gaps = 0/93 (0%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            +GWE S D  SW++   F VGD + F Y++   S+ ELGS   Y +CDL   +     G 
Sbjct  30   QGWEESTDFNSWASNTKFKVGDQLVFKYTSGLHSVVELGSESAYKNCDLGTALDSKNTGN  89

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQS  506
            D + L   G RYF  G L  C  G+K+ +T ++
Sbjct  90   DVVKLTKPGTRYFACGTLGHCDQGMKVKITTEA  122



>ref|XP_011032393.1| PREDICTED: mavicyanin-like [Populus euphratica]
Length=193

 Score = 77.8 bits (190),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 54/91 (59%), Gaps = 2/91 (2%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
             GW    D  +W++ + F VGD++ F YS+   S+AE+ S+++Y SC  SN ++ YT+G 
Sbjct  30   SGWTTVGDYTTWASGKTFTVGDSLLFKYSSTH-SVAEV-SKDDYDSCSASNTLKTYTDGS  87

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
              +PL   G RYF+      C  G+KL +TV
Sbjct  88   STVPLSTAGQRYFICSTPGHCSGGMKLAITV  118



>ref|XP_002877026.1| hypothetical protein ARALYDRAFT_484503 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53285.1| hypothetical protein ARALYDRAFT_484503 [Arabidopsis lyrata subsp. 
lyrata]
Length=171

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 51/91 (56%), Gaps = 1/91 (1%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            +GWE S D  SWS+ + F VGD I F YS    S+ ELGS   Y SCDL   +   ++G 
Sbjct  32   QGWEQSVDFDSWSSDQSFKVGDQIVFKYSGLH-SVVELGSETAYKSCDLGTSVNSLSSGN  90

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
            D + L   G RYF  G +  C+ G+K+ + V
Sbjct  91   DVVKLSKTGTRYFACGTVGHCEQGMKIKVNV  121



>ref|XP_004138792.1| PREDICTED: blue copper protein-like [Cucumis sativus]
Length=170

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 51/91 (56%), Gaps = 0/91 (0%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            +GW+ S D  SW++++ F VGD I F Y ++  S+ EL     Y +CD+ N I   ++G 
Sbjct  42   QGWQESVDFDSWASSQTFKVGDQIVFKYDSSLHSVVELSDESSYKNCDIGNSIESKSSGN  101

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
            D I L   G RYF  G +  C  G+K+ + +
Sbjct  102  DAIKLTKSGTRYFACGTIGHCSQGMKVKIKI  132



>ref|XP_011026746.1| PREDICTED: mavicyanin [Populus euphratica]
Length=184

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 59/93 (63%), Gaps = 2/93 (2%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            + GW++S D+ +W+ ++ F VGD + F YS++  S+ E+  +E++ SC+ +N  R +TNG
Sbjct  29   NSGWDISTDLDTWAQSKKFVVGDLLLFQYSSSH-SLEEV-KKEDFDSCNTTNVARTFTNG  86

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQ  503
               +PL   G RYFV GN   C  G+KL + V+
Sbjct  87   NTTVPLTEPGTRYFVCGNQLHCLGGMKLHVNVE  119



>gb|KJB19644.1| hypothetical protein B456_003G111800 [Gossypium raimondii]
Length=184

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 58/95 (61%), Gaps = 2/95 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW++S DI SW+  + FNVGD + F YS++  S++E+ ++E + +C+ +N +  ++NG  
Sbjct  31   GWDISTDIDSWATNKTFNVGDVLLFQYSSSH-SVSEV-NKESFETCNTTNSLTTFSNGNT  88

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPK  515
             + L   G RYFV GN   C  G+KL + V    K
Sbjct  89   TVTLSNAGKRYFVCGNKLHCLGGMKLQVNVLEDEK  123



>ref|XP_004168663.1| PREDICTED: blue copper protein-like [Cucumis sativus]
 gb|KGN63174.1| Blue copper protein [Cucumis sativus]
Length=174

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 51/91 (56%), Gaps = 0/91 (0%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            +GW+ S D  SW++++ F VGD I F Y ++  S+ EL     Y +CD+ N I   ++G 
Sbjct  42   QGWQESVDFDSWASSQTFKVGDQIVFKYDSSLHSVVELSDESSYKNCDIGNSIESKSSGN  101

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
            D I L   G RYF  G +  C  G+K+ + +
Sbjct  102  DAIKLTKSGTRYFACGTIGHCSQGMKVKIKI  132



>emb|CDY28484.1| BnaC02g36760D [Brassica napus]
Length=170

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 53/97 (55%), Gaps = 1/97 (1%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            +GWE S D  SWS+ + F VGD + F YS    S+ ELGS   Y SCDL   +   ++G 
Sbjct  32   QGWEESVDFDSWSSDQSFKVGDQLVFKYSGLH-SVVELGSETAYKSCDLGTTVNSLSSGN  90

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKT  518
            D + L   G RYF  G    C+ G+K+ + + SS  T
Sbjct  91   DVVKLSKTGTRYFACGTPGHCEQGMKVKVNIVSSDST  127



>ref|XP_010425458.1| PREDICTED: mavicyanin-like [Camelina sativa]
Length=174

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 52/91 (57%), Gaps = 1/91 (1%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            +GWE S D  SW++ + F VGD + F YS    S+ ELGS   Y SCD+  P+   ++G 
Sbjct  33   QGWEQSVDFDSWASDQSFKVGDQLVFKYSGLH-SVVELGSETAYKSCDVGTPVNSLSSGN  91

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
            D + L   G RYF  G +  C+ G+K+ + V
Sbjct  92   DVVKLSKTGTRYFACGTVGHCEQGMKIKVNV  122



>ref|NP_566810.1| plastocyanin-like domain-containing protein [Arabidopsis thaliana]
 gb|AAL62418.1| blue copper protein, putative [Arabidopsis thaliana]
 gb|AAP21370.1| At3g27200 [Arabidopsis thaliana]
 gb|AEE77278.1| plastocyanin-like domain-containing protein [Arabidopsis thaliana]
Length=174

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 51/91 (56%), Gaps = 1/91 (1%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            +GWE S D  SWS+ + F VGD I F YS    S+ ELGS   Y SCDL   +   ++G 
Sbjct  32   QGWEQSVDFDSWSSDQSFKVGDQIVFKYSELH-SVVELGSETAYKSCDLGTSVNSLSSGN  90

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
            D + L   G RYF  G +  C+ G+K+ + V
Sbjct  91   DVVKLSKTGTRYFACGTVGHCEQGMKIKVNV  121



>ref|XP_009130995.1| PREDICTED: mavicyanin-like [Brassica rapa]
 emb|CDX78296.1| BnaA03g02080D [Brassica napus]
Length=194

 Score = 77.0 bits (188),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 59/91 (65%), Gaps = 2/91 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW++S+D+ SW   + F+VGD + F YS++  S+ E+ +++ + SC+ ++PIR +TNG  
Sbjct  37   GWDISSDLESWPLGKRFSVGDVLMFQYSSSH-SVYEV-AKDNFQSCNTTDPIRTFTNGNT  94

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQ  503
             + L   G R+FV GN   C  G++L + VQ
Sbjct  95   TVALSKPGDRFFVCGNRLHCFAGMRLQVNVQ  125



>ref|XP_006490068.1| PREDICTED: blue copper protein-like [Citrus sinensis]
Length=189

 Score = 76.6 bits (187),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 61/90 (68%), Gaps = 2/90 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW++S+++ +W   ++F VGD + F+YS++  S+ E+ +++ + +C++SNP++ Y+NG  
Sbjct  31   GWDISSNLDTWPDDKVFKVGDVLVFSYSSS-NSVREV-TKQNFDTCNISNPLKTYSNGNT  88

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
             + L   G RYFVSGN   C  G+KL + V
Sbjct  89   TVTLSAPGDRYFVSGNRLYCFGGMKLHVHV  118



>ref|XP_006289951.1| hypothetical protein CARUB_v10003579mg [Capsella rubella]
 gb|AAR15456.1| Cu2+ plastocyanin-like [Capsella rubella]
 gb|EOA22849.1| hypothetical protein CARUB_v10003579mg [Capsella rubella]
Length=191

 Score = 76.6 bits (187),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 61/98 (62%), Gaps = 2/98 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW++S+D+ SW++ + F+ GD + F YS+   S+ E+ ++  Y SC+ ++PIR +TNG  
Sbjct  37   GWDISSDLESWTSGKRFSPGDVLMFQYSSTH-SVYEV-AKNNYQSCNTTDPIRTFTNGNT  94

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNA  524
             + L   G R+FV GN   C  G++L + VQ +  + A
Sbjct  95   TVSLSKPGDRFFVCGNRLHCFAGMRLQVNVQGNGPSQA  132



>ref|XP_011022375.1| PREDICTED: stellacyanin-like [Populus euphratica]
Length=183

 Score = 76.6 bits (187),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 59/95 (62%), Gaps = 2/95 (2%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            + GW++S DI +W+  + F VGD + F YS++  S+ E+  +E++ SC+++N +R +T G
Sbjct  29   NSGWDISTDIDTWAQDKTFAVGDLLMFQYSSSH-SVEEV-KKEDFDSCNMTNVLRKFTTG  86

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSS  509
               + L   G RYFV GN   C  G+KL + V S+
Sbjct  87   NTTVSLTNPGTRYFVCGNKLHCLGGMKLQVNVASN  121



>ref|XP_008231138.1| PREDICTED: mavicyanin [Prunus mume]
Length=172

 Score = 76.3 bits (186),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 49/90 (54%), Gaps = 0/90 (0%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            +GW+ S D  SW++A+ F VGD + F YS+   S+ EL +   Y SCDL   +     G 
Sbjct  32   QGWDESTDFNSWASAQKFKVGDQLVFKYSSGLHSVVELPNESAYKSCDLGGALASKNTGN  91

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLT  497
            D + L   G RYF  G L  C  G+K+ +T
Sbjct  92   DVVKLTKAGTRYFACGTLGHCGQGMKVKIT  121



>ref|XP_006399230.1| hypothetical protein EUTSA_v10014745mg [Eutrema salsugineum]
 gb|ESQ40683.1| hypothetical protein EUTSA_v10014745mg [Eutrema salsugineum]
Length=193

 Score = 76.3 bits (186),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 64/98 (65%), Gaps = 2/98 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW++S+D+ SW+  + F+VGD + F YS+   S+ E+ +++++ +C+ ++PIR +TNG  
Sbjct  37   GWDISSDLDSWTLGKRFSVGDVLMFQYSSTH-SVYEV-AKDKFQNCNTTDPIRTFTNGNT  94

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNA  524
             + L   G R+FV GN   C  G+KL + V+ +  ++A
Sbjct  95   TVALSKPGDRFFVCGNRLHCFAGMKLQVNVEGNGPSSA  132



>ref|XP_006385823.1| hypothetical protein POPTR_0003s15000g [Populus trichocarpa]
 gb|ERP63620.1| hypothetical protein POPTR_0003s15000g [Populus trichocarpa]
Length=174

 Score = 75.9 bits (185),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 57/94 (61%), Gaps = 2/94 (2%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            + GW++S DI +W+  + F VGD + F YS++  S+ E+  +E++ SC+ +N +R +T G
Sbjct  20   NSGWDISTDIDTWAQDKTFAVGDVLMFQYSSSH-SVDEV-KKEDFDSCNTTNVLRTFTTG  77

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQS  506
               + L   G RYFV GN   C  G+KL + V S
Sbjct  78   NTTVSLTNPGTRYFVCGNKLHCLGGMKLQVNVAS  111



>ref|XP_006385822.1| hypothetical protein POPTR_0003s15000g [Populus trichocarpa]
 gb|ERP63619.1| hypothetical protein POPTR_0003s15000g [Populus trichocarpa]
Length=183

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 57/94 (61%), Gaps = 2/94 (2%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            + GW++S DI +W+  + F VGD + F YS++  S+ E+  +E++ SC+ +N +R +T G
Sbjct  29   NSGWDISTDIDTWAQDKTFAVGDVLMFQYSSSH-SVDEV-KKEDFDSCNTTNVLRTFTTG  86

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQS  506
               + L   G RYFV GN   C  G+KL + V S
Sbjct  87   NTTVSLTNPGTRYFVCGNKLHCLGGMKLQVNVAS  120



>emb|CDP16681.1| unnamed protein product [Coffea canephora]
Length=174

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 48/89 (54%), Gaps = 0/89 (0%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            +GW+ S D +SW++ + F VGD + F Y+    S+ ELGS   Y SCD+S  +     G 
Sbjct  32   QGWDESTDFSSWASGQTFKVGDQLVFKYTPGLHSVVELGSESAYKSCDISTALDSKNGGN  91

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPL  494
            D + L   G RYF  G    C  G+K+ +
Sbjct  92   DVVKLAKAGTRYFACGTAGHCGQGMKVKI  120



>ref|XP_007216268.1| hypothetical protein PRUPE_ppa017323mg [Prunus persica]
 gb|EMJ17467.1| hypothetical protein PRUPE_ppa017323mg [Prunus persica]
Length=172

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 50/90 (56%), Gaps = 0/90 (0%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            +GW+ S D  SW++A+ F VGD + F YS+   S+ EL +   Y SCDL   +    +G 
Sbjct  32   QGWDESTDFNSWASAQKFKVGDQLVFKYSSGLHSLVELPNESAYKSCDLGGALDSKNSGN  91

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLT  497
            D + L   G RYF  G L  C  G+K+ +T
Sbjct  92   DVVKLTKAGTRYFACGTLGHCGQGMKVKIT  121



>ref|XP_004231787.1| PREDICTED: mavicyanin [Solanum lycopersicum]
Length=170

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 54/99 (55%), Gaps = 1/99 (1%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            +GW+ S D  SW++ + F VGDT+ F Y+    S+ EL     Y SCD+S+ +   + G 
Sbjct  33   QGWDESADFKSWASGQTFKVGDTLVFRYNPGLHSVVELEGDSSYKSCDISSTVNSMSAGN  92

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPL-TVQSSPKTN  521
            D + L+  G RYF  G    C  G+KL + TV  S  +N
Sbjct  93   DVVKLNKPGTRYFACGTAGHCDQGMKLKIKTVTGSAPSN  131



>gb|KJB79910.1| hypothetical protein B456_013G071700 [Gossypium raimondii]
Length=244

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 60/95 (63%), Gaps = 3/95 (3%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW+ S D+ +W+A++ F VGD + F Y+   + + E+ ++ +Y SC  S+PIR YT+G  
Sbjct  31   GWDSSTDLQTWAASQKFAVGDNLIFQYTPNHD-LVEV-TKADYDSCQTSSPIRTYTDGNT  88

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPL-TVQSSP  512
             +PL   G RYF+ G L  C  G+++ + T+ +SP
Sbjct  89   VVPLTSPGKRYFICGTLGHCSQGMQIEIDTLATSP  123



>ref|XP_006338690.1| PREDICTED: blue copper protein-like [Solanum tuberosum]
Length=170

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 54/99 (55%), Gaps = 1/99 (1%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            +GW+ S D  SW++ + F VGDT+ F Y+    S+ EL     Y SCD+S+ +   + G 
Sbjct  33   QGWDESADFKSWASGQTFKVGDTLVFRYNPGLHSVVELEGDSSYKSCDISSTVNSMSAGN  92

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPL-TVQSSPKTN  521
            D + L+  G RYF  G    C  G+KL + TV  S  +N
Sbjct  93   DVVKLNKPGTRYFACGTAGHCDQGMKLKIKTVTGSAPSN  131



>ref|XP_004287916.1| PREDICTED: blue copper protein [Fragaria vesca subsp. vesca]
Length=233

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 60/103 (58%), Gaps = 4/103 (4%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            + GW+ S D+ +W++++ F VGD + F YS +   + E+ S+ +Y SC  SN I+ Y+ G
Sbjct  33   NGGWDASTDLQTWASSQTFLVGDNLNFQYSPSHN-VLEV-SKADYDSCQGSNSIQAYSGG  90

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNAIWP  533
               IPL   G RYF+ G +  C  G+K  L V +SP T +  P
Sbjct  91   STTIPLSSAGKRYFICGTIGHCSQGMK--LEVGTSPATTSAPP  131



>ref|XP_010522318.1| PREDICTED: blue copper protein [Tarenaya hassleriana]
Length=266

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 58/104 (56%), Gaps = 3/104 (3%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
              GW + +D+ +WSA++ F VGD + F Y +A   + E+ S+ E+ +C    P+  ++NG
Sbjct  30   PSGWTMGSDLRTWSASQTFVVGDNLVFAYPSAFHDVVEV-SKPEFDNCQAIKPLVTFSNG  88

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNAIWPL  536
               +PL   G RYF+ G    C  G+KL + V   P  NA+ PL
Sbjct  89   NTVVPLTSPGKRYFICGMPGHCTQGMKLEVNVL--PTANAVTPL  130



>emb|CDP05527.1| unnamed protein product [Coffea canephora]
Length=180

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 56/91 (62%), Gaps = 2/91 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW++S D+ +WS  +IF VGD + F YS+   S++E+ ++  Y  C+ +N ++  +NG  
Sbjct  31   GWDISTDVDTWSKDKIFQVGDVLLFQYSS-YHSVSEV-TQPNYEGCNTTNVLQTSSNGNT  88

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQ  503
             IPL   G RYFV GN   C  G+KL + VQ
Sbjct  89   SIPLKNPGDRYFVCGNRLHCLGGMKLHVHVQ  119



>emb|CDX81058.1| BnaC03g03120D [Brassica napus]
Length=194

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 58/91 (64%), Gaps = 2/91 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW++S+D+ SW   + F+VGD + F YS+   S+ E+ +++ + SC+ ++PIR +TNG  
Sbjct  37   GWDISSDLESWPLGKRFSVGDVLMFQYSSTH-SVYEV-AKDNFQSCNTTDPIRTFTNGNT  94

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQ  503
             I L   G R+FV GN   C  G++L + V+
Sbjct  95   TIALSKPGDRFFVCGNRLHCFAGMRLQVNVE  125



>ref|XP_008441346.1| PREDICTED: mavicyanin-like [Cucumis melo]
Length=172

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            +GW+ S D  SW++++ F VGD I F Y ++  S+ EL     Y +CD+ N I   ++G 
Sbjct  40   QGWQESVDFDSWASSQTFKVGDQIVFKYDSSLHSVVELPEESSYKNCDIGNSIESKSSGN  99

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQS  506
            D I L   G RYF  G +  C  G+K+ + + +
Sbjct  100  DVIKLTKSGTRYFACGTIGHCSQGMKVKIKIAT  132



>gb|KHN25766.1| Early nodulin-like protein 1 [Glycine soja]
Length=216

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 64/101 (63%), Gaps = 3/101 (3%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW+ ++++ SW++++IF+VGD++ F Y    + + E+ ++ +Y SC  +NPI+ Y +G  
Sbjct  33   GWDTNSNLQSWASSQIFSVGDSLVFQYPPNHD-VVEV-TKADYDSCQPTNPIQSYNDGAT  90

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNAIWP  533
             IPL   G RYF+ G +  C  G+K+ +   +S  TN++ P
Sbjct  91   TIPLTLPGKRYFICGTIGHCSQGMKVEIDTLAS-ATNSVTP  130



>ref|XP_003540323.1| PREDICTED: blue copper protein-like [Glycine max]
Length=216

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 64/101 (63%), Gaps = 3/101 (3%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW+ ++++ SW++++IF+VGD++ F Y    + + E+ ++ +Y SC  +NPI+ Y +G  
Sbjct  33   GWDTNSNLQSWASSQIFSVGDSLVFQYPPNHD-VVEV-TKADYDSCQPTNPIQSYNDGAT  90

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNAIWP  533
             IPL   G RYF+ G +  C  G+K+ +   +S  TN++ P
Sbjct  91   TIPLTLPGKRYFICGTIGHCSQGMKVEIDTLAS-ATNSVTP  130



>gb|ACU23845.1| unknown [Glycine max]
Length=216

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 64/101 (63%), Gaps = 3/101 (3%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW+ ++++ SW++++IF+VGD++ F Y    + + E+ ++ +Y SC  +NPI+ Y +G  
Sbjct  33   GWDTNSNLQSWASSQIFSVGDSLVFQYPPNHD-VVEV-TKADYDSCQPTNPIQSYNDGAT  90

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNAIWP  533
             IPL   G RYF+ G +  C  G+K+ +   +S  TN++ P
Sbjct  91   TIPLTLPGKRYFICGTIGHCSQGMKVEIDTLAS-ATNSVTP  130



>ref|XP_009612608.1| PREDICTED: uclacyanin-2-like [Nicotiana tomentosiformis]
Length=276

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 56/86 (65%), Gaps = 2/86 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW+ ++D+ SW+A++ F VGD I F+Y A   ++ E+ ++ +Y SCD +NPI IY+ G+ 
Sbjct  44   GWDQTSDLQSWAASQKFFVGDKITFSY-APSHTVLEV-TKAQYDSCDNTNPIAIYSGGMT  101

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKL  488
             I L   G RYF+ G    C +G+KL
Sbjct  102  VITLASVGKRYFICGTGGHCSSGMKL  127



>ref|XP_002281286.1| PREDICTED: mavicyanin [Vitis vinifera]
 emb|CBI38573.3| unnamed protein product [Vitis vinifera]
Length=182

 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 58/94 (62%), Gaps = 2/94 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW++S D+ +W+  + F VGD + F YS++  S+ E+ + E +  C++++ ++  +NG  
Sbjct  33   GWDISTDLDTWAKDKKFIVGDVLLFQYSSSN-SVNEV-TEESFKGCNMTDTLQTSSNGNT  90

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSP  512
             IPL+  G RYFV GN   C  G+KL + VQ  P
Sbjct  91   SIPLNRPGERYFVCGNKLHCLGGMKLQVNVQKDP  124



>ref|XP_009371662.1| PREDICTED: mavicyanin [Pyrus x bretschneideri]
Length=177

 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 51/91 (56%), Gaps = 0/91 (0%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            +GWE S ++ SW++A+ F VGD + F Y++   S+ EL +   Y SCD  + +   ++G 
Sbjct  32   QGWEQSTELNSWASAQKFKVGDQLVFKYTSGLHSVVELPNESAYKSCDAGSALDTKSSGN  91

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
            D + L   G RYF  G    C  G+K+ +T 
Sbjct  92   DVVKLTKAGTRYFACGTSGHCDQGMKMKITT  122



>gb|KHN30685.1| Blue copper protein [Glycine soja]
Length=166

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 59/98 (60%), Gaps = 2/98 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW++S ++ +W A + F VGD + F YS+ Q S+ E+ ++E + +C+ +N +  + NG  
Sbjct  31   GWDISTNLDAWIADKNFRVGDALVFQYSSGQ-SVEEV-TKENFNTCNTTNALATHGNGNT  88

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNA  524
             +PL   G RYFVSGN   C  G+KL   VQ   K+ A
Sbjct  89   TVPLTRAGDRYFVSGNKLYCLGGMKLHAHVQGDDKSLA  126



>ref|XP_007149946.1| hypothetical protein PHAVU_005G112600g [Phaseolus vulgaris]
 gb|ESW21940.1| hypothetical protein PHAVU_005G112600g [Phaseolus vulgaris]
Length=215

 Score = 74.3 bits (181),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 56/86 (65%), Gaps = 2/86 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW+ ++++ SW++++IF+VGD++ F Y    + + E+ ++ +Y SC  +NPI+ Y +G  
Sbjct  33   GWDTNSNLQSWASSQIFSVGDSLVFQYPPNHD-VVEV-TKADYDSCQPTNPIQSYNDGAT  90

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKL  488
             IPL   G RYF+ G +  C  G+K+
Sbjct  91   AIPLTSPGQRYFICGTIGHCSQGMKV  116



>ref|XP_004956416.1| PREDICTED: blue copper protein-like [Setaria italica]
Length=179

 Score = 73.9 bits (180),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 56/98 (57%), Gaps = 2/98 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW+   D  +W+  + F+VGDT+ F Y AA  S+ E+ S  ++ +C  SNP+R + +   
Sbjct  33   GWKPGVDYTAWAKGKPFSVGDTLSFQYGAAH-SVLEV-SEADHSACSASNPLRTHGDQST  90

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNA  524
             IPL   G RYF+ G    C +G+KL +TV     T++
Sbjct  91   TIPLTKPGTRYFICGTAGHCASGMKLAVTVSDGGATSS  128



>ref|XP_009626225.1| PREDICTED: stellacyanin-like [Nicotiana tomentosiformis]
Length=180

 Score = 73.6 bits (179),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 57/92 (62%), Gaps = 2/92 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW++S D+ +W   + FNVGD + F YS+  +S++E+ ++E +  C++SN + +  NG  
Sbjct  31   GWDISTDLDTWLVGKKFNVGDVLVFQYSSF-DSVSEV-TKENFEGCNMSNVLDLSKNGNT  88

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQS  506
              PL   G RYFVSGN   C  G+KL   V++
Sbjct  89   SFPLTKPGDRYFVSGNRLHCLGGMKLHANVEN  120



>gb|KHN36563.1| Early nodulin-like protein 1 [Glycine soja]
Length=227

 Score = 73.9 bits (180),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 64/101 (63%), Gaps = 3/101 (3%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW+ ++++ SW++++IF+VGD++ F Y    + + E+ ++ +Y SC  ++PI+ Y +G  
Sbjct  33   GWDTNSNLQSWASSQIFSVGDSLVFQYPPNHD-VVEV-TKADYDSCQPTSPIQSYNDGTT  90

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNAIWP  533
             IPL   G RYF+ G +  C  G+K+ +   +S  TN++ P
Sbjct  91   TIPLTSLGKRYFICGTIGHCSQGMKVEIDTLAS-ATNSVTP  130



>ref|XP_003543376.1| PREDICTED: blue copper protein-like [Glycine max]
Length=227

 Score = 73.9 bits (180),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 64/101 (63%), Gaps = 3/101 (3%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW+ ++++ SW++++IF+VGD++ F Y    + + E+ ++ +Y SC  ++PI+ Y +G  
Sbjct  33   GWDTNSNLQSWASSQIFSVGDSLVFQYPPNHD-VVEV-TKADYDSCQPTSPIQSYNDGTT  90

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNAIWP  533
             IPL   G RYF+ G +  C  G+K+ +   +S  TN++ P
Sbjct  91   TIPLTSLGKRYFICGTIGHCSQGMKVEIDTLAS-ATNSVTP  130



>gb|ACU19678.1| unknown [Glycine max]
Length=227

 Score = 73.9 bits (180),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 64/101 (63%), Gaps = 3/101 (3%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW+ ++++ SW++++IF+VGD++ F Y    + + E+ ++ +Y SC  ++PI+ Y +G  
Sbjct  33   GWDTNSNLQSWASSQIFSVGDSLVFQYPPNHD-VVEV-TKADYDSCQPTSPIQSYNDGTT  90

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNAIWP  533
             IPL   G RYF+ G +  C  G+K+ +   +S  TN++ P
Sbjct  91   TIPLTSLGKRYFICGTIGHCSQGMKVEIDTLAS-ATNSVTP  130



>emb|CDX70043.1| BnaA10g23920D [Brassica napus]
Length=197

 Score = 73.6 bits (179),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 59/91 (65%), Gaps = 2/91 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW++S+D+ SW+  + F+VGD + F YS+   S+ E+ +++ + SC+ ++PIR +TNG  
Sbjct  37   GWDISSDLESWTLGKRFSVGDVLMFQYSSTH-SVYEV-AKDNFQSCNSTDPIRTFTNGNT  94

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQ  503
             + L   G R+F+ GN   C  G++L + V+
Sbjct  95   TVALSKPGDRFFLCGNRLHCFAGMRLQVNVE  125



>ref|XP_008793738.1| PREDICTED: blue copper protein-like [Phoenix dactylifera]
Length=261

 Score = 73.9 bits (180),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 54/86 (63%), Gaps = 2/86 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW++S ++A+W+AA+ FNVGDT+ F Y++A + + E+ S+ +Y +C  S P   YT G  
Sbjct  33   GWDLSTNLAAWAAAQKFNVGDTLTFNYASAHD-VLEV-SKADYDACATSKPTNSYTGGST  90

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKL  488
             + L   G RYF+ G    C  G+K+
Sbjct  91   VVKLSSPGKRYFICGIPGHCSQGMKV  116



>gb|AAR15424.1| Cu2+ plastocyanin-like [Sisymbrium irio]
Length=195

 Score = 73.6 bits (179),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 60/91 (66%), Gaps = 2/91 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW++S+D+ SW++ + F VGD + F YS+   S+ E+ +++++ +C+ ++PIR +TNG  
Sbjct  37   GWDISSDLESWTSGKRFAVGDVLMFQYSSTH-SVYEV-AKDKFQNCNTTDPIRTFTNGNT  94

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQ  503
             + L   G R+FV  N   C +G+KL + V+
Sbjct  95   TVALSKPGDRFFVCRNRLHCFSGMKLQVNVE  125



>gb|EYU45397.1| hypothetical protein MIMGU_mgv1a014864mg [Erythranthe guttata]
Length=175

 Score = 73.2 bits (178),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 51/90 (57%), Gaps = 0/90 (0%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            +GW+ S D  SW++A+ FNVGD + F Y+    S+ ELGS     SCD+ + +   ++G 
Sbjct  34   QGWDESTDFDSWASAQTFNVGDELEFKYTPGLHSVVELGSESALKSCDVGSSLNSLSSGS  93

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLT  497
            D I L   G RYF  G    C  G+K+ +T
Sbjct  94   DTIKLSKAGTRYFACGTSGHCGQGMKVKIT  123



>dbj|BAJ90938.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=190

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 54/94 (57%), Gaps = 6/94 (6%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQ--ESIAELGSREEYMSCDLSNPIRIYTNG  404
            GW++S D+ SW+AA+IFNVGD + FTYS     + + E G    Y  C  +N +   ++G
Sbjct  34   GWDISADLRSWAAAKIFNVGDVLVFTYSKTHTLDEVDEAG----YKKCSAANALLSSSDG  89

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQS  506
               +PL   G RYF+ G+   C  G+KL + V S
Sbjct  90   NTTVPLTAGGDRYFICGHQMHCLGGMKLHVHVTS  123



>ref|XP_008379120.1| PREDICTED: mavicyanin [Malus domestica]
Length=168

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 50/91 (55%), Gaps = 0/91 (0%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
             +GWE S D+ SW++   F VGD + F Y++   S+ EL +   Y SC+  + +   ++G
Sbjct  31   SQGWEESTDLNSWASGEKFKVGDQLVFKYTSGLHSVVELPNESAYKSCNTGSALDSKSSG  90

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLT  497
             D + L   G RYF  G L  C  G+K+ +T
Sbjct  91   NDVVKLTKAGTRYFACGTLGHCGQGMKMKIT  121



>ref|NP_001235329.1| uncharacterized protein LOC100500505 precursor [Glycine max]
 gb|ACU15605.1| unknown [Glycine max]
Length=185

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 59/98 (60%), Gaps = 2/98 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW++S ++ +W A + F VGD + F YS+ Q S+ E+ ++E + +C+ +N +  + NG  
Sbjct  31   GWDISTNLDAWIADKNFRVGDALVFQYSSGQ-SVEEV-TKENFNTCNTTNVLATHGNGNT  88

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNA  524
             +PL   G RYFVSGN   C  G+KL   VQ   K+ A
Sbjct  89   TVPLTRAGDRYFVSGNKLYCLGGMKLHAHVQGDDKSLA  126



>ref|XP_010258753.1| PREDICTED: stellacyanin-like [Nelumbo nucifera]
Length=186

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 55/90 (61%), Gaps = 2/90 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW++S+ + SW+  + F VGD + F YS+   ++ EL +++ +  C++ NP++I +NG  
Sbjct  31   GWDISSSLDSWTIDKTFKVGDVLLFQYSS-YHNVVEL-TKDNFDGCNVGNPLQISSNGNT  88

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
             IPL   G RYF  GN   C  G+KL + V
Sbjct  89   SIPLTSPGQRYFACGNKLHCLGGMKLQVNV  118



>ref|XP_009614877.1| PREDICTED: basic blue protein-like [Nicotiana tomentosiformis]
Length=173

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 48/90 (53%), Gaps = 0/90 (0%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            +GW+ S D  SW++   F +GDT+ F Y+    S+ E+     Y SCD S+ +   + G 
Sbjct  33   QGWDESTDFNSWASGETFKIGDTLVFRYNPGLHSVVEVEGESAYKSCDTSSSVNSMSAGN  92

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLT  497
            D + L+  G RYF  G    C  G+KL +T
Sbjct  93   DVVKLNKPGTRYFACGTAGHCDQGMKLKIT  122



>ref|XP_009122335.1| PREDICTED: blue copper protein [Brassica rapa]
Length=224

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 59/91 (65%), Gaps = 2/91 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW++S+D+ SW+  + F+VGD + F YS+   S+ E+ +++ + SC+ ++PIR +TNG  
Sbjct  37   GWDISSDLESWTLGKRFSVGDVLMFQYSSTH-SVYEV-AKDNFQSCNSTDPIRTFTNGNT  94

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQ  503
             + L   G R+F+ GN   C  G++L + V+
Sbjct  95   TVALSKPGDRFFLCGNRLHCFAGMRLQVNVE  125



>ref|XP_009764625.1| PREDICTED: uclacyanin-3-like [Nicotiana sylvestris]
Length=276

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 57/90 (63%), Gaps = 2/90 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW+ ++D+ SW A++ F VGD I F+Y A   ++ E+ ++ +Y SCD +NPI IY+ G+ 
Sbjct  44   GWDQTSDLQSWVASQKFFVGDKITFSY-APSHTVLEV-TKAQYDSCDNTNPIAIYSGGMT  101

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
             I L   G RYF+ G    C +G+KL + +
Sbjct  102  VITLASVGKRYFICGTGGHCGSGMKLEVNI  131



>ref|XP_006338895.1| PREDICTED: blue copper protein-like [Solanum tuberosum]
Length=159

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 56/98 (57%), Gaps = 4/98 (4%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW  S D ++W++A+ F+VGD + F Y  +      + S+++Y +C+  N +  YT G +
Sbjct  30   GWSQSGDYSTWASAQTFSVGDNLVFNYGGSHG--VNVVSKDDYENCNTGNALLTYTGGQN  87

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQ--SSPKT  518
             IPL   G  YFV   L+ C  G+KL + V+  SSP T
Sbjct  88   SIPLSSSGDMYFVCPTLNHCDTGMKLAIKVEGSSSPAT  125



>gb|KJB50019.1| hypothetical protein B456_008G150100 [Gossypium raimondii]
Length=209

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 53/86 (62%), Gaps = 2/86 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW+ S D+ SW A++ F VGD + F Y+   + + E+ ++ ++ SC  S+P++ YT+G  
Sbjct  33   GWDTSTDLQSWVASQTFAVGDNLIFQYTPNHD-VLEV-TKADHDSCQTSSPLQTYTDGNT  90

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKL  488
             IPL   G RYF+ G L  C  G+++
Sbjct  91   VIPLTSPGKRYFICGTLGHCSQGMQI  116



>ref|XP_009803778.1| PREDICTED: basic blue protein-like [Nicotiana sylvestris]
Length=173

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 48/90 (53%), Gaps = 0/90 (0%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            +GW+ S D  +W++   F VGDT+ F Y+    S+ E+     Y SCD S+ +   + G 
Sbjct  34   QGWDESTDFNAWASGETFKVGDTLVFRYNPGLHSVVEVEGESAYKSCDTSSSVNSMSAGN  93

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLT  497
            D + L+  G RYF  G    C  G+KL +T
Sbjct  94   DVVKLNKPGTRYFACGTAGHCDQGMKLKIT  123



>ref|XP_004307775.1| PREDICTED: mavicyanin [Fragaria vesca subsp. vesca]
Length=180

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 58/93 (62%), Gaps = 2/93 (2%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            + GW++S D+ +W++ + F VGD +WF YS++  S+ ++ ++E Y  C+ +N ++ YT G
Sbjct  30   NSGWDISTDLPTWASDKKFVVGDVLWFQYSSS-NSVNQV-TKENYEGCNTTNVVKSYTGG  87

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQ  503
               + L   G  YFVSGN   C  G+KL + VQ
Sbjct  88   NTTVTLTRPGDWYFVSGNKLYCLGGMKLQVPVQ  120



>ref|XP_008437239.1| PREDICTED: chemocyanin-like [Cucumis melo]
Length=217

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 57/101 (56%), Gaps = 5/101 (5%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW+++++I +WSAA  F VGD + F Y    + +    +R ++ +C   NPIR +++G  
Sbjct  38   GWDLNSNILAWSAATTFQVGDYLVFKYLPVHDVLEV--NRTDFFNCRTVNPIRTHSDGET  95

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTV---QSSPKTNA  524
             IPL+  G RYF+ G    C  GLKL + V    S P  N+
Sbjct  96   VIPLNQPGSRYFICGRPQHCLMGLKLRVQVLQRMSDPNNNS  136



>ref|XP_004137571.1| PREDICTED: early nodulin-55-2-like [Cucumis sativus]
 ref|XP_004162955.1| PREDICTED: early nodulin-55-2-like [Cucumis sativus]
 gb|KGN63959.1| hypothetical protein Csa_1G031800 [Cucumis sativus]
Length=217

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 57/101 (56%), Gaps = 5/101 (5%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW+++++I +WSAA  F VGD + F Y    + +    +R ++ +C   NPIR +++G  
Sbjct  38   GWDLNSNILAWSAATTFQVGDYLVFKYLPVHDVLEV--NRTDFFNCRTVNPIRTHSDGET  95

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTV---QSSPKTNA  524
             IPL+  G RYF+ G    C  GLKL + V    S P  N+
Sbjct  96   VIPLNQPGSRYFICGRPQHCLMGLKLRVQVLQRMSDPNNNS  136



>ref|XP_006299468.1| hypothetical protein CARUB_v10015633mg, partial [Capsella rubella]
 gb|EOA32366.1| hypothetical protein CARUB_v10015633mg, partial [Capsella rubella]
Length=201

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 50/90 (56%), Gaps = 2/90 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW V +D  SW   + F+VGD++ F Y      +A++ +  EYMSCD S+P  +Y  G D
Sbjct  33   GWTVKDD--SWDEHKQFHVGDSLVFQYDKNVNDLAQVSTATEYMSCDASSPKVVYNTGHD  90

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
             +     G  YF++ N   C NGLKL + V
Sbjct  91   VVTFKEPGHYYFITSNHIQCVNGLKLDVVV  120



>ref|XP_004303985.1| PREDICTED: basic blue protein [Fragaria vesca subsp. vesca]
Length=184

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 52/90 (58%), Gaps = 1/90 (1%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            +GWE S D+ SW++++ F VGD + F YS+   S+ EL +   + +CDL + +     G 
Sbjct  32   QGWEQSTDLNSWASSQKFKVGDQLVFKYSS-MHSVVELPNESAFKNCDLGSALDTKKGGN  90

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLT  497
            D + L+  G RYF  G L  C  G+K+ +T
Sbjct  91   DVVKLNKAGTRYFACGTLGHCDGGMKVKIT  120



>ref|XP_010111589.1| Blue copper protein [Morus notabilis]
 gb|EXC31334.1| Blue copper protein [Morus notabilis]
Length=179

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 54/93 (58%), Gaps = 1/93 (1%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            +GW+ S D  SW + + F VGD + F YSA   S+AEL +   Y +C++S+ +   ++G 
Sbjct  32   QGWDASTDFNSWVSDKTFKVGDHLVFKYSALH-SVAELANENAYKNCEISSALDSKSSGN  90

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQS  506
            D + L+  G RYF  G    C+ G+K+ +T  S
Sbjct  91   DVVKLNKPGTRYFACGTSGHCQGGMKVKITTVS  123



>ref|XP_010034982.1| PREDICTED: blue copper protein [Eucalyptus grandis]
Length=183

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 59/93 (63%), Gaps = 2/93 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW++S D+ +W+  + FNVGD + F Y ++ +S+ E+ S++ Y +C  +N ++ ++NG  
Sbjct  32   GWDISTDLDTWANGKAFNVGDVLSFQYPSS-DSVEEV-SKDSYNNCSTTNALQTFSNGNT  89

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSS  509
             +PL   G  YF+SGN   C  G+KL + V +S
Sbjct  90   TVPLTRPGPWYFISGNRLYCLGGMKLQVNVANS  122



>ref|XP_004953983.1| PREDICTED: blue copper protein-like [Setaria italica]
Length=220

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 50/91 (55%), Gaps = 1/91 (1%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
             GW    D  SW+A++ F VGD++ F Y+    ++ E+ S  EYM+C  +NP+   ++G 
Sbjct  35   SGWTTGVDYTSWTASKTFKVGDSLVFNYAKGLHTVVEV-SAAEYMACTAANPLGSDSSGA  93

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
              +PL   G  YFV      C  G+KL +TV
Sbjct  94   TTVPLKTPGTHYFVCSITGHCGAGMKLAVTV  124



>emb|CDY65237.1| BnaC09g47900D [Brassica napus]
Length=195

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 58/91 (64%), Gaps = 2/91 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW++S+D+ SW+  + F+VGD + F YS+   S+ E+ +++ +  C+ ++PIR +TNG  
Sbjct  36   GWDISSDLESWTLGKRFSVGDVLMFQYSSTH-SVYEV-AKDNFQRCNSTDPIRTFTNGNT  93

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQ  503
             + L   G R+F+ GN   C  G++L + V+
Sbjct  94   TVALSKPGDRFFLCGNRLHCFAGMRLQVNVE  124



>gb|AAR15473.1| Cu2+ plastocyanin-like [Olimarabidopsis pumila]
Length=191

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 57/91 (63%), Gaps = 2/91 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW++S+D+ SW++ + F+ GD + F Y A+  S+ E+ +++ Y SC+ +  IR +TNG  
Sbjct  37   GWDISSDLESWTSGKRFSPGDVLMFQY-ASTHSVYEV-AKDNYQSCNTTEAIRTFTNGNT  94

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQ  503
             + L   G R+FV GN   C  G++L + V+
Sbjct  95   TVALSKPGDRFFVCGNRLHCFGGMRLQVNVE  125



>ref|XP_006295920.1| hypothetical protein CARUB_v10025057mg [Capsella rubella]
 gb|EOA28818.1| hypothetical protein CARUB_v10025057mg [Capsella rubella]
Length=263

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 48/87 (55%), Gaps = 1/87 (1%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
             GW V   + SW+AA+ F VGD + F+Y AA   + E+ ++ E+ SC    P+  + NG 
Sbjct  32   SGWTVGASLRSWAAAQTFAVGDNLVFSYPAAFHDVVEV-TKPEFDSCQAVKPLITFANGN  90

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKL  488
              +PL   G RYF+ G    C  G+KL
Sbjct  91   SIVPLTTPGKRYFICGMPGHCSQGMKL  117



>ref|XP_006301030.1| hypothetical protein CARUB_v10021421mg [Capsella rubella]
 gb|EOA33928.1| hypothetical protein CARUB_v10021421mg [Capsella rubella]
Length=347

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 53/90 (59%), Gaps = 2/90 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW V +D  SW+  + F+VGD++ F Y      +A++ + +EYMSCD+S+P  +Y  G D
Sbjct  33   GWTVKDD--SWAEHKQFHVGDSLIFQYDKNVNDLAQVSNAKEYMSCDVSSPKVVYNTGHD  90

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
             +     G  YF++ N   C NGLKL + V
Sbjct  91   VVTFKEPGHYYFITSNHIQCVNGLKLDVLV  120


 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 54/106 (51%), Gaps = 2/106 (2%)
 Frame = +3

Query  228  KGWEVSNDIA--SWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTN  401
            KGW V N      WS  + F VGDT++F Y+     + E+    E+ SC+ ++ + +Y  
Sbjct  222  KGWSVYNSYYYYRWSETKQFRVGDTLYFEYNKNLNDVREISDDLEFRSCEPTSAVAVYKT  281

Query  402  GIDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNAIWPLV  539
            G D I L   GV YFVS     C+ G+KL + V  S + +   P V
Sbjct  282  GHDLIKLTKPGVHYFVSLKTGLCQAGIKLRVNVLPSTEDDTTLPNV  327



>ref|XP_002511023.1| Blue copper protein precursor, putative [Ricinus communis]
 gb|EEF51625.1| Blue copper protein precursor, putative [Ricinus communis]
Length=182

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 60/99 (61%), Gaps = 2/99 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW++S D+ +W+  + F VGD + F Y+++ E + E+ ++E +  C+ +N IR YTNG  
Sbjct  32   GWDISTDLPTWAHDKQFLVGDVLLFQYTSS-EVVNEV-TKEAFDGCNTTNVIRTYTNGNT  89

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNAI  527
             + L   G  YF+SGN   C  G+KL + VQ +  ++ +
Sbjct  90   TVTLTRPGAWYFISGNKLYCLGGMKLQVNVQGTQASSPV  128



>ref|XP_010693462.1| PREDICTED: stellacyanin-like [Beta vulgaris subsp. vulgaris]
Length=185

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 58/98 (59%), Gaps = 2/98 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW++S+D+ SW   + F  GD + F YS++ +S+ E+ +++E+  CD SN I   T+G  
Sbjct  32   GWDISSDLDSWVTGKRFVAGDVLAFQYSSSSDSVCEV-TKKEFDGCDTSNAILKSTSGNT  90

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNA  524
              PL   G RYFV  N   C  G+KL + V+ +  TNA
Sbjct  91   TFPLTKPGERYFVCCNRLYCLGGMKLHVHVEPN-STNA  127



>ref|XP_006301575.1| hypothetical protein CARUB_v10022013mg [Capsella rubella]
 gb|EOA34473.1| hypothetical protein CARUB_v10022013mg [Capsella rubella]
Length=351

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 53/90 (59%), Gaps = 2/90 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW V +D  SW+  + F+VGD++ F Y      +A++ + +EYMSCD+S+P  +Y  G D
Sbjct  33   GWTVKDD--SWAEHKQFHVGDSLIFQYDKNVNDLAQVSNAKEYMSCDVSSPKVVYNTGHD  90

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
             +     G  YF++ N   C NGLKL + V
Sbjct  91   VVTFKEPGHYYFITSNHIQCVNGLKLDVLV  120


 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 54/106 (51%), Gaps = 2/106 (2%)
 Frame = +3

Query  228  KGWEVSNDIA--SWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTN  401
            KGW V N      WS  + F VGDT++F Y+     + E+    E+ SC+ ++ + +Y  
Sbjct  226  KGWSVYNSYYYYRWSETKQFRVGDTLYFEYNKNLNDVREISDDLEFRSCEPTSTVAVYKT  285

Query  402  GIDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNAIWPLV  539
            G D I L   GV YFVS     C+ G+KL + V  S + +   P V
Sbjct  286  GHDLIKLTKPGVHYFVSLKTGLCQAGIKLRVNVLPSTEDDTTLPNV  331



>ref|XP_010247016.1| PREDICTED: uclacyanin-3 [Nelumbo nucifera]
Length=230

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 57/93 (61%), Gaps = 2/93 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW+ + D+ +W+A++ F VGD++ FTYS+  + + E+ ++ +Y SC  SNPI+ Y +G  
Sbjct  32   GWDTTTDLQTWAASQSFFVGDSLIFTYSSIHD-VLEV-TKADYDSCSSSNPIKSYNDGNT  89

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSS  509
             I L     RYF+ G    C  G+KL + V +S
Sbjct  90   TIQLSSPVKRYFICGKTGHCDQGMKLEVNVLAS  122



>ref|XP_004248538.1| PREDICTED: mavicyanin-like [Solanum lycopersicum]
Length=163

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 53/93 (57%), Gaps = 2/93 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW  S D ++W++A+ FNVGD + F Y  +      + S+++Y +C+  N +  YT G +
Sbjct  30   GWSQSGDYSTWASAQTFNVGDNLVFNYGGSHG--VNIVSKDDYDNCNTGNALLSYTGGQN  87

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSS  509
             IPL   G  YFV   L+ C  G+KL + V+ +
Sbjct  88   SIPLSSAGDMYFVCPTLNHCDTGMKLAIKVEGT  120



>gb|AFK42126.1| unknown [Lotus japonicus]
Length=185

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 58/96 (60%), Gaps = 2/96 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW++S+ + +W+A + F  GD + F YS+   S+ E+ ++E Y +C+ SN ++ Y NG  
Sbjct  30   GWDISSSLDTWTADKKFQTGDALSFQYSS-MYSVDEV-TKENYDTCNTSNILKSYGNGNT  87

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKT  518
             +PL   G RYF+ GN   C  G+KL + V+ +  T
Sbjct  88   TVPLTKAGERYFICGNKLYCLGGMKLHVHVEDNKNT  123



>gb|ABK26526.1| unknown [Picea sitchensis]
Length=187

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 51/91 (56%), Gaps = 2/91 (2%)
 Frame = +3

Query  234  WEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGIDK  413
            W +  D  +W++ + F VGD + F YSA   S+ E+ S+ +Y +C  SN I+ Y  G   
Sbjct  39   WNLGVDYGTWASGKTFAVGDKLVFAYSA-LHSVMEV-SKADYDACSTSNAIKSYNGGSTT  96

Query  414  IPLDGEGVRYFVSGNLHSCKNGLKLPLTVQS  506
            + LD  G +YFV G    C  G+KL +TV +
Sbjct  97   VTLDSAGAKYFVCGTAGHCSGGMKLGVTVAT  127



>ref|XP_010052796.1| PREDICTED: mavicyanin-like [Eucalyptus grandis]
 gb|KCW76874.1| hypothetical protein EUGRSUZ_D01225 [Eucalyptus grandis]
Length=176

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 56/91 (62%), Gaps = 2/91 (2%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
             GW    + A+W+A++ FNVGD++ FTY+    S+ ++ S+++Y +C+  N I+ YT+G 
Sbjct  32   SGWTQGTNYATWAASQTFNVGDSLVFTYTTLH-SVDQV-SKDDYDNCNTGNAIKSYTSGS  89

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
              IPL   G  YF+      C +G+KL +TV
Sbjct  90   TTIPLSTAGPMYFICPTSGHCSSGMKLAITV  120



>ref|XP_010469615.1| PREDICTED: blue copper protein [Camelina sativa]
Length=261

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 48/87 (55%), Gaps = 1/87 (1%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
             GW V   + +W+AA+ F VGD + F+Y AA   + E+ ++ E+ SC    P+  + NG 
Sbjct  32   SGWTVGTSLRTWAAAQTFAVGDNLVFSYPAAFHDVVEV-TKPEFDSCQSVKPLITFANGD  90

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKL  488
              +PL   G RYF+ G    C  G+KL
Sbjct  91   SIVPLTTPGKRYFICGMPGHCSQGMKL  117



>ref|XP_011083962.1| PREDICTED: early nodulin-like protein 1 [Sesamum indicum]
Length=184

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 51/83 (61%), Gaps = 1/83 (1%)
 Frame = +3

Query  261  WSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGIDKIPLDGEGVR  440
            W+    F +GDT+  TY A  +S+ E+ + + Y +C++SNPIR YT+G  KI LD  G  
Sbjct  49   WAQRNRFQIGDTVVLTYDAKSDSVLEV-TEKNYQTCNVSNPIRSYTDGNTKITLDRSGPF  107

Query  441  YFVSGNLHSCKNGLKLPLTVQSS  509
            +FVSG    C+ G KL + V S+
Sbjct  108  FFVSGAEDHCQKGQKLEILVLSA  130



>ref|XP_003597041.1| Blue copper protein [Medicago truncatula]
 gb|AES67292.1| plastocyanin-like domain protein [Medicago truncatula]
Length=228

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 59/99 (60%), Gaps = 5/99 (5%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW+ ++++ SW++++ F+VGD + F Y    + + E+ ++ +Y SC  +NPI+ Y +G  
Sbjct  33   GWDTNSNLQSWTSSQQFSVGDNLIFQYPPNHD-VVEV-TKADYDSCQQTNPIQSYNDGAT  90

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKL---PLTVQSSPKT  518
             IPL   G RYF+ G +  C  G+K+    L  Q SP +
Sbjct  91   SIPLTSTGKRYFICGTIGHCSQGMKVEIDTLAAQVSPAS  129



>gb|AFK38402.1| unknown [Medicago truncatula]
Length=228

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 59/99 (60%), Gaps = 5/99 (5%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW+ ++++ SW++++ F+VGD + F Y    + + E+ ++ +Y SC  +NPI+ Y +G  
Sbjct  33   GWDTNSNLQSWTSSQQFSVGDNLIFQYPPDHD-VVEV-TKADYDSCQQTNPIQSYNDGAT  90

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKL---PLTVQSSPKT  518
             IPL   G RYF+ G +  C  G+K+    L  Q SP +
Sbjct  91   SIPLTSTGKRYFICGTIGHCSQGMKVEIDTLAAQVSPAS  129



>ref|XP_010445415.1| PREDICTED: early nodulin-20-like [Camelina sativa]
Length=308

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 51/92 (55%), Gaps = 2/92 (2%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D GW V +D  +W+  R F+VGD++ F Y      +A++ S  EY SCD S+P  +Y  G
Sbjct  17   DYGWTVKDD--TWAEHRQFHVGDSLVFEYDQNVNDLAQVSSASEYDSCDSSSPKVVYNTG  74

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
             D +     G  YF++ N   C NGLKL + V
Sbjct  75   YDVVTFKEPGHHYFITSNQIQCVNGLKLDVLV  106


 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 53/96 (55%), Gaps = 2/96 (2%)
 Frame = +3

Query  228  KGWEVSNDIA--SWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTN  401
            KGW V N      WS  + F VGDT++F Y+     + E+    E+ SC+ ++ + +Y +
Sbjct  180  KGWSVYNSYYYYKWSKNKQFCVGDTLYFEYNKDISDVREISDDLEFKSCESNSTVAVYKS  239

Query  402  GIDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSS  509
            G D + L   GV YFVS     C+ G+KL +TVQ S
Sbjct  240  GHDLVKLTKPGVHYFVSLKTGLCQAGIKLRVTVQPS  275



>gb|KDO48731.1| hypothetical protein CISIN_1g042393mg [Citrus sinensis]
Length=187

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 53/90 (59%), Gaps = 2/90 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW++S++I +WSA   F+VGDT+ FTY+   + +    ++ EY +C   NPI  + +G  
Sbjct  35   GWDLSSNIHAWSATATFHVGDTLVFTYTPLHDVLEV--NQLEYATCHTVNPISAHNSGDT  92

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
             +PL   G RYF+ G    C +GLK  + V
Sbjct  93   VVPLIEPGTRYFICGRNGHCASGLKFRVDV  122



>ref|XP_008230134.1| PREDICTED: blue copper protein [Prunus mume]
Length=244

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 52/86 (60%), Gaps = 2/86 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW+ + D+ +W++++ F VGD + F Y+ + + + E+ S+ +Y SC  SN I+ Y+ G  
Sbjct  34   GWDSTTDLQTWASSQTFLVGDNLNFQYAPSHD-VVEV-SKADYDSCQASNSIQSYSGGST  91

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKL  488
             IPL   G RYF+ G    C  G+KL
Sbjct  92   TIPLSSPGKRYFICGTTGHCSQGMKL  117



>ref|XP_003556323.1| PREDICTED: blue copper protein-like [Glycine max]
Length=185

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 61/98 (62%), Gaps = 2/98 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW++S ++ +W A + F VGD + F YS++Q S+ E+ ++E + +C+ +N +  Y +G  
Sbjct  31   GWDISTNLDTWIADKNFKVGDALVFQYSSSQ-SVEEV-TKENFDTCNTTNVLATYGSGNT  88

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNA  524
             +PL   G RY+VSGN   C  G+KL + V+   K+ A
Sbjct  89   TVPLTRAGGRYYVSGNKLYCLGGMKLHVHVEGDDKSLA  126



>gb|KHN00992.1| Blue copper protein [Glycine soja]
Length=185

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 61/98 (62%), Gaps = 2/98 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW++S ++ +W A + F VGD + F YS++Q S+ E+ ++E + +C+ +N +  Y +G  
Sbjct  31   GWDISTNLDTWIADKNFKVGDALVFQYSSSQ-SVEEV-TKENFDTCNTTNVLATYGSGNT  88

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNA  524
             +PL   G RY+VSGN   C  G+KL + V+   K+ A
Sbjct  89   TVPLTRAGDRYYVSGNKLYCLGGMKLHVHVEGDDKSLA  126



>tpg|DAA36598.1| TPA: hypothetical protein ZEAMMB73_027469 [Zea mays]
Length=188

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 53/90 (59%), Gaps = 2/90 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW+   D A+W+  + F +GDT+ F YS+A  S+ E+ S  ++ +C  SNP+R +     
Sbjct  34   GWKSGVDYAAWAKGKPFAIGDTLSFQYSSAH-SVLEV-SEADHGACSASNPLRSHQGQST  91

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
             IPL   G RYF+ G    C +G+K+ +TV
Sbjct  92   TIPLTKAGTRYFICGAPGHCASGMKVAITV  121



>ref|XP_009771215.1| PREDICTED: stellacyanin-like [Nicotiana sylvestris]
Length=178

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 55/92 (60%), Gaps = 2/92 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW++S D+ +W   + FNVGD + F YS+   S++E+ ++E +  C+ SN +    NG  
Sbjct  31   GWDISTDLDTWLVGKRFNVGDVLVFQYSSFH-SVSEV-TKENFEGCNTSNVLDSSKNGNT  88

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQS  506
              PL  +G RYFV GN   C  G+KL + V++
Sbjct  89   SFPLTKQGDRYFVCGNRLHCLGGMKLHVNVEN  120



>ref|XP_009370414.1| PREDICTED: mavicyanin [Pyrus x bretschneideri]
Length=178

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 57/93 (61%), Gaps = 2/93 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW+ S D+ SWS+ + FNVGD +WF YS++  S+ ++ ++E + +C+ +  I  YT G  
Sbjct  33   GWDTSTDLKSWSSDKKFNVGDVLWFQYSSSN-SVCQV-TKESFDACNTAKVIETYTGGNT  90

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSS  509
             + L   G  YFVSGN   C  G+KL   V+++
Sbjct  91   TVTLTKPGDWYFVSGNKLYCLGGMKLMAEVENN  123



>ref|NP_001149787.1| blue copper protein precursor [Zea mays]
 gb|ACG36799.1| blue copper protein precursor [Zea mays]
Length=192

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 53/90 (59%), Gaps = 2/90 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW+   D A+W+  + F +GDT+ F YS+A  S+ E+ S  ++ +C  SNP+R +     
Sbjct  34   GWKSGVDYAAWAKGKPFAIGDTLSFQYSSAH-SVLEV-SEADHGACSASNPLRSHQGQST  91

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
             IPL   G RYF+ G    C +G+K+ +TV
Sbjct  92   TIPLTKAGTRYFICGAPGHCASGMKVAITV  121



>ref|XP_008436972.1| PREDICTED: stellacyanin [Cucumis melo]
Length=191

 Score = 70.9 bits (172),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 60/93 (65%), Gaps = 2/93 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW++S D+ +WS  + F VGD + F YS++  S+ E+ +RE + +C+ +N ++ Y++G  
Sbjct  37   GWDISTDLDTWSQGKRFFVGDVLVFQYSSS-ASLNEV-TRENFNTCNTTNVLKAYSSGNT  94

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSS  509
             + L   G R+FVSGN   C  G+KL + V+++
Sbjct  95   TVTLSKPGQRFFVSGNRLLCLGGMKLQVNVENN  127



>ref|XP_009386042.1| PREDICTED: stellacyanin [Musa acuminata subsp. malaccensis]
Length=183

 Score = 70.9 bits (172),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 53/92 (58%), Gaps = 2/92 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW++S D+ASW A ++F VGD + F YS    ++ E+ S   Y SC+ + P    +NG  
Sbjct  31   GWDISADLASWVANKVFYVGDALMFEYST-YHTVNEVDS-AGYESCNFATPRLTGSNGNT  88

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQS  506
             +PL   G RYFV G    C  G+KL + V+S
Sbjct  89   TVPLTSPGERYFVCGVTLHCLGGMKLHVNVES  120



>ref|NP_680152.1| cupredoxin superfamily protein [Arabidopsis thaliana]
 gb|AAQ22659.1| At5g07475 [Arabidopsis thaliana]
 dbj|BAF00061.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED91163.1| cupredoxin superfamily protein [Arabidopsis thaliana]
Length=192

 Score = 70.9 bits (172),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 61/98 (62%), Gaps = 2/98 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW++S+D+ SW++ + F+ GD + F YS+   S+ E+ +++ Y +C+ ++ IR +TNG  
Sbjct  37   GWDISSDLESWTSGKRFSPGDVLMFQYSSTH-SVYEV-AKDNYQNCNTTDAIRTFTNGNT  94

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNA  524
             + L   G R+FV GN   C  G++L + V+ +  + A
Sbjct  95   TVALSKPGNRFFVCGNRLHCFAGMRLLVNVEGNGPSQA  132



>gb|KDO55610.1| hypothetical protein CISIN_1g030729mg [Citrus sinensis]
Length=172

 Score = 70.5 bits (171),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 47/90 (52%), Gaps = 0/90 (0%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            +GW  S D+ SW++ + F VGD I F Y+    S+ EL S   Y SCDL        +G 
Sbjct  34   QGWVESADLNSWASGQTFKVGDQIVFKYTPGLHSVVELPSESAYKSCDLGTAKDSMNSGN  93

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLT  497
            D + L   G RYF  G    C+ G+K+ +T
Sbjct  94   DVVKLVKPGTRYFACGTSGHCEQGMKVKIT  123



>ref|XP_006447099.1| hypothetical protein CICLE_v10016947mg [Citrus clementina]
 ref|XP_006470037.1| PREDICTED: blue copper protein-like [Citrus sinensis]
 gb|ESR60339.1| hypothetical protein CICLE_v10016947mg [Citrus clementina]
Length=172

 Score = 70.5 bits (171),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 47/90 (52%), Gaps = 0/90 (0%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            +GW  S D+ SW++ + F VGD I F Y+    S+ EL S   Y SCDL        +G 
Sbjct  34   QGWVESADLNSWASGQTFKVGDQIVFKYTPGLHSVVELPSESAYKSCDLGTAKDSMNSGN  93

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLT  497
            D + L   G RYF  G    C+ G+K+ +T
Sbjct  94   DVVKLVKPGTRYFACGTSGHCEQGMKVKIT  123



>gb|KHN24517.1| Blue copper protein [Glycine soja]
Length=171

 Score = 70.5 bits (171),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 56/90 (62%), Gaps = 2/90 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW++ ++I +WS+   FNVGD + F+Y+AA + + E+ ++ +Y +C ++N +  Y NG  
Sbjct  38   GWDLGSNIQAWSSTTTFNVGDDLVFSYTAAHD-VMEV-NQLDYDTCKIANALATYDNGET  95

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
             I L     RYFV G +  C+ GLKL + +
Sbjct  96   VIHLSDAKTRYFVCGRMGHCQQGLKLQVQI  125



>ref|XP_006301015.1| hypothetical protein CARUB_v10021406mg [Capsella rubella]
 gb|EOA33913.1| hypothetical protein CARUB_v10021406mg [Capsella rubella]
Length=351

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 53/90 (59%), Gaps = 2/90 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW V +D  SW+  + F+VGD++ F Y      +A++ + +EYM+CD+S+P  +Y  G D
Sbjct  33   GWTVKDD--SWAEHKQFHVGDSLIFQYDKNVNDLAQVSNAKEYMACDVSSPKVVYNTGHD  90

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
             +     G  YF++ N   C NGLKL + V
Sbjct  91   VVTFKEPGHYYFITSNHIQCVNGLKLDVLV  120


 Score = 66.6 bits (161),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 54/106 (51%), Gaps = 2/106 (2%)
 Frame = +3

Query  228  KGWEVSNDIA--SWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTN  401
            KGW V N      WS  + F VGDT++F Y+     + E+    E+ SC+ ++ + +Y  
Sbjct  226  KGWSVYNSYYYYRWSETKQFRVGDTLYFEYNKNLNDVREISDDFEFRSCEPTSTVAVYKT  285

Query  402  GIDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNAIWPLV  539
            G D I L   GV YFVS     C+ G+KL + V  S + +   P V
Sbjct  286  GHDLIKLTKPGVHYFVSLKTGLCQAGIKLRVNVLPSTEDDTNLPNV  331



>ref|XP_006396340.1| hypothetical protein EUTSA_v10029326mg, partial [Eutrema salsugineum]
 gb|ESQ37793.1| hypothetical protein EUTSA_v10029326mg, partial [Eutrema salsugineum]
Length=327

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 52/97 (54%), Gaps = 2/97 (2%)
 Frame = +3

Query  228  KGWEV--SNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTN  401
            KGW V  S+    WS  + F+VGD + F YS     + E+    E+ SCD ++P+ ++  
Sbjct  181  KGWRVYDSDFYHKWSEEKQFHVGDKLLFEYSNEANDVLEINGHLEFKSCDPTSPVAVHKT  240

Query  402  GIDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSP  512
            G D + L   GV YF+S  +  C  GLKL + V  +P
Sbjct  241  GHDLVMLTEPGVHYFISSKIGHCAAGLKLRVVVAPTP  277


 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/91 (31%), Positives = 45/91 (49%), Gaps = 1/91 (1%)
 Frame = +3

Query  231  GWEVSNDIA-SWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            GW   +D+  SW+  + F+VGD++ F Y      + ++    EY  CD  +P  +Y  G 
Sbjct  61   GWTAKDDVYNSWAERKEFHVGDSLVFEYDRNLNDVTQVSGALEYQFCDSFSPKAVYNTGH  120

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
            D +     G  YF+S N   C+ G +L + V
Sbjct  121  DVVTFTEPGFHYFISSNHAQCELGQRLDVLV  151



>gb|AFK47720.1| unknown [Medicago truncatula]
Length=228

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 54/86 (63%), Gaps = 2/86 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW+ ++++ SW++++ F+VGD + F Y    + + E+ ++ +Y SC  +NPI+ Y +G  
Sbjct  33   GWDTNSNLQSWTSSQQFSVGDNLIFQYPPNHD-VVEV-TKADYDSCQQTNPIQSYNDGAT  90

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKL  488
             IPL   G RYF+ G +  C  G+K+
Sbjct  91   SIPLTSTGKRYFICGTIGHCSQGMKV  116



>ref|XP_010510046.1| PREDICTED: blue copper protein-like [Camelina sativa]
Length=262

 Score = 71.2 bits (173),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 48/86 (56%), Gaps = 1/86 (1%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW V   + +W+AA+ F VGD + F+Y AA   + E+ ++ E+ SC    P+  + NG  
Sbjct  33   GWTVGASLRTWAAAQTFAVGDNLVFSYPAAFHDVVEV-TKPEFDSCQSVKPLITFANGNS  91

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKL  488
             +PL   G RYF+ G    C  G+KL
Sbjct  92   IVPLTTPGKRYFICGMPGHCSQGMKL  117



>ref|XP_009143966.1| PREDICTED: blue copper protein-like [Brassica rapa]
 emb|CDY48275.1| BnaA05g10790D [Brassica napus]
 emb|CDX76046.1| BnaA04g03100D [Brassica napus]
Length=259

 Score = 71.2 bits (173),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 53/99 (54%), Gaps = 3/99 (3%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
             GW V  ++ +W+A + F VGD + F Y +A   + E+ ++ E+ SC +  P+  + NG 
Sbjct  32   SGWTVGANLGTWAAGQTFAVGDNLVFAYPSAFHDVVEV-TKPEFDSCQVVKPLITFANGN  90

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNA  524
              +PL   G RYF+ G    C  G+KL + V   P  NA
Sbjct  91   SIVPLTTPGKRYFICGMPGHCTQGMKLEVNVL--PNANA  127



>gb|AAR13691.1| Cu2+ plastocyanin-like protein [Brassica oleracea]
Length=195

 Score = 70.5 bits (171),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 58/91 (64%), Gaps = 2/91 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW++S+D+ SW+  + F+VGD + F YS+   S+ E+ +++ + SC+ ++PIR +TNG  
Sbjct  36   GWDISSDLESWTLGKRFSVGDVLMFQYSSTH-SVYEV-AKDNFQSCNSTDPIRTFTNGNT  93

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQ  503
             + L   G  +F+ GN   C  G++L + V+
Sbjct  94   TVALSKPGDGFFLCGNRLHCFAGMRLQVNVE  124



>gb|KDP22478.1| hypothetical protein JCGZ_26309 [Jatropha curcas]
Length=181

 Score = 70.5 bits (171),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 57/92 (62%), Gaps = 3/92 (3%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYT-NGI  407
            GW++S D+ASW+  + F VGD + F YS++ +S+ E+ ++E Y  C+ +  I+ YT NG 
Sbjct  31   GWDISTDLASWAQDKTFTVGDVLIFQYSSS-DSVNEV-TKEAYDGCNTTKVIKTYTNNGN  88

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQ  503
              + L   G  YF+SGN   C  G+KL + VQ
Sbjct  89   TTVTLTRPGAWYFISGNRLYCLGGMKLQVNVQ  120



>ref|XP_006396338.1| hypothetical protein EUTSA_v10029173mg [Eutrema salsugineum]
 gb|ESQ37791.1| hypothetical protein EUTSA_v10029173mg [Eutrema salsugineum]
Length=264

 Score = 71.2 bits (173),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 52/97 (54%), Gaps = 2/97 (2%)
 Frame = +3

Query  228  KGWEV--SNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTN  401
            KGW V  S+    WS  + F+VGD + F YS     + E+    E+ SCD ++P+ ++  
Sbjct  151  KGWRVYDSDFYHKWSEEKQFHVGDKLLFEYSNEANDVLEINGHLEFKSCDPTSPVAVHKT  210

Query  402  GIDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSP  512
            G D + L   GV YF+S  +  C  GLKL + V  +P
Sbjct  211  GHDLVILTEPGVHYFISSKIGHCVAGLKLRVVVAPTP  247


 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/91 (30%), Positives = 45/91 (49%), Gaps = 1/91 (1%)
 Frame = +3

Query  231  GWEVSNDIA-SWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            GW   +D+  SW+  + F+VGD++ F Y      + ++    EY  CD  +P  +Y  G 
Sbjct  31   GWTAKDDVYNSWAERKEFHVGDSLVFEYDRNFNDVTQVSGALEYQFCDSFSPKAVYNTGH  90

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
            D +     G  YF++ N   C+ G +L + V
Sbjct  91   DVVTFTEPGFHYFITSNHAHCELGQRLDVLV  121



>gb|KCW46231.1| hypothetical protein EUGRSUZ_K00120 [Eucalyptus grandis]
Length=117

 Score = 69.3 bits (168),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 55/86 (64%), Gaps = 2/86 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW++S D+ +W+  + FNVGD + F Y ++ +S+ E+ S++ Y +C  +N ++ ++NG  
Sbjct  14   GWDISTDLDTWANGKAFNVGDVLSFQYPSS-DSVEEV-SKDSYNNCSTTNALQTFSNGNT  71

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKL  488
             +PL   G  YF+SGN   C  G+KL
Sbjct  72   TVPLTRPGPWYFISGNRLYCLGGMKL  97



>dbj|BAF01024.1| uclacyanin I - like predicted GPI-anchored protein [Arabidopsis 
thaliana]
Length=261

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 1/103 (1%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
             GW V   + +W+A + F VGD + F+Y AA   + E+ ++ E+ SC    P+  + NG 
Sbjct  32   SGWTVGASLRTWAAGQTFAVGDNLVFSYPAAFHDVVEV-TKPEFDSCQAVKPLITFANGN  90

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNAIWPL  536
              +PL   G RYF+ G    C  G+KL + V  +       PL
Sbjct  91   SLVPLTTPGKRYFICGMPGHCSQGMKLEVNVVPTATVAPTAPL  133



>ref|NP_180789.1| uclacyanin 1 [Arabidopsis thaliana]
 gb|AAC32038.1| uclacyanin I [Arabidopsis thaliana]
 gb|AAC69948.1| putative uclacyanin I [Arabidopsis thaliana]
 gb|AEC08665.1| uclacyanin 1 [Arabidopsis thaliana]
Length=261

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 1/103 (1%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
             GW V   + +W+A + F VGD + F+Y AA   + E+ ++ E+ SC    P+  + NG 
Sbjct  32   SGWTVGASLRTWAAGQTFAVGDNLVFSYPAAFHDVVEV-TKPEFDSCQAVKPLITFANGN  90

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNAIWPL  536
              +PL   G RYF+ G    C  G+KL + V  +       PL
Sbjct  91   SLVPLTTPGKRYFICGMPGHCSQGMKLEVNVVPTATVAPTAPL  133



>dbj|BAD03006.1| putative blue copper binding protein [Oryza sativa Japonica Group]
 dbj|BAD03083.1| putative blue copper binding protein [Oryza sativa Japonica Group]
Length=195

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 51/96 (53%), Gaps = 1/96 (1%)
 Frame = +3

Query  234  WEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGIDK  413
            W+   + A W +A  F VGD + F YS A   + E+ ++  Y SC  S P+  + +G D 
Sbjct  38   WDTRTNYAQWVSAVTFRVGDQLVFKYSPAAHDVVEV-TKAGYDSCSSSGPVATFNSGDDT  96

Query  414  IPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTN  521
            +PL   G RYF+ G    C  G+K+ + V+++  T 
Sbjct  97   VPLTATGTRYFMCGFPGHCAAGMKIAVKVEAATATG  132



>gb|EAZ05531.1| hypothetical protein OsI_27747 [Oryza sativa Indica Group]
Length=195

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 51/96 (53%), Gaps = 1/96 (1%)
 Frame = +3

Query  234  WEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGIDK  413
            W+   + A W +A  F VGD + F YS A   + E+ ++  Y SC  S P+  + +G D 
Sbjct  38   WDTRTNYAQWVSAVTFRVGDQLVFKYSPAAHDVVEV-TKAGYDSCSSSGPVATFNSGDDT  96

Query  414  IPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTN  521
            +PL   G RYF+ G    C  G+K+ + V+++  T 
Sbjct  97   VPLTATGTRYFMCGFPGHCAAGMKIAVKVEAATATG  132



>ref|XP_008341310.1| PREDICTED: basic blue protein-like [Malus domestica]
Length=174

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 47/91 (52%), Gaps = 0/91 (0%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            +GWE S D+ SW++ + F  GD + F Y +   S+ EL +   Y  CD  + +   ++G 
Sbjct  32   QGWEQSTDLNSWASGQKFKAGDQLVFKYXSGLHSVVELPNESAYKGCDTGSALDSKSSGS  91

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
            D + L   G RYF  G    C  G+K+ +T 
Sbjct  92   DVVKLTKAGTRYFACGTSGHCDQGMKMKITT  122



>emb|CDY19128.1| BnaA04g18680D [Brassica napus]
Length=259

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 52/99 (53%), Gaps = 3/99 (3%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
             GW V  ++ +W+A + F VGD + F Y +A   + E+ ++ E+ SC    P+  ++NG 
Sbjct  32   SGWTVGTNLGTWAAGQTFAVGDNLVFAYPSAFHDVVEV-TKPEFDSCQAVKPLITFSNGN  90

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNA  524
              +PL   G RYF+ G    C  G+K  L V   P  NA
Sbjct  91   SIVPLTTPGKRYFICGMPGHCTQGMK--LEVNVIPTANA  127



>gb|EYU20166.1| hypothetical protein MIMGU_mgv1a022640mg [Erythranthe guttata]
Length=185

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 55/94 (59%), Gaps = 3/94 (3%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLS-NPIRIYTN  401
            + GW++S D+ SW+  + F+VGDT+ F YS    ++ E+  R+ Y  C+ + N IR  +N
Sbjct  31   NSGWDISTDVNSWAKDKSFSVGDTLLFQYS-QYHTVNEV-KRDNYEGCNTTNNVIRSSSN  88

Query  402  GIDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQ  503
            G     L G G RYFV GN   C  G+KL +TV 
Sbjct  89   GNASFALTGPGERYFVCGNRLHCLGGMKLHVTVH  122



>ref|XP_010429499.1| PREDICTED: early nodulin-like protein 1 [Camelina sativa]
Length=178

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 55/97 (57%), Gaps = 2/97 (2%)
 Frame = +3

Query  243  SNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGIDKIPL  422
            S     W+    F VGD I F Y A ++S+ E+ S+E Y SC+ +NP+  YT+G  K+ L
Sbjct  43   SYSFTEWAQKARFKVGDFIVFRYEAGKDSVLEV-SKEAYNSCNTTNPLANYTDGETKVKL  101

Query  423  DGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNAIWP  533
            D  G  YF+SG    C+ G KL L V  SP+ + I P
Sbjct  102  DRSGPFYFISGVNGHCEKGQKLSLVVI-SPRHSVISP  137



>ref|XP_009117087.1| PREDICTED: early nodulin-like protein 1 [Brassica rapa]
Length=178

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 55/97 (57%), Gaps = 2/97 (2%)
 Frame = +3

Query  243  SNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGIDKIPL  422
            S     W+    F VGD I F Y A ++S+ ++ ++E Y SC+ +NP+  YT+G  K+ L
Sbjct  42   SYSFTEWAQKARFKVGDFIVFRYEAGKDSVLQV-TQEAYKSCNTTNPLANYTDGETKVKL  100

Query  423  DGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNAIWP  533
            D  G  YF+SG    C+ G KL L V  SP+  AI P
Sbjct  101  DRSGPFYFISGVDGHCEKGQKLSLVVV-SPRHEAISP  136



>emb|CDY34741.1| BnaA09g41080D [Brassica napus]
Length=178

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 55/97 (57%), Gaps = 2/97 (2%)
 Frame = +3

Query  243  SNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGIDKIPL  422
            S     W+    F VGD I F Y A ++S+ ++ ++E Y SC+ +NP+  YT+G  K+ L
Sbjct  42   SYSFTEWAQKARFKVGDFIVFRYEAGKDSVLQV-TQEAYKSCNTTNPLANYTDGETKVKL  100

Query  423  DGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNAIWP  533
            D  G  YF+SG    C+ G KL L V  SP+  AI P
Sbjct  101  DRSGPFYFISGVDGHCEKGQKLSLVVV-SPRHEAISP  136



>ref|XP_009363718.1| PREDICTED: mavicyanin-like [Pyrus x bretschneideri]
Length=178

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 56/93 (60%), Gaps = 2/93 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW+ S D+ SWS+ + FNVGD +WF YS++  S+ +  ++E + +C+ +  I  YT G  
Sbjct  33   GWDTSTDLNSWSSDKKFNVGDVLWFQYSSSN-SVCQ-ATKESFDACNTAKVIETYTGGNT  90

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSS  509
             + L   G  YFVSGN   C  G+KL   V+++
Sbjct  91   TVTLTKPGDWYFVSGNKLYCLGGMKLMAEVENN  123



>ref|XP_010414015.1| PREDICTED: blue copper protein-like [Camelina sativa]
Length=261

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 51/99 (52%), Gaps = 3/99 (3%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
             GW V   + +W+AA+ F VGD + F+Y A    + E+ ++ E+ SC    P+  + NG 
Sbjct  32   SGWTVGTSLRTWAAAQTFAVGDNLVFSYPATFHDVVEV-TKPEFDSCQSVKPLITFANGN  90

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNA  524
              +PL   G RYF+ G    C  G+K  L V   P  NA
Sbjct  91   SIVPLTTPGKRYFICGMPGHCSQGMK--LEVNVVPTANA  127



>gb|KGN50322.1| hypothetical protein Csa_5G167140 [Cucumis sativus]
Length=189

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 59/94 (63%), Gaps = 2/94 (2%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
             GW++S D+ +WS  + F VGD + F YS+   S+ E+ +RE + SC+ +N ++ Y++G 
Sbjct  35   SGWDISTDLDTWSQGKRFFVGDVLVFQYSSL-ASLNEV-TRENFNSCNTTNVLKAYSSGN  92

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSS  509
              + L   G R+FVSGN   C  G+KL + V+++
Sbjct  93   TTVTLSEPGHRFFVSGNRLLCLGGMKLQVNVENN  126



>dbj|BAB02115.1| unnamed protein product [Arabidopsis thaliana]
Length=169

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 48/91 (53%), Gaps = 6/91 (7%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            +GWE S D  SWS+ + F VGD I         S+ ELGS   Y SCDL   +   ++G 
Sbjct  32   QGWEQSVDFDSWSSDQSFKVGDQIEL------HSVVELGSETAYKSCDLGTSVNSLSSGN  85

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
            D + L   G RYF  G +  C+ G+K+ + V
Sbjct  86   DVVKLSKTGTRYFACGTVGHCEQGMKIKVNV  116



>emb|CDX69514.1| BnaA10g18630D [Brassica napus]
Length=138

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 59/102 (58%), Gaps = 4/102 (4%)
 Frame = +3

Query  228  KGWEV--SNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTN  401
            +GW+V  S+    WS  + F+VGDT+ F Y      + E+    E+M+CD ++P+ ++  
Sbjct  9    EGWKVYDSDFYNKWSEEKQFHVGDTLLFKYDNEVSDVYEINGDLEFMTCDPTSPVAVHKT  68

Query  402  GIDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNAI  527
            G D + L   GV YF++ +  +C+ GLKL + V   P++ A+
Sbjct  69   GHDLVRLMKPGVHYFITSHSGTCEAGLKLRVMV--GPQSKAV  108



>ref|XP_010431323.1| PREDICTED: early nodulin-20-like [Camelina sativa]
Length=328

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 58/106 (55%), Gaps = 3/106 (3%)
 Frame = +3

Query  228  KGWEVSNDIA--SWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTN  401
            KGW V N      WS  R F VGDT++F Y+     + EL    ++ SC+ ++ + +Y  
Sbjct  200  KGWSVYNSYYYYRWSKDRQFRVGDTLFFQYNNKLNDVRELSDDLDFKSCEPNSTVAVYKT  259

Query  402  GIDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNAIWPLV  539
            G D I L   GV YFVS     C+ G+KL +TVQ+S + + I P V
Sbjct  260  GHDLIKLTKPGVHYFVSLKTGLCQAGIKLRVTVQTSTE-DVILPDV  304


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 51/93 (55%), Gaps = 3/93 (3%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D GW + +D  SW+  + F+VGD++ F Y      +A++ S  EY SC+ S+P  +Y  G
Sbjct  30   DYGWTIKDD--SWAEHKKFHVGDSLVFEYDQDINDVAQVSSALEYDSCNSSSPKVVYNTG  87

Query  405  IDKIPLDGEGVRYFVSGNLHSCK-NGLKLPLTV  500
             D +     G  YF++ N   C+ +GLK  + V
Sbjct  88   YDVVTFKEPGHHYFITSNEFQCRVSGLKYDVFV  120



>ref|XP_006441403.1| hypothetical protein CICLE_v10023892mg, partial [Citrus clementina]
 gb|ESR54643.1| hypothetical protein CICLE_v10023892mg, partial [Citrus clementina]
Length=256

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 55/90 (61%), Gaps = 2/90 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW++S++I +WSA   F+VGDT+ FTY+   + + E+ ++ EY +C   NPI  + +G  
Sbjct  95   GWDLSSNIHAWSATATFHVGDTLVFTYTPLHD-VLEV-NQLEYATCHTVNPISAHNSGDT  152

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
             +PL   G RYF+ G    C +GLK  + V
Sbjct  153  VVPLIEPGTRYFICGRNGHCASGLKFRVDV  182



>ref|XP_002303318.2| hypothetical protein POPTR_0003s04580g [Populus trichocarpa]
 gb|EEE78297.2| hypothetical protein POPTR_0003s04580g [Populus trichocarpa]
Length=198

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 57/93 (61%), Gaps = 1/93 (1%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW +  D   W++ + F VGDT+ F Y+    ++ ++ ++++Y SC++ +P+  + +G D
Sbjct  30   GWTIGVDYNQWASTKKFQVGDTLVFNYNTMFHNVLQV-TKQDYESCNVKSPVATFASGRD  88

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSS  509
             I LD  G  YFV G    C+ GLK+ ++V++S
Sbjct  89   FITLDKAGHSYFVCGFPGHCQAGLKVAISVRAS  121



>ref|XP_006599708.1| PREDICTED: blue copper protein-like [Glycine max]
Length=214

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 56/90 (62%), Gaps = 2/90 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW++ ++I +WS+   FNVGD + F+Y+AA + + E+ ++ +Y +C ++N +  Y NG  
Sbjct  38   GWDLGSNIQAWSSTTTFNVGDDLVFSYTAAHD-VMEV-NQLDYDTCKIANALATYDNGET  95

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
             I L     RYFV G +  C+ GLKL + +
Sbjct  96   VIHLSDAKTRYFVCGRMGHCQQGLKLQVQI  125



>ref|XP_010506975.1| PREDICTED: early nodulin-20-like [Camelina sativa]
Length=313

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 51/92 (55%), Gaps = 2/92 (2%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D GW V +D  SW+  + F+VGD++ F Y      +A++ S  EY SCD S+P  +Y  G
Sbjct  30   DYGWTVKDD--SWAENKQFHVGDSLVFEYDQNVNDLAQVSSALEYDSCDASSPKVVYNTG  87

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
             D +     G  YF++ N   C NGLKL + V
Sbjct  88   YDVVTFKEPGHHYFITSNHIQCVNGLKLDVLV  119


 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 52/96 (54%), Gaps = 2/96 (2%)
 Frame = +3

Query  228  KGWEV--SNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTN  401
            KGW V  S     WS  + F VGDT++F Y+     + E+    E+ SC+ ++ + +Y  
Sbjct  185  KGWSVYTSYYYYKWSKNKQFRVGDTLYFEYNKDLSDVREISDDLEFKSCESNSTVAVYKT  244

Query  402  GIDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSS  509
            G D + L   GV YFVS     C+ G+KL +TVQ S
Sbjct  245  GHDLVKLTKPGVHYFVSLKTGLCQAGIKLRVTVQPS  280



>ref|XP_006396274.1| hypothetical protein EUTSA_v10029152mg [Eutrema salsugineum]
 gb|ESQ37727.1| hypothetical protein EUTSA_v10029152mg [Eutrema salsugineum]
Length=277

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 52/97 (54%), Gaps = 2/97 (2%)
 Frame = +3

Query  228  KGWEV--SNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTN  401
            KGW V  S+    WS  + F+VGD + F YS     + E+    E+ SCD ++P+ ++  
Sbjct  164  KGWRVYDSDFYHKWSEEKQFHVGDKLIFEYSNEANDVLEINGHLEFKSCDPTSPVAVHKT  223

Query  402  GIDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSP  512
            G D + L   GV YF+S  +  C  GLKL + V  +P
Sbjct  224  GQDLVILTEPGVHYFISSKIGHCAAGLKLRVLVAPTP  260


 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/91 (30%), Positives = 46/91 (51%), Gaps = 1/91 (1%)
 Frame = +3

Query  231  GWEVSNDIA-SWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            GW   +D+  SW+  + F+VGD++ F Y      + ++    EY  CD  +P  +Y  G 
Sbjct  44   GWTAKDDVYNSWAERKEFHVGDSLLFEYDRNFNDVTQVSGALEYQFCDSFSPKAVYNTGH  103

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
            D +     G  YF++ N   C++G +L + V
Sbjct  104  DVVTFTEPGFHYFITSNHACCESGQRLDVLV  134



>emb|CDY12217.1| BnaC04g12470D [Brassica napus]
Length=258

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 52/103 (50%), Gaps = 1/103 (1%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
             GW V  ++ +W+A + F VGD + F Y +A   + E+ ++ E+ SC    P+  + NG 
Sbjct  32   SGWTVGANLGTWAAGQTFAVGDNLVFAYPSAFHDVVEV-TKPEFDSCQAVKPLITFANGN  90

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNAIWPL  536
              +PL   G RYF+ G    C  G+KL + V  +       PL
Sbjct  91   SIVPLTTPGKRYFICGMPGHCAQGMKLEVNVLPTANAAPTAPL  133



>emb|CDX77822.1| BnaC07g20760D [Brassica napus]
Length=278

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 57/104 (55%), Gaps = 4/104 (4%)
 Frame = +3

Query  237  EVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGIDKI  416
            E S+  + WS  + F+VGD + F Y+   + + E+ S  E+ SCD  +P+ ++  G D I
Sbjct  160  EESDFYSKWSEEKQFHVGDNLLFYYNDQVDDVLEINSDLEFKSCDTISPVAVHNAGQDLI  219

Query  417  PLDGEGVRYFVSGNLHSCKNGLKLPLTV----QSSPKTNAIWPL  536
             L   G+RYF++  +  C+ GLKL + V    +S PK   + P 
Sbjct  220  KLTKPGIRYFITSKIGHCEAGLKLRVVVRPLSKSVPKKMQLSPF  263



>ref|XP_004158120.1| PREDICTED: LOW QUALITY PROTEIN: blue copper protein-like [Cucumis 
sativus]
Length=188

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 59/94 (63%), Gaps = 2/94 (2%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
             GW++S D+ +WS  + F VGD + F YS+   S+ E+ +RE + SC+ +N ++ Y++G 
Sbjct  35   SGWDISTDLDTWSQGKRFFVGDVLVFQYSSL-ASLNEV-TRENFNSCNTTNVLKAYSSGN  92

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSS  509
              + L   G R+FVSGN   C  G+KL + V+++
Sbjct  93   TTVTLSEPGHRFFVSGNRLLCLGGMKLQVNVENN  126



>ref|XP_009119630.1| PREDICTED: early nodulin-55-2-like [Brassica rapa]
Length=285

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 60/104 (58%), Gaps = 3/104 (3%)
 Frame = +3

Query  228  KGWEV--SNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTN  401
            +GW+V  S+    WS  + F+VGD++ F Y+     + ++    E+M+CD ++P+ ++  
Sbjct  158  EGWKVYDSDFYNKWSEEKQFHVGDSLIFEYADEVNDVYKISGDLEFMTCDPTSPVAVHKT  217

Query  402  GIDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNAIWP  533
            G D + L   GV YF++ N  SC+ GLKL + V   PK   ++P
Sbjct  218  GHDLVRLTEPGVHYFITSNSGSCEAGLKLRVMVGPVPKV-VLYP  260


 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/94 (31%), Positives = 48/94 (51%), Gaps = 3/94 (3%)
 Frame = +3

Query  228  KGWEVSNDIA-SWSAA--RIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYT  398
            +GW   +D+  +W+    + F+VGD++ F Y      + ++    EY  CDLS+P  +Y 
Sbjct  36   EGWTAKDDVYYAWAERDYKEFHVGDSLVFEYDPIINDVTQVSGGLEYEFCDLSSPKAVYN  95

Query  399  NGIDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
             G + + L   G  YF++ N   C  G KL + V
Sbjct  96   TGHEVVTLTEPGFHYFITSNQEQCVLGHKLEVLV  129



>ref|XP_002515714.1| Early nodulin 20 precursor, putative [Ricinus communis]
 gb|EEF46661.1| Early nodulin 20 precursor, putative [Ricinus communis]
Length=258

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 57/92 (62%), Gaps = 2/92 (2%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            + GW+ S ++ +W+A+++F+VGD + F Y  A  ++ E+ S+ +Y SC  SN I+ +++G
Sbjct  31   NGGWDTSTNLQAWAASQLFSVGDNLIFQY-GANHNLFEV-SQADYDSCQTSNAIQGHSDG  88

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
               IPL   G RYF+ G    C  G+K+ + V
Sbjct  89   STVIPLSSPGTRYFICGTPGHCTQGMKVEIDV  120



>ref|XP_010473859.1| PREDICTED: early nodulin-20-like [Camelina sativa]
Length=324

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 50/92 (54%), Gaps = 2/92 (2%)
 Frame = +3

Query  225  DKGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNG  404
            D GW V +D  SW   + F+VGD++ F Y      +A++ S  EY SCD S+P  +Y  G
Sbjct  31   DYGWTVKDD--SWDEHKQFHVGDSLVFEYDLNVNDLAQVSSALEYDSCDASSPKVVYNTG  88

Query  405  IDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
             D +     G  YF++ N   C NGLKL + V
Sbjct  89   YDVVTFKKPGHHYFITSNHIQCVNGLKLDVLV  120


 Score = 69.3 bits (168),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 52/96 (54%), Gaps = 2/96 (2%)
 Frame = +3

Query  228  KGWEVSNDIA--SWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTN  401
            KGW V N      WS  + F VGDT++F Y+     + E+    E+ SC+ ++ + +Y  
Sbjct  196  KGWRVYNSYYYYKWSKNKQFRVGDTLYFEYNKDLSDVREISDDLEFKSCESNSTVAVYKT  255

Query  402  GIDKIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQSS  509
            G D + L   GV YFVS     C+ G+KL +TVQ S
Sbjct  256  GHDLVKLTKPGVHYFVSLKTGLCQAGIKLRVTVQPS  291



>ref|XP_010417263.1| PREDICTED: early nodulin-like protein 1 [Camelina sativa]
Length=178

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 55/97 (57%), Gaps = 2/97 (2%)
 Frame = +3

Query  243  SNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGIDKIPL  422
            S     W+    F VGD I F Y A ++S+ E+ ++E Y SC+ +NP+  YT+G  K+ L
Sbjct  43   SYSFTEWAQKARFKVGDFIVFRYEAGKDSVLEV-TKEAYNSCNTTNPLANYTDGETKVKL  101

Query  423  DGEGVRYFVSGNLHSCKNGLKLPLTVQSSPKTNAIWP  533
            D  G  YF+SG    C+ G KL L V  SP+ + I P
Sbjct  102  DRSGPFYFISGANGHCEKGQKLSLVVI-SPRHSVISP  137



>ref|XP_010491367.1| PREDICTED: stellacyanin-like [Camelina sativa]
Length=194

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 57/91 (63%), Gaps = 2/91 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW++S+D+ SW++ + F+ GD + F YS+   S+ E+  +  Y +C+ ++ IR +TNG  
Sbjct  37   GWDISSDLESWTSGKRFSSGDVLMFQYSSTH-SVYEV-DKNNYQNCNSTDAIRTFTNGNT  94

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTVQ  503
             + L   G R+FV GN   C +G++L + V+
Sbjct  95   TVSLSKPGDRFFVCGNRLHCFSGMRLRVNVE  125



>dbj|BAJ90875.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86973.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=240

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 50/90 (56%), Gaps = 2/90 (2%)
 Frame = +3

Query  231  GWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGID  410
            GW+   D  SW++AR F  GDT+ F YS+    +   G  ++Y +C  +NP+ I  +G  
Sbjct  39   GWQGKTDYKSWASARTFVPGDTLTFKYSSNHNVLEVTG--DDYEACSTANPVIIDNSGTT  96

Query  411  KIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
             I L   G RYF+ G    C+NG+KL + V
Sbjct  97   TIALTAPGKRYFICGGPGHCQNGMKLEVDV  126



>emb|CDY65457.1| BnaC03g71950D [Brassica napus]
Length=255

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 50/91 (55%), Gaps = 1/91 (1%)
 Frame = +3

Query  228  KGWEVSNDIASWSAARIFNVGDTIWFTYSAAQESIAELGSREEYMSCDLSNPIRIYTNGI  407
            +GW V  ++ +W+A + F VGD + F Y +A   + E+ ++ EY SC    P+  + NG 
Sbjct  32   RGWTVGANLKTWAAGQTFVVGDNLVFAYPSAFHDVVEV-TKPEYDSCQAVKPLIKFANGN  90

Query  408  DKIPLDGEGVRYFVSGNLHSCKNGLKLPLTV  500
              +PL   G RYF+ G    C  G+KL + V
Sbjct  91   SIVPLTTPGKRYFICGMPGHCTQGMKLEVNV  121



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 764930893160