BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001C23

Length=336
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAF46302.1|  cysteine proteinase precursor                          200   3e-60   Ipomoea nil [qian niu]
gb|AAQ81938.1|  cysteine proteinase precursor                           199   5e-60   Ipomoea batatas [batate]
gb|KJB29613.1|  hypothetical protein B456_005G110200                    156   4e-45   Gossypium raimondii
ref|XP_007017672.1|  Papain family cysteine protease                    160   1e-44   
gb|KJB29612.1|  hypothetical protein B456_005G110200                    157   2e-44   Gossypium raimondii
gb|KJB29611.1|  hypothetical protein B456_005G110200                    158   5e-44   Gossypium raimondii
gb|EYU27644.1|  hypothetical protein MIMGU_mgv1a008452mg                157   8e-44   Erythranthe guttata [common monkey flower]
gb|KHG15062.1|  Cysteinease RD19a -like protein                         157   8e-44   Gossypium arboreum [tree cotton]
ref|XP_002302004.2|  hypothetical protein POPTR_0002s03020g             156   1e-43   
ref|XP_011028940.1|  PREDICTED: cysteine proteinase 15A-like            156   2e-43   Populus euphratica
gb|ABK96580.1|  unknown                                                 153   3e-42   Populus trichocarpa x Populus deltoides
gb|ABK94801.1|  unknown                                                 153   4e-42   Populus trichocarpa [western balsam poplar]
gb|AAN57719.1|  cysteine proteinase precursor                           145   4e-42   Solanum melongena [aubergine]
gb|AAD29084.1|AF082181_1  cysteine proteinase precursor                 151   1e-41   Solanum melongena [aubergine]
gb|KJB58164.1|  hypothetical protein B456_009G197400                    151   2e-41   Gossypium raimondii
dbj|BAG16515.1|  putative cysteine proteinase                           149   7e-41   Capsicum chinense [bonnet pepper]
emb|CDP07452.1|  unnamed protein product                                148   3e-40   Coffea canephora [robusta coffee]
ref|XP_009776238.1|  PREDICTED: cysteine proteinase 15A-like            148   3e-40   Nicotiana sylvestris
ref|XP_006341997.1|  PREDICTED: cysteine proteinase 15A-like            147   8e-40   Solanum tuberosum [potatoes]
gb|KDO84720.1|  hypothetical protein CISIN_1g017548mg                   147   9e-40   Citrus sinensis [apfelsine]
ref|XP_006473584.1|  PREDICTED: cysteine proteinase 15A-like            146   1e-39   Citrus sinensis [apfelsine]
emb|CAA78361.1|  tobacco pre-pro-cysteine proteinase                    146   1e-39   Nicotiana tabacum [American tobacco]
ref|XP_009611293.1|  PREDICTED: cysteine proteinase 15A-like            145   2e-39   Nicotiana tomentosiformis
ref|XP_010271520.1|  PREDICTED: cysteine proteinase RD19a-like          145   3e-39   Nelumbo nucifera [Indian lotus]
ref|XP_009146338.1|  PREDICTED: cysteine proteinase 15A-like            145   3e-39   Brassica rapa
ref|XP_002510469.1|  cysteine protease, putative                        145   4e-39   Ricinus communis
gb|EPS65881.1|  cysteine proteinase                                     144   6e-39   Genlisea aurea
ref|XP_004238314.1|  PREDICTED: cysteine proteinase 15A                 144   8e-39   
ref|XP_006435090.1|  hypothetical protein CICLE_v10001559mg             144   8e-39   Citrus clementina [clementine]
gb|AIB06025.1|  CP3                                                     144   8e-39   Hevea brasiliensis [jebe]
emb|CAA78403.1|  pre-pro-cysteine proteinase                            144   1e-38   Solanum lycopersicum
ref|XP_011083631.1|  PREDICTED: cysteine proteinase 15A-like            144   1e-38   Sesamum indicum [beniseed]
dbj|BAJ53178.1|  JHL18I08.12                                            143   1e-38   Jatropha curcas
ref|XP_002306900.1|  hypothetical protein POPTR_0005s25540g             143   2e-38   
gb|AAZ32411.1|  cysteine proteinase glycinain type                      142   2e-38   Nicotiana benthamiana
gb|AAK07731.1|  CPR2-like cysteine proteinase                           143   2e-38   Nicotiana tabacum [American tobacco]
gb|AAF40416.1|AF216785_1  papain-like cysteine proteinase isoform...    142   3e-38   Ipomoea batatas [batate]
ref|XP_009786000.1|  PREDICTED: cysteine proteinase RD19a-like          142   3e-38   Nicotiana sylvestris
ref|XP_008387995.1|  PREDICTED: cysteine proteinase 15A                 142   4e-38   Malus domestica [apple tree]
ref|XP_010449835.1|  PREDICTED: cysteine proteinase 15A-like            141   7e-38   Camelina sativa [gold-of-pleasure]
ref|XP_002870174.1|  hypothetical protein ARALYDRAFT_915142             141   1e-37   Arabidopsis lyrata subsp. lyrata
ref|XP_010268619.1|  PREDICTED: cysteine proteinase RD19a-like          141   1e-37   Nelumbo nucifera [Indian lotus]
ref|XP_004291404.1|  PREDICTED: cysteine proteinase 15A-like            140   1e-37   Fragaria vesca subsp. vesca
gb|KDO84721.1|  hypothetical protein CISIN_1g017548mg                   139   2e-37   Citrus sinensis [apfelsine]
ref|XP_009335626.1|  PREDICTED: cysteine proteinase 15A                 140   2e-37   Pyrus x bretschneideri [bai li]
ref|XP_010434865.1|  PREDICTED: cysteine proteinase 15A-like            140   2e-37   Camelina sativa [gold-of-pleasure]
gb|AAF61440.1|AF138264_1  papain-like cysteine proteinase isoform I     140   3e-37   Ipomoea batatas [batate]
gb|AAF40414.1|AF216783_1  papain-like cysteine proteinase isoform I     140   3e-37   Ipomoea batatas [batate]
ref|NP_567489.1|  papain family cysteine protease                       140   3e-37   Arabidopsis thaliana [mouse-ear cress]
emb|CDY34441.1|  BnaC01g21920D                                          139   4e-37   Brassica napus [oilseed rape]
emb|CDP20652.1|  unnamed protein product                                139   6e-37   Coffea canephora [robusta coffee]
ref|XP_010530325.1|  PREDICTED: cysteine proteinase RD19a               138   2e-36   Tarenaya hassleriana [spider flower]
gb|KDP41743.1|  hypothetical protein JCGZ_26761                         138   2e-36   Jatropha curcas
ref|XP_009602233.1|  PREDICTED: cysteine proteinase RD19a-like          137   2e-36   Nicotiana tomentosiformis
ref|XP_004150061.1|  PREDICTED: cysteine proteinase RD19a-like          137   2e-36   Cucumis sativus [cucumbers]
ref|NP_001241450.1|  uncharacterized protein LOC100778716 precursor     137   2e-36   Glycine max [soybeans]
ref|XP_011092831.1|  PREDICTED: cysteine proteinase RD19a-like          137   2e-36   Sesamum indicum [beniseed]
ref|XP_010061009.1|  PREDICTED: cysteine proteinase RD19a-like          137   3e-36   Eucalyptus grandis [rose gum]
ref|XP_006414378.1|  hypothetical protein EUTSA_v10025521mg             137   3e-36   Eutrema salsugineum [saltwater cress]
gb|EYU42593.1|  hypothetical protein MIMGU_mgv1a008336mg                137   3e-36   Erythranthe guttata [common monkey flower]
gb|AAF40415.1|AF216784_1  papain-like cysteine proteinase isoform II    137   3e-36   Ipomoea batatas [batate]
ref|XP_007223351.1|  hypothetical protein PRUPE_ppa007441mg             137   4e-36   Prunus persica
emb|CAA78365.1|  tobacco pre-pro-cysteine proteinase                    136   5e-36   Nicotiana tabacum [American tobacco]
gb|KFK24413.1|  hypothetical protein AALP_AAs58848U000200               136   6e-36   Arabis alpina [alpine rockcress]
gb|AAF61441.1|AF138265_1  papain-like cysteine proteinase isoform II    136   8e-36   Ipomoea batatas [batate]
gb|KHN22211.1|  Cysteine proteinase 15A                                 136   9e-36   Glycine soja [wild soybean]
ref|XP_008460996.1|  PREDICTED: cysteine proteinase RD19a-like          136   1e-35   Cucumis melo [Oriental melon]
ref|XP_008221329.1|  PREDICTED: cysteine proteinase 15A-like            135   2e-35   Prunus mume [ume]
ref|XP_002275759.1|  PREDICTED: cysteine proteinase RD19a               135   2e-35   Vitis vinifera
gb|ACX54787.2|  cysteine protease                                       134   4e-35   Arachis diogoi
emb|CAB17075.1|  cysteine proteinase precursor                          134   4e-35   Phaseolus vulgaris [French bean]
ref|XP_004290288.1|  PREDICTED: probable cysteine proteinase A494       134   5e-35   Fragaria vesca subsp. vesca
ref|XP_007201310.1|  hypothetical protein PRUPE_ppa007454mg             134   6e-35   Prunus persica
dbj|BAD10859.1|  cysteine protease                                      134   6e-35   Tripolium pannonicum [sea starwort]
ref|XP_002452058.1|  hypothetical protein SORBIDRAFT_04g017830          134   6e-35   Sorghum bicolor [broomcorn]
ref|XP_011088458.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    134   6e-35   Sesamum indicum [beniseed]
ref|XP_002280798.2|  PREDICTED: cysteine proteinase 15A                 133   8e-35   Vitis vinifera
ref|XP_010440192.1|  PREDICTED: cysteine proteinase RD19a-like          133   9e-35   Camelina sativa [gold-of-pleasure]
gb|AAK27969.1|AF242373_1  cysteine protease                             133   1e-34   Ipomoea batatas [batate]
ref|NP_001267989.1|  cysteine protease precursor                        133   1e-34   Vitis vinifera
gb|EPS70818.1|  cysteine proteinase                                     132   1e-34   Genlisea aurea
ref|XP_010672379.1|  PREDICTED: cysteine proteinase RD19a-like          133   1e-34   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007160702.1|  hypothetical protein PHAVU_001G009900g             132   1e-34   Phaseolus vulgaris [French bean]
ref|XP_006283974.1|  hypothetical protein CARUB_v10005098mg             132   2e-34   Capsella rubella
ref|XP_004507484.1|  PREDICTED: cysteine proteinase RD19a-like          132   2e-34   Cicer arietinum [garbanzo]
gb|ACK57563.1|  cysteine protease-like protein                          132   2e-34   Arachis hypogaea [goober]
ref|XP_011045161.1|  PREDICTED: cysteine proteinase 15A-like            132   2e-34   Populus euphratica
gb|AJA74415.1|  cysteine protease                                       132   3e-34   Cicer arietinum [garbanzo]
ref|XP_002280808.2|  PREDICTED: cysteine proteinase 15A                 132   3e-34   Vitis vinifera
ref|XP_010436538.1|  PREDICTED: cysteine proteinase 15A-like            129   3e-34   
ref|NP_001266121.1|  uncharacterized protein LOC101501911 precursor     131   4e-34   Cicer arietinum [garbanzo]
ref|XP_006362019.1|  PREDICTED: cysteine proteinase RD19a-like          131   4e-34   Solanum tuberosum [potatoes]
gb|KHN45894.1|  Cysteine proteinase RD19a                               131   4e-34   Glycine soja [wild soybean]
ref|XP_008236965.1|  PREDICTED: cysteine proteinase RD19a               131   4e-34   Prunus mume [ume]
dbj|BAF03553.1|  cysteine proteinase CP2                                131   4e-34   Phaseolus vulgaris [French bean]
gb|ACF86683.1|  unknown                                                 131   4e-34   Zea mays [maize]
ref|NP_001046828.1|  Os02g0469600                                       131   6e-34   
ref|XP_004952477.1|  PREDICTED: cysteine proteinase 1-like              131   6e-34   Setaria italica
ref|XP_010105270.1|  Cysteine proteinase 15A                            131   7e-34   Morus notabilis
ref|XP_003545051.1|  PREDICTED: cysteine proteinase 15A-like            130   9e-34   Glycine max [soybeans]
ref|XP_010943608.1|  PREDICTED: cysteine proteinase 1-like              130   9e-34   Elaeis guineensis
gb|EYU37835.1|  hypothetical protein MIMGU_mgv1a008237mg                130   1e-33   Erythranthe guttata [common monkey flower]
ref|XP_008382317.1|  PREDICTED: cysteine proteinase RD19a               130   1e-33   
emb|CDP08018.1|  unnamed protein product                                126   2e-33   Coffea canephora [robusta coffee]
emb|CAA82995.1|  cysteine proteinase                                    129   2e-33   Vicia sativa [spring vetch]
ref|XP_003606998.1|  Cysteine proteinase                                129   2e-33   Medicago truncatula
ref|XP_004230928.1|  PREDICTED: cysteine proteinase RD19a               129   3e-33   Solanum lycopersicum
gb|ACM80348.1|  cysteine proteinase                                     129   3e-33   Solanum lycopersicum
dbj|BAA92495.1|  cysteine protease                                      128   6e-33   Vigna mungo [urad dal]
gb|AAL05851.1|AF411121_1  cysteine proteinase precursor                 128   6e-33   Sandersonia aurantiaca [Chinese-lantern lily]
gb|AIB06024.1|  CP2                                                     128   7e-33   Hevea brasiliensis [jebe]
ref|XP_008775280.1|  PREDICTED: cysteine proteinase 1-like              128   8e-33   Phoenix dactylifera
ref|XP_009373000.1|  PREDICTED: cysteine proteinase RD19a               128   8e-33   Pyrus x bretschneideri [bai li]
ref|XP_008448073.1|  PREDICTED: cysteine proteinase RD19a-like          127   1e-32   Cucumis melo [Oriental melon]
gb|AGV54334.1|  cysteine proteinase RD19a-like protein                  127   2e-32   Phaseolus vulgaris [French bean]
gb|KDO49483.1|  hypothetical protein CISIN_1g017318mg                   127   2e-32   Citrus sinensis [apfelsine]
ref|XP_004165230.1|  PREDICTED: cysteine proteinase RD19a-like          127   2e-32   
ref|XP_003550405.2|  PREDICTED: cysteine proteinase 15A                 127   2e-32   
gb|KGN43159.1|  Papain-like cysteine proteinase isoform I               127   2e-32   Cucumis sativus [cucumbers]
ref|XP_007042077.1|  Papain family cysteine protease                    127   2e-32   
gb|KHG24064.1|  Cysteinease RD19a -like protein                         127   2e-32   Gossypium arboreum [tree cotton]
ref|XP_007160703.1|  hypothetical protein PHAVU_001G009900g             125   2e-32   Phaseolus vulgaris [French bean]
emb|CDY09707.1|  BnaC07g33540D                                          127   2e-32   Brassica napus [oilseed rape]
gb|ACI04578.1|  cysteine protease-like protein                          126   2e-32   Robinia pseudoacacia [black locust]
ref|XP_004148554.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    127   2e-32   
ref|XP_002305451.2|  cysteine proteinase A494 precursor                 126   3e-32   
ref|XP_006487337.1|  PREDICTED: cysteine proteinase RD19a-like          126   3e-32   Citrus sinensis [apfelsine]
gb|KJB32561.1|  hypothetical protein B456_005G247000                    126   3e-32   Gossypium raimondii
ref|XP_007136047.1|  hypothetical protein PHAVU_009G013600g             126   4e-32   Phaseolus vulgaris [French bean]
gb|AAB67878.1|  pre-pro-cysteine proteinase                             126   4e-32   Vicia faba [broad bean]
ref|XP_003606999.1|  Cysteine proteinase                                122   5e-32   
gb|AAO11786.1|  pre-pro cysteine proteinase                             125   5e-32   Vicia faba [broad bean]
emb|CDX90537.1|  BnaA03g42440D                                          125   7e-32   
ref|XP_003523684.1|  PREDICTED: cysteine proteinase 15A-like            125   7e-32   Glycine max [soybeans]
ref|XP_006828787.1|  hypothetical protein AMTR_s00001p00114210          125   9e-32   
gb|AEQ94105.1|  putative drought-inducible cysteine proteinase          121   1e-31   Elaeis guineensis
ref|NP_001105685.1|  cysteine proteinase 1 precursor                    125   1e-31   Zea mays [maize]
ref|XP_003589348.1|  Cysteine proteinase                                124   2e-31   Medicago truncatula
sp|P25804.1|CYSP_PEA  RecName: Full=Cysteine proteinase 15A; AltN...    124   2e-31   Pisum sativum [garden pea]
ref|XP_004152668.1|  PREDICTED: cysteine proteinase RD19a-like          124   3e-31   Cucumis sativus [cucumbers]
ref|XP_010028631.1|  PREDICTED: cysteine proteinase RD19a-like          124   4e-31   Eucalyptus grandis [rose gum]
ref|XP_009406357.1|  PREDICTED: cysteine proteinase 1-like              123   4e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009136751.1|  PREDICTED: cysteine proteinase RD19a-like          123   4e-31   Brassica rapa
ref|XP_007131787.1|  hypothetical protein PHAVU_011G041600g             123   5e-31   Phaseolus vulgaris [French bean]
gb|KHG15253.1|  Cysteinease RD19a -like protein                         123   5e-31   Gossypium arboreum [tree cotton]
ref|XP_011037175.1|  PREDICTED: cysteine proteinase RD19a-like          123   6e-31   Populus euphratica
gb|AEQ94152.1|  drought-inducible cysteine proteinase                   120   7e-31   Elaeis guineensis
ref|XP_006423403.1|  hypothetical protein CICLE_v10028670mg             122   8e-31   Citrus clementina [clementine]
ref|XP_003574963.1|  PREDICTED: cysteine proteinase 1-like              122   8e-31   Brachypodium distachyon [annual false brome]
gb|KFK30492.1|  hypothetical protein AALP_AA7G268600                    122   1e-30   Arabis alpina [alpine rockcress]
ref|XP_002279862.1|  PREDICTED: cysteine proteinase RD19a               122   1e-30   Vitis vinifera
gb|KJB79047.1|  hypothetical protein B456_013G033800                    121   2e-30   Gossypium raimondii
ref|XP_008444769.1|  PREDICTED: cysteine proteinase RD19a-like          121   2e-30   Cucumis melo [Oriental melon]
ref|XP_010910124.1|  PREDICTED: cysteine proteinase 1-like              121   2e-30   Elaeis guineensis
ref|XP_006411706.1|  hypothetical protein EUTSA_v10025494mg             121   3e-30   Eutrema salsugineum [saltwater cress]
emb|CDY71205.1|  BnaCnng71840D                                          121   3e-30   Brassica napus [oilseed rape]
dbj|BAF98585.1|  CM0216.510.nc                                          121   3e-30   Lotus japonicus
gb|AFK47617.1|  unknown                                                 119   3e-30   Medicago truncatula
gb|ABQ10201.1|  cysteine protease Cp3                                   120   4e-30   Actinidia deliciosa [Chinese gooseberry]
gb|EMT16425.1|  Cysteine proteinase 1                                   120   5e-30   
dbj|BAF98584.1|  CM0216.500.nc                                          120   5e-30   Lotus japonicus
emb|CAE45589.1|  papain-like cysteine proteinase-like protein 2         120   5e-30   Lotus japonicus
gb|KHN25410.1|  Cysteine proteinase RD19a                               120   5e-30   Glycine soja [wild soybean]
ref|XP_003540987.1|  PREDICTED: cysteine proteinase RD19a-like          120   5e-30   Glycine max [soybeans]
ref|XP_002512963.1|  cysteine protease, putative                        120   5e-30   Ricinus communis
emb|CAE54306.1|  putative papain-like cysteine proteinase               120   6e-30   Gossypium hirsutum [American cotton]
emb|CDY41960.1|  BnaA01g05320D                                          119   1e-29   Brassica napus [oilseed rape]
gb|AAL60581.1|AF454959_1  senescence-associated cysteine protease       119   1e-29   Brassica oleracea
ref|XP_002868883.1|  hypothetical protein ARALYDRAFT_490677             119   1e-29   
ref|XP_004975256.1|  PREDICTED: cysteine proteinase 1-like              119   2e-29   Setaria italica
ref|XP_009373025.1|  PREDICTED: cysteine proteinase RD19a-like          119   2e-29   Pyrus x bretschneideri [bai li]
tpe|CAD66657.1|  TPA: putative cysteine proteinase precursor            119   3e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002880378.1|  hypothetical protein ARALYDRAFT_481008             118   3e-29   Arabidopsis lyrata subsp. lyrata
dbj|BAC41322.1|  hypothetical protein                                   118   3e-29   Lotus japonicus
emb|CAE45588.1|  papain-like cysteine proteinase-like protein 1         118   3e-29   Lotus japonicus
gb|KJB79049.1|  hypothetical protein B456_013G033800                    115   4e-29   Gossypium raimondii
ref|XP_010437007.1|  PREDICTED: cysteine proteinase RD19a-like          118   4e-29   Camelina sativa [gold-of-pleasure]
ref|NP_568052.1|  cysteine proteinase RD19a                             118   4e-29   Arabidopsis thaliana [mouse-ear cress]
gb|ABK92536.1|  unknown                                                 117   5e-29   Populus trichocarpa [western balsam poplar]
ref|XP_002313770.1|  cysteine proteinase A494 precursor                 117   5e-29   
gb|AAM65162.1|  cysteine proteinase RD19A                               117   5e-29   Arabidopsis thaliana [mouse-ear cress]
gb|KJB79048.1|  hypothetical protein B456_013G033800                    116   5e-29   Gossypium raimondii
ref|XP_009109502.1|  PREDICTED: cysteine proteinase RD19a-like          117   7e-29   Brassica rapa
gb|KJB79050.1|  hypothetical protein B456_013G033800                    116   7e-29   Gossypium raimondii
ref|XP_009150026.1|  PREDICTED: cysteine proteinase RD19a               117   7e-29   Brassica rapa
ref|XP_010446443.1|  PREDICTED: cysteine proteinase RD19a               117   9e-29   Camelina sativa [gold-of-pleasure]
ref|XP_006283963.1|  hypothetical protein CARUB_v10005086mg             117   9e-29   Capsella rubella
ref|XP_010431862.1|  PREDICTED: cysteine proteinase RD19a               117   1e-28   Camelina sativa [gold-of-pleasure]
ref|XP_008775532.1|  PREDICTED: cysteine proteinase 1-like              117   1e-28   Phoenix dactylifera
gb|AAW21813.1|  cysteine protease                                       116   1e-28   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010066197.1|  PREDICTED: probable cysteine proteinase A494       116   1e-28   Eucalyptus grandis [rose gum]
ref|XP_010531457.1|  PREDICTED: probable cysteine proteinase A494       116   2e-28   Tarenaya hassleriana [spider flower]
ref|XP_003539008.1|  PREDICTED: cysteine proteinase RD19a-like          116   2e-28   Glycine max [soybeans]
emb|CAQ00101.1|  papain-like cysteine proteinase                        116   2e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011047717.1|  PREDICTED: cysteine proteinase RD19a               116   2e-28   Populus euphratica
ref|XP_009376976.1|  PREDICTED: cysteine proteinase RD19a-like          115   4e-28   
gb|AAX19661.1|  cysteine proteinase                                     115   4e-28   Populus tomentosa [Chinese white poplar]
gb|KJB07487.1|  hypothetical protein B456_001G026600                    115   4e-28   Gossypium raimondii
gb|AAN60308.1|  unknown                                                 112   5e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009376977.1|  PREDICTED: cysteine proteinase RD19a-like          115   5e-28   
ref|XP_009405542.1|  PREDICTED: cysteine proteinase 1-like              114   9e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_565512.1|  Papain family cysteine protease                       114   9e-28   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD43619.1|  putative cysteine proteinase                           114   1e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010690815.1|  PREDICTED: cysteine proteinase RD19a               114   1e-27   Beta vulgaris subsp. vulgaris [field beet]
emb|CAD40319.2|  OSJNBb0054B09.3                                        114   1e-27   Oryza sativa Japonica Group [Japonica rice]
gb|EMT10192.1|  Cysteine proteinase 1                                   111   8e-27   
ref|XP_009140277.1|  PREDICTED: probable cysteine proteinase A494       110   2e-26   Brassica rapa
emb|CDY15894.1|  BnaA04g12170D                                          110   2e-26   Brassica napus [oilseed rape]
ref|XP_009392632.1|  PREDICTED: cysteine proteinase 1-like              110   2e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003579573.2|  PREDICTED: cysteine proteinase 1-like              110   3e-26   Brachypodium distachyon [annual false brome]
gb|ABF46642.1|  papain-like cysteine proteinase                         109   7e-26   Pachysandra terminalis
gb|AES89347.2|  papain family cysteine protease                         108   7e-26   Medicago truncatula
ref|XP_003607150.1|  Cysteine proteinase                                108   7e-26   
emb|CDY14798.1|  BnaC04g47950D                                          103   1e-25   Brassica napus [oilseed rape]
gb|KEH30505.1|  papain family cysteine protease                         107   3e-25   Medicago truncatula
ref|XP_003607110.1|  Cysteine proteinase                                107   3e-25   Medicago truncatula
gb|KHN39817.1|  Cysteine proteinase RD19a                               107   4e-25   Glycine soja [wild soybean]
ref|XP_006294682.1|  hypothetical protein CARUB_v10023719mg           97.1    4e-23   
ref|XP_006404590.1|  hypothetical protein EUTSA_v10000210mg             101   4e-23   Eutrema salsugineum [saltwater cress]
gb|KHN25481.1|  Cysteine proteinase 15A                               99.8    5e-23   Glycine soja [wild soybean]
gb|EMS64962.1|  Cysteine proteinase 1                                 99.4    1e-22   Triticum urartu
ref|XP_009117680.1|  PREDICTED: probable cysteine proteinase A494     97.8    7e-22   Brassica rapa
ref|XP_006653265.1|  PREDICTED: cysteine proteinase 1-like            97.8    7e-22   
emb|CDX99593.1|  BnaC04g33500D                                        96.3    2e-21   
gb|ABK21238.1|  unknown                                               95.9    3e-21   Picea sitchensis
gb|ABK24688.1|  unknown                                               95.9    4e-21   Picea sitchensis
ref|XP_002960585.1|  hypothetical protein SELMODRAFT_266583           94.7    9e-21   
ref|XP_010534431.1|  PREDICTED: cysteine proteinase 15A               94.7    1e-20   Tarenaya hassleriana [spider flower]
ref|XP_002969223.1|  hypothetical protein SELMODRAFT_91274            94.0    2e-20   
gb|ACN40679.1|  unknown                                               93.2    3e-20   Picea sitchensis
ref|XP_008233261.1|  PREDICTED: cysteine proteinase 15A               92.4    8e-20   Prunus mume [ume]
emb|CAB41090.1|  cysteine proteinase precursor-like protein           91.7    1e-19   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567010.5|  Papain family cysteine protease                     91.7    1e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009116190.1|  PREDICTED: probable cysteine proteinase A494     91.3    2e-19   Brassica rapa
emb|CDY56961.1|  BnaA09g55030D                                        91.3    2e-19   Brassica napus [oilseed rape]
ref|XP_006403513.1|  hypothetical protein EUTSA_v10010475mg           90.9    3e-19   Eutrema salsugineum [saltwater cress]
emb|CDX73424.1|  BnaC08g25790D                                        90.5    3e-19   
ref|XP_010034320.1|  PREDICTED: cysteine proteinase 1                 90.5    4e-19   Eucalyptus grandis [rose gum]
ref|XP_007218137.1|  hypothetical protein PRUPE_ppa007240mg           89.7    6e-19   Prunus persica
ref|XP_008446834.1|  PREDICTED: cysteine proteinase 15A               89.7    6e-19   Cucumis melo [Oriental melon]
ref|XP_010918606.1|  PREDICTED: probable cysteine proteinase A494     89.4    1e-18   Elaeis guineensis
gb|KDO48246.1|  hypothetical protein CISIN_1g037577mg                 86.3    1e-18   Citrus sinensis [apfelsine]
ref|XP_010243268.1|  PREDICTED: cysteine proteinase 15A               88.6    2e-18   Nelumbo nucifera [Indian lotus]
ref|XP_002876278.1|  hypothetical protein ARALYDRAFT_485911           88.6    2e-18   
gb|KFK34737.1|  hypothetical protein AALP_AA5G186400                  88.2    2e-18   Arabis alpina [alpine rockcress]
ref|XP_006293095.1|  hypothetical protein CARUB_v10019394mg           87.8    3e-18   Capsella rubella
ref|XP_004157559.1|  PREDICTED: cysteine proteinase 15A-like          88.2    3e-18   
ref|XP_004142497.1|  PREDICTED: cysteine proteinase 15A-like          88.2    3e-18   
ref|XP_002266821.1|  PREDICTED: cysteine proteinase 15A               87.0    6e-18   Vitis vinifera
emb|CAA52403.1|  putative thiol protease                              85.9    1e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006436511.1|  hypothetical protein CICLE_v10031865mg           86.3    1e-17   Citrus clementina [clementine]
ref|XP_010103534.1|  putative cysteine proteinase A494                85.9    2e-17   Morus notabilis
gb|ABK24153.1|  unknown                                               85.5    3e-17   Picea sitchensis
ref|XP_006361690.1|  PREDICTED: cysteine proteinase 15A-like          85.1    3e-17   Solanum tuberosum [potatoes]
ref|XP_010504326.1|  PREDICTED: cysteine proteinase 15A-like          84.7    4e-17   Camelina sativa [gold-of-pleasure]
ref|XP_009789260.1|  PREDICTED: cysteine proteinase 15A               85.1    5e-17   Nicotiana sylvestris
ref|XP_008802783.1|  PREDICTED: probable cysteine proteinase A494     84.7    5e-17   Phoenix dactylifera
gb|KHN37802.1|  Cysteine proteinase 1                                 84.3    5e-17   Glycine soja [wild soybean]
ref|XP_004250044.1|  PREDICTED: cysteine proteinase 15A               84.3    7e-17   Solanum lycopersicum
gb|EPS63354.1|  hypothetical protein M569_11429                       84.0    7e-17   Genlisea aurea
ref|NP_001236888.1|  cysteine proteinase precursor                    84.3    8e-17   Glycine max [soybeans]
gb|KDP30486.1|  hypothetical protein JCGZ_16165                       84.0    1e-16   Jatropha curcas
emb|CAB17077.1|  cysteine proteinase precursor                        82.8    2e-16   Phaseolus vulgaris [French bean]
ref|XP_002533377.1|  cysteine protease, putative                      82.4    3e-16   Ricinus communis
ref|XP_007010012.1|  Papain family cysteine protease                  82.4    3e-16   
ref|XP_006423400.1|  hypothetical protein CICLE_v10029917mg           79.0    4e-16   Citrus clementina [clementine]
gb|EMS53996.1|  Cysteine proteinase 1                                 82.8    4e-16   Triticum urartu
ref|XP_007143764.1|  hypothetical protein PHAVU_007G099600g           83.2    4e-16   Phaseolus vulgaris [French bean]
ref|XP_001781954.1|  predicted protein                                82.0    4e-16   
gb|KHG08355.1|  Cysteinease 1                                         81.6    4e-16   Gossypium arboreum [tree cotton]
gb|KJB73490.1|  hypothetical protein B456_011G235500                  82.0    5e-16   Gossypium raimondii
gb|KHN00877.1|  Cysteine proteinase 15A                               80.9    7e-16   Glycine soja [wild soybean]
ref|XP_010688493.1|  PREDICTED: cysteine proteinase 15A               81.3    9e-16   Beta vulgaris subsp. vulgaris [field beet]
gb|KEH43476.1|  papain family cysteine protease                       81.3    1e-15   Medicago truncatula
ref|XP_008362714.1|  PREDICTED: cysteine proteinase 15A               80.5    2e-15   
ref|XP_009617441.1|  PREDICTED: cysteine proteinase 15A               80.1    3e-15   Nicotiana tomentosiformis
ref|XP_004496226.1|  PREDICTED: cysteine proteinase 15A-like          79.7    3e-15   Cicer arietinum [garbanzo]
ref|XP_009404192.1|  PREDICTED: cysteine proteinase 15A               79.3    3e-15   
emb|CAB16316.1|  cysteine proteinase precursor                        79.7    3e-15   Vicia sativa [spring vetch]
emb|CDO99795.1|  unnamed protein product                              79.7    4e-15   
gb|AEQ54770.1|  cysteine proteinase CP1                               79.7    4e-15   
ref|XP_008780344.1|  PREDICTED: cysteine proteinase 15A-like          77.8    4e-15   
emb|CAN64491.1|  hypothetical protein VITISV_015725                   78.2    6e-15   
ref|XP_001761980.1|  predicted protein                                79.0    6e-15   
gb|EYU39642.1|  hypothetical protein MIMGU_mgv1a008552mg              78.6    8e-15   
ref|XP_006850211.1|  hypothetical protein AMTR_s00022p00251800        77.8    1e-14   
gb|EEE60725.1|  hypothetical protein OsJ_14236                        77.8    2e-14   
ref|XP_011024366.1|  PREDICTED: cysteine proteinase 15A               76.6    5e-14   
gb|ACA52224.1|  drought-inducible cysteine proteinase Rd19A           71.6    1e-13   
ref|XP_002316398.1|  hypothetical protein POPTR_0010s23510g           73.9    2e-13   
ref|XP_002978562.1|  hypothetical protein SELMODRAFT_109056           73.9    3e-13   
gb|ACA52223.1|  drought-inducible cysteine proteinase Rd19A           69.7    6e-13   
ref|XP_002970484.1|  hypothetical protein SELMODRAFT_93661            72.8    9e-13   
gb|AAD46920.1|AF167986_1  putative cysteine proteinase GmPM33         72.8    1e-12   
emb|CCD21670.1|  cysteine peptidase (CP), putative                    72.4    1e-12   
emb|CCC48265.1|  cysteine peptidase precursor, fragment               72.4    1e-12   
emb|CCC48258.1|  cysteine peptidase precursor                         72.4    2e-12   
emb|CCC48259.1|  cysteine peptidase precursor, fragment               72.4    2e-12   
emb|CCC48256.1|  cysteine peptidase precursor                         72.4    2e-12   
emb|CCD20093.1|  cysteine peptidase precursor                         72.4    2e-12   
emb|CCD21595.1|  hypothetical protein, conserved in T. vivax          70.1    3e-12   
emb|CCC48260.1|  cysteine peptidase precursor, fragment               69.3    4e-12   
ref|XP_003970181.1|  PREDICTED: cathepsin F-like                      71.6    5e-12   
emb|CCC48263.1|  cysteine peptidase precursor, fragment               69.3    7e-12   
gb|AAB16996.1|  thiol protease isoform B                              70.1    7e-12   
ref|XP_010754224.1|  PREDICTED: cathepsin F                           70.9    8e-12   
emb|CCC48262.1|  cysteine peptidase, Clan CA, family C1,Cathepsin...  69.3    1e-11   
ref|XP_005916689.1|  PREDICTED: cathepsin F-like                      70.1    1e-11   
ref|XP_003451852.1|  PREDICTED: cathepsin F-like                      70.1    1e-11   
emb|CAF92720.1|  unnamed protein product                              67.0    2e-11   
ref|XP_004563245.1|  PREDICTED: cathepsin F-like                      70.1    2e-11   
ref|XP_011094506.1|  PREDICTED: cysteine proteinase 15A               69.3    2e-11   
ref|XP_008280430.1|  PREDICTED: cathepsin W isoform X2                69.7    2e-11   
ref|XP_008280429.1|  PREDICTED: cathepsin W isoform X1                69.7    2e-11   
emb|CCD12886.1|  unnamed protein product                              68.9    2e-11   
emb|CCD15016.1|  unnamed protein product                              68.9    2e-11   
emb|CCD12273.1|  unnamed protein product                              68.9    2e-11   
emb|CCD11724.1|  unnamed protein product                              68.9    3e-11   
gb|ADE76932.1|  unknown                                               69.3    3e-11   
emb|CCD11725.1|  unnamed protein product                              68.6    3e-11   
emb|CCD11901.1|  unnamed protein product                              68.6    3e-11   
emb|CCD14279.1|  unnamed protein product                              68.6    3e-11   
gb|ACN56478.1|  cathepsin F                                           69.3    3e-11   
gb|ACC86111.1|  cathepsin F                                           69.3    3e-11   
emb|CCD15012.1|  unnamed protein product                              68.6    3e-11   
gb|AAD24589.1|AF139913_1  cysteine protease                           68.9    3e-11   
emb|CAA81061.1|  cysteine proteinase                                  68.9    3e-11   
gb|AAA18215.1|  cysteine protease precursor                           68.9    3e-11   
emb|CCD14732.1|  unnamed protein product                              68.9    3e-11   
emb|CCD15484.1|  unnamed protein product                              68.9    3e-11   
emb|CCD17026.1|  unnamed protein product                              68.9    3e-11   
emb|CCD12272.1|  unnamed protein product                              68.9    4e-11   
emb|CCD11889.1|  unnamed protein product                              68.9    4e-11   
ref|XP_008418047.1|  PREDICTED: cathepsin F-like                      68.9    4e-11   
ref|XP_009029595.1|  hypothetical protein HELRODRAFT_157956           67.8    4e-11   
gb|EEC70284.1|  hypothetical protein OsI_01107                        65.5    4e-11   
ref|XP_005811173.1|  PREDICTED: cathepsin F-like                      68.9    5e-11   
ref|XP_010765827.1|  PREDICTED: cathepsin W                           68.9    5e-11   
ref|XP_007568468.1|  PREDICTED: cathepsin W                           68.6    5e-11   
ref|XP_004073613.1|  PREDICTED: cathepsin F isoform X2                68.2    7e-11   
ref|XP_011478802.1|  PREDICTED: cathepsin F isoform X1                68.2    7e-11   
ref|XP_006171430.1|  PREDICTED: cathepsin F                           67.4    1e-10   
ref|XP_006782128.1|  PREDICTED: cathepsin F-like                      67.4    2e-10   
ref|XP_008577225.1|  PREDICTED: cathepsin F                           67.4    2e-10   
emb|CCD11596.1|  unnamed protein product                              67.0    2e-10   
emb|CCD16236.1|  unnamed protein product                              67.0    2e-10   
emb|CCD16903.1|  unnamed protein product                              67.0    2e-10   
gb|ELV09527.1|  Cathepsin F                                           67.0    2e-10   
emb|CCD14094.1|  unnamed protein product                              65.5    2e-10   
emb|CCD13687.1|  unnamed protein product                              67.0    2e-10   
ref|XP_004959670.1|  PREDICTED: cysteine proteinase 1-like            65.9    3e-10   
gb|EEC70287.1|  hypothetical protein OsI_01111                        63.2    3e-10   
ref|XP_006937669.1|  PREDICTED: cathepsin F                           66.2    4e-10   
ref|XP_007092117.1|  PREDICTED: cathepsin F                           65.5    5e-10   
gb|ELK24293.1|  Cathepsin F                                           65.5    6e-10   
ref|XP_006771750.1|  PREDICTED: cathepsin F                           65.5    6e-10   
gb|AAB41118.1|  cruzipain                                             65.1    7e-10   
emb|CDQ83896.1|  unnamed protein product                              65.1    7e-10   
ref|XP_004596891.1|  PREDICTED: cathepsin F                           65.5    7e-10   
gb|ACN10907.1|  Cathepsin F precursor                                 65.1    9e-10   
ref|XP_006179549.1|  PREDICTED: cathepsin F                           64.3    9e-10   
gb|AAC37213.1|  cysteine proteinase                                   65.1    1e-09   
ref|XP_803044.1|  cysteine peptidase                                  65.1    1e-09   
gb|AAR92156.1|  putative cysteine protease 3                          63.5    1e-09   
ref|XP_006210811.1|  PREDICTED: cathepsin F                           64.3    1e-09   
emb|CCD16264.1|  unnamed protein product                              64.3    1e-09   
ref|XP_004393930.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      64.7    1e-09   
ref|XP_005598385.1|  PREDICTED: cathepsin F                           64.3    1e-09   
ref|XP_003560213.1|  PREDICTED: cysteine proteinase 1                 63.9    1e-09   
gb|AFA34858.1|  cathepsin L-like protein                              64.3    2e-09   
ref|XP_005864349.1|  PREDICTED: cathepsin F                           63.9    2e-09   
ref|XP_008531628.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      64.3    2e-09   
ref|XP_008048262.1|  PREDICTED: cathepsin F                           63.9    2e-09   
ref|XP_005631485.1|  PREDICTED: cathepsin F isoform X1                64.3    2e-09   
ref|XP_533219.4|  PREDICTED: cathepsin F isoform X2                   64.3    2e-09   
ref|XP_010954979.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      64.3    2e-09   
ref|XP_006860939.1|  PREDICTED: cathepsin F                           63.9    2e-09   
gb|KJB60399.1|  hypothetical protein B456_009G303700                  61.2    2e-09   
ref|XP_005699987.1|  PREDICTED: cathepsin F isoform X2                63.5    2e-09   
ref|XP_005699986.1|  PREDICTED: cathepsin F isoform X1                63.5    2e-09   
ref|XP_004713618.1|  PREDICTED: cathepsin F                           62.8    2e-09   
ref|XP_004463677.1|  PREDICTED: cathepsin F                           62.8    2e-09   
ref|XP_007171073.1|  PREDICTED: cathepsin F isoform X1                63.2    2e-09   
gb|AAB01769.1|  cysteine proteinase homolog                           63.2    3e-09   
ref|XP_005968922.1|  PREDICTED: cathepsin F                           63.5    3e-09   
ref|XP_008707386.1|  PREDICTED: cathepsin F                           63.2    3e-09   
ref|XP_007518834.1|  PREDICTED: cathepsin F                           63.5    3e-09   
gb|AIC36736.1|  cathepsin F                                           63.5    3e-09   
ref|XP_004019753.1|  PREDICTED: cathepsin F isoform 1                 63.5    3e-09   
ref|XP_004437729.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      63.5    3e-09   
ref|XP_004019754.1|  PREDICTED: cathepsin F isoform 2                 63.5    3e-09   
ref|NP_001068884.1|  cathepsin F precursor                            63.2    4e-09   
ref|XP_006044418.1|  PREDICTED: cathepsin F isoform X1                63.2    4e-09   
ref|XP_007461994.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      63.2    4e-09   
ref|XP_005903598.1|  PREDICTED: cathepsin F isoform X1                63.2    4e-09   
emb|CDY13816.1|  BnaA09g43180D                                        62.0    4e-09   
ref|XP_010597319.1|  PREDICTED: cathepsin F                           63.2    4e-09   
ref|XP_006044419.1|  PREDICTED: cathepsin F isoform X2                63.2    4e-09   
ref|XP_005654721.1|  PREDICTED: cathepsin F-like isoform X2           63.2    4e-09   
gb|AAB41119.1|  cruzipain                                             63.2    4e-09   
ref|XP_003122543.2|  PREDICTED: cathepsin F isoform X1                63.2    4e-09   
ref|XP_002755611.1|  PREDICTED: cathepsin F                           63.2    5e-09   
ref|NP_001059639.1|  Os07g0480900                                     62.8    5e-09   
ref|XP_004759498.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      63.2    5e-09   
ref|XP_004656783.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      63.2    5e-09   
gb|AFA34855.1|  cathepsin L-like protein                              62.8    5e-09   
ref|XP_004368288.1|  cysteine proteinase precursor, putative          62.4    5e-09   
ref|XP_004383745.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      62.8    5e-09   
ref|XP_805951.1|  cysteine peptidase                                  62.4    6e-09   
ref|NP_001133678.1|  Cathepsin F precursor                            62.8    6e-09   
gb|AFA34857.1|  cathepsin L-like protein                              62.4    6e-09   
gb|AAG35357.1|AF314929_1  cruzipain                                   62.4    7e-09   
gb|AAF75546.1|  cruzipain                                             62.4    7e-09   
gb|AAG35358.1|AF314930_1  cruzipain                                   62.4    7e-09   
ref|XP_820174.1|  cysteine peptidase                                  62.4    7e-09   
ref|XP_818579.1|  cruzipain precursor                                 62.4    7e-09   
ref|XP_818578.1|  cysteine peptidase                                  62.4    7e-09   
sp|P25779.1|CYSP_TRYCR  RecName: Full=Cruzipain; AltName: Full=Cr...  62.4    7e-09   
gb|AFA34856.1|  cathepsin L-like protein                              62.4    7e-09   
ref|XP_008271777.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      62.4    7e-09   
gb|ELK13294.1|  Cathepsin F                                           62.4    7e-09   
gb|EKG00105.1|  cysteine peptidase, putative,cysteine peptidase, ...  61.6    7e-09   
gb|AAL96762.1|AC104496_8  Tcc1l8.8                                    62.4    7e-09   
tpg|DAA40800.1|  TPA: putative cysteine protease family protein       62.0    7e-09   
gb|EEE67161.1|  hypothetical protein OsJ_24244                        61.6    7e-09   
ref|XP_005699988.1|  PREDICTED: cathepsin F isoform X3                61.6    7e-09   
prf||2117247C  Cys protease:ISOTYPE=3                                 62.4    7e-09
ref|XP_011367226.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      62.4    7e-09   
ref|XP_006911111.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      62.4    7e-09   
ref|XP_007115106.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      62.4    8e-09   
gb|ABQ23965.1|  cathepsin F                                           60.5    8e-09   
gb|EEC82027.1|  hypothetical protein OsI_25996                        62.8    9e-09   
gb|ESL05803.1|  cysteine peptidase B                                  62.0    9e-09   
gb|ESL05789.1|  cysteine peptidase B                                  62.0    9e-09   
gb|AGN32942.1|  cysteine peptidase                                    62.0    9e-09   
ref|XP_006101673.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      62.0    9e-09   
ref|XP_008145119.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      62.0    9e-09   
gb|ESL11420.1|  cysteine peptidase B                                  62.0    9e-09   
gb|ESL06275.1|  cysteine peptidase B                                  62.0    9e-09   
gb|AGN32955.1|  cysteine peptidase                                    62.0    9e-09   
prf||2117247B  Cys protease:ISOTYPE=2                                 62.0    9e-09
ref|XP_004618609.1|  PREDICTED: cathepsin F                           61.6    9e-09   
gb|EKF27064.1|  cysteine peptidase                                    60.1    1e-08   
ref|XP_004317592.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      61.6    1e-08   
ref|XP_010896687.1|  PREDICTED: cathepsin F                           61.6    1e-08   
emb|CAQ00102.1|  papain-like cysteine proteinase                      61.2    1e-08   
ref|XP_011233805.1|  PREDICTED: cathepsin F                           62.0    1e-08   
ref|XP_007942912.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      61.6    1e-08   
ref|XP_004278022.1|  PREDICTED: cathepsin F isoform 1                 61.6    1e-08   
ref|XP_010346669.1|  PREDICTED: cathepsin F isoform X2                61.2    1e-08   
ref|XP_004278023.1|  PREDICTED: cathepsin F isoform 2                 61.6    1e-08   
ref|XP_002674919.1|  predicted protein                                60.8    1e-08   
gb|EKG02025.1|  cysteine peptidase, putative,cysteine peptidase, ...  60.5    2e-08   
ref|XP_003937801.1|  PREDICTED: cathepsin F isoform X1                61.2    2e-08   
gb|AAA79289.1|  rangelipain                                           60.1    2e-08   
emb|CDW75439.1|  cathepsin l                                          60.8    2e-08   
ref|XP_820178.1|  cruzipain precursor                                 58.9    2e-08   
gb|AAA79287.1|  rangelipain                                           59.7    2e-08   
ref|XP_002460693.1|  hypothetical protein SORBIDRAFT_02g033270        60.8    2e-08   
ref|XP_003798388.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      61.2    2e-08   
dbj|BAK03623.1|  predicted protein                                    58.9    2e-08   
gb|AAC78838.1|  cathepsin F                                           60.5    2e-08   
emb|CAG46481.1|  CTSF                                                 60.5    2e-08   
gb|EAW74547.1|  cathepsin F, isoform CRA_a                            60.5    3e-08   
gb|AAA30270.1|  cysteine proteinase                                   58.5    3e-08   
ref|XP_008952375.1|  PREDICTED: cathepsin F                           60.1    3e-08   
gb|EHH56046.1|  Cathepsin F                                           60.1    3e-08   
gb|KFO28364.1|  Cathepsin F                                           60.1    3e-08   
ref|XP_010634471.1|  PREDICTED: cathepsin F                           60.1    3e-08   
ref|XP_007246457.1|  PREDICTED: cathepsin F-like                      60.5    3e-08   
ref|XP_004695908.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      60.5    4e-08   
gb|AAF13146.1|AF136279_1  cathepsin F precursor                       60.5    4e-08   
ref|NP_003784.2|  cathepsin F precursor                               60.5    4e-08   
gb|AAV38405.1|  cathepsin F                                           60.5    4e-08   
pir||T46294  hypothetical protein DKFZp434F0610.1 - human (fragment)  59.7    4e-08
gb|AAC78839.1|  cathepsin F                                           59.3    4e-08   
gb|AAY81946.1|  cysteine protease 8                                   59.3    4e-08   
ref|XP_002672864.1|  predicted protein                                59.7    4e-08   
gb|EHH22649.1|  Cathepsin F                                           60.1    4e-08   
ref|XP_009183845.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      60.1    5e-08   
ref|XP_010364711.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      60.1    5e-08   
ref|XP_009421804.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      60.1    5e-08   
ref|XP_007972284.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      60.1    5e-08   
ref|XP_005577203.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      60.1    5e-08   
ref|XP_004051670.1|  PREDICTED: cathepsin F                           60.1    5e-08   
ref|XP_003273955.2|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      60.1    5e-08   
gb|EJY84073.1|  Cathepsin L                                           59.3    5e-08   
gb|ELU07930.1|  hypothetical protein CAPTEDRAFT_222628                58.5    5e-08   
prf||2117247A  Cys protease:ISOTYPE=1                                 59.7    6e-08
ref|XP_005333611.1|  PREDICTED: cathepsin F                           59.7    6e-08   
ref|XP_003468143.2|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      59.7    6e-08   
gb|AAF75547.1|  cruzipain                                             59.7    6e-08   
ref|NP_001106423.1|  cathepsin F precursor                            59.7    6e-08   
gb|AAY81945.1|  cysteine protease 7                                   58.9    7e-08   
ref|XP_003777749.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      59.7    7e-08   
ref|XP_007518819.1|  PREDICTED: cathepsin W                           58.9    7e-08   
ref|XP_007658982.1|  PREDICTED: cathepsin F-like                      57.0    7e-08   
dbj|BAF81994.1|  cysteine proteinase                                  58.9    7e-08   
ref|XP_006129733.1|  PREDICTED: cathepsin F-like                      58.9    7e-08   
ref|XP_003774144.1|  PREDICTED: cathepsin F                           59.3    8e-08   



>dbj|BAF46302.1| cysteine proteinase precursor [Ipomoea nil]
Length=369

 Score =   200 bits (508),  Expect = 3e-60, Method: Composition-based stats.
 Identities = 108/108 (100%), Positives = 108/108 (100%), Gaps = 0/108 (0%)
 Frame = +1

Query  13   MDRFsllsllilaltaaCVVRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYAT  192
            MDRFSLLSLLILALTAACVVRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYAT
Sbjct  1    MDRFSLLSLLILALTAACVVRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYAT  60

Query  193  QEEHDYRLSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            QEEHDYRLSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFL
Sbjct  61   QEEHDYRLSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  108



>gb|AAQ81938.1| cysteine proteinase precursor [Ipomoea batatas]
Length=371

 Score =   199 bits (507),  Expect = 5e-60, Method: Composition-based stats.
 Identities = 104/108 (96%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  13   MDRFsllsllilaltaaCVVRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYAT  192
            MDRFSL SLLI ALTAACVVRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYAT
Sbjct  1    MDRFSLPSLLIHALTAACVVRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYAT  60

Query  193  QEEHDYRLSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            QEEHDYRLSVFKANLRRAKRHQ+LDPSAVHGVTKFSDLTPKEFRRT+L
Sbjct  61   QEEHDYRLSVFKANLRRAKRHQMLDPSAVHGVTKFSDLTPKEFRRTYL  108



>gb|KJB29613.1| hypothetical protein B456_005G110200 [Gossypium raimondii]
Length=207

 Score =   156 bits (394),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/94 (82%), Positives = 82/94 (87%), Gaps = 5/94 (5%)
 Frame = +1

Query  70   VRADEDPLIRQVVSDG-----EDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKAN  234
            V +D DPLIRQVVSDG      DD LLNA+HHFTLFKSKYGK+YA+QEEHDYRL VFKAN
Sbjct  23   VNSDGDPLIRQVVSDGGVEEDSDDHLLNAEHHFTLFKSKYGKTYASQEEHDYRLGVFKAN  82

Query  235  LRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            LRRAKRHQLLDPSAVHGVTKFSDLTP EFRR +L
Sbjct  83   LRRAKRHQLLDPSAVHGVTKFSDLTPSEFRRQYL  116



>ref|XP_007017672.1| Papain family cysteine protease [Theobroma cacao]
 gb|EOY14897.1| Papain family cysteine protease [Theobroma cacao]
Length=401

 Score =   160 bits (405),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 75/90 (83%), Positives = 81/90 (90%), Gaps = 4/90 (4%)
 Frame = +1

Query  79   DEDPLIRQVVSDG----EDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRA  246
            ++DPLIRQVVS+G     DD LLNA+HHFTLFKSKYGK+YATQEEHDYRL VFKANLRRA
Sbjct  58   EDDPLIRQVVSNGAGEDSDDHLLNAEHHFTLFKSKYGKTYATQEEHDYRLGVFKANLRRA  117

Query  247  KRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            KRHQLLDP+AVHGVTKFSDLTP EFRR FL
Sbjct  118  KRHQLLDPTAVHGVTKFSDLTPSEFRRQFL  147



>gb|KJB29612.1| hypothetical protein B456_005G110200 [Gossypium raimondii]
Length=301

 Score =   157 bits (396),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/94 (82%), Positives = 82/94 (87%), Gaps = 5/94 (5%)
 Frame = +1

Query  70   VRADEDPLIRQVVSDG-----EDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKAN  234
            V +D DPLIRQVVSDG      DD LLNA+HHFTLFKSKYGK+YA+QEEHDYRL VFKAN
Sbjct  23   VNSDGDPLIRQVVSDGGVEEDSDDHLLNAEHHFTLFKSKYGKTYASQEEHDYRLGVFKAN  82

Query  235  LRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            LRRAKRHQLLDPSAVHGVTKFSDLTP EFRR +L
Sbjct  83   LRRAKRHQLLDPSAVHGVTKFSDLTPSEFRRQYL  116



>gb|KJB29611.1| hypothetical protein B456_005G110200 [Gossypium raimondii]
Length=370

 Score =   158 bits (399),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 77/94 (82%), Positives = 82/94 (87%), Gaps = 5/94 (5%)
 Frame = +1

Query  70   VRADEDPLIRQVVSDG-----EDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKAN  234
            V +D DPLIRQVVSDG      DD LLNA+HHFTLFKSKYGK+YA+QEEHDYRL VFKAN
Sbjct  23   VNSDGDPLIRQVVSDGGVEEDSDDHLLNAEHHFTLFKSKYGKTYASQEEHDYRLGVFKAN  82

Query  235  LRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            LRRAKRHQLLDPSAVHGVTKFSDLTP EFRR +L
Sbjct  83   LRRAKRHQLLDPSAVHGVTKFSDLTPSEFRRQYL  116



>gb|EYU27644.1| hypothetical protein MIMGU_mgv1a008452mg [Erythranthe guttata]
Length=373

 Score =   157 bits (397),  Expect = 8e-44, Method: Composition-based stats.
 Identities = 71/87 (82%), Positives = 81/87 (93%), Gaps = 2/87 (2%)
 Frame = +1

Query  82   EDPLIRQVVSDGED--DALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRH  255
            +DPLIRQVVSDG D  D LL+ADHHF+LFK+KYGKSYATQEEHDYR SVFKANLRR+KRH
Sbjct  31   DDPLIRQVVSDGADAVDQLLHADHHFSLFKTKYGKSYATQEEHDYRFSVFKANLRRSKRH  90

Query  256  QLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            Q+LDPSAVHGVTKFSDLTP+EF +++L
Sbjct  91   QILDPSAVHGVTKFSDLTPEEFEKSYL  117



>gb|KHG15062.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=370

 Score =   157 bits (397),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 76/94 (81%), Positives = 83/94 (88%), Gaps = 5/94 (5%)
 Frame = +1

Query  70   VRADEDPLIRQVVSDG-----EDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKAN  234
            V +D+DPLIRQVVSDG      DD LLNA+HHFTLFKSKYGK+YA+QEEHDYRL VFKAN
Sbjct  23   VNSDDDPLIRQVVSDGGVEEDSDDHLLNAEHHFTLFKSKYGKTYASQEEHDYRLGVFKAN  82

Query  235  LRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            LRRAKRHQ+LDPSAVHGVTKFSDLTP EFRR +L
Sbjct  83   LRRAKRHQVLDPSAVHGVTKFSDLTPSEFRRQYL  116



>ref|XP_002302004.2| hypothetical protein POPTR_0002s03020g [Populus trichocarpa]
 gb|ABK94746.1| unknown [Populus trichocarpa]
 gb|EEE81277.2| hypothetical protein POPTR_0002s03020g [Populus trichocarpa]
Length=367

 Score =   156 bits (395),  Expect = 1e-43, Method: Composition-based stats.
 Identities = 70/85 (82%), Positives = 79/85 (93%), Gaps = 1/85 (1%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            +DPLIRQVVSDGEDD LLNA+HHFT FKSK+GK+YATQEEHDYR  VFKANLRRAK+HQ+
Sbjct  29   DDPLIRQVVSDGEDD-LLNAEHHFTSFKSKFGKTYATQEEHDYRFGVFKANLRRAKKHQM  87

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            +DP+A HG+TKFSDLTPKEFRR FL
Sbjct  88   IDPTAAHGITKFSDLTPKEFRRQFL  112



>ref|XP_011028940.1| PREDICTED: cysteine proteinase 15A-like [Populus euphratica]
Length=367

 Score =   156 bits (395),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 71/85 (84%), Positives = 79/85 (93%), Gaps = 1/85 (1%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            +DPLIRQVVSDGEDD LLNA+HHFT FKSK+GK+YATQEEHDYR  VFKANLRRAK+HQ+
Sbjct  29   DDPLIRQVVSDGEDD-LLNAEHHFTSFKSKFGKTYATQEEHDYRFGVFKANLRRAKKHQM  87

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            +DP+A HGVTKFSDLTPKEFRR FL
Sbjct  88   IDPTAAHGVTKFSDLTPKEFRRQFL  112



>gb|ABK96580.1| unknown [Populus trichocarpa x Populus deltoides]
Length=367

 Score =   153 bits (386),  Expect = 3e-42, Method: Composition-based stats.
 Identities = 70/85 (82%), Positives = 78/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            +DPLI QVVSDGEDD LLNA+HHFT FKSK+GK+YATQEEHDYR  VFKANLRRAK+HQ+
Sbjct  29   DDPLIIQVVSDGEDD-LLNAEHHFTSFKSKFGKTYATQEEHDYRFGVFKANLRRAKKHQM  87

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            +DP+A HGVTKFSDLTPKEFRR FL
Sbjct  88   IDPTAAHGVTKFSDLTPKEFRRQFL  112



>gb|ABK94801.1| unknown [Populus trichocarpa]
Length=367

 Score =   153 bits (386),  Expect = 4e-42, Method: Composition-based stats.
 Identities = 70/85 (82%), Positives = 78/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            +DPLI QVVSDGEDD LLNA+HHFT FKSK+GK+YATQEEHDYR  VFKANLRRAK+HQ+
Sbjct  29   DDPLIIQVVSDGEDD-LLNAEHHFTSFKSKFGKTYATQEEHDYRFGVFKANLRRAKKHQM  87

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            +DP+A HGVTKFSDLTPKEFRR FL
Sbjct  88   IDPTAAHGVTKFSDLTPKEFRRQFL  112



>gb|AAN57719.1| cysteine proteinase precursor [Solanum melongena]
Length=120

 Score =   145 bits (367),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +1

Query  13   MDRFsllsllilaltaaCVVRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYAT  192
            MDR  LLSLL  AL ++ +  +D+DPLIRQVVS+ +D+ +LNA+HHF+LFKSKYGK YA+
Sbjct  1    MDRLFLLSLLAFALFSSAIAFSDDDPLIRQVVSETDDNHMLNAEHHFSLFKSKYGKIYAS  60

Query  193  QEEHDYRLSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            QEEHD+RL VFKANLRRA+RHQLLDP+A HG+T+FSDLTP EFRRT+L
Sbjct  61   QEEHDHRLKVFKANLRRARRHQLLDPTAEHGITQFSDLTPSEFRRTYL  108



>gb|AAD29084.1|AF082181_1 cysteine proteinase precursor [Solanum melongena]
Length=363

 Score =   151 bits (382),  Expect = 1e-41, Method: Composition-based stats.
 Identities = 66/87 (76%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = +1

Query  76   ADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRH  255
            +D+DPLIRQVVS+ +D+ +LNA+HHF+LFKSKYGK YA+QEEHD+RL VFKANLRRA+RH
Sbjct  22   SDDDPLIRQVVSETDDNHMLNAEHHFSLFKSKYGKIYASQEEHDHRLKVFKANLRRARRH  81

Query  256  QLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            QLLDP+A HG+T+FSDLTP EFRRT+L
Sbjct  82   QLLDPTAEHGITQFSDLTPSEFRRTYL  108



>gb|KJB58164.1| hypothetical protein B456_009G197400 [Gossypium raimondii]
Length=375

 Score =   151 bits (381),  Expect = 2e-41, Method: Composition-based stats.
 Identities = 72/94 (77%), Positives = 81/94 (86%), Gaps = 5/94 (5%)
 Frame = +1

Query  70   VRADEDPLIRQVVSDG---ED--DALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKAN  234
            V +++ PLIRQV SDG   ED  D LLNA+HHFTLFKSK+GK+YAT+EEHDYRL VFKAN
Sbjct  23   VISNDGPLIRQVASDGVAEEDFVDQLLNAEHHFTLFKSKFGKTYATKEEHDYRLGVFKAN  82

Query  235  LRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            +RRAKRHQLLDP+A HGVTKFSDLTP EFRR FL
Sbjct  83   MRRAKRHQLLDPTAFHGVTKFSDLTPSEFRRQFL  116



>dbj|BAG16515.1| putative cysteine proteinase [Capsicum chinense]
Length=367

 Score =   149 bits (377),  Expect = 7e-41, Method: Composition-based stats.
 Identities = 68/89 (76%), Positives = 80/89 (90%), Gaps = 2/89 (2%)
 Frame = +1

Query  76   ADEDPLIRQVVSDGEDDA--LLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAK  249
            +DEDPLIRQV S+ +D+   LLNA+HHF+LFKSK+GK YATQEEHD+RL VFKANLRRA+
Sbjct  23   SDEDPLIRQVTSESDDNNNHLLNAEHHFSLFKSKFGKIYATQEEHDHRLKVFKANLRRAR  82

Query  250  RHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            RHQLLDP+A HG+TKFSDLTP EFRRT+L
Sbjct  83   RHQLLDPTAEHGITKFSDLTPSEFRRTYL  111



>emb|CDP07452.1| unnamed protein product [Coffea canephora]
Length=376

 Score =   148 bits (373),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/87 (84%), Positives = 80/87 (92%), Gaps = 2/87 (2%)
 Frame = +1

Query  82   EDPLIRQVV-SDGED-DALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRH  255
            +DPLIRQVV SDG+D D LLNADHHF+LFK+KYGK+Y+TQEEHD+R SVFKANLRRAKRH
Sbjct  35   DDPLIRQVVTSDGDDADPLLNADHHFSLFKTKYGKTYSTQEEHDHRFSVFKANLRRAKRH  94

Query  256  QLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            QLLDPSAVHGVTKFSDLTP EFRR  L
Sbjct  95   QLLDPSAVHGVTKFSDLTPSEFRRNHL  121



>ref|XP_009776238.1| PREDICTED: cysteine proteinase 15A-like [Nicotiana sylvestris]
Length=365

 Score =   148 bits (373),  Expect = 3e-40, Method: Composition-based stats.
 Identities = 68/89 (76%), Positives = 79/89 (89%), Gaps = 2/89 (2%)
 Frame = +1

Query  76   ADEDPLIRQVVSDGE--DDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAK  249
            +DEDPLIRQVVS+ E  D  LLNA+HHF+LFKSK+GK YA++EEHD+R  VFKANLRRA+
Sbjct  22   SDEDPLIRQVVSETETDDSHLLNAEHHFSLFKSKFGKIYASEEEHDHRFKVFKANLRRAR  81

Query  250  RHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            RHQLLDPSA HG+TKFSDLTP EFRRT+L
Sbjct  82   RHQLLDPSAEHGITKFSDLTPSEFRRTYL  110



>ref|XP_006341997.1| PREDICTED: cysteine proteinase 15A-like [Solanum tuberosum]
Length=376

 Score =   147 bits (370),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = +1

Query  10   PMDRFsllsllilaltaaCVVRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYA  189
            PMDR  LLSLL LAL ++ +  +D+DPLIRQVVS+ +D+ +LNA+HHF+LFK K+GK YA
Sbjct  13   PMDRLFLLSLLALALFSSAIAFSDDDPLIRQVVSENDDNHMLNAEHHFSLFKVKFGKIYA  72

Query  190  TQEEHDYRLSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            +QEEHD+RL VFKANLRRA+RHQLLDPSA HG+T+FSDLTP EFRRT+L
Sbjct  73   SQEEHDHRLKVFKANLRRARRHQLLDPSAEHGITQFSDLTPSEFRRTYL  121



>gb|KDO84720.1| hypothetical protein CISIN_1g017548mg [Citrus sinensis]
Length=369

 Score =   147 bits (370),  Expect = 9e-40, Method: Composition-based stats.
 Identities = 70/89 (79%), Positives = 78/89 (88%), Gaps = 3/89 (3%)
 Frame = +1

Query  79   DEDPLIRQVV-SDGE--DDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAK  249
            D+D +IRQVV SDGE  +D LLNA+HHF+LFKSK+ K+YATQEEHDYR  VFKANLRRAK
Sbjct  26   DDDAMIRQVVPSDGEQSEDHLLNAEHHFSLFKSKFSKTYATQEEHDYRFRVFKANLRRAK  85

Query  250  RHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            R QLLDP+AVHGVTKFSDLTP EFRR FL
Sbjct  86   RRQLLDPTAVHGVTKFSDLTPSEFRRQFL  114



>ref|XP_006473584.1| PREDICTED: cysteine proteinase 15A-like [Citrus sinensis]
Length=369

 Score =   146 bits (369),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 70/89 (79%), Positives = 78/89 (88%), Gaps = 3/89 (3%)
 Frame = +1

Query  79   DEDPLIRQVV-SDGE--DDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAK  249
            D+D +IRQVV SDGE  +D LLNA+HHF+LFKSK+ K+YATQEEHDYR  VFKANLRRAK
Sbjct  26   DDDAMIRQVVPSDGEQSEDHLLNAEHHFSLFKSKFSKTYATQEEHDYRFRVFKANLRRAK  85

Query  250  RHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            R QLLDP+AVHGVTKFSDLTP EFRR FL
Sbjct  86   RRQLLDPTAVHGVTKFSDLTPSEFRRQFL  114



>emb|CAA78361.1| tobacco pre-pro-cysteine proteinase [Nicotiana tabacum]
Length=363

 Score =   146 bits (368),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 65/87 (75%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +1

Query  76   ADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRH  255
            +DEDPLIRQVVS+ +D  LLNA+HHF+LFKSK+GK YA++EEHD+R  VFKANLRRA+ +
Sbjct  22   SDEDPLIRQVVSETDDSHLLNAEHHFSLFKSKFGKIYASEEEHDHRFKVFKANLRRARLN  81

Query  256  QLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            QLLDPSA HG+TKFSDLTP EFRRT+L
Sbjct  82   QLLDPSAEHGITKFSDLTPSEFRRTYL  108



>ref|XP_009611293.1| PREDICTED: cysteine proteinase 15A-like [Nicotiana tomentosiformis]
 emb|CAB44983.1| putative preprocysteine proteinase [Nicotiana tabacum]
Length=363

 Score =   145 bits (367),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 80/90 (89%), Gaps = 0/90 (0%)
 Frame = +1

Query  67   VVRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRA  246
            +  +DEDPLIRQVVS+ +D  LLNA+HHF+LFKSK+GK YA++EEHD+R  VFKANLRRA
Sbjct  19   IAFSDEDPLIRQVVSETDDSHLLNAEHHFSLFKSKFGKIYASEEEHDHRFKVFKANLRRA  78

Query  247  KRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            +RHQLLDPSA HG+TKFSDLTP EFRRT+L
Sbjct  79   RRHQLLDPSAEHGITKFSDLTPSEFRRTYL  108



>ref|XP_010271520.1| PREDICTED: cysteine proteinase RD19a-like [Nelumbo nucifera]
Length=370

 Score =   145 bits (366),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 68/85 (80%), Positives = 75/85 (88%), Gaps = 1/85 (1%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            EDPLIRQVVSD +DD LLNA+HHF  FK K+GKSYAT EEH YRL VFKANLRRA+RHQ 
Sbjct  33   EDPLIRQVVSD-DDDLLLNAEHHFNNFKRKFGKSYATPEEHAYRLGVFKANLRRARRHQK  91

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            LDPSAVHGVT+FSDLTP EFRR++L
Sbjct  92   LDPSAVHGVTQFSDLTPAEFRRSYL  116



>ref|XP_009146338.1| PREDICTED: cysteine proteinase 15A-like [Brassica rapa]
 emb|CDY32227.1| BnaA01g17570D [Brassica napus]
Length=368

 Score =   145 bits (365),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 64/85 (75%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            ++P+IRQVV +  D+ LLNA+HHF+LFKSKY K+YATQ EHD+R  VFKANLRRA+RHQL
Sbjct  28   DNPIIRQVVPEENDEQLLNAEHHFSLFKSKYQKTYATQAEHDHRFRVFKANLRRARRHQL  87

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            LDPSAVHGVT+FSDLTPKEFRR +L
Sbjct  88   LDPSAVHGVTQFSDLTPKEFRRKYL  112



>ref|XP_002510469.1| cysteine protease, putative [Ricinus communis]
 gb|EEF52656.1| cysteine protease, putative [Ricinus communis]
Length=366

 Score =   145 bits (365),  Expect = 4e-39, Method: Composition-based stats.
 Identities = 66/85 (78%), Positives = 76/85 (89%), Gaps = 1/85 (1%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            +DPLIRQVV D ED  LL+A HHFT FK+K+GK+YATQEEHDYR  VFKANLRRA++HQL
Sbjct  29   DDPLIRQVVPDVED-YLLSAQHHFTAFKAKFGKNYATQEEHDYRFKVFKANLRRAQKHQL  87

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            +DPSAVHGVTKFSDLTP+EFRR +L
Sbjct  88   MDPSAVHGVTKFSDLTPREFRRQYL  112



>gb|EPS65881.1| cysteine proteinase, partial [Genlisea aurea]
Length=335

 Score =   144 bits (362),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 76/85 (89%), Gaps = 1/85 (1%)
 Frame = +1

Query  85   DPLIRQVVSDGED-DALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            DPLIRQVV   E+ D LLNADHHF+LFKSKYGKSYATQEEHD R SVFKANLRRAK+ QL
Sbjct  1    DPLIRQVVDGVEEIDLLLNADHHFSLFKSKYGKSYATQEEHDRRFSVFKANLRRAKKRQL  60

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            LDPSAVHG+TKFSDLTP EF++TFL
Sbjct  61   LDPSAVHGITKFSDLTPAEFKKTFL  85



>ref|XP_004238314.1| PREDICTED: cysteine proteinase 15A [Solanum lycopersicum]
Length=363

 Score =   144 bits (363),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 91/108 (84%), Gaps = 0/108 (0%)
 Frame = +1

Query  13   MDRFsllsllilaltaaCVVRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYAT  192
            MDR  LLS L  AL ++ +  +D+DPLIRQVVS  +D+ +LNA+HHF+LFK+K+GK YA+
Sbjct  1    MDRLFLLSFLAFALFSSAIAFSDDDPLIRQVVSGNDDNHMLNAEHHFSLFKAKFGKIYAS  60

Query  193  QEEHDYRLSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            QEEHD+RL VFKANL RAKRHQLLDPSA HG+T+FSDLTP EFRRT+L
Sbjct  61   QEEHDHRLKVFKANLHRAKRHQLLDPSAEHGITQFSDLTPSEFRRTYL  108



>ref|XP_006435090.1| hypothetical protein CICLE_v10001559mg [Citrus clementina]
 gb|ESR48330.1| hypothetical protein CICLE_v10001559mg [Citrus clementina]
Length=369

 Score =   144 bits (363),  Expect = 8e-39, Method: Composition-based stats.
 Identities = 69/88 (78%), Positives = 77/88 (88%), Gaps = 3/88 (3%)
 Frame = +1

Query  82   EDPLIRQVV-SDGE--DDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKR  252
            +D +IRQVV SDGE  +D LLNA+HHF+LFKSK+ K+YATQEEHDYR  VFKANLRRAKR
Sbjct  27   DDAMIRQVVPSDGEQSEDHLLNAEHHFSLFKSKFSKTYATQEEHDYRFRVFKANLRRAKR  86

Query  253  HQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
             QLLDP+AVHGVTKFSDLTP EFRR FL
Sbjct  87   RQLLDPTAVHGVTKFSDLTPSEFRRQFL  114



>gb|AIB06025.1| CP3 [Hevea brasiliensis]
Length=366

 Score =   144 bits (363),  Expect = 8e-39, Method: Composition-based stats.
 Identities = 65/85 (76%), Positives = 76/85 (89%), Gaps = 1/85 (1%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            EDPLIRQVV +  D  LLNA+HHFT FKSK+GK+YATQEEHD+R  VFKANLRRA++HQ+
Sbjct  29   EDPLIRQVVPEAVDH-LLNAEHHFTTFKSKFGKNYATQEEHDHRFKVFKANLRRARKHQM  87

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            +DPSAVHGVTKFSDLTP+EFRR +L
Sbjct  88   MDPSAVHGVTKFSDLTPREFRRQYL  112



>emb|CAA78403.1| pre-pro-cysteine proteinase [Solanum lycopersicum]
Length=361

 Score =   144 bits (362),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 80/90 (89%), Gaps = 0/90 (0%)
 Frame = +1

Query  67   VVRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRA  246
            +  +D+DPLIRQVVS  +D+ +LNA+HHF+LFK+K+GK YA+QEEHD+RL VFKANL RA
Sbjct  17   IAFSDDDPLIRQVVSGNDDNHMLNAEHHFSLFKAKFGKIYASQEEHDHRLKVFKANLHRA  76

Query  247  KRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            KRHQLLDPSA HG+T+FSDLTP EFRRT+L
Sbjct  77   KRHQLLDPSAEHGITQFSDLTPSEFRRTYL  106



>ref|XP_011083631.1| PREDICTED: cysteine proteinase 15A-like [Sesamum indicum]
Length=371

 Score =   144 bits (362),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 65/92 (71%), Positives = 80/92 (87%), Gaps = 2/92 (2%)
 Frame = +1

Query  67   VVRADEDPLIRQVVSDGED--DALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLR  240
            + +  +DPLIRQVVSD  +  D LL+A+HHF+LFK+KYGK+Y TQEEHDYR SVFK+NLR
Sbjct  25   IEQVSDDPLIRQVVSDSVEAVDQLLHAEHHFSLFKAKYGKTYDTQEEHDYRFSVFKSNLR  84

Query  241  RAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            RAKR+QLLDPSAVHGVT+FSDLTP EF +++L
Sbjct  85   RAKRNQLLDPSAVHGVTRFSDLTPDEFEKSYL  116



>dbj|BAJ53178.1| JHL18I08.12 [Jatropha curcas]
 gb|KDP38578.1| hypothetical protein JCGZ_04503 [Jatropha curcas]
Length=368

 Score =   143 bits (361),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            +DPLIRQVV DG+ D LLNA+HHFT FK+K+GK+YATQEEHDYR  +FKANLRRA++HQ+
Sbjct  29   DDPLIRQVVPDGDQDHLLNAEHHFTTFKAKFGKTYATQEEHDYRFKLFKANLRRARKHQM  88

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            +DP+AVHGVT FSDLTP+EFRR +L
Sbjct  89   MDPTAVHGVTMFSDLTPREFRRQYL  113



>ref|XP_002306900.1| hypothetical protein POPTR_0005s25540g [Populus trichocarpa]
 gb|ABK92924.1| unknown [Populus trichocarpa]
 gb|EEE93896.1| hypothetical protein POPTR_0005s25540g [Populus trichocarpa]
Length=367

 Score =   143 bits (361),  Expect = 2e-38, Method: Composition-based stats.
 Identities = 65/80 (81%), Positives = 74/80 (93%), Gaps = 1/80 (1%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            +DPLIRQVVS+GED  LLNA+HHFT FKSK+GK+YATQEEHDYR SVFKANL RAK+HQ+
Sbjct  29   DDPLIRQVVSEGEDH-LLNAEHHFTTFKSKFGKNYATQEEHDYRFSVFKANLLRAKKHQI  87

Query  262  LDPSAVHGVTKFSDLTPKEF  321
            +DP+A HGVTKFSDLTPKEF
Sbjct  88   MDPTAAHGVTKFSDLTPKEF  107



>gb|AAZ32411.1| cysteine proteinase glycinain type [Nicotiana benthamiana]
Length=355

 Score =   142 bits (359),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 80/92 (87%), Gaps = 2/92 (2%)
 Frame = +1

Query  67   VVRADEDPLIRQVVSDGE--DDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLR  240
            V  +DEDPLIRQVVS+ E  D  LLNA+HHF+LFKSK+GK YA++EEHD+R  VFKANLR
Sbjct  19   VAFSDEDPLIRQVVSETETDDSHLLNAEHHFSLFKSKFGKIYASEEEHDHRFKVFKANLR  78

Query  241  RAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            RA+RHQLLDPSA HG+TKFSDLTP EFRRT+L
Sbjct  79   RARRHQLLDPSAEHGITKFSDLTPSEFRRTYL  110



>gb|AAK07731.1| CPR2-like cysteine proteinase [Nicotiana tabacum]
Length=363

 Score =   143 bits (360),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 79/90 (88%), Gaps = 0/90 (0%)
 Frame = +1

Query  67   VVRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRA  246
            +  +DEDPLIRQVVS+ +D  LLNA+HHF+LFKSK+GK YA++EEHD+R  VFKAN RRA
Sbjct  19   IAFSDEDPLIRQVVSETDDSHLLNAEHHFSLFKSKFGKIYASEEEHDHRFKVFKANRRRA  78

Query  247  KRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            +RHQLLDPSA HG+TKFSDLTP EFRRT+L
Sbjct  79   RRHQLLDPSAEHGITKFSDLTPSEFRRTYL  108



>gb|AAF40416.1|AF216785_1 papain-like cysteine proteinase isoform III [Ipomoea batatas]
 gb|AAF61442.1|AF138266_1 papain-like cysteine proteinase isoform III [Ipomoea batatas]
Length=366

 Score =   142 bits (359),  Expect = 3e-38, Method: Composition-based stats.
 Identities = 65/85 (76%), Positives = 75/85 (88%), Gaps = 1/85 (1%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            +D LIRQVV DG+ D LLNADHHF +FK ++GK+YA+ EEHDYRLSVFKAN+RRAKRHQ 
Sbjct  27   DDILIRQVVGDGDGD-LLNADHHFAVFKRRFGKAYASDEEHDYRLSVFKANMRRAKRHQQ  85

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            LDP+AVHGVT+FSDLTP EFRR FL
Sbjct  86   LDPAAVHGVTQFSDLTPTEFRRKFL  110



>ref|XP_009786000.1| PREDICTED: cysteine proteinase RD19a-like [Nicotiana sylvestris]
Length=370

 Score =   142 bits (359),  Expect = 3e-38, Method: Composition-based stats.
 Identities = 66/86 (77%), Positives = 74/86 (86%), Gaps = 1/86 (1%)
 Frame = +1

Query  79   DEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  258
            D+D LIRQVV D +DD LLNADHHFT+FK ++GK+YA+ EEH YR SVFKANLRRA RHQ
Sbjct  32   DDDILIRQVVGD-DDDHLLNADHHFTIFKRRFGKTYASDEEHHYRFSVFKANLRRAMRHQ  90

Query  259  LLDPSAVHGVTKFSDLTPKEFRRTFL  336
             LDPSAVHGVT+FSDLTP EFRR FL
Sbjct  91   KLDPSAVHGVTQFSDLTPAEFRRNFL  116



>ref|XP_008387995.1| PREDICTED: cysteine proteinase 15A [Malus domestica]
Length=365

 Score =   142 bits (358),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +1

Query  70   VRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAK  249
            V  D DPLI+QVVS+ +DD LL+A+ HF+ FK+ +GK+YATQEEHDYR  VFKANLRRAK
Sbjct  23   VPNDVDPLIQQVVSESDDDQLLHAERHFSSFKATFGKTYATQEEHDYRFGVFKANLRRAK  82

Query  250  RHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            RHQ LDP+AVHGVTKFSDLTPKEFRR FL
Sbjct  83   RHQALDPTAVHGVTKFSDLTPKEFRRNFL  111



>ref|XP_010449835.1| PREDICTED: cysteine proteinase 15A-like [Camelina sativa]
Length=365

 Score =   141 bits (356),  Expect = 7e-38, Method: Composition-based stats.
 Identities = 67/84 (80%), Positives = 76/84 (90%), Gaps = 1/84 (1%)
 Frame = +1

Query  85   DPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLL  264
            D  IRQVV + E+D LLNA+HHF+LFKSKY K+YATQEEHD+RL VFKANLRRA+R+QLL
Sbjct  26   DNPIRQVVPE-ENDELLNAEHHFSLFKSKYQKTYATQEEHDHRLRVFKANLRRARRNQLL  84

Query  265  DPSAVHGVTKFSDLTPKEFRRTFL  336
            DPSAVHGVT+FSDLTPKEFRR FL
Sbjct  85   DPSAVHGVTQFSDLTPKEFRRQFL  108



>ref|XP_002870174.1| hypothetical protein ARALYDRAFT_915142 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46433.1| hypothetical protein ARALYDRAFT_915142 [Arabidopsis lyrata subsp. 
lyrata]
Length=373

 Score =   141 bits (356),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 64/81 (79%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +1

Query  94   IRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLLDPS  273
            IRQVV +  D+ LLNA+HHF+LFKSKY K+YATQEEHD+R  VFKANLRRA+R+QLLDPS
Sbjct  36   IRQVVPEENDEHLLNAEHHFSLFKSKYEKTYATQEEHDHRFRVFKANLRRARRNQLLDPS  95

Query  274  AVHGVTKFSDLTPKEFRRTFL  336
            AVHGVT+FSDLTPKEFRR FL
Sbjct  96   AVHGVTQFSDLTPKEFRRKFL  116



>ref|XP_010268619.1| PREDICTED: cysteine proteinase RD19a-like [Nelumbo nucifera]
Length=369

 Score =   141 bits (355),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 66/85 (78%), Positives = 76/85 (89%), Gaps = 1/85 (1%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            ED LIRQVV+  +DD L+NA+HHFT FKSK+GKSYAT+EEH YRL VFKANLRRA+RHQ 
Sbjct  32   EDLLIRQVVAH-DDDLLMNAEHHFTNFKSKFGKSYATREEHAYRLGVFKANLRRARRHQK  90

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            LDPSAVHG+T+FSDLTP EFRRT+L
Sbjct  91   LDPSAVHGITQFSDLTPAEFRRTYL  115



>ref|XP_004291404.1| PREDICTED: cysteine proteinase 15A-like [Fragaria vesca subsp. 
vesca]
Length=365

 Score =   140 bits (354),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 66/85 (78%), Positives = 73/85 (86%), Gaps = 1/85 (1%)
 Frame = +1

Query  85   DPLIRQVV-SDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            DPLIRQVV    EDD LL+A+ HF+ FK+ +GKSYA+QEEHDYR  VFKANLRRAKRHQ 
Sbjct  27   DPLIRQVVPGAAEDDELLHAERHFSNFKATFGKSYASQEEHDYRFGVFKANLRRAKRHQG  86

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            LDP+AVHGVTKFSDLTPKEFRR FL
Sbjct  87   LDPTAVHGVTKFSDLTPKEFRRNFL  111



>gb|KDO84721.1| hypothetical protein CISIN_1g017548mg [Citrus sinensis]
Length=300

 Score =   139 bits (350),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 78/89 (88%), Gaps = 3/89 (3%)
 Frame = +1

Query  79   DEDPLIRQVV-SDGE--DDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAK  249
            D+D +IRQVV SDGE  +D LLNA+HHF+LFKSK+ K+YATQEEHDYR  VFKANLRRAK
Sbjct  26   DDDAMIRQVVPSDGEQSEDHLLNAEHHFSLFKSKFSKTYATQEEHDYRFRVFKANLRRAK  85

Query  250  RHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            R QLLDP+AVHGVTKFSDLTP EFRR FL
Sbjct  86   RRQLLDPTAVHGVTKFSDLTPSEFRRQFL  114



>ref|XP_009335626.1| PREDICTED: cysteine proteinase 15A [Pyrus x bretschneideri]
Length=366

 Score =   140 bits (353),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +1

Query  70   VRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAK  249
            V  D DPLI+QVVS+ +DD LL+A+ HF+ FK+ +GK+YATQEE+DYR  VFKANLRRAK
Sbjct  24   VPIDVDPLIQQVVSESDDDQLLHAERHFSSFKATFGKAYATQEEYDYRFGVFKANLRRAK  83

Query  250  RHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            RHQ LDP+AVHGVTKFSDLTPKEFRR FL
Sbjct  84   RHQALDPTAVHGVTKFSDLTPKEFRRNFL  112



>ref|XP_010434865.1| PREDICTED: cysteine proteinase 15A-like [Camelina sativa]
Length=365

 Score =   140 bits (353),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 66/84 (79%), Positives = 76/84 (90%), Gaps = 1/84 (1%)
 Frame = +1

Query  85   DPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLL  264
            D  IRQVV + E+D LLNA+HHF+LFKSKY K+YATQ+EHD+RL VFKANLRRA+R+QLL
Sbjct  26   DNPIRQVVPE-ENDELLNAEHHFSLFKSKYQKTYATQQEHDHRLRVFKANLRRARRNQLL  84

Query  265  DPSAVHGVTKFSDLTPKEFRRTFL  336
            DPSAVHGVT+FSDLTPKEFRR FL
Sbjct  85   DPSAVHGVTQFSDLTPKEFRRQFL  108



>gb|AAF61440.1|AF138264_1 papain-like cysteine proteinase isoform I [Ipomoea batatas]
Length=368

 Score =   140 bits (352),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 76/85 (89%), Gaps = 1/85 (1%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            +D LIRQVV DG+ D LLNADHHFT+FK ++GK+YA+ EEHDYRLSVFKAN+RRAKRHQ 
Sbjct  29   DDVLIRQVVGDGDGD-LLNADHHFTVFKRRFGKAYASDEEHDYRLSVFKANMRRAKRHQE  87

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            LDP+AVHGVT+FSDLTP EFRR FL
Sbjct  88   LDPAAVHGVTQFSDLTPTEFRRKFL  112



>gb|AAF40414.1|AF216783_1 papain-like cysteine proteinase isoform I [Ipomoea batatas]
Length=368

 Score =   140 bits (352),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 76/85 (89%), Gaps = 1/85 (1%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            +D LIRQVV DG+ D LLNADHHFT+FK ++GK+YA+ EEHDYRLSVFKAN+RRAKRHQ 
Sbjct  29   DDILIRQVVGDGDGD-LLNADHHFTVFKRRFGKAYASDEEHDYRLSVFKANMRRAKRHQE  87

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            LDP+AVHGVT+FSDLTP EFRR FL
Sbjct  88   LDPAAVHGVTQFSDLTPTEFRRKFL  112



>ref|NP_567489.1| papain family cysteine protease [Arabidopsis thaliana]
 emb|CAB10398.1| cysteine proteinase like protein [Arabidopsis thaliana]
 emb|CAB78661.1| cysteine proteinase like protein [Arabidopsis thaliana]
 gb|AAK62611.1| AT4g16190/dl4135w [Arabidopsis thaliana]
 gb|AAM91059.1| AT4g16190/dl4135w [Arabidopsis thaliana]
 gb|AAM96982.1| cysteine proteinase [Arabidopsis thaliana]
 gb|AAN31875.1| putative cysteine proteinase [Arabidopsis thaliana]
 dbj|BAE98514.1| cysteine proteinase like protein [Arabidopsis thaliana]
 gb|AEE83713.1| papain family cysteine protease [Arabidopsis thaliana]
Length=373

 Score =   140 bits (352),  Expect = 3e-37, Method: Composition-based stats.
 Identities = 64/81 (79%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +1

Query  94   IRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLLDPS  273
            IRQVV +  D+ LLNA+HHFTLFKSKY K+YATQ EHD+R  VFKANLRRA+R+QLLDPS
Sbjct  36   IRQVVPEENDEQLLNAEHHFTLFKSKYEKTYATQVEHDHRFRVFKANLRRARRNQLLDPS  95

Query  274  AVHGVTKFSDLTPKEFRRTFL  336
            AVHGVT+FSDLTPKEFRR FL
Sbjct  96   AVHGVTQFSDLTPKEFRRKFL  116



>emb|CDY34441.1| BnaC01g21920D [Brassica napus]
Length=368

 Score =   139 bits (351),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            ++P+IRQVV +  D+ LLNA+HHF+LFKSKY K+YATQ EHD+R  VFKANLRRA+RHQL
Sbjct  28   DNPIIRQVVPEENDEQLLNAEHHFSLFKSKYDKTYATQAEHDHRFRVFKANLRRARRHQL  87

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            LDPSAVHGVT+FSDLTPKEFRR +L
Sbjct  88   LDPSAVHGVTQFSDLTPKEFRRKYL  112



>emb|CDP20652.1| unnamed protein product [Coffea canephora]
Length=372

 Score =   139 bits (350),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 78/89 (88%), Gaps = 2/89 (2%)
 Frame = +1

Query  70   VRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAK  249
            V ++++PLIRQVV  G++D LL ADHHF+LFK K+GKSYA++EEHDYR +VFKAN+RRA 
Sbjct  32   VVSNDNPLIRQVV--GDNDHLLTADHHFSLFKKKFGKSYASKEEHDYRFAVFKANMRRAL  89

Query  250  RHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            RHQ LDPSAVHGVTKFSDLTP EFRR FL
Sbjct  90   RHQKLDPSAVHGVTKFSDLTPAEFRRNFL  118



>ref|XP_010530325.1| PREDICTED: cysteine proteinase RD19a [Tarenaya hassleriana]
Length=370

 Score =   138 bits (347),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 66/89 (74%), Positives = 75/89 (84%), Gaps = 3/89 (3%)
 Frame = +1

Query  70   VRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAK  249
            + A  D  IRQVV +   D LL+A+HHF+LFKSKY KSYATQEEHDYR  +FKANLRR++
Sbjct  30   IDAGFDNPIRQVVPE---DHLLHAEHHFSLFKSKYSKSYATQEEHDYRFRIFKANLRRSR  86

Query  250  RHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            RHQ+LDPSAVHGVTKFSDLTPKEFRR FL
Sbjct  87   RHQVLDPSAVHGVTKFSDLTPKEFRRQFL  115



>gb|KDP41743.1| hypothetical protein JCGZ_26761 [Jatropha curcas]
Length=370

 Score =   138 bits (347),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 62/86 (72%), Positives = 74/86 (86%), Gaps = 1/86 (1%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDA-LLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  258
            EDPLIRQVV DG  +A +L+A+HHF+LFK K+GKSYA+QEEH+YR  VF+ANLRRA RHQ
Sbjct  31   EDPLIRQVVDDGRGEAHVLSAEHHFSLFKKKFGKSYASQEEHNYRFKVFQANLRRAARHQ  90

Query  259  LLDPSAVHGVTKFSDLTPKEFRRTFL  336
             LDPSA HGVT+FSDLTP EF++ FL
Sbjct  91   KLDPSASHGVTQFSDLTPAEFKKQFL  116



>ref|XP_009602233.1| PREDICTED: cysteine proteinase RD19a-like [Nicotiana tomentosiformis]
Length=369

 Score =   137 bits (346),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 63/87 (72%), Positives = 73/87 (84%), Gaps = 1/87 (1%)
 Frame = +1

Query  76   ADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRH  255
             D+  LIRQV+ + +DD LLN DHHFT+FK ++GK+YA+ EEH YRLSVFKANLRRA RH
Sbjct  30   GDDGILIRQVIGN-DDDHLLNVDHHFTIFKKRFGKTYASDEEHHYRLSVFKANLRRAMRH  88

Query  256  QLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            Q LDPSAVHGVT+FSDLTP EFRR FL
Sbjct  89   QKLDPSAVHGVTQFSDLTPAEFRRKFL  115



>ref|XP_004150061.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 ref|XP_004166953.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 gb|KGN61836.1| Cysteine protease [Cucumis sativus]
Length=377

 Score =   137 bits (346),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 63/94 (67%), Positives = 75/94 (80%), Gaps = 7/94 (7%)
 Frame = +1

Query  76   ADEDPLIRQVVSDGE-------DDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKAN  234
            +D D +IRQVV DG        DD LL ADHHF++FK K+GKSYA++EEHD+R  VFKAN
Sbjct  28   SDGDFIIRQVVDDGGVNEGSNGDDLLLGADHHFSVFKQKFGKSYASKEEHDHRFRVFKAN  87

Query  235  LRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            L+RA+RHQ LDPSA HGVT+FSDLTP EFRR+FL
Sbjct  88   LKRAQRHQALDPSATHGVTQFSDLTPSEFRRSFL  121



>ref|NP_001241450.1| uncharacterized protein LOC100778716 precursor [Glycine max]
 gb|ACU20049.1| unknown [Glycine max]
Length=366

 Score =   137 bits (346),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 62/86 (72%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +1

Query  79   DEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  258
            ++D LIRQVV D ED  LLNA+HHF+ FK+K+GK+YATQEEHD+R  +FK NL RAK HQ
Sbjct  27   EDDLLIRQVVPDAEDHHLLNAEHHFSAFKTKFGKTYATQEEHDHRFRIFKNNLLRAKSHQ  86

Query  259  LLDPSAVHGVTKFSDLTPKEFRRTFL  336
             LDPSAVHGVT+FSDLTP EFRR FL
Sbjct  87   KLDPSAVHGVTRFSDLTPAEFRRQFL  112



>ref|XP_011092831.1| PREDICTED: cysteine proteinase RD19a-like [Sesamum indicum]
Length=378

 Score =   137 bits (346),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 79/95 (83%), Gaps = 6/95 (6%)
 Frame = +1

Query  70   VRADEDPLIRQVVSDGE------DDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKA  231
            V  ++D LIRQVV  G+      +++L+NADHHFT+FK K+GK YATQEEHDYR SVFKA
Sbjct  30   VAGNDDLLIRQVVDHGDGGGAVDENSLVNADHHFTIFKRKFGKVYATQEEHDYRFSVFKA  89

Query  232  NLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            NLRRA+RHQ LDP+AVHGVT+FSDLTP+EFRR FL
Sbjct  90   NLRRARRHQKLDPAAVHGVTQFSDLTPREFRRQFL  124



>ref|XP_010061009.1| PREDICTED: cysteine proteinase RD19a-like [Eucalyptus grandis]
 gb|KCW67908.1| hypothetical protein EUGRSUZ_F01612 [Eucalyptus grandis]
Length=369

 Score =   137 bits (346),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 66/86 (77%), Positives = 72/86 (84%), Gaps = 1/86 (1%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDAL-LNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  258
            EDPLIRQVVS G DD L L A+ HF  FK ++GK+YAT EEHDYRL VFKANLRRA+ HQ
Sbjct  30   EDPLIRQVVSSGGDDDLALGAERHFVDFKLRFGKAYATPEEHDYRLGVFKANLRRARLHQ  89

Query  259  LLDPSAVHGVTKFSDLTPKEFRRTFL  336
             LDPSAVHGVTKFSDLTP+EFRR FL
Sbjct  90   KLDPSAVHGVTKFSDLTPEEFRRQFL  115



>ref|XP_006414378.1| hypothetical protein EUTSA_v10025521mg [Eutrema salsugineum]
 gb|ESQ55831.1| hypothetical protein EUTSA_v10025521mg [Eutrema salsugineum]
Length=367

 Score =   137 bits (345),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 65/90 (72%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = +1

Query  67   VVRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRA  246
            VV    D  IRQVV +  D+ LL A+HHF LFKSKY K+YATQEEHD+R  VFKANLRRA
Sbjct  22   VVDLSFDNPIRQVVPEESDEQLLTAEHHFALFKSKYEKTYATQEEHDHRFRVFKANLRRA  81

Query  247  KRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            KRHQ LDP+AVHGVT+FSDLTPKEFRR +L
Sbjct  82   KRHQALDPTAVHGVTQFSDLTPKEFRRKYL  111



>gb|EYU42593.1| hypothetical protein MIMGU_mgv1a008336mg [Erythranthe guttata]
Length=377

 Score =   137 bits (346),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 63/90 (70%), Positives = 75/90 (83%), Gaps = 5/90 (6%)
 Frame = +1

Query  82   EDPLIRQVVSDGE-----DDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRA  246
            +D LIRQVV  GE     +++LLNADHHF  FK K+GK+YATQEEHDYR SVF+AN+RRA
Sbjct  35   DDLLIRQVVDHGEGGAVDENSLLNADHHFAAFKRKFGKAYATQEEHDYRFSVFEANMRRA  94

Query  247  KRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
             RHQ +DPSAVHGVT+FSDLTP+EFR+ FL
Sbjct  95   VRHQKIDPSAVHGVTQFSDLTPREFRQQFL  124



>gb|AAF40415.1|AF216784_1 papain-like cysteine proteinase isoform II [Ipomoea batatas]
Length=368

 Score =   137 bits (345),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 75/85 (88%), Gaps = 1/85 (1%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            +D LIRQVV DG+ D LLNADHHFT+FK ++GK+YA+ EEHDYRLSVFKAN+RRAKRHQ 
Sbjct  29   DDILIRQVVGDGDGD-LLNADHHFTVFKRRFGKAYASDEEHDYRLSVFKANMRRAKRHQE  87

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            LDP+AVHGVT+FSD TP EFRR FL
Sbjct  88   LDPAAVHGVTQFSDSTPTEFRRKFL  112



>ref|XP_007223351.1| hypothetical protein PRUPE_ppa007441mg [Prunus persica]
 gb|EMJ24550.1| hypothetical protein PRUPE_ppa007441mg [Prunus persica]
Length=367

 Score =   137 bits (344),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +1

Query  67   VVRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRA  246
            V   D DPLI+QVV +  D+ LL+A+ HF+ FK+ +GK+YATQEEHDYR  VFKANLRRA
Sbjct  25   VTPNDADPLIQQVVPEANDNLLLHAERHFSSFKATFGKTYATQEEHDYRFGVFKANLRRA  84

Query  247  KRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            KRHQ LDP+AVHGVTKFSDLTP EFRR FL
Sbjct  85   KRHQGLDPTAVHGVTKFSDLTPSEFRRNFL  114



>emb|CAA78365.1| tobacco pre-pro-cysteine proteinase [Nicotiana tabacum]
Length=365

 Score =   136 bits (343),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 77/88 (88%), Gaps = 2/88 (2%)
 Frame = +1

Query  79   DEDPLIRQVVSDGE--DDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKR  252
            DEDPLIRQVVS+ E  D  LLNA+HHF+LFKSK+GK YA++EEHD+R  VFKANLRRA+ 
Sbjct  23   DEDPLIRQVVSETETDDSHLLNAEHHFSLFKSKFGKIYASEEEHDHRFKVFKANLRRARL  82

Query  253  HQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            +QLLDPSA HG+TKFSDLTP EFRRT+L
Sbjct  83   NQLLDPSAEHGITKFSDLTPSEFRRTYL  110



>gb|KFK24413.1| hypothetical protein AALP_AAs58848U000200 [Arabis alpina]
Length=372

 Score =   136 bits (343),  Expect = 6e-36, Method: Composition-based stats.
 Identities = 66/91 (73%), Positives = 76/91 (84%), Gaps = 1/91 (1%)
 Frame = +1

Query  67   VVRADEDPLIRQVVSD-GEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRR  243
            VV    D  IRQVV +   D+ +LNA+ HFTLFKSKY K+YATQEEHDYR  VF+ANLRR
Sbjct  26   VVDGGLDNPIRQVVPELKNDEQILNAELHFTLFKSKYEKTYATQEEHDYRFRVFEANLRR  85

Query  244  AKRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            AKR+QLLDPSAVHGVT+FSDLTPKEFRR++L
Sbjct  86   AKRNQLLDPSAVHGVTQFSDLTPKEFRRSYL  116



>gb|AAF61441.1|AF138265_1 papain-like cysteine proteinase isoform II [Ipomoea batatas]
Length=366

 Score =   136 bits (342),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 74/85 (87%), Gaps = 2/85 (2%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            +D LIRQVV DG D  LLNADHHFT+FK ++GK YA+ EEHDYRLSVFKAN+RRAK+HQ 
Sbjct  28   DDILIRQVVGDGGD--LLNADHHFTVFKRRFGKVYASDEEHDYRLSVFKANMRRAKQHQE  85

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            LDP+AVHGVT+FSDLTP EFRR FL
Sbjct  86   LDPAAVHGVTQFSDLTPTEFRRKFL  110



>gb|KHN22211.1| Cysteine proteinase 15A [Glycine soja]
Length=366

 Score =   136 bits (342),  Expect = 9e-36, Method: Composition-based stats.
 Identities = 61/86 (71%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +1

Query  79   DEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  258
            ++D LIRQVV D ED  LLNA+HHF+ FK+K+GK+YATQEEHD+R  +FK NL RAK HQ
Sbjct  27   EDDLLIRQVVPDAEDHHLLNAEHHFSAFKTKFGKTYATQEEHDHRFRIFKNNLLRAKSHQ  86

Query  259  LLDPSAVHGVTKFSDLTPKEFRRTFL  336
             LDPSAVHGVT+FSDL P EFRR FL
Sbjct  87   KLDPSAVHGVTRFSDLNPAEFRRQFL  112



>ref|XP_008460996.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=377

 Score =   136 bits (342),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 62/94 (66%), Positives = 75/94 (80%), Gaps = 7/94 (7%)
 Frame = +1

Query  76   ADEDPLIRQVVSDGE-------DDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKAN  234
            +D D +IRQVV DG        DD LL A+HHF++FK K+GKSYA++EEHD+R  VFKAN
Sbjct  28   SDGDFIIRQVVDDGGVNGASNGDDLLLGAEHHFSVFKQKFGKSYASKEEHDHRFRVFKAN  87

Query  235  LRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            L+RA+RHQ LDPSA HGVT+FSDLTP EFRR+FL
Sbjct  88   LKRAQRHQALDPSATHGVTQFSDLTPSEFRRSFL  121



>ref|XP_008221329.1| PREDICTED: cysteine proteinase 15A-like [Prunus mume]
Length=366

 Score =   135 bits (339),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = +1

Query  67   VVRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRA  246
            V   D DPLI QVV +  D+ LL+A+ HF+ FK+ +G++YATQEEHDYR  VFKANLRRA
Sbjct  24   VTPNDADPLIEQVVPEANDNLLLHAERHFSSFKATFGRTYATQEEHDYRFGVFKANLRRA  83

Query  247  KRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            KRHQ LDP+AVHGVTKFSDLTP EFRR FL
Sbjct  84   KRHQGLDPTAVHGVTKFSDLTPSEFRRNFL  113



>ref|XP_002275759.1| PREDICTED: cysteine proteinase RD19a [Vitis vinifera]
 emb|CBI17456.3| unnamed protein product [Vitis vinifera]
Length=367

 Score =   135 bits (339),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 61/82 (74%), Positives = 73/82 (89%), Gaps = 2/82 (2%)
 Frame = +1

Query  91   LIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLLDP  270
            LIRQVV +G+D  LL+A+H F LFK+K+GK+Y+T EEHDYR SVF+ANLRRA+RHQLLDP
Sbjct  34   LIRQVVPEGDD--LLSAEHQFGLFKAKFGKTYSTVEEHDYRFSVFEANLRRARRHQLLDP  91

Query  271  SAVHGVTKFSDLTPKEFRRTFL  336
            SAVHGVT+FSDLTP EFRR +L
Sbjct  92   SAVHGVTRFSDLTPDEFRRDYL  113



>gb|ACX54787.2| cysteine protease [Arachis diogoi]
Length=360

 Score =   134 bits (337),  Expect = 4e-35, Method: Composition-based stats.
 Identities = 63/84 (75%), Positives = 72/84 (86%), Gaps = 2/84 (2%)
 Frame = +1

Query  85   DPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLL  264
            DPLIRQV +DG D  +LNA+HHFT FK+K+GKSYATQEEHDYR  VF+ANLRRAK H  L
Sbjct  24   DPLIRQV-TDG-DHHMLNAEHHFTTFKTKFGKSYATQEEHDYRFGVFRANLRRAKLHAKL  81

Query  265  DPSAVHGVTKFSDLTPKEFRRTFL  336
            DPSA HGVTKFSDLTP+EF+R +L
Sbjct  82   DPSAEHGVTKFSDLTPEEFKRQYL  105



>emb|CAB17075.1| cysteine proteinase precursor [Phaseolus vulgaris]
Length=365

 Score =   134 bits (337),  Expect = 4e-35, Method: Composition-based stats.
 Identities = 61/86 (71%), Positives = 73/86 (85%), Gaps = 1/86 (1%)
 Frame = +1

Query  82   EDPLIRQVVSDGE-DDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  258
            +D LIRQVV +GE +D LLNA+HHF+ FKSK+GK+YAT+EEHD+R  VFK+N+RRA+ H 
Sbjct  27   DDILIRQVVPEGEVEDHLLNAEHHFSTFKSKFGKTYATKEEHDHRFGVFKSNMRRARLHA  86

Query  259  LLDPSAVHGVTKFSDLTPKEFRRTFL  336
             LDPSAVHGVTKFSDLTP EF R FL
Sbjct  87   QLDPSAVHGVTKFSDLTPAEFHRKFL  112



>ref|XP_004290288.1| PREDICTED: probable cysteine proteinase A494 [Fragaria vesca 
subsp. vesca]
Length=372

 Score =   134 bits (337),  Expect = 5e-35, Method: Composition-based stats.
 Identities = 64/103 (62%), Positives = 77/103 (75%), Gaps = 15/103 (15%)
 Frame = +1

Query  73   RAD---EDPLIRQVVSDGED------------DALLNADHHFTLFKSKYGKSYATQEEHD  207
            RAD    DPLIRQVV  G++            +A+L A+HHF+LFK K+GKSYA+QEEHD
Sbjct  19   RADVDVSDPLIRQVVDGGDESPHHHHHHDHDGEAMLGAEHHFSLFKRKFGKSYASQEEHD  78

Query  208  YRLSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            YR SVFK N+RRAKRHQ LDP+A HGVT+FSDLTP EFR++ L
Sbjct  79   YRFSVFKTNMRRAKRHQRLDPTAQHGVTRFSDLTPAEFRKSHL  121



>ref|XP_007201310.1| hypothetical protein PRUPE_ppa007454mg [Prunus persica]
 gb|EMJ02509.1| hypothetical protein PRUPE_ppa007454mg [Prunus persica]
Length=367

 Score =   134 bits (336),  Expect = 6e-35, Method: Composition-based stats.
 Identities = 61/87 (70%), Positives = 72/87 (83%), Gaps = 3/87 (3%)
 Frame = +1

Query  85   DPLIRQVVSDGED---DALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRH  255
            DPLIRQVV  G+D   D  L A+HHF+LFK ++GKSYA+QEEHDYR  VFKANLRRA RH
Sbjct  25   DPLIRQVVDGGDDHQHDHRLGAEHHFSLFKHQFGKSYASQEEHDYRFEVFKANLRRAARH  84

Query  256  QLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            Q+LDPSA HGVT+FSD+TP EFR++ L
Sbjct  85   QMLDPSAQHGVTRFSDMTPAEFRKSQL  111



>dbj|BAD10859.1| cysteine protease [Aster tripolium]
Length=363

 Score =   134 bits (336),  Expect = 6e-35, Method: Composition-based stats.
 Identities = 62/94 (66%), Positives = 77/94 (82%), Gaps = 5/94 (5%)
 Frame = +1

Query  70   VRADE-DPLIRQVVSDGE----DDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKAN  234
            V AD  DPLIRQVV + E     D LL+ +HHF LFK+K+G++Y T+EEH+YRL+VFK+N
Sbjct  18   VTADSSDPLIRQVVQNDETEIESDPLLDPEHHFKLFKNKFGRTYDTEEEHEYRLTVFKSN  77

Query  235  LRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            LRRAKRHQ+LDP+A HGVTKFSDLTP EFR+ +L
Sbjct  78   LRRAKRHQVLDPTAKHGVTKFSDLTPSEFRKKYL  111



>ref|XP_002452058.1| hypothetical protein SORBIDRAFT_04g017830 [Sorghum bicolor]
 gb|EES05034.1| hypothetical protein SORBIDRAFT_04g017830 [Sorghum bicolor]
Length=371

 Score =   134 bits (336),  Expect = 6e-35, Method: Composition-based stats.
 Identities = 63/86 (73%), Positives = 71/86 (83%), Gaps = 1/86 (1%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDAL-LNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  258
            EDPLIRQVV  G+D+ L LNA+ HF  F  ++GKSY   EEH YRLS+FKANLRRA+RHQ
Sbjct  24   EDPLIRQVVPGGDDNELELNAESHFLSFVQRFGKSYKDAEEHAYRLSIFKANLRRARRHQ  83

Query  259  LLDPSAVHGVTKFSDLTPKEFRRTFL  336
            LLDPSA HGVTKFSDLTP EFRRT+L
Sbjct  84   LLDPSAEHGVTKFSDLTPAEFRRTYL  109



>ref|XP_011088458.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase RD19a-like 
[Sesamum indicum]
Length=379

 Score =   134 bits (336),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 76/94 (81%), Gaps = 5/94 (5%)
 Frame = +1

Query  70   VRADEDPLIRQVVSDGED-----DALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKAN  234
            V   +DPLIRQVV  G+D     ++LLNAD+HF +FK K+GKSYA+QEEHDYR SVFKAN
Sbjct  32   VVGSDDPLIRQVVDHGDDEVVDENSLLNADYHFAIFKRKFGKSYASQEEHDYRFSVFKAN  91

Query  235  LRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            L  A+RHQ LDPSAVHGVT+FSDLTP+EFR  FL
Sbjct  92   LHLARRHQKLDPSAVHGVTQFSDLTPREFRHQFL  125



>ref|XP_002280798.2| PREDICTED: cysteine proteinase 15A [Vitis vinifera]
 emb|CAN73591.1| hypothetical protein VITISV_022889 [Vitis vinifera]
 emb|CBI19785.3| unnamed protein product [Vitis vinifera]
Length=371

 Score =   133 bits (335),  Expect = 8e-35, Method: Composition-based stats.
 Identities = 62/85 (73%), Positives = 74/85 (87%), Gaps = 2/85 (2%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            ED LI QVVSDG+D  LLNA++ F  FK+K+GK+YAT EEHD+R +VFKANLRRAKRHQL
Sbjct  35   EDLLIHQVVSDGDD--LLNAEYQFAEFKTKFGKTYATAEEHDHRFNVFKANLRRAKRHQL  92

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            LDPSA HGVT+FSDLTP+EFR+ +L
Sbjct  93   LDPSAEHGVTQFSDLTPREFRQNYL  117



>ref|XP_010440192.1| PREDICTED: cysteine proteinase RD19a-like [Camelina sativa]
Length=365

 Score =   133 bits (334),  Expect = 9e-35, Method: Composition-based stats.
 Identities = 63/84 (75%), Positives = 73/84 (87%), Gaps = 1/84 (1%)
 Frame = +1

Query  85   DPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLL  264
            D  IRQVV + E+  LLNA+HHF+LFKSKY K+YATQEEHD+RL VFKANLRRA+R+QLL
Sbjct  26   DNPIRQVVPE-ENHELLNAEHHFSLFKSKYQKTYATQEEHDHRLRVFKANLRRARRNQLL  84

Query  265  DPSAVHGVTKFSDLTPKEFRRTFL  336
            DPSAVHGVT+FSDLTPKEF R  +
Sbjct  85   DPSAVHGVTQFSDLTPKEFSRQLM  108



>gb|AAK27969.1|AF242373_1 cysteine protease [Ipomoea batatas]
Length=366

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 73/85 (86%), Gaps = 2/85 (2%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            +D LIRQVV DG D  LLNADHHFT+FK ++GK YA+ EEHDYRLS FKAN+RRAK+HQ 
Sbjct  28   DDILIRQVVGDGGD--LLNADHHFTVFKRRFGKVYASDEEHDYRLSEFKANMRRAKQHQE  85

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            LDP+AVHGVT+FSDLTP EFRR FL
Sbjct  86   LDPAAVHGVTQFSDLTPTEFRRKFL  110



>ref|NP_001267989.1| cysteine protease precursor [Vitis vinifera]
 gb|ABX79341.1| cysteine protease [Vitis vinifera]
Length=377

 Score =   133 bits (334),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 62/94 (66%), Positives = 76/94 (81%), Gaps = 7/94 (7%)
 Frame = +1

Query  76   ADEDPLIRQVVSD------GEDDALLNADHH-FTLFKSKYGKSYATQEEHDYRLSVFKAN  234
            +D+D +IRQVV +      GE++ LL ADHH F++FK ++GKSYA+QEEHDYR  VFKAN
Sbjct  30   SDDDIIIRQVVPELGDVEGGEEENLLTADHHHFSIFKRRFGKSYASQEEHDYRFKVFKAN  89

Query  235  LRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            LRRA+RHQ LDPSA HGVT+FSDLTP EFR T+L
Sbjct  90   LRRARRHQQLDPSATHGVTQFSDLTPAEFRGTYL  123



>gb|EPS70818.1| cysteine proteinase, partial [Genlisea aurea]
Length=355

 Score =   132 bits (333),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 63/86 (73%), Positives = 72/86 (84%), Gaps = 3/86 (3%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNADHH-FTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  258
            ++PLIRQVV+DG D  LL+ADHH F LFK+ YGK+YATQEEHDYR SVFK NLRRA+  Q
Sbjct  19   DEPLIRQVVTDGID--LLDADHHHFALFKADYGKAYATQEEHDYRFSVFKTNLRRARSRQ  76

Query  259  LLDPSAVHGVTKFSDLTPKEFRRTFL  336
             LDPSAVHGVT FSDLTP EFR ++L
Sbjct  77   QLDPSAVHGVTMFSDLTPDEFRNSYL  102



>ref|XP_010672379.1| PREDICTED: cysteine proteinase RD19a-like [Beta vulgaris subsp. 
vulgaris]
Length=375

 Score =   133 bits (334),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 62/94 (66%), Positives = 75/94 (80%), Gaps = 7/94 (7%)
 Frame = +1

Query  76   ADEDPLIRQVVSDGE-------DDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKAN  234
            AD+D LIRQV ++         +D LLNADHHF+LFKSK+ K Y+++EEHD R S+FKAN
Sbjct  23   ADDDLLIRQVTTEDSSSSSSSPNDLLLNADHHFSLFKSKFNKIYSSKEEHDNRFSIFKAN  82

Query  235  LRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            LRRA RHQ LDPSAVHGVTKFSDLTP+EFR+ +L
Sbjct  83   LRRASRHQTLDPSAVHGVTKFSDLTPREFRQKYL  116



>ref|XP_007160702.1| hypothetical protein PHAVU_001G009900g [Phaseolus vulgaris]
 gb|ESW32696.1| hypothetical protein PHAVU_001G009900g [Phaseolus vulgaris]
Length=365

 Score =   132 bits (333),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 60/86 (70%), Positives = 73/86 (85%), Gaps = 1/86 (1%)
 Frame = +1

Query  82   EDPLIRQVVSDGE-DDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  258
            +D LIRQVV +GE +D LLNA+HHF+ FK+K+GK+YAT+EEHD+R  VFK+N+RRA+ H 
Sbjct  27   DDILIRQVVPEGEVEDHLLNAEHHFSTFKAKFGKTYATKEEHDHRFGVFKSNMRRARLHA  86

Query  259  LLDPSAVHGVTKFSDLTPKEFRRTFL  336
             LDPSAVHGVTKFSDLTP EF R FL
Sbjct  87   QLDPSAVHGVTKFSDLTPAEFHRKFL  112



>ref|XP_006283974.1| hypothetical protein CARUB_v10005098mg [Capsella rubella]
 gb|EOA16872.1| hypothetical protein CARUB_v10005098mg [Capsella rubella]
Length=365

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 74/84 (88%), Gaps = 1/84 (1%)
 Frame = +1

Query  85   DPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLL  264
            D  IRQVV + E+D LLNA HHF+LFKSKY K+YATQ+EHD+R  VFKANLRRAKR+QLL
Sbjct  26   DNPIRQVVPE-ENDELLNAAHHFSLFKSKYEKTYATQDEHDHRFRVFKANLRRAKRNQLL  84

Query  265  DPSAVHGVTKFSDLTPKEFRRTFL  336
            DPSAVHGVT+FSDLTPKEFRR FL
Sbjct  85   DPSAVHGVTQFSDLTPKEFRRQFL  108



>ref|XP_004507484.1| PREDICTED: cysteine proteinase RD19a-like [Cicer arietinum]
Length=363

 Score =   132 bits (333),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 59/86 (69%), Positives = 72/86 (84%), Gaps = 2/86 (2%)
 Frame = +1

Query  79   DEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  258
            +EDPLIRQVV DG     L A+HHF  FK ++GK Y+T++EHDYR +VFKAN+RRAKRHQ
Sbjct  26   EEDPLIRQVVDDG--GVRLGAEHHFIEFKHRFGKVYSTKDEHDYRFNVFKANMRRAKRHQ  83

Query  259  LLDPSAVHGVTKFSDLTPKEFRRTFL  336
            L+DPSAVHGVT+FSDLTP+EFR + L
Sbjct  84   LMDPSAVHGVTRFSDLTPREFRNSVL  109



>gb|ACK57563.1| cysteine protease-like protein [Arachis hypogaea]
Length=364

 Score =   132 bits (333),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 61/86 (71%), Positives = 72/86 (84%), Gaps = 1/86 (1%)
 Frame = +1

Query  79   DEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  258
            D++ LIRQVV DG D+ LLNA+HHF+ FK+K+ K+YAT+EEHDYR  VFK+NL RAK HQ
Sbjct  26   DDNILIRQVVEDG-DEHLLNAEHHFSAFKTKFSKTYATKEEHDYRFGVFKSNLLRAKSHQ  84

Query  259  LLDPSAVHGVTKFSDLTPKEFRRTFL  336
             LDPSA+HGVTKFSDLTP EFR  FL
Sbjct  85   ELDPSAIHGVTKFSDLTPSEFRSQFL  110



>ref|XP_011045161.1| PREDICTED: cysteine proteinase 15A-like [Populus euphratica]
Length=367

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 74/85 (87%), Gaps = 1/85 (1%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            +DPLIRQVVSDGED  LLNA+HHFT FKSK+GK+YATQEEHD+R SVFK NL  AK+HQ+
Sbjct  29   DDPLIRQVVSDGEDH-LLNAEHHFTTFKSKFGKNYATQEEHDFRFSVFKDNLLLAKKHQM  87

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            +DP+A HGVTKFSDLTP++  R FL
Sbjct  88   MDPTAAHGVTKFSDLTPRDSPRQFL  112



>gb|AJA74415.1| cysteine protease [Cicer arietinum]
Length=358

 Score =   132 bits (331),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 63/86 (73%), Positives = 72/86 (84%), Gaps = 1/86 (1%)
 Frame = +1

Query  79   DEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  258
            ++D LIRQV +D EDD LLNA+HHFT FKSK+ KSYAT+EEHDYR  VFK+NL++AK HQ
Sbjct  24   NDDFLIRQV-TDHEDDQLLNAEHHFTTFKSKFSKSYATKEEHDYRFGVFKSNLKKAKLHQ  82

Query  259  LLDPSAVHGVTKFSDLTPKEFRRTFL  336
             LDPSA HGVTKFSDLT  EFRR FL
Sbjct  83   KLDPSAEHGVTKFSDLTASEFRRQFL  108



>ref|XP_002280808.2| PREDICTED: cysteine proteinase 15A [Vitis vinifera]
 emb|CBI19783.3| unnamed protein product [Vitis vinifera]
Length=365

 Score =   132 bits (331),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 60/85 (71%), Positives = 74/85 (87%), Gaps = 2/85 (2%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            +D LIRQVVS+ +D  LL+A+HHF  FK+++ K+YAT EEHDYR S+FKANLRRAKR+QL
Sbjct  31   DDLLIRQVVSNSDD--LLSAEHHFAAFKARFRKTYATAEEHDYRFSIFKANLRRAKRNQL  88

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            LDPSAVHGVT+FSDLTP EFR+ +L
Sbjct  89   LDPSAVHGVTRFSDLTPAEFRQNYL  113



>ref|XP_010436538.1| PREDICTED: cysteine proteinase 15A-like [Camelina sativa]
Length=227

 Score =   129 bits (323),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 74/84 (88%), Gaps = 1/84 (1%)
 Frame = +1

Query  85   DPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLL  264
            D  IRQVV + E+D LLNA+HHF+LFKSKY K+YATQ+EHD+RL VFKANLRRA+R+QLL
Sbjct  26   DNPIRQVVPE-ENDELLNAEHHFSLFKSKYQKTYATQQEHDHRLRVFKANLRRARRNQLL  84

Query  265  DPSAVHGVTKFSDLTPKEFRRTFL  336
            DPSAVHGVT+FSDLTPKEF R  +
Sbjct  85   DPSAVHGVTQFSDLTPKEFSRQLM  108



>ref|NP_001266121.1| uncharacterized protein LOC101501911 precursor [Cicer arietinum]
 emb|CAA08906.1| cysteine proteinase [Cicer arietinum]
Length=362

 Score =   131 bits (330),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 63/86 (73%), Positives = 72/86 (84%), Gaps = 1/86 (1%)
 Frame = +1

Query  79   DEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  258
            ++D LIRQV +D EDD LLNA+HHFT FKSK+ KSYAT+EEHDYR  VFK+NL++AK HQ
Sbjct  24   NDDFLIRQV-TDHEDDQLLNAEHHFTTFKSKFSKSYATKEEHDYRFGVFKSNLKKAKLHQ  82

Query  259  LLDPSAVHGVTKFSDLTPKEFRRTFL  336
             LDPSA HGVTKFSDLT  EFRR FL
Sbjct  83   KLDPSAEHGVTKFSDLTASEFRRQFL  108



>ref|XP_006362019.1| PREDICTED: cysteine proteinase RD19a-like [Solanum tuberosum]
Length=368

 Score =   131 bits (330),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 61/87 (70%), Positives = 70/87 (80%), Gaps = 1/87 (1%)
 Frame = +1

Query  76   ADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRH  255
             D+D  IRQVV D +D  +LNADHHFTLFK ++GK+YA+ EEH YR SVFKANLRRA  H
Sbjct  30   GDDDIFIRQVVGD-DDHHMLNADHHFTLFKKRFGKTYASDEEHHYRFSVFKANLRRAMSH  88

Query  256  QLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            Q LDPSAVHGVT+FSDLTP EF + FL
Sbjct  89   QKLDPSAVHGVTQFSDLTPDEFSQKFL  115



>gb|KHN45894.1| Cysteine proteinase RD19a [Glycine soja]
Length=366

 Score =   131 bits (330),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 62/87 (71%), Positives = 70/87 (80%), Gaps = 1/87 (1%)
 Frame = +1

Query  79   DEDPL-IRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRH  255
            DED L IRQVV D ED  LLNA+HHF+ FK+K+ K+YATQEEHD+R  +FK NL RAK H
Sbjct  26   DEDNLLIRQVVPDAEDHHLLNAEHHFSAFKTKFAKTYATQEEHDHRFRIFKNNLLRAKSH  85

Query  256  QLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            Q LDPSAVHGVT+FSDLTP EFR  FL
Sbjct  86   QKLDPSAVHGVTRFSDLTPAEFRGQFL  112



>ref|XP_008236965.1| PREDICTED: cysteine proteinase RD19a [Prunus mume]
Length=367

 Score =   131 bits (330),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 61/87 (70%), Positives = 71/87 (82%), Gaps = 3/87 (3%)
 Frame = +1

Query  85   DPLIRQVVSDGED---DALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRH  255
            DPLIRQVV  G+D   D  L A+HHF+LFK ++GKSYA+QEEHDYR  VFKANLRRA RH
Sbjct  25   DPLIRQVVDGGDDHQHDHRLGAEHHFSLFKHQFGKSYASQEEHDYRFEVFKANLRRAARH  84

Query  256  QLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            Q LDPSA HGVT+FSD+TP EFR++ L
Sbjct  85   QRLDPSAQHGVTRFSDMTPAEFRKSQL  111



>dbj|BAF03553.1| cysteine proteinase CP2 [Phaseolus vulgaris]
Length=365

 Score =   131 bits (330),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 59/83 (71%), Positives = 71/83 (86%), Gaps = 1/83 (1%)
 Frame = +1

Query  91   LIRQVVSDGE-DDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLLD  267
            LIRQVV +GE +D LLNA+HHF+ FK+K+GK+YAT+EEHD+R  VFK+N+RRA+ H  LD
Sbjct  30   LIRQVVPEGEVEDHLLNAEHHFSTFKAKFGKTYATKEEHDHRFGVFKSNMRRARLHAQLD  89

Query  268  PSAVHGVTKFSDLTPKEFRRTFL  336
            PSAVHGVTKFSDLTP EF R FL
Sbjct  90   PSAVHGVTKFSDLTPAEFHRKFL  112



>gb|ACF86683.1| unknown [Zea mays]
 gb|AFW71402.1| cysteine protease1 [Zea mays]
Length=371

 Score =   131 bits (330),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 63/86 (73%), Positives = 71/86 (83%), Gaps = 1/86 (1%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDAL-LNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  258
            EDPLIRQVV  G+D+ L LNA+ HF  F  ++GKSY   +EH YRLSVFKANLRRA+RHQ
Sbjct  24   EDPLIRQVVPGGDDNDLELNAESHFLSFVQRFGKSYKDADEHAYRLSVFKANLRRARRHQ  83

Query  259  LLDPSAVHGVTKFSDLTPKEFRRTFL  336
            LLDPSA HGVTKFSDLTP EFRRT+L
Sbjct  84   LLDPSAEHGVTKFSDLTPAEFRRTYL  109



>ref|NP_001046828.1| Os02g0469600 [Oryza sativa Japonica Group]
 dbj|BAD19579.1| putative cysteine proteinase 1 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF08742.1| Os02g0469600 [Oryza sativa Japonica Group]
 dbj|BAG92750.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93804.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94031.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC83204.1| hypothetical protein OsI_28465 [Oryza sativa Indica Group]
 gb|EEE56967.1| hypothetical protein OsJ_06681 [Oryza sativa Japonica Group]
Length=373

 Score =   131 bits (329),  Expect = 6e-34, Method: Composition-based stats.
 Identities = 62/90 (69%), Positives = 72/90 (80%), Gaps = 1/90 (1%)
 Frame = +1

Query  70   VRADEDPLIRQVVSDGEDDAL-LNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRA  246
            V  +E+PLIRQVV  G+D+ L LNA+ HF  F  ++GKSY   +EH YRLSVFKANLRRA
Sbjct  22   VPGEEEPLIRQVVGGGDDNELELNAERHFASFVQRFGKSYRDADEHAYRLSVFKANLRRA  81

Query  247  KRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            +RHQLLDPSA HGVTKFSDLTP EFRR +L
Sbjct  82   RRHQLLDPSAEHGVTKFSDLTPAEFRRAYL  111



>ref|XP_004952477.1| PREDICTED: cysteine proteinase 1-like [Setaria italica]
Length=374

 Score =   131 bits (329),  Expect = 6e-34, Method: Composition-based stats.
 Identities = 62/86 (72%), Positives = 71/86 (83%), Gaps = 1/86 (1%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDAL-LNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  258
            EDPLIRQVV  G+D+ L LNA+ HF  F  ++GKSY   +EH YRLSVFKANLRRA+RHQ
Sbjct  26   EDPLIRQVVPGGDDNDLELNAESHFLNFVQRFGKSYKDADEHAYRLSVFKANLRRARRHQ  85

Query  259  LLDPSAVHGVTKFSDLTPKEFRRTFL  336
            LLDPSA HG+TKFSDLTP EFRRT+L
Sbjct  86   LLDPSAEHGITKFSDLTPAEFRRTYL  111



>ref|XP_010105270.1| Cysteine proteinase 15A [Morus notabilis]
 gb|EXC04205.1| Cysteine proteinase 15A [Morus notabilis]
Length=372

 Score =   131 bits (329),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 74/86 (86%), Gaps = 1/86 (1%)
 Frame = +1

Query  79   DEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  258
            D+D LIRQVVS G DD LL+A+HHF+ FK+++GK+Y T+EEHDYR  VFKANLRRAK HQ
Sbjct  29   DDDLLIRQVVSAG-DDQLLSAEHHFSSFKARFGKAYETEEEHDYRFEVFKANLRRAKTHQ  87

Query  259  LLDPSAVHGVTKFSDLTPKEFRRTFL  336
             LDP+AVHGVTKFSDLTP EFR+ FL
Sbjct  88   KLDPNAVHGVTKFSDLTPGEFRKKFL  113



>ref|XP_003545051.1| PREDICTED: cysteine proteinase 15A-like [Glycine max]
Length=367

 Score =   130 bits (328),  Expect = 9e-34, Method: Composition-based stats.
 Identities = 64/97 (66%), Positives = 72/97 (74%), Gaps = 7/97 (7%)
 Frame = +1

Query  67   VVRADEDPLIRQVVSDG-------EDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVF  225
            V  A +D LIRQVV D        E+D LLNA+HHF  FK+K+GK YAT+EEHD R  VF
Sbjct  18   VSSAADDILIRQVVPDAVGEAAEKEEDHLLNAEHHFASFKAKFGKKYATKEEHDRRFGVF  77

Query  226  KANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            K+NLRRA+ H  LDPSAVHGVTKFSDLTP EFRR FL
Sbjct  78   KSNLRRARLHAKLDPSAVHGVTKFSDLTPAEFRRQFL  114



>ref|XP_010943608.1| PREDICTED: cysteine proteinase 1-like [Elaeis guineensis]
Length=371

 Score =   130 bits (328),  Expect = 9e-34, Method: Composition-based stats.
 Identities = 61/88 (69%), Positives = 71/88 (81%), Gaps = 1/88 (1%)
 Frame = +1

Query  76   ADEDPLIRQVVSDGEDDAL-LNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKR  252
            AD DPLI QVV D EDD L LNA+ HF+ F  ++GKSYA ++EH YR SVFKANL RA+R
Sbjct  28   ADNDPLILQVVPDAEDDELMLNAEAHFSSFLRRFGKSYADEKEHAYRFSVFKANLWRAQR  87

Query  253  HQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            HQ LDP+AVHG+TKFSDLTP EFRR +L
Sbjct  88   HQRLDPTAVHGITKFSDLTPAEFRRNYL  115



>gb|EYU37835.1| hypothetical protein MIMGU_mgv1a008237mg [Erythranthe guttata]
Length=380

 Score =   130 bits (328),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 60/90 (67%), Positives = 73/90 (81%), Gaps = 5/90 (6%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDD-----ALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRA  246
            +D +IRQVV  GED+     +LLNADHHF +FK K+GK+Y  + EHDYRLSVFKAN+RRA
Sbjct  36   DDLVIRQVVDHGEDEVVGENSLLNADHHFAIFKRKFGKTYTDKAEHDYRLSVFKANMRRA  95

Query  247  KRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
             +HQ +DPSAVHGVT+FSDLTP+EFR  FL
Sbjct  96   VQHQKIDPSAVHGVTQFSDLTPREFRSRFL  125



>ref|XP_008382317.1| PREDICTED: cysteine proteinase RD19a [Malus domestica]
Length=371

 Score =   130 bits (327),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 60/91 (66%), Positives = 71/91 (78%), Gaps = 7/91 (8%)
 Frame = +1

Query  85   DPLIRQVVSDGEDDA-------LLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRR  243
            DPLIRQVV  G++         +L A+HHF+LFK KYGKSYA++EEHDYR  VFKANLRR
Sbjct  25   DPLIRQVVDGGDESHHDHDHDHVLGAEHHFSLFKHKYGKSYASKEEHDYRFDVFKANLRR  84

Query  244  AKRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            A RHQ LDPSA HGVT+FSD+TP EFR++ L
Sbjct  85   AARHQRLDPSAQHGVTRFSDMTPAEFRKSQL  115



>emb|CDP08018.1| unnamed protein product [Coffea canephora]
Length=209

 Score =   126 bits (317),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 70/83 (84%), Gaps = 1/83 (1%)
 Frame = +1

Query  82   EDPLIRQVVS-DGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  258
            ED   RQVV  D + D LLNADHHF+LFK KYGK+Y+TQEE DYR SVFKANL RAKRHQ
Sbjct  35   EDLSFRQVVPLDDDVDPLLNADHHFSLFKKKYGKTYSTQEEDDYRFSVFKANLHRAKRHQ  94

Query  259  LLDPSAVHGVTKFSDLTPKEFRR  327
            LLDPSAVHG+TKFSDLTP EF++
Sbjct  95   LLDPSAVHGITKFSDLTPSEFQQ  117



>emb|CAA82995.1| cysteine proteinase [Vicia sativa]
Length=358

 Score =   129 bits (325),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 62/85 (73%), Positives = 70/85 (82%), Gaps = 1/85 (1%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            +D LIRQVV D E+D LLNA+HHFT FKSK+ KSYAT+EEHDYR  VFKANL +AK HQ 
Sbjct  21   DDFLIRQVV-DNEEDHLLNAEHHFTSFKSKFSKSYATKEEHDYRFGVFKANLIKAKLHQK  79

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            LDP+A HG+TKFSDLT  EFRR FL
Sbjct  80   LDPTAEHGITKFSDLTASEFRRQFL  104



>ref|XP_003606998.1| Cysteine proteinase [Medicago truncatula]
 gb|AES89195.1| papain family cysteine protease [Medicago truncatula]
Length=362

 Score =   129 bits (325),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 56/85 (66%), Positives = 71/85 (84%), Gaps = 2/85 (2%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            EDP+IRQVV   E+   L A+HHF LFK K+GK Y++++EHDYR  +FK+NL RAKRHQL
Sbjct  27   EDPIIRQVVD--EEGVRLGAEHHFNLFKHKFGKVYSSKDEHDYRFKIFKSNLNRAKRHQL  84

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            +DPSAVHGVT+FSDLTP+EFR++ L
Sbjct  85   MDPSAVHGVTRFSDLTPREFRKSVL  109



>ref|XP_004230928.1| PREDICTED: cysteine proteinase RD19a [Solanum lycopersicum]
Length=369

 Score =   129 bits (324),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 72/87 (83%), Gaps = 1/87 (1%)
 Frame = +1

Query  76   ADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRH  255
             D+D LIRQVV D ED  +LNA+HHFTLFK ++GK+YA+ EEH YR SVFKANLRRA RH
Sbjct  30   GDDDILIRQVVGD-EDHHMLNAEHHFTLFKKRFGKTYASDEEHHYRFSVFKANLRRAMRH  88

Query  256  QLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            Q LDPSAVHGVT+FSD+TP EF + FL
Sbjct  89   QKLDPSAVHGVTQFSDMTPDEFSQKFL  115



>gb|ACM80348.1| cysteine proteinase [Solanum lycopersicum]
Length=368

 Score =   129 bits (324),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 72/87 (83%), Gaps = 1/87 (1%)
 Frame = +1

Query  76   ADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRH  255
             D+D LIRQVV D ED  +LNA+HHFTLFK ++GK+YA+ EEH YR SVFKANLRRA RH
Sbjct  30   GDDDILIRQVVGD-EDHHMLNAEHHFTLFKKRFGKTYASDEEHHYRFSVFKANLRRAMRH  88

Query  256  QLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            Q LDPSAVHGVT+FSD+TP EF + FL
Sbjct  89   QKLDPSAVHGVTQFSDMTPDEFSQKFL  115



>dbj|BAA92495.1| cysteine protease [Vigna mungo]
Length=364

 Score =   128 bits (322),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 59/83 (71%), Positives = 71/83 (86%), Gaps = 1/83 (1%)
 Frame = +1

Query  91   LIRQVVSDGE-DDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLLD  267
            LIRQVV +GE +D LLNA+HHF+ FK+K+GK+YAT+EEHD+R  VFK+NLRRA+ H  LD
Sbjct  29   LIRQVVPEGEVEDHLLNAEHHFSNFKAKFGKTYATKEEHDHRFGVFKSNLRRARLHAQLD  88

Query  268  PSAVHGVTKFSDLTPKEFRRTFL  336
            PSAVHGVTKFSDLT  EF+R FL
Sbjct  89   PSAVHGVTKFSDLTAAEFQRQFL  111



>gb|AAL05851.1|AF411121_1 cysteine proteinase precursor [Sandersonia aurantiaca]
Length=360

 Score =   128 bits (322),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 59/85 (69%), Positives = 72/85 (85%), Gaps = 1/85 (1%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            EDP+IRQVVSD +   LL+A+ HF+ F S+YGKSYA + EH YR SVFK+NLRRA+RHQ 
Sbjct  23   EDPVIRQVVSD-DQQQLLSAEAHFSSFLSRYGKSYADEAEHAYRFSVFKSNLRRARRHQR  81

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            LDP+AVHGVT+F+DLTP EFRRT+L
Sbjct  82   LDPTAVHGVTRFADLTPSEFRRTYL  106



>gb|AIB06024.1| CP2 [Hevea brasiliensis]
Length=372

 Score =   128 bits (322),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 74/90 (82%), Gaps = 6/90 (7%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDA-----LLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRA  246
            EDPLIRQVV DG+D++     LL+ +HHF+LFKSK+ KSY +Q+EHDYR  VFKANLRRA
Sbjct  29   EDPLIRQVV-DGQDESSTSPHLLSEEHHFSLFKSKFKKSYTSQQEHDYRFKVFKANLRRA  87

Query  247  KRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
             RHQ LDP+A HGVT+FSDLTP EFRR FL
Sbjct  88   ARHQKLDPTASHGVTQFSDLTPAEFRRQFL  117



>ref|XP_008775280.1| PREDICTED: cysteine proteinase 1-like [Phoenix dactylifera]
Length=368

 Score =   128 bits (321),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 59/86 (69%), Positives = 70/86 (81%), Gaps = 1/86 (1%)
 Frame = +1

Query  79   DEDPLIRQVVSDGEDDAL-LNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRH  255
            D+DPLI QVV D EDD L LN + HF+ F  ++GKSYA ++EH YR SVFKANLRRA+RH
Sbjct  27   DDDPLILQVVPDAEDDELMLNTEAHFSSFLRRFGKSYADEKEHAYRFSVFKANLRRARRH  86

Query  256  QLLDPSAVHGVTKFSDLTPKEFRRTF  333
            Q LDP+AVHG+TKFSDLTP EFRR +
Sbjct  87   QRLDPTAVHGITKFSDLTPAEFRRNY  112



>ref|XP_009373000.1| PREDICTED: cysteine proteinase RD19a [Pyrus x bretschneideri]
Length=371

 Score =   128 bits (321),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 59/91 (65%), Positives = 70/91 (77%), Gaps = 7/91 (8%)
 Frame = +1

Query  85   DPLIRQVVSDGEDDAL-------LNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRR  243
            DPLIRQVV  G++          L A+HHF+LFK K+GKSYA++EEHDYR  VFKANLRR
Sbjct  25   DPLIRQVVDGGDESHHHHDHDHALGAEHHFSLFKHKFGKSYASKEEHDYRFDVFKANLRR  84

Query  244  AKRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            A RHQ LDPSA HGVT+FSD+TP EFR++ L
Sbjct  85   AARHQRLDPSAQHGVTRFSDMTPAEFRKSQL  115



>ref|XP_008448073.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=385

 Score =   127 bits (320),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 58/91 (64%), Positives = 71/91 (78%), Gaps = 2/91 (2%)
 Frame = +1

Query  70   VRADEDPLIRQVVSDGED--DALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRR  243
            V+ D DP IRQVV D  D     L A+HHF+LFK ++GKSYAT+EEHD R  +FKAN+RR
Sbjct  28   VQHDRDPFIRQVVEDDGDFNRHALGAEHHFSLFKRRFGKSYATEEEHDRRFKIFKANMRR  87

Query  244  AKRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            A+RHQ  DPSA+HG+T+FSDLTP EFR+ FL
Sbjct  88   AERHQSFDPSAIHGITQFSDLTPFEFRKAFL  118



>gb|AGV54334.1| cysteine proteinase RD19a-like protein [Phaseolus vulgaris]
Length=366

 Score =   127 bits (319),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 59/89 (66%), Positives = 72/89 (81%), Gaps = 1/89 (1%)
 Frame = +1

Query  70   VRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAK  249
            +  ++D LIRQVV D E+  LLNA++HF+ FK+K+G++YAT+EEHDYR  +FK NL RAK
Sbjct  25   IDGEDDLLIRQVVPDAEEH-LLNAENHFSAFKTKFGRTYATKEEHDYRFRIFKNNLLRAK  83

Query  250  RHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
             HQ LDPSAVHGVTKFSDLTP EF R FL
Sbjct  84   SHQKLDPSAVHGVTKFSDLTPAEFSRQFL  112



>gb|KDO49483.1| hypothetical protein CISIN_1g017318mg [Citrus sinensis]
Length=373

 Score =   127 bits (319),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 58/95 (61%), Positives = 72/95 (76%), Gaps = 9/95 (9%)
 Frame = +1

Query  79   DEDPLIRQVVSDGED---------DALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKA  231
            D D LIRQV   G++         + LL A+HHF+LFK K+ K+YA+QEEHD+R ++FKA
Sbjct  27   DVDQLIRQVTDGGDEILSHHESTNNDLLGAEHHFSLFKKKFNKAYASQEEHDHRFTIFKA  86

Query  232  NLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            NLRRA RHQ LDPSA HG+T+FSDLTP EFRRT+L
Sbjct  87   NLRRAARHQKLDPSATHGITQFSDLTPAEFRRTYL  121



>ref|XP_004165230.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
Length=387

 Score =   127 bits (320),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 60/91 (66%), Positives = 74/91 (81%), Gaps = 2/91 (2%)
 Frame = +1

Query  70   VRADEDPLIRQVV-SDGE-DDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRR  243
            V  D DPLIRQVV +DG+ +   L A+HHF+LFK ++GKSYAT+EEHD R  +FKAN+RR
Sbjct  30   VEHDGDPLIRQVVENDGDFNHHALGAEHHFSLFKRRFGKSYATEEEHDRRFKIFKANMRR  89

Query  244  AKRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            A+RHQ  DPSA+HGVT+FSDLTP EFR+ FL
Sbjct  90   AERHQSFDPSAIHGVTQFSDLTPFEFRKAFL  120



>ref|XP_003550405.2| PREDICTED: cysteine proteinase 15A [Glycine max]
Length=392

 Score =   127 bits (320),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 60/86 (70%), Positives = 69/86 (80%), Gaps = 4/86 (5%)
 Frame = +1

Query  91   LIRQVVSD----GEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  258
            LIRQVV D     E+D LLNA+HHF  FK+K+ K+YAT+EEHD+R  VFK+NLRRA+ H 
Sbjct  54   LIRQVVPDVGEAEEEDNLLNAEHHFASFKAKFAKTYATKEEHDHRFGVFKSNLRRARLHA  113

Query  259  LLDPSAVHGVTKFSDLTPKEFRRTFL  336
             LDPSAVHGVTKFSDLTP EFRR FL
Sbjct  114  KLDPSAVHGVTKFSDLTPAEFRRQFL  139



>gb|KGN43159.1| Papain-like cysteine proteinase isoform I [Cucumis sativus]
Length=387

 Score =   127 bits (320),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 60/91 (66%), Positives = 74/91 (81%), Gaps = 2/91 (2%)
 Frame = +1

Query  70   VRADEDPLIRQVV-SDGE-DDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRR  243
            V  D DPLIRQVV +DG+ +   L A+HHF+LFK ++GKSYAT+EEHD R  +FKAN+RR
Sbjct  30   VEHDGDPLIRQVVENDGDFNHHALGAEHHFSLFKRRFGKSYATEEEHDRRFKIFKANMRR  89

Query  244  AKRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            A+RHQ  DPSA+HGVT+FSDLTP EFR+ FL
Sbjct  90   AERHQSFDPSAIHGVTQFSDLTPFEFRKAFL  120



>ref|XP_007042077.1| Papain family cysteine protease [Theobroma cacao]
 gb|EOX97908.1| Papain family cysteine protease [Theobroma cacao]
Length=395

 Score =   127 bits (320),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 73/87 (84%), Gaps = 4/87 (5%)
 Frame = +1

Query  85   DPLIRQVVSDGEDDA---LLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRH  255
            DPLIRQV +DG+D A   LL A+HHF+LFKS++ KSY +QEEHDYR  VF+ NLRRA RH
Sbjct  56   DPLIRQV-TDGQDGAEPQLLTAEHHFSLFKSRFKKSYGSQEEHDYRFKVFQDNLRRAARH  114

Query  256  QLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            Q LDPSA HGVT+FSDLTP+EFRRT+L
Sbjct  115  QKLDPSASHGVTQFSDLTPREFRRTYL  141



>gb|KHG24064.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=374

 Score =   127 bits (319),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 58/89 (65%), Positives = 73/89 (82%), Gaps = 5/89 (6%)
 Frame = +1

Query  67   VVRADEDPLIRQVVSDGEDDAL----LNADHHFTLFKSKYGKSYATQEEHDYRLSVFKAN  234
            VV ++ DPLIRQV +DG+DD +    L A+HHF+LFK+++ KSY ++EEHDYR  VF+AN
Sbjct  28   VVGSEVDPLIRQV-TDGQDDGVETQPLTAEHHFSLFKARFKKSYGSEEEHDYRFKVFRAN  86

Query  235  LRRAKRHQLLDPSAVHGVTKFSDLTPKEF  321
            LRRA+RHQ LDPSA HGVT+FSDLTP EF
Sbjct  87   LRRAERHQKLDPSATHGVTQFSDLTPGEF  115



>ref|XP_007160703.1| hypothetical protein PHAVU_001G009900g [Phaseolus vulgaris]
 gb|ESW32697.1| hypothetical protein PHAVU_001G009900g [Phaseolus vulgaris]
Length=292

 Score =   125 bits (315),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 73/86 (85%), Gaps = 1/86 (1%)
 Frame = +1

Query  82   EDPLIRQVVSDGE-DDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  258
            +D LIRQVV +GE +D LLNA+HHF+ FK+K+GK+YAT+EEHD+R  VFK+N+RRA+ H 
Sbjct  27   DDILIRQVVPEGEVEDHLLNAEHHFSTFKAKFGKTYATKEEHDHRFGVFKSNMRRARLHA  86

Query  259  LLDPSAVHGVTKFSDLTPKEFRRTFL  336
             LDPSAVHGVTKFSDLTP EF R FL
Sbjct  87   QLDPSAVHGVTKFSDLTPAEFHRKFL  112



>emb|CDY09707.1| BnaC07g33540D [Brassica napus]
Length=366

 Score =   127 bits (318),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 57/81 (70%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +1

Query  94   IRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLLDPS  273
            IRQVV +  D+ LLN DH FTLFKSKY K+Y  Q EHD+R  VFKAN+RRA+RHQ LDPS
Sbjct  30   IRQVVKEENDEQLLNLDHQFTLFKSKYEKTYKNQVEHDHRFRVFKANVRRARRHQQLDPS  89

Query  274  AVHGVTKFSDLTPKEFRRTFL  336
            AVHGVT+FSD+TPKEF R +L
Sbjct  90   AVHGVTQFSDVTPKEFSRKYL  110



>gb|ACI04578.1| cysteine protease-like protein [Robinia pseudoacacia]
Length=335

 Score =   126 bits (317),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 70/84 (83%), Gaps = 1/84 (1%)
 Frame = +1

Query  85   DPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLL  264
            D LIRQVV D ED  +LNA+HHF+ FKSK+ K+YAT+EEHDYR  VFK+N+RRAK H  L
Sbjct  1    DLLIRQVVDDNEDH-VLNAEHHFSTFKSKFSKTYATKEEHDYRFGVFKSNVRRAKLHAKL  59

Query  265  DPSAVHGVTKFSDLTPKEFRRTFL  336
            DPSAVHGVTKFSDLTP EFRR FL
Sbjct  60   DPSAVHGVTKFSDLTPSEFRRQFL  83



>ref|XP_004148554.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase RD19a-like 
[Cucumis sativus]
Length=381

 Score =   127 bits (319),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 60/91 (66%), Positives = 74/91 (81%), Gaps = 2/91 (2%)
 Frame = +1

Query  70   VRADEDPLIRQVV-SDGE-DDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRR  243
            V  D DPLIRQVV +DG+ +   L A+HHF+LFK ++GKSYAT+EEHD R  +FKAN+RR
Sbjct  30   VEHDGDPLIRQVVENDGDFNHHALGAEHHFSLFKRRFGKSYATEEEHDRRFKIFKANMRR  89

Query  244  AKRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            A+RHQ  DPSA+HGVT+FSDLTP EFR+ FL
Sbjct  90   AERHQSFDPSAIHGVTQFSDLTPFEFRKAFL  120



>ref|XP_002305451.2| cysteine proteinase A494 precursor [Populus trichocarpa]
 gb|EEE85962.2| cysteine proteinase A494 precursor [Populus trichocarpa]
Length=368

 Score =   126 bits (317),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 62/89 (70%), Positives = 74/89 (83%), Gaps = 5/89 (6%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDA---LLNAD-HHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAK  249
            +DPLIR+VV DG+D +   LL+A+ HHF+LFKSK+ KSY +QEEHDYR SVFKANLRRA 
Sbjct  27   DDPLIREVV-DGQDASSSNLLSAEQHHFSLFKSKFKKSYGSQEEHDYRFSVFKANLRRAA  85

Query  250  RHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            RHQ LDP+A HGVT+FSDLTP EFR+  L
Sbjct  86   RHQELDPTASHGVTQFSDLTPAEFRKQVL  114



>ref|XP_006487337.1| PREDICTED: cysteine proteinase RD19a-like [Citrus sinensis]
Length=373

 Score =   126 bits (317),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 57/95 (60%), Positives = 72/95 (76%), Gaps = 9/95 (9%)
 Frame = +1

Query  79   DEDPLIRQVVSDGED---------DALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKA  231
            D D +IRQV   G++         + LL A+HHF+LFK K+ K+YA+QEEHD+R ++FKA
Sbjct  27   DVDQMIRQVTDGGDEILSHHESTNNDLLGAEHHFSLFKKKFNKAYASQEEHDHRFTIFKA  86

Query  232  NLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            NLRRA RHQ LDPSA HG+T+FSDLTP EFRRT+L
Sbjct  87   NLRRAARHQKLDPSATHGITQFSDLTPAEFRRTYL  121



>gb|KJB32561.1| hypothetical protein B456_005G247000 [Gossypium raimondii]
Length=374

 Score =   126 bits (317),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 58/89 (65%), Positives = 72/89 (81%), Gaps = 5/89 (6%)
 Frame = +1

Query  67   VVRADEDPLIRQVVSDGEDDAL----LNADHHFTLFKSKYGKSYATQEEHDYRLSVFKAN  234
            VV ++ DPLIRQV +DG+DD +    L A+HHF+LFK+++ KSY ++EEHDYR  VF+AN
Sbjct  28   VVGSEVDPLIRQV-TDGQDDGVETQPLTAEHHFSLFKARFKKSYGSEEEHDYRFKVFRAN  86

Query  235  LRRAKRHQLLDPSAVHGVTKFSDLTPKEF  321
            LRRA RHQ LDPSA HGVT+FSDLTP EF
Sbjct  87   LRRAARHQKLDPSATHGVTQFSDLTPGEF  115



>ref|XP_007136047.1| hypothetical protein PHAVU_009G013600g [Phaseolus vulgaris]
 gb|ESW08041.1| hypothetical protein PHAVU_009G013600g [Phaseolus vulgaris]
Length=366

 Score =   126 bits (316),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 58/89 (65%), Positives = 72/89 (81%), Gaps = 1/89 (1%)
 Frame = +1

Query  70   VRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAK  249
            +  ++D LIRQVV D E+  LLNA++HF+ FK+++G++YAT+EEHDYR  +FK NL RAK
Sbjct  25   IDGEDDLLIRQVVPDAEEH-LLNAENHFSAFKTRFGRTYATKEEHDYRFRIFKNNLLRAK  83

Query  250  RHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
             HQ LDPSAVHGVTKFSDLTP EF R FL
Sbjct  84   SHQKLDPSAVHGVTKFSDLTPAEFSRQFL  112



>gb|AAB67878.1| pre-pro-cysteine proteinase [Vicia faba]
Length=363

 Score =   126 bits (316),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 59/85 (69%), Positives = 70/85 (82%), Gaps = 1/85 (1%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            +D +IRQVV D E+D LLNA+HHFT FKSK+ KSY+T+EEHDYR  VFK+NL +AK HQ 
Sbjct  26   DDFIIRQVV-DNEEDHLLNAEHHFTSFKSKFSKSYSTKEEHDYRFGVFKSNLIKAKLHQK  84

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            LDP+A HG+TKFSDLT  EFRR FL
Sbjct  85   LDPTAEHGITKFSDLTASEFRRQFL  109



>ref|XP_003606999.1| Cysteine proteinase [Medicago truncatula]
Length=210

 Score =   122 bits (307),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 71/85 (84%), Gaps = 2/85 (2%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            EDP+IRQVV   E+   L A+HHF LFK K+GK Y++++EHDYR  +FK+NL RAKRHQL
Sbjct  27   EDPIIRQVVD--EEGVRLGAEHHFNLFKHKFGKVYSSKDEHDYRFKIFKSNLNRAKRHQL  84

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            +DPSAVHGVT+FSDLTP+EFR++ L
Sbjct  85   MDPSAVHGVTRFSDLTPREFRKSVL  109



>gb|AAO11786.1| pre-pro cysteine proteinase [Vicia faba]
Length=363

 Score =   125 bits (315),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 59/85 (69%), Positives = 70/85 (82%), Gaps = 1/85 (1%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            +D +IRQVV D E+D LLNA+HHFT FKSK+ KSY+T+EEHDYR  VFK+NL +AK HQ 
Sbjct  26   DDFIIRQVV-DNEEDHLLNAEHHFTSFKSKFSKSYSTKEEHDYRFGVFKSNLIKAKLHQK  84

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            LDP+A HG+TKFSDLT  EFRR FL
Sbjct  85   LDPTAEHGITKFSDLTASEFRRQFL  109



>emb|CDX90537.1| BnaA03g42440D [Brassica napus]
Length=366

 Score =   125 bits (314),  Expect = 7e-32, Method: Composition-based stats.
 Identities = 56/81 (69%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +1

Query  94   IRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLLDPS  273
            I+QVV +  D+ LLN DH FTLFKSKY K+Y  Q EHD+R  VFKAN+RRA+RHQ LDPS
Sbjct  30   IKQVVREENDEQLLNLDHQFTLFKSKYEKTYKNQVEHDHRFRVFKANVRRARRHQQLDPS  89

Query  274  AVHGVTKFSDLTPKEFRRTFL  336
            AVHGVT+FSD+TPKEF R +L
Sbjct  90   AVHGVTQFSDVTPKEFSRKYL  110



>ref|XP_003523684.1| PREDICTED: cysteine proteinase 15A-like [Glycine max]
Length=366

 Score =   125 bits (314),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 70/87 (80%), Gaps = 1/87 (1%)
 Frame = +1

Query  79   DEDPL-IRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRH  255
            DED L IRQVV D ED  LLNA+HHF+ FK+K+ K+YATQEEHD+R  +FK NL RAK H
Sbjct  26   DEDNLLIRQVVPDAEDHHLLNAEHHFSAFKTKFAKTYATQEEHDHRFRIFKNNLLRAKSH  85

Query  256  QLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            Q LDPSAVHGVT+FSDLTP EFR  FL
Sbjct  86   QKLDPSAVHGVTRFSDLTPSEFRGQFL  112



>ref|XP_006828787.1| hypothetical protein AMTR_s00001p00114210 [Amborella trichopoda]
 gb|ERM96203.1| hypothetical protein AMTR_s00001p00114210 [Amborella trichopoda]
Length=365

 Score =   125 bits (314),  Expect = 9e-32, Method: Composition-based stats.
 Identities = 53/85 (62%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            EDP+IRQV SD   ++LL A+ HF+LFK K+GK Y+ + EH+YR SVFKAN+ RA+RHQ+
Sbjct  27   EDPIIRQVTSDDAGNSLLGAEGHFSLFKRKFGKEYSNEAEHNYRFSVFKANMARARRHQI  86

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            LDP+AVHGVT+FSDLT +EF+  +L
Sbjct  87   LDPTAVHGVTQFSDLTEEEFQERYL  111



>gb|AEQ94105.1| putative drought-inducible cysteine proteinase [Elaeis guineensis]
Length=187

 Score =   121 bits (303),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 73/87 (84%), Gaps = 1/87 (1%)
 Frame = +1

Query  76   ADEDPLIRQVVSDGEDDAL-LNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKR  252
            A++DPLI QVV + ++D L LNA+ HF+ F  ++GKSYA ++EH YR SVFKANLRRA+R
Sbjct  29   AEDDPLIVQVVPESDEDELRLNAEAHFSSFLRRFGKSYADEKEHAYRFSVFKANLRRARR  88

Query  253  HQLLDPSAVHGVTKFSDLTPKEFRRTF  333
            HQ +DP+AVHG+TKFSDLTP EFRRT+
Sbjct  89   HQKMDPTAVHGITKFSDLTPAEFRRTY  115



>ref|NP_001105685.1| cysteine proteinase 1 precursor [Zea mays]
 sp|Q10716.1|CYSP1_MAIZE RecName: Full=Cysteine proteinase 1; Flags: Precursor [Zea mays]
 dbj|BAA08244.1| cysteine proteinase [Zea mays]
Length=371

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 70/86 (81%), Gaps = 1/86 (1%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDAL-LNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  258
            EDPLIRQVV  G+D+ L LNA+ HF  F  ++GKSY   +EH YRLSVFK NLRRA+RHQ
Sbjct  24   EDPLIRQVVPGGDDNDLELNAESHFLSFVQRFGKSYKDADEHAYRLSVFKDNLRRARRHQ  83

Query  259  LLDPSAVHGVTKFSDLTPKEFRRTFL  336
            LLDPSA HGVTKFSDLTP EFRRT+L
Sbjct  84   LLDPSAEHGVTKFSDLTPAEFRRTYL  109



>ref|XP_003589348.1| Cysteine proteinase [Medicago truncatula]
 gb|AES59599.1| papain family cysteine protease [Medicago truncatula]
Length=364

 Score =   124 bits (312),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 59/85 (69%), Positives = 69/85 (81%), Gaps = 1/85 (1%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            +D LIRQVV D  +D +LNA+HHFT FKSK+ K+YAT+EEHDYR  VFK+NL +AK HQ 
Sbjct  29   DDLLIRQVV-DTAEDHILNAEHHFTSFKSKFSKNYATKEEHDYRFGVFKSNLIKAKLHQK  87

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            LDPSA HG+TKFSDLT  EFRR FL
Sbjct  88   LDPSAQHGITKFSDLTASEFRRQFL  112



>sp|P25804.1|CYSP_PEA RecName: Full=Cysteine proteinase 15A; AltName: Full=Turgor-responsive 
protein 15A; Flags: Precursor [Pisum sativum]
 emb|CAA38242.1| unnamed protein product [Pisum sativum]
Length=363

 Score =   124 bits (311),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 59/86 (69%), Positives = 70/86 (81%), Gaps = 1/86 (1%)
 Frame = +1

Query  79   DEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  258
            ++D +IRQVV D E+D LLNA+HHFT FKSK+ KSYAT+EEHDYR  VFK+NL +AK HQ
Sbjct  25   NDDFIIRQVV-DNEEDHLLNAEHHFTSFKSKFSKSYATKEEHDYRFGVFKSNLIKAKLHQ  83

Query  259  LLDPSAVHGVTKFSDLTPKEFRRTFL  336
              DP+A HG+TKFSDLT  EFRR FL
Sbjct  84   NRDPTAEHGITKFSDLTASEFRRQFL  109



>ref|XP_004152668.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 ref|XP_004167370.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 gb|KGN62647.1| Cysteine protease [Cucumis sativus]
Length=371

 Score =   124 bits (311),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 60/89 (67%), Positives = 67/89 (75%), Gaps = 1/89 (1%)
 Frame = +1

Query  70   VRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAK  249
            V  +ED LIRQVVS G DD  L A+ HF  FK K+GK+Y T EEHDYR  VFKANLR+AK
Sbjct  32   VSDEEDILIRQVVS-GADDRPLTAEQHFQDFKLKFGKTYTTDEEHDYRFRVFKANLRKAK  90

Query  250  RHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            RHQ LDP AVHGVT+FSDLT  EFR  F+
Sbjct  91   RHQKLDPDAVHGVTRFSDLTESEFRENFV  119



>ref|XP_010028631.1| PREDICTED: cysteine proteinase RD19a-like [Eucalyptus grandis]
 gb|KCW55393.1| hypothetical protein EUGRSUZ_I01305 [Eucalyptus grandis]
Length=370

 Score =   124 bits (310),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 59/88 (67%), Positives = 71/88 (81%), Gaps = 2/88 (2%)
 Frame = +1

Query  79   DEDPLIRQVVSDGEDDALLNA-DH-HFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKR  252
            D D LIRQVV     D  L+  DH HF+LFK+++GKSYA+QEEHD+R +VF+ANL RA+R
Sbjct  25   DGDALIRQVVDGAAADGDLSTEDHRHFSLFKTRFGKSYASQEEHDHRFAVFRANLHRARR  84

Query  253  HQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            HQ LDPSAVHGVT+FSDLTP EFRR+ L
Sbjct  85   HQELDPSAVHGVTRFSDLTPSEFRRSHL  112



>ref|XP_009406357.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=372

 Score =   123 bits (309),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 57/86 (66%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = +1

Query  79   DEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  258
            DEDPLI QVV   +D   LNA+ HFT F S++GK+YA +EE  +RL VFKANLRRA RHQ
Sbjct  33   DEDPLILQVVDLEKDGLTLNAEAHFTSFMSRFGKTYADEEERSHRLKVFKANLRRAARHQ  92

Query  259  LLDPSAVHGVTKFSDLTPKEFRRTFL  336
             LDP+AVHG+TKFSDLTP EFR  +L
Sbjct  93   RLDPTAVHGITKFSDLTPAEFRSAYL  118



>ref|XP_009136751.1| PREDICTED: cysteine proteinase RD19a-like [Brassica rapa]
Length=368

 Score =   123 bits (309),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 55/81 (68%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = +1

Query  94   IRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLLDPS  273
            I+QVV +  D+ LLN DH FT FKSKY K+Y  Q EHD+R  VFKAN+RRA+RHQ LDPS
Sbjct  32   IKQVVREENDEQLLNLDHQFTQFKSKYEKTYKNQVEHDHRFRVFKANVRRARRHQQLDPS  91

Query  274  AVHGVTKFSDLTPKEFRRTFL  336
            AVHGVT+FSD+TPKEF R +L
Sbjct  92   AVHGVTQFSDVTPKEFSRKYL  112



>ref|XP_007131787.1| hypothetical protein PHAVU_011G041600g [Phaseolus vulgaris]
 gb|ESW03781.1| hypothetical protein PHAVU_011G041600g [Phaseolus vulgaris]
Length=361

 Score =   123 bits (309),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 58/85 (68%), Positives = 66/85 (78%), Gaps = 4/85 (5%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            ED +IRQVV    D   L A+ HF  FKS++GK+YAT EEHDYR +VFKANLRRA+RHQ 
Sbjct  27   EDSMIRQVV----DGVRLGAEEHFLEFKSRFGKAYATPEEHDYRFTVFKANLRRARRHQS  82

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            LDPSAVHGVT+FSDLTP EFR   L
Sbjct  83   LDPSAVHGVTRFSDLTPSEFRNKVL  107



>gb|KHG15253.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=373

 Score =   123 bits (309),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 54/86 (63%), Positives = 65/86 (76%), Gaps = 2/86 (2%)
 Frame = +1

Query  85   DPLIRQVVS--DGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  258
            DPLI QV    +G +  LL A HHF+LFK ++ KSY +QEEHDYR  +F+ NLRRA RHQ
Sbjct  34   DPLIEQVTDGHEGAEPQLLTAKHHFSLFKKRFKKSYGSQEEHDYRFKIFQVNLRRAARHQ  93

Query  259  LLDPSAVHGVTKFSDLTPKEFRRTFL  336
             LDPSA HGVT+FSDLTP EFR+ +L
Sbjct  94   KLDPSATHGVTQFSDLTPGEFRKAYL  119



>ref|XP_011037175.1| PREDICTED: cysteine proteinase RD19a-like [Populus euphratica]
 ref|XP_011037176.1| PREDICTED: cysteine proteinase RD19a-like [Populus euphratica]
Length=368

 Score =   123 bits (308),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 78/98 (80%), Gaps = 9/98 (9%)
 Frame = +1

Query  67   VVRAD----EDPLIRQVVSDGEDDA---LLNAD-HHFTLFKSKYGKSYATQEEHDYRLSV  222
             V+AD    +DPLIR+VV DG+D +   LL+A+ HHF+LFKSK+ KSY +QEEHDYR SV
Sbjct  18   AVQADALNGDDPLIREVV-DGQDASSSNLLSAEQHHFSLFKSKFKKSYGSQEEHDYRFSV  76

Query  223  FKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            FKANLRRA RHQ LDP+A HGVT+FSDLTP EFR+  L
Sbjct  77   FKANLRRAARHQALDPTASHGVTQFSDLTPAEFRKQVL  114



>gb|AEQ94152.1| drought-inducible cysteine proteinase [Elaeis guineensis]
Length=252

 Score =   120 bits (302),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 73/87 (84%), Gaps = 1/87 (1%)
 Frame = +1

Query  76   ADEDPLIRQVVSDGEDDAL-LNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKR  252
            A++DPLI QVV + ++D L LNA+ HF+ F  ++GKSYA ++EH YR SVFKANLRRA+R
Sbjct  29   AEDDPLIVQVVPESDEDELRLNAEAHFSSFLRRFGKSYADEKEHAYRFSVFKANLRRARR  88

Query  253  HQLLDPSAVHGVTKFSDLTPKEFRRTF  333
            HQ +DP+AVHG+TKFSDLTP EFRRT+
Sbjct  89   HQKMDPTAVHGITKFSDLTPAEFRRTY  115



>ref|XP_006423403.1| hypothetical protein CICLE_v10028670mg [Citrus clementina]
 gb|ESR36643.1| hypothetical protein CICLE_v10028670mg [Citrus clementina]
Length=375

 Score =   122 bits (307),  Expect = 8e-31, Method: Composition-based stats.
 Identities = 58/95 (61%), Positives = 70/95 (74%), Gaps = 9/95 (9%)
 Frame = +1

Query  79   DEDPLIRQVVSDGED---------DALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKA  231
            D D LIRQV   G++         + LL A+HHF+LFK K+ K+YA+QEEHD R ++FKA
Sbjct  27   DVDQLIRQVTDGGDEILSHHESTNNDLLGAEHHFSLFKKKFNKAYASQEEHDRRFTIFKA  86

Query  232  NLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            NLRRA R Q LDPSA HGVT+FSDLTP EFRRT+L
Sbjct  87   NLRRAARRQKLDPSATHGVTQFSDLTPAEFRRTYL  121



>ref|XP_003574963.1| PREDICTED: cysteine proteinase 1-like [Brachypodium distachyon]
Length=377

 Score =   122 bits (307),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 68/88 (77%), Gaps = 1/88 (1%)
 Frame = +1

Query  76   ADEDPLIRQVVSDGE-DDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKR  252
             DEDPLIRQVV   + DD  L    HFT F  ++GK+Y   EEH +RLSVFKANLRRA+R
Sbjct  27   GDEDPLIRQVVGGADGDDNDLELSSHFTSFVQRFGKTYKDAEEHAHRLSVFKANLRRARR  86

Query  253  HQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            HQLLDPSA HG+TKFSDLTP EFRRTFL
Sbjct  87   HQLLDPSAEHGITKFSDLTPAEFRRTFL  114



>gb|KFK30492.1| hypothetical protein AALP_AA7G268600 [Arabis alpina]
Length=367

 Score =   122 bits (306),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 56/82 (68%), Positives = 67/82 (82%), Gaps = 1/82 (1%)
 Frame = +1

Query  91   LIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLLDP  270
            +IRQVV DG +  +L ++ HF+LFK K+GK Y + EEHDYRLSVFKANLRRAKRHQ LDP
Sbjct  31   VIRQVV-DGSEPKILTSEDHFSLFKKKFGKVYVSNEEHDYRLSVFKANLRRAKRHQKLDP  89

Query  271  SAVHGVTKFSDLTPKEFRRTFL  336
            SA+HGVT+FSDLT  EFR+  L
Sbjct  90   SAIHGVTQFSDLTRSEFRKMHL  111



>ref|XP_002279862.1| PREDICTED: cysteine proteinase RD19a [Vitis vinifera]
 emb|CBI19784.3| unnamed protein product [Vitis vinifera]
Length=368

 Score =   122 bits (306),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 58/82 (71%), Positives = 68/82 (83%), Gaps = 2/82 (2%)
 Frame = +1

Query  91   LIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLLDP  270
            +IRQV S  +D   LNA+ HF  FK+++ K+YAT EEHDYR +VFKANLRRAKRHQLLDP
Sbjct  34   MIRQVESHVDD--FLNAERHFEKFKARFQKTYATPEEHDYRFNVFKANLRRAKRHQLLDP  91

Query  271  SAVHGVTKFSDLTPKEFRRTFL  336
            SAVHGVT+FSDLTP EFRR +L
Sbjct  92   SAVHGVTQFSDLTPAEFRRDYL  113



>gb|KJB79047.1| hypothetical protein B456_013G033800 [Gossypium raimondii]
Length=373

 Score =   121 bits (304),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 53/86 (62%), Positives = 66/86 (77%), Gaps = 2/86 (2%)
 Frame = +1

Query  85   DPLIRQVVS--DGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  258
            DPLI QV    +G +  LL A+HHF+LFK ++ KSY +Q+EHDYR  +F+ NLRRA RHQ
Sbjct  34   DPLIEQVTDGHEGAEPQLLTAEHHFSLFKKRFKKSYGSQKEHDYRFKIFQVNLRRAARHQ  93

Query  259  LLDPSAVHGVTKFSDLTPKEFRRTFL  336
             LDPSA HGVT+FSDLTP EFR+ +L
Sbjct  94   NLDPSATHGVTQFSDLTPGEFRKAYL  119



>ref|XP_008444769.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=373

 Score =   121 bits (304),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 59/85 (69%), Positives = 65/85 (76%), Gaps = 1/85 (1%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            ED LIRQVVS G DD LL A+  F  FK K+GK+YAT EEHDYR  VFK NLR+AKRHQ 
Sbjct  36   EDLLIRQVVS-GADDRLLTAEQRFQNFKLKFGKTYATAEEHDYRFRVFKDNLRKAKRHQK  94

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            LDP AVHGVT+FSDLT  EFR  F+
Sbjct  95   LDPDAVHGVTRFSDLTESEFRENFV  119



>ref|XP_010910124.1| PREDICTED: cysteine proteinase 1-like [Elaeis guineensis]
Length=374

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 73/87 (84%), Gaps = 1/87 (1%)
 Frame = +1

Query  76   ADEDPLIRQVVSDGEDDAL-LNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKR  252
            A++DPLI QVV + ++D L LNA+ HF+ F  ++GKSYA ++EH YR SVFKANLRRA+R
Sbjct  31   AEDDPLIVQVVPESDEDELRLNAEAHFSSFLRRFGKSYADEKEHAYRFSVFKANLRRARR  90

Query  253  HQLLDPSAVHGVTKFSDLTPKEFRRTF  333
            HQ +DP+AVHG+TKFSDLTP EFRRT+
Sbjct  91   HQKMDPTAVHGITKFSDLTPAEFRRTY  117



>ref|XP_006411706.1| hypothetical protein EUTSA_v10025494mg [Eutrema salsugineum]
 dbj|BAJ33785.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ53159.1| hypothetical protein EUTSA_v10025494mg [Eutrema salsugineum]
Length=373

 Score =   121 bits (304),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 57/85 (67%), Positives = 70/85 (82%), Gaps = 1/85 (1%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            +D +IRQVV DG +  +L+++ HF+LFK K+GK YA+ EEHDYRLSVFKANLRRA+RHQ 
Sbjct  34   DDLVIRQVV-DGAEPKVLSSEDHFSLFKRKFGKVYASSEEHDYRLSVFKANLRRARRHQK  92

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            LDPSA HGVT+FSDLT  EFR+  L
Sbjct  93   LDPSARHGVTQFSDLTRSEFRKKHL  117



>emb|CDY71205.1| BnaCnng71840D [Brassica napus]
Length=368

 Score =   121 bits (303),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 54/85 (64%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            +D +I+QVV  G D  +L+++ HF+LFK K+GK YA++EEHDYR SVFK+NLRRA+RHQ 
Sbjct  28   DDLVIKQVVDGGADPNVLSSEDHFSLFKKKFGKVYASREEHDYRFSVFKSNLRRARRHQK  87

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            LDPSA HGVT+FSDLT  EF+R  L
Sbjct  88   LDPSARHGVTQFSDLTRSEFKRKHL  112



>dbj|BAF98585.1| CM0216.510.nc [Lotus japonicus]
Length=360

 Score =   121 bits (303),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 56/84 (67%), Positives = 67/84 (80%), Gaps = 4/84 (5%)
 Frame = +1

Query  85   DPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLL  264
            DPLIRQVV DGE    L A+HHF  FK ++GK Y ++EEH YR +VFK+N+ RA+RHQLL
Sbjct  27   DPLIRQVV-DGEG---LGAEHHFLEFKRRFGKVYVSEEEHGYRFNVFKSNMHRARRHQLL  82

Query  265  DPSAVHGVTKFSDLTPKEFRRTFL  336
            DPSAVHGVT+FSDLTP EFR + L
Sbjct  83   DPSAVHGVTRFSDLTPMEFRHSVL  106



>gb|AFK47617.1| unknown [Medicago truncatula]
Length=241

 Score =   119 bits (297),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 69/85 (81%), Gaps = 1/85 (1%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            +D LIRQVV D  +D +LNA+HHFT FKSK+ K+YAT+EEHDYR  VFK+NL +AK HQ 
Sbjct  29   DDLLIRQVV-DTAEDHILNAEHHFTSFKSKFSKNYATKEEHDYRFGVFKSNLIKAKLHQK  87

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            LDPSA HG+TKFSDLT  EFRR FL
Sbjct  88   LDPSAQHGITKFSDLTASEFRRQFL  112



>gb|ABQ10201.1| cysteine protease Cp3 [Actinidia deliciosa]
Length=365

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 69/85 (81%), Gaps = 3/85 (4%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            ED +I+Q+V   + D  L+ADHHF LFK ++GKSYATQE+HDYR SVFK NLRRA+ HQ 
Sbjct  30   EDLVIQQIV---DGDHPLSADHHFRLFKRRFGKSYATQEDHDYRFSVFKTNLRRARHHQR  86

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            LDPSAVHGVT+FSDLTP EFRR  L
Sbjct  87   LDPSAVHGVTQFSDLTPAEFRRNHL  111



>gb|EMT16425.1| Cysteine proteinase 1 [Aegilops tauschii]
Length=379

 Score =   120 bits (302),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 57/86 (66%), Positives = 67/86 (78%), Gaps = 1/86 (1%)
 Frame = +1

Query  82   EDPLIRQVVS-DGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  258
            EDPLI QVV  D E++  LNA+ HF  F  ++GKSY   +EH +RLSVF+ANLRRA+RHQ
Sbjct  31   EDPLIEQVVGGDAENELELNAEAHFATFVRRFGKSYRDADEHAHRLSVFRANLRRARRHQ  90

Query  259  LLDPSAVHGVTKFSDLTPKEFRRTFL  336
             LDPSAVHG+TKFSDLTP EFR  FL
Sbjct  91   RLDPSAVHGITKFSDLTPDEFRERFL  116



>dbj|BAF98584.1| CM0216.500.nc [Lotus japonicus]
Length=360

 Score =   120 bits (301),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 55/84 (65%), Positives = 66/84 (79%), Gaps = 4/84 (5%)
 Frame = +1

Query  85   DPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLL  264
            DP+I QVV    DD  L A+HHF  FK ++GK YAT+EEH YR +VFK+N+ RA+RHQLL
Sbjct  27   DPMICQVV----DDEGLGAEHHFLEFKRRFGKVYATEEEHGYRFNVFKSNMHRARRHQLL  82

Query  265  DPSAVHGVTKFSDLTPKEFRRTFL  336
            DPSAVHGVT+FSDLTP EFR + L
Sbjct  83   DPSAVHGVTRFSDLTPMEFRHSVL  106



>emb|CAE45589.1| papain-like cysteine proteinase-like protein 2 [Lotus japonicus]
Length=361

 Score =   120 bits (301),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 55/84 (65%), Positives = 66/84 (79%), Gaps = 4/84 (5%)
 Frame = +1

Query  85   DPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLL  264
            DP+I QVV    DD  L A+HHF  FK ++GK YAT+EEH YR +VFK+N+ RA+RHQLL
Sbjct  27   DPMICQVV----DDEGLGAEHHFLEFKRRFGKVYATEEEHGYRFNVFKSNMHRARRHQLL  82

Query  265  DPSAVHGVTKFSDLTPKEFRRTFL  336
            DPSAVHGVT+FSDLTP EFR + L
Sbjct  83   DPSAVHGVTRFSDLTPMEFRHSVL  106



>gb|KHN25410.1| Cysteine proteinase RD19a [Glycine soja]
Length=365

 Score =   120 bits (302),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 54/87 (62%), Positives = 66/87 (76%), Gaps = 2/87 (2%)
 Frame = +1

Query  76   ADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRH  255
             +E+PLI QVV  G  D  L A+HHF  FK ++GK+Y +++EHDYR  VFKAN+RRA+RH
Sbjct  27   GNEEPLIMQVVDGG--DVRLGAEHHFLEFKRRFGKAYDSEDEHDYRYKVFKANMRRARRH  84

Query  256  QLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            Q LDPSA HGVT+FSDLTP EFR   L
Sbjct  85   QSLDPSAAHGVTRFSDLTPSEFRNKVL  111



>ref|XP_003540987.1| PREDICTED: cysteine proteinase RD19a-like [Glycine max]
Length=365

 Score =   120 bits (302),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 54/87 (62%), Positives = 66/87 (76%), Gaps = 2/87 (2%)
 Frame = +1

Query  76   ADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRH  255
             +E+PLI QVV  G  D  L A+HHF  FK ++GK+Y +++EHDYR  VFKAN+RRA+RH
Sbjct  27   GNEEPLIMQVVDGG--DVRLGAEHHFLEFKRRFGKAYDSEDEHDYRYKVFKANMRRARRH  84

Query  256  QLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            Q LDPSA HGVT+FSDLTP EFR   L
Sbjct  85   QSLDPSAAHGVTRFSDLTPSEFRNKVL  111



>ref|XP_002512963.1| cysteine protease, putative [Ricinus communis]
 gb|EEF49466.1| cysteine protease, putative [Ricinus communis]
Length=373

 Score =   120 bits (301),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 60/90 (67%), Positives = 74/90 (82%), Gaps = 6/90 (7%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDA-----LLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRA  246
            EDPLIRQV +DG+D++     LL A+HHF+LFK K+ K+YA+QEEHDYR  +FK+NLRRA
Sbjct  31   EDPLIRQV-TDGQDESSANPNLLGAEHHFSLFKKKFKKTYASQEEHDYRFKIFKSNLRRA  89

Query  247  KRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            +RHQ LDP+A HGVT+FSDLT  EFRR FL
Sbjct  90   ERHQKLDPTATHGVTQFSDLTHSEFRRQFL  119



>emb|CAE54306.1| putative papain-like cysteine proteinase [Gossypium hirsutum]
Length=373

 Score =   120 bits (301),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 52/86 (60%), Positives = 66/86 (77%), Gaps = 2/86 (2%)
 Frame = +1

Query  85   DPLIRQVVS--DGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  258
            DPLI QV    +G +  LL A+HH++LFK ++ KSY +Q+EHDYR  +F+ NLRRA RHQ
Sbjct  34   DPLIEQVTDGHEGAEPQLLTAEHHYSLFKKRFKKSYGSQKEHDYRFKIFQVNLRRAARHQ  93

Query  259  LLDPSAVHGVTKFSDLTPKEFRRTFL  336
             LDPSA HGVT+FSDLTP EFR+ +L
Sbjct  94   NLDPSATHGVTQFSDLTPGEFRKAYL  119



>emb|CDY41960.1| BnaA01g05320D [Brassica napus]
Length=367

 Score =   119 bits (299),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 54/85 (64%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            +D +IRQVV    +  +L+++ HF+LFKSK+GK YA+ EEHDYR SVFKANLRRA+RHQ 
Sbjct  27   DDAVIRQVVDGAAEPNVLSSEDHFSLFKSKFGKVYASGEEHDYRFSVFKANLRRARRHQK  86

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            +DPSA HGVT+FSDLT  EFR   L
Sbjct  87   MDPSARHGVTQFSDLTRSEFREKHL  111



>gb|AAL60581.1|AF454959_1 senescence-associated cysteine protease [Brassica oleracea]
Length=368

 Score =   119 bits (299),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 53/85 (62%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            +D +I+QVV  G +  +L+++ HF+LFK K+GK YA++EEHDYR SVFK+NLRRA+RHQ 
Sbjct  28   DDLVIKQVVDGGAEPNVLSSEDHFSLFKKKFGKVYASREEHDYRFSVFKSNLRRARRHQK  87

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            LDPSA HGVT+FSDLT  EF+R  L
Sbjct  88   LDPSARHGVTQFSDLTRSEFKRKHL  112



>ref|XP_002868883.1| hypothetical protein ARALYDRAFT_490677 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45142.1| hypothetical protein ARALYDRAFT_490677 [Arabidopsis lyrata subsp. 
lyrata]
Length=368

 Score =   119 bits (299),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 57/89 (64%), Positives = 69/89 (78%), Gaps = 1/89 (1%)
 Frame = +1

Query  70   VRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAK  249
            V   +D +IRQVV  G +  +L ++ HF+LFKSK+GK YA+ EEHDYR SVFKANLRRA+
Sbjct  25   VNDGDDLVIRQVVG-GAEPQVLTSEDHFSLFKSKFGKVYASNEEHDYRFSVFKANLRRAR  83

Query  250  RHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            RHQ LDPSA HGVT+FSDLT  EFR+  L
Sbjct  84   RHQKLDPSARHGVTQFSDLTRSEFRKKHL  112



>ref|XP_004975256.1| PREDICTED: cysteine proteinase 1-like [Setaria italica]
Length=388

 Score =   119 bits (298),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 60/91 (66%), Positives = 68/91 (75%), Gaps = 4/91 (4%)
 Frame = +1

Query  76   ADEDPLIRQVVSDGE-DDAL---LNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRR  243
            A EDPLI QVV DG  DD L   LNA+ HF  F  ++GKSY    E  +R+SVFKANLRR
Sbjct  36   AAEDPLIEQVVGDGAADDELEMELNAEAHFASFVRRFGKSYRDDGERAHRMSVFKANLRR  95

Query  244  AKRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            A+RHQ LDP+AVHGVT+FSDLTP EFRR FL
Sbjct  96   ARRHQRLDPTAVHGVTQFSDLTPDEFRRQFL  126



>ref|XP_009373025.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=371

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 71/92 (77%), Gaps = 9/92 (10%)
 Frame = +1

Query  85   DPLIRQVVSDGEDDAL--------LNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLR  240
            DPLIRQVV +G D++         L A+HHF+LFK K+GKSYA++EEHDYR  VFKANLR
Sbjct  25   DPLIRQVV-EGRDESHHHHDHDHALGAEHHFSLFKHKFGKSYASKEEHDYRFDVFKANLR  83

Query  241  RAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            RA RHQ LDPSA HGVT+FSD+ P EFR++ L
Sbjct  84   RAARHQRLDPSAQHGVTRFSDMPPAEFRKSQL  115



>tpe|CAD66657.1| TPA: putative cysteine proteinase precursor [Hordeum vulgare 
subsp. vulgare]
 dbj|BAJ94057.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93100.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=377

 Score =   119 bits (297),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 58/88 (66%), Positives = 66/88 (75%), Gaps = 1/88 (1%)
 Frame = +1

Query  76   ADEDPLIRQVVSDGED-DALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKR  252
             DE+PLIRQVV   +  D  L  D  F  F  ++GK+Y   EEH +RLSVFKANLRRA+R
Sbjct  27   GDEEPLIRQVVGGADPLDNDLELDSQFVGFVQRFGKTYRDAEEHAHRLSVFKANLRRARR  86

Query  253  HQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            HQLLDPSA HGVTKFSDLTP EFRRT+L
Sbjct  87   HQLLDPSAEHGVTKFSDLTPAEFRRTYL  114



>ref|XP_002880378.1| hypothetical protein ARALYDRAFT_481008 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56637.1| hypothetical protein ARALYDRAFT_481008 [Arabidopsis lyrata subsp. 
lyrata]
Length=360

 Score =   118 bits (296),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 57/87 (66%), Positives = 66/87 (76%), Gaps = 1/87 (1%)
 Frame = +1

Query  76   ADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRH  255
             DED LIRQVV + E   +L+++ HFTLFK K+GK Y + EEH YR SVFKANLRRA RH
Sbjct  23   GDEDLLIRQVVDEAEPK-VLSSEDHFTLFKKKFGKDYGSIEEHYYRFSVFKANLRRAMRH  81

Query  256  QLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            Q +DPSA HGVT+FSDLT  EFRR  L
Sbjct  82   QKMDPSARHGVTQFSDLTGSEFRRKHL  108



>dbj|BAC41322.1| hypothetical protein [Lotus japonicus]
Length=358

 Score =   118 bits (296),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 54/84 (64%), Positives = 66/84 (79%), Gaps = 4/84 (5%)
 Frame = +1

Query  85   DPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLL  264
            DP+I QVV    DD  L A+HHF  FK ++GK YAT+EEH YR +VFK+N+ RA+RHQLL
Sbjct  27   DPMICQVV----DDEGLGAEHHFLEFKRRFGKVYATEEEHGYRFNVFKSNMHRARRHQLL  82

Query  265  DPSAVHGVTKFSDLTPKEFRRTFL  336
            DPSAVHGVT+FSDLTP EF+ + L
Sbjct  83   DPSAVHGVTQFSDLTPMEFQHSVL  106



>emb|CAE45588.1| papain-like cysteine proteinase-like protein 1 [Lotus japonicus]
Length=359

 Score =   118 bits (296),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 54/84 (64%), Positives = 66/84 (79%), Gaps = 4/84 (5%)
 Frame = +1

Query  85   DPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLL  264
            DP+I QVV    DD  L A+HHF  FK ++GK YAT+EEH YR +VFK+N+ RA+RHQLL
Sbjct  27   DPMICQVV----DDEGLGAEHHFLEFKRRFGKVYATEEEHGYRFNVFKSNMHRARRHQLL  82

Query  265  DPSAVHGVTKFSDLTPKEFRRTFL  336
            DPSAVHGVT+FSDLTP EF+ + L
Sbjct  83   DPSAVHGVTQFSDLTPMEFQHSVL  106



>gb|KJB79049.1| hypothetical protein B456_013G033800 [Gossypium raimondii]
 gb|KJB79051.1| hypothetical protein B456_013G033800 [Gossypium raimondii]
Length=211

 Score =   115 bits (288),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 66/86 (77%), Gaps = 2/86 (2%)
 Frame = +1

Query  85   DPLIRQVVS--DGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  258
            DPLI QV    +G +  LL A+HHF+LFK ++ KSY +Q+EHDYR  +F+ NLRRA RHQ
Sbjct  34   DPLIEQVTDGHEGAEPQLLTAEHHFSLFKKRFKKSYGSQKEHDYRFKIFQVNLRRAARHQ  93

Query  259  LLDPSAVHGVTKFSDLTPKEFRRTFL  336
             LDPSA HGVT+FSDLTP EFR+ +L
Sbjct  94   NLDPSATHGVTQFSDLTPGEFRKAYL  119



>ref|XP_010437007.1| PREDICTED: cysteine proteinase RD19a-like [Camelina sativa]
Length=368

 Score =   118 bits (295),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 56/85 (66%), Positives = 69/85 (81%), Gaps = 3/85 (4%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            +D LIRQVV + +   +L+++ HF+LFK K+GK YA+ EEHDYRLSVFKANLRRA+RHQ 
Sbjct  31   DDLLIRQVVDEAK---VLSSEDHFSLFKKKFGKVYASNEEHDYRLSVFKANLRRARRHQK  87

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            LDPSA HGVT+FSDLT  EFR+  L
Sbjct  88   LDPSARHGVTQFSDLTRAEFRKKHL  112



>ref|NP_568052.1| cysteine proteinase RD19a [Arabidopsis thaliana]
 sp|P43296.1|RD19A_ARATH RecName: Full=Cysteine proteinase RD19a; Short=RD19; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAA02373.1| thiol protease [Arabidopsis thaliana]
 emb|CAB38829.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 emb|CAB80572.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 gb|AAL85009.1| putative cysteine proteinase RD19A [Arabidopsis thaliana]
 gb|AAM91778.1| putative cysteine proteinase RD19A [Arabidopsis thaliana]
 dbj|BAE98545.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 gb|AEE87016.1| cysteine proteinase RD19a [Arabidopsis thaliana]
Length=368

 Score =   118 bits (295),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 56/89 (63%), Positives = 68/89 (76%), Gaps = 1/89 (1%)
 Frame = +1

Query  70   VRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAK  249
            V   +D +IRQVV  G +  +L ++ HF+LFK K+GK YA+ EEHDYR SVFKANLRRA+
Sbjct  25   VNDGDDLVIRQVVG-GAEPQVLTSEDHFSLFKRKFGKVYASNEEHDYRFSVFKANLRRAR  83

Query  250  RHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            RHQ LDPSA HGVT+FSDLT  EFR+  L
Sbjct  84   RHQKLDPSATHGVTQFSDLTRSEFRKKHL  112



>gb|ABK92536.1| unknown [Populus trichocarpa]
Length=368

 Score =   117 bits (294),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 58/89 (65%), Positives = 71/89 (80%), Gaps = 5/89 (6%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDA---LLNAD-HHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAK  249
            +D LIRQVV +G+D++   LL A+ HHF+LFK K+ KSY +QEEHDYR SVFK+NLRRA 
Sbjct  27   DDSLIRQVV-EGQDESSSNLLTAEQHHFSLFKRKFKKSYLSQEEHDYRFSVFKSNLRRAA  85

Query  250  RHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            RHQ LDP+A HGVT+FSDLT  EFR+  L
Sbjct  86   RHQKLDPTASHGVTQFSDLTSAEFRKQVL  114



>ref|XP_002313770.1| cysteine proteinase A494 precursor [Populus trichocarpa]
 gb|EEE87725.1| cysteine proteinase A494 precursor [Populus trichocarpa]
Length=368

 Score =   117 bits (294),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 58/89 (65%), Positives = 71/89 (80%), Gaps = 5/89 (6%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDA---LLNAD-HHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAK  249
            +D LIRQVV +G+D++   LL A+ HHF+LFK K+ KSY +QEEHDYR SVFK+NLRRA 
Sbjct  27   DDSLIRQVV-EGQDESSSNLLTAEQHHFSLFKRKFKKSYLSQEEHDYRFSVFKSNLRRAA  85

Query  250  RHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            RHQ LDP+A HGVT+FSDLT  EFR+  L
Sbjct  86   RHQKLDPTASHGVTQFSDLTSAEFRKQVL  114



>gb|AAM65162.1| cysteine proteinase RD19A [Arabidopsis thaliana]
Length=368

 Score =   117 bits (294),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 56/89 (63%), Positives = 68/89 (76%), Gaps = 1/89 (1%)
 Frame = +1

Query  70   VRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAK  249
            V   +D +IRQVV  G +  +L ++ HF+LFK K+GK YA+ EEHDYR SVFKANLRRA+
Sbjct  25   VNDGDDLVIRQVVG-GAEPQVLTSEDHFSLFKRKFGKVYASNEEHDYRFSVFKANLRRAR  83

Query  250  RHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            RHQ LDPSA HGVT+FSDLT  EFR+  L
Sbjct  84   RHQKLDPSATHGVTQFSDLTRSEFRKKHL  112



>gb|KJB79048.1| hypothetical protein B456_013G033800 [Gossypium raimondii]
Length=263

 Score =   116 bits (290),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 66/86 (77%), Gaps = 2/86 (2%)
 Frame = +1

Query  85   DPLIRQVVS--DGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  258
            DPLI QV    +G +  LL A+HHF+LFK ++ KSY +Q+EHDYR  +F+ NLRRA RHQ
Sbjct  34   DPLIEQVTDGHEGAEPQLLTAEHHFSLFKKRFKKSYGSQKEHDYRFKIFQVNLRRAARHQ  93

Query  259  LLDPSAVHGVTKFSDLTPKEFRRTFL  336
             LDPSA HGVT+FSDLTP EFR+ +L
Sbjct  94   NLDPSATHGVTQFSDLTPGEFRKAYL  119



>ref|XP_009109502.1| PREDICTED: cysteine proteinase RD19a-like [Brassica rapa]
 emb|CDX90310.1| BnaA08g16740D [Brassica napus]
Length=369

 Score =   117 bits (293),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 52/85 (61%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            +D +I+QVV  G +  +L+++ HF+LFK K+GK YA+ EEHDYR SVFK NLRRA+RHQ 
Sbjct  29   DDLVIKQVVDGGAEPNVLSSEDHFSLFKKKFGKVYASSEEHDYRFSVFKTNLRRARRHQK  88

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            LDPSA HGVT+FSDLT  EF++  L
Sbjct  89   LDPSARHGVTQFSDLTRSEFKKKHL  113



>gb|KJB79050.1| hypothetical protein B456_013G033800 [Gossypium raimondii]
Length=285

 Score =   116 bits (290),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 66/86 (77%), Gaps = 2/86 (2%)
 Frame = +1

Query  85   DPLIRQVVS--DGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  258
            DPLI QV    +G +  LL A+HHF+LFK ++ KSY +Q+EHDYR  +F+ NLRRA RHQ
Sbjct  34   DPLIEQVTDGHEGAEPQLLTAEHHFSLFKKRFKKSYGSQKEHDYRFKIFQVNLRRAARHQ  93

Query  259  LLDPSAVHGVTKFSDLTPKEFRRTFL  336
             LDPSA HGVT+FSDLTP EFR+ +L
Sbjct  94   NLDPSATHGVTQFSDLTPGEFRKAYL  119



>ref|XP_009150026.1| PREDICTED: cysteine proteinase RD19a [Brassica rapa]
Length=367

 Score =   117 bits (293),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 53/85 (62%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            +D +IRQVV    +  +L ++ HF+LFK K+GK YA+ EEHDYR SVFKANLRRA+RHQ 
Sbjct  27   DDAVIRQVVDGAAEPNVLTSEDHFSLFKRKFGKVYASGEEHDYRFSVFKANLRRARRHQK  86

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            +DPSA HGVT+FSDLT  EFR   L
Sbjct  87   MDPSARHGVTQFSDLTRSEFREKHL  111



>ref|XP_010446443.1| PREDICTED: cysteine proteinase RD19a [Camelina sativa]
Length=367

 Score =   117 bits (292),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 55/85 (65%), Positives = 69/85 (81%), Gaps = 3/85 (4%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            +D LIRQVV + +   +L+++ HF+LFK K+GK YA+ EEHDYRLSVFKANLRRA+RHQ 
Sbjct  30   DDLLIRQVVDEAK---VLSSEDHFSLFKKKFGKVYASNEEHDYRLSVFKANLRRARRHQK  86

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            LDPSA HGVT+FSDLT  EF++  L
Sbjct  87   LDPSARHGVTQFSDLTRAEFKKKHL  111



>ref|XP_006283963.1| hypothetical protein CARUB_v10005086mg [Capsella rubella]
 gb|EOA16861.1| hypothetical protein CARUB_v10005086mg [Capsella rubella]
Length=368

 Score =   117 bits (292),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 56/89 (63%), Positives = 68/89 (76%), Gaps = 1/89 (1%)
 Frame = +1

Query  70   VRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAK  249
            V   +D +IRQVV   + + L +ADH F+LFK K+GK YA+ EEHDYR SVFKANLR+A+
Sbjct  25   VNDGDDLVIRQVVGGADSEVLSSADH-FSLFKKKFGKVYASNEEHDYRFSVFKANLRQAR  83

Query  250  RHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            RHQ LDPSA HGVT+FSDLT  EFR+  L
Sbjct  84   RHQKLDPSARHGVTQFSDLTRSEFRKKHL  112



>ref|XP_010431862.1| PREDICTED: cysteine proteinase RD19a [Camelina sativa]
Length=367

 Score =   117 bits (292),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 55/85 (65%), Positives = 69/85 (81%), Gaps = 3/85 (4%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            +D +IRQVV + +   +L+++ HF+LFK K+GK YA+ EEHDYRLSVFKANLRRA+RHQ 
Sbjct  30   DDLVIRQVVDEAK---VLSSEDHFSLFKKKFGKVYASNEEHDYRLSVFKANLRRARRHQK  86

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            LDPSA HGVT+FSDLT  EFR+  L
Sbjct  87   LDPSARHGVTQFSDLTRAEFRKKHL  111



>ref|XP_008775532.1| PREDICTED: cysteine proteinase 1-like [Phoenix dactylifera]
Length=371

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 69/82 (84%), Gaps = 1/82 (1%)
 Frame = +1

Query  91   LIRQVVSDG-EDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLLD  267
            LI QVVS+  ED+ +LNA+ HF+ F  ++GKSYA ++EH YR SVFKANLRRA+RHQ +D
Sbjct  33   LIVQVVSEADEDELMLNAEAHFSSFLRRFGKSYADEKEHAYRFSVFKANLRRARRHQKMD  92

Query  268  PSAVHGVTKFSDLTPKEFRRTF  333
            P+AVHG+TK+SDLTP EFRRTF
Sbjct  93   PTAVHGITKYSDLTPAEFRRTF  114



>gb|AAW21813.1| cysteine protease [Triticum aestivum]
Length=377

 Score =   116 bits (291),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 57/88 (65%), Positives = 65/88 (74%), Gaps = 1/88 (1%)
 Frame = +1

Query  76   ADEDPLIRQVVSDGED-DALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKR  252
             DE+PLIRQVV   +  D  L  D     F  ++GK+Y   EEH +RLSVFKANLRRA+R
Sbjct  27   GDEEPLIRQVVGGADPLDNDLELDSQLLGFVQRFGKTYRDAEEHAHRLSVFKANLRRARR  86

Query  253  HQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            HQ+LDPSA HGVTKFSDLTP EFRRTFL
Sbjct  87   HQMLDPSAEHGVTKFSDLTPAEFRRTFL  114



>ref|XP_010066197.1| PREDICTED: probable cysteine proteinase A494 [Eucalyptus grandis]
 gb|KCW64029.1| hypothetical protein EUGRSUZ_G01706 [Eucalyptus grandis]
 gb|KCW64030.1| hypothetical protein EUGRSUZ_G01706 [Eucalyptus grandis]
Length=376

 Score =   116 bits (291),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 69/90 (77%), Gaps = 3/90 (3%)
 Frame = +1

Query  76   ADEDPLIRQVVSDGEDDAL---LNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRA  246
             D D LIRQVV DG D      L+  HHF+LFK ++G+SY +QEEHDYR  VF+ANLRRA
Sbjct  32   GDGDALIRQVVDDGGDGREGGPLSDHHHFSLFKRRFGRSYGSQEEHDYRFGVFRANLRRA  91

Query  247  KRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            +RHQ LDPSA HGVT+FSDLTP EFRRT L
Sbjct  92   RRHQKLDPSAAHGVTQFSDLTPSEFRRTHL  121



>ref|XP_010531457.1| PREDICTED: probable cysteine proteinase A494 [Tarenaya hassleriana]
Length=364

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 68/85 (80%), Gaps = 1/85 (1%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            ED LIRQVV D     +L+++ HF+LFK K+GK Y ++EEHDYR SVF+ANL RAKRHQ 
Sbjct  28   EDILIRQVV-DETKPKVLSSEDHFSLFKRKFGKVYGSREEHDYRFSVFRANLLRAKRHQK  86

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            LDPSA HGVT+FSDLTP EFRR FL
Sbjct  87   LDPSAQHGVTQFSDLTPSEFRRRFL  111



>ref|XP_003539008.1| PREDICTED: cysteine proteinase RD19a-like [Glycine max]
Length=363

 Score =   116 bits (290),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 53/87 (61%), Positives = 64/87 (74%), Gaps = 2/87 (2%)
 Frame = +1

Query  76   ADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRH  255
             D++PLI QVV        L A+HHF  FK ++GK+YA+QEEH+YR  VFKAN+RRA+RH
Sbjct  25   GDDEPLIMQVVEG--SGVRLGAEHHFLDFKRRFGKAYASQEEHNYRFEVFKANMRRARRH  82

Query  256  QLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            Q LDPSA HGVT+FSDLT  EFR   L
Sbjct  83   QSLDPSAAHGVTRFSDLTASEFRNKVL  109



>emb|CAQ00101.1| papain-like cysteine proteinase [Hordeum vulgare subsp. vulgare]
Length=381

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 68/86 (79%), Gaps = 1/86 (1%)
 Frame = +1

Query  82   EDPLIRQVVS-DGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  258
            EDPLI QVV  D E++  LNA+ HF  F  ++GKSY   +EH++RLSVF+ANLRRA+RHQ
Sbjct  34   EDPLIEQVVGGDAENELELNAEAHFASFVRRFGKSYRDADEHEHRLSVFRANLRRARRHQ  93

Query  259  LLDPSAVHGVTKFSDLTPKEFRRTFL  336
             LDPSAVHG+TKFSDLTP EFR  FL
Sbjct  94   RLDPSAVHGITKFSDLTPDEFRERFL  119



>ref|XP_011047717.1| PREDICTED: cysteine proteinase RD19a [Populus euphratica]
Length=368

 Score =   116 bits (290),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 55/89 (62%), Positives = 68/89 (76%), Gaps = 5/89 (6%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDA----LLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAK  249
            +D LIRQVV +G+D++    L    HHF+LFK K+ KSY +Q+EHDYR SVFK+NLRRA 
Sbjct  27   DDSLIRQVV-EGQDESSSNLLTGEQHHFSLFKRKFKKSYLSQQEHDYRFSVFKSNLRRAA  85

Query  250  RHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            RHQ LDP+A HGVT+FSDLT  EFR+  L
Sbjct  86   RHQKLDPTASHGVTQFSDLTAAEFRKQVL  114



>ref|XP_009376976.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=445

 Score =   115 bits (289),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 69/90 (77%), Gaps = 7/90 (8%)
 Frame = +1

Query  85   DPLIRQVV-SDGED-----DALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRA  246
            DPLIRQVV  DGE      DAL  A+HHF+ FK KYGKSYA++EEHDYR  VFKANLRRA
Sbjct  91   DPLIRQVVDGDGESHHHHHDAL-GAEHHFSFFKHKYGKSYASKEEHDYRFDVFKANLRRA  149

Query  247  KRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
              HQ LDPSA HG+T+FSD+ P EFR++ L
Sbjct  150  ACHQRLDPSAQHGMTRFSDMIPAEFRKSQL  179



>gb|AAX19661.1| cysteine proteinase [Populus tomentosa]
Length=374

 Score =   115 bits (288),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 57/89 (64%), Positives = 70/89 (79%), Gaps = 5/89 (6%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDA---LLNAD-HHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAK  249
            +D LIRQVV +G+D++   LL A+ HH +LFK K+ KSY +QEEHDYR SVFK+NLRRA 
Sbjct  33   DDSLIRQVV-EGQDESSPNLLTAEQHHLSLFKRKFKKSYLSQEEHDYRFSVFKSNLRRAA  91

Query  250  RHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            RHQ LDP+A HGVT+FSDLT  EFR+  L
Sbjct  92   RHQKLDPTASHGVTQFSDLTSAEFRKQVL  120



>gb|KJB07487.1| hypothetical protein B456_001G026600 [Gossypium raimondii]
Length=377

 Score =   115 bits (288),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 71/96 (74%), Gaps = 7/96 (7%)
 Frame = +1

Query  67   VVRADEDPLIRQVVSDGEDDA------LLNADHHFTLFKSKYGKSYATQEEHDYRLSVFK  228
             V ++ DPLIRQV +D  DD       L  A+HHF+LFK+++ KSY ++ EHDYR  VF+
Sbjct  28   AVASEVDPLIRQV-TDVHDDGTEPQQLLTAAEHHFSLFKARFNKSYGSKAEHDYRFKVFR  86

Query  229  ANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            +NLRRA RHQ LDPSA HGVT+FSDLTP EFR+ FL
Sbjct  87   SNLRRAARHQKLDPSATHGVTQFSDLTPGEFRKRFL  122



>gb|AAN60308.1| unknown [Arabidopsis thaliana]
Length=193

 Score =   112 bits (279),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 68/89 (76%), Gaps = 1/89 (1%)
 Frame = +1

Query  70   VRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAK  249
            V   +D +IRQVV  G +  +L ++ HF+LFK K+GK YA+ EEHDYR SVFKANLRRA+
Sbjct  25   VNDGDDLVIRQVVG-GAEPQVLTSEDHFSLFKRKFGKVYASNEEHDYRFSVFKANLRRAR  83

Query  250  RHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            RHQ LDPSA HGVT+FSDLT  EFR+  L
Sbjct  84   RHQKLDPSATHGVTQFSDLTRSEFRKKHL  112



>ref|XP_009376977.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=447

 Score =   115 bits (288),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 67/91 (74%), Gaps = 7/91 (8%)
 Frame = +1

Query  85   DPLIRQVV-SDGED------DALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRR  243
            DPLIRQVV  DGE          L A+HHF+ FK KYGKSYA++EEHDYR  VFKANLRR
Sbjct  91   DPLIRQVVDGDGESHXXXXXXXALGAEHHFSFFKHKYGKSYASKEEHDYRFDVFKANLRR  150

Query  244  AKRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            A  HQ LDPSA HG+T+FSD+ P EFR++ L
Sbjct  151  AACHQRLDPSAQHGMTRFSDMIPAEFRKSQL  181



>ref|XP_009405542.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=366

 Score =   114 bits (285),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 55/86 (64%), Positives = 65/86 (76%), Gaps = 1/86 (1%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDD-ALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  258
            EDPLIRQVV D E +   L+A+ HF  F  ++ K+YA  EE   R +VFKANL RA+RHQ
Sbjct  30   EDPLIRQVVQDAEGELTALDAEVHFARFIKRFRKTYADTEERARRFAVFKANLLRARRHQ  89

Query  259  LLDPSAVHGVTKFSDLTPKEFRRTFL  336
            LLDP+AVHGVTKFSDLTP EFRR +L
Sbjct  90   LLDPTAVHGVTKFSDLTPAEFRRAYL  115



>ref|NP_565512.1| Papain family cysteine protease [Arabidopsis thaliana]
 sp|P43295.2|A494_ARATH RecName: Full=Probable cysteine proteinase A494; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAD23687.1| cysteine proteinase [Arabidopsis thaliana]
 gb|ABJ98563.1| At2g21430 [Arabidopsis thaliana]
 gb|AEC07177.1| Papain family cysteine protease [Arabidopsis thaliana]
Length=361

 Score =   114 bits (285),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 57/89 (64%), Positives = 66/89 (74%), Gaps = 1/89 (1%)
 Frame = +1

Query  70   VRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAK  249
            V  DED LIRQVV + E   +L+++ HFTLFK K+GK Y + EEH YR SVFKANL RA 
Sbjct  22   VCGDEDVLIRQVVDETEPK-VLSSEDHFTLFKKKFGKVYGSIEEHYYRFSVFKANLLRAM  80

Query  250  RHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            RHQ +DPSA HGVT+FSDLT  EFRR  L
Sbjct  81   RHQKMDPSARHGVTQFSDLTRSEFRRKHL  109



>dbj|BAD43619.1| putative cysteine proteinase [Arabidopsis thaliana]
Length=361

 Score =   114 bits (285),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 57/89 (64%), Positives = 66/89 (74%), Gaps = 1/89 (1%)
 Frame = +1

Query  70   VRADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAK  249
            V  DED LIRQVV + E   +L+++ HFTLFK K+GK Y + EEH YR SVFKANL RA 
Sbjct  22   VCGDEDVLIRQVVDETEPK-VLSSEDHFTLFKKKFGKVYGSIEEHYYRFSVFKANLLRAM  80

Query  250  RHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            RHQ +DPSA HGVT+FSDLT  EFRR  L
Sbjct  81   RHQKMDPSARHGVTQFSDLTRSEFRRKHL  109



>ref|XP_010690815.1| PREDICTED: cysteine proteinase RD19a [Beta vulgaris subsp. vulgaris]
Length=403

 Score =   114 bits (285),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 60/91 (66%), Positives = 70/91 (77%), Gaps = 10/91 (11%)
 Frame = +1

Query  85   DPLIRQVVSDGEDDAL-LNA------DHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRR  243
            D +IRQVVS+   DAL LN+        HF+LFK ++ KSYATQEEHDYR +VFKANLRR
Sbjct  63   DEIIRQVVSN---DALSLNSLDLSQPHQHFSLFKKRFNKSYATQEEHDYRFNVFKANLRR  119

Query  244  AKRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            AKR+Q LDP+AVHGVT+FSDLT  EFR  FL
Sbjct  120  AKRNQELDPTAVHGVTRFSDLTQSEFRNRFL  150



>emb|CAD40319.2| OSJNBb0054B09.3 [Oryza sativa Japonica Group]
 emb|CAH66180.1| OSIGBa0130O15.4 [Oryza sativa Indica Group]
 emb|CAH66205.1| OSIGBa0148D14.11 [Oryza sativa Indica Group]
Length=381

 Score =   114 bits (285),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 54/88 (61%), Positives = 66/88 (75%), Gaps = 1/88 (1%)
 Frame = +1

Query  76   ADEDPLIRQVVSDGED-DALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKR  252
             +EDPLI QVV  GE+ DA L+A+ HF  F+ ++G++Y    E  YR+SVF ANLRRA+R
Sbjct  32   GEEDPLIEQVVGGGEEEDAQLDAEAHFASFERRFGRTYRDAGERAYRMSVFAANLRRARR  91

Query  253  HQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            HQ LDP+A HGVTKFSDLTP EFR  FL
Sbjct  92   HQRLDPTATHGVTKFSDLTPGEFRDRFL  119



>gb|EMT10192.1| Cysteine proteinase 1 [Aegilops tauschii]
Length=369

 Score =   111 bits (278),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 65/88 (74%), Gaps = 1/88 (1%)
 Frame = +1

Query  76   ADEDPLIRQVVSDGED-DALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKR  252
             +E+PLIRQVV   +  D  L  D  F  F  ++GK+Y   EEH +RLSVFKA LRRA+R
Sbjct  19   GEEEPLIRQVVGGADPLDNDLELDSQFLGFVQRFGKTYRDAEEHAHRLSVFKATLRRARR  78

Query  253  HQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            HQLLDPSA HGVTKFSDLTP EFRRTFL
Sbjct  79   HQLLDPSAEHGVTKFSDLTPAEFRRTFL  106



>ref|XP_009140277.1| PREDICTED: probable cysteine proteinase A494 [Brassica rapa]
Length=362

 Score =   110 bits (276),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 50/85 (59%), Positives = 67/85 (79%), Gaps = 1/85 (1%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            ED LIRQVV +G +  +L+++ HF+LFK ++GK Y + EEH +R +VF++NL+RA RHQ 
Sbjct  28   EDILIRQVV-NGSEPKVLSSEDHFSLFKRRFGKVYGSLEEHRHRFAVFRSNLQRAMRHQK  86

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            +DPSA HGVT+FSDLTP EFRR  L
Sbjct  87   MDPSARHGVTQFSDLTPSEFRRMHL  111



>emb|CDY15894.1| BnaA04g12170D [Brassica napus]
Length=362

 Score =   110 bits (276),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 50/85 (59%), Positives = 67/85 (79%), Gaps = 1/85 (1%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            ED LIRQVV +G +  +L+++ HF+LFK ++GK Y + EEH +R +VF++NL+RA RHQ 
Sbjct  28   EDILIRQVV-NGSEPKVLSSEDHFSLFKRRFGKVYGSLEEHRHRFAVFRSNLQRAMRHQK  86

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            +DPSA HGVT+FSDLTP EFRR  L
Sbjct  87   MDPSARHGVTQFSDLTPSEFRRMHL  111



>ref|XP_009392632.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=369

 Score =   110 bits (276),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 51/87 (59%), Positives = 64/87 (74%), Gaps = 0/87 (0%)
 Frame = +1

Query  76   ADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRH  255
            AD DPLI QVV D + +  L+A+ HF  F  ++GK+YA +EE   R  VFKANL RA R+
Sbjct  28   ADGDPLILQVVDDEKGELALSAEAHFASFVRRFGKTYADEEERALRFKVFKANLHRAARY  87

Query  256  QLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            Q LDP+A+HGVTKFSDL+P EFRR +L
Sbjct  88   QRLDPTAIHGVTKFSDLSPAEFRRAYL  114



>ref|XP_003579573.2| PREDICTED: cysteine proteinase 1-like [Brachypodium distachyon]
Length=399

 Score =   110 bits (275),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 64/86 (74%), Gaps = 1/86 (1%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDAL-LNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  258
            EDPLI QVV   E + L LNA+ HF  F  ++ KSY   +EH +RLSVF ANLRRA+RHQ
Sbjct  51   EDPLIEQVVGGDEKNELELNAEAHFASFVQRFNKSYRDADEHAHRLSVFTANLRRARRHQ  110

Query  259  LLDPSAVHGVTKFSDLTPKEFRRTFL  336
             LDPSAVHGVTKFSDLTP EFR  FL
Sbjct  111  RLDPSAVHGVTKFSDLTPDEFRDRFL  136



>gb|ABF46642.1| papain-like cysteine proteinase [Pachysandra terminalis]
Length=374

 Score =   109 bits (272),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 72/96 (75%), Gaps = 6/96 (6%)
 Frame = +1

Query  67   VVRADE--DPLIRQVVSDGEDDALLN----ADHHFTLFKSKYGKSYATQEEHDYRLSVFK  228
             V +DE  D LIRQVV+  +D    +    A+HHF+ FK ++GK+Y + +EHD R  VFK
Sbjct  24   TVSSDESDDLLIRQVVAGADDHDNDDLLLNAEHHFSSFKKRFGKAYTSCDEHDRRFGVFK  83

Query  229  ANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            ANLRRAKR+Q+LDPSAVHGVT+F DLTP EFRRT+L
Sbjct  84   ANLRRAKRNQILDPSAVHGVTQFFDLTPAEFRRTYL  119



>gb|AES89347.2| papain family cysteine protease [Medicago truncatula]
Length=327

 Score =   108 bits (271),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 65/85 (76%), Gaps = 6/85 (7%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            EDP+I+QVV  G       A+H F  FK ++GK Y++++EHDYR +VFK+NL RAKRH +
Sbjct  31   EDPIIQQVVDKG------GAEHQFNEFKQRFGKVYSSKDEHDYRFNVFKSNLHRAKRHVI  84

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            +DPSA HGVT+FSDLTP+EFR + L
Sbjct  85   MDPSATHGVTRFSDLTPREFRNSIL  109



>ref|XP_003607150.1| Cysteine proteinase [Medicago truncatula]
Length=326

 Score =   108 bits (271),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 65/85 (76%), Gaps = 6/85 (7%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            EDP+I+QVV  G       A+H F  FK ++GK Y++++EHDYR +VFK+NL RAKRH +
Sbjct  30   EDPIIQQVVDKG------GAEHQFNEFKQRFGKVYSSKDEHDYRFNVFKSNLHRAKRHVI  83

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            +DPSA HGVT+FSDLTP+EFR + L
Sbjct  84   MDPSATHGVTRFSDLTPREFRNSIL  108



>emb|CDY14798.1| BnaC04g47950D [Brassica napus]
Length=122

 Score =   103 bits (258),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            +D +I QVV  G +  +L+++ HF+LFK ++GK YA++EEHDYR SVFK+NLRRA+RHQ 
Sbjct  28   DDLVINQVVDGGAEPNVLSSEDHFSLFKKRFGKVYASREEHDYRFSVFKSNLRRARRHQK  87

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            LDPSA HGVT+FSDL    F   F 
Sbjct  88   LDPSARHGVTQFSDLRKGGFAEYFF  112



>gb|KEH30505.1| papain family cysteine protease [Medicago truncatula]
Length=330

 Score =   107 bits (267),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 65/85 (76%), Gaps = 6/85 (7%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            EDP+I+QVV  G       A++ F  FK ++GK Y++++EHDYR +VFK+NL RAKRH +
Sbjct  30   EDPIIQQVVDKG------GAEYQFNEFKQRFGKVYSSKDEHDYRFNVFKSNLHRAKRHGI  83

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            +DPSA HGVT+FSDLTP+EFR + L
Sbjct  84   MDPSATHGVTRFSDLTPREFRNSIL  108



>ref|XP_003607110.1| Cysteine proteinase [Medicago truncatula]
 gb|AES89307.1| papain family cysteine protease [Medicago truncatula]
Length=331

 Score =   107 bits (266),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 65/85 (76%), Gaps = 6/85 (7%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            EDP+I+QVV  G       A++ F  FK ++GK Y++++EHDYR +VFK+NL RAKRH +
Sbjct  31   EDPIIQQVVDKG------GAEYQFNEFKQRFGKVYSSKDEHDYRFNVFKSNLHRAKRHGI  84

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            +DPSA HGVT+FSDLTP+EFR + L
Sbjct  85   MDPSATHGVTRFSDLTPREFRNSIL  109



>gb|KHN39817.1| Cysteine proteinase RD19a [Glycine soja]
Length=332

 Score =   107 bits (266),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 60/79 (76%), Gaps = 2/79 (3%)
 Frame = +1

Query  100  QVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLLDPSAV  279
            QVV  G  D  L A+HHF  FK ++GK+YA+QEEH+YR  VFKAN+RRA+RHQ LDPSA 
Sbjct  2    QVVDGG--DVRLGAEHHFLDFKRRFGKAYASQEEHNYRFEVFKANMRRARRHQSLDPSAA  59

Query  280  HGVTKFSDLTPKEFRRTFL  336
            HGVT+FSDLT  EFR   L
Sbjct  60   HGVTRFSDLTASEFRNKVL  78



>ref|XP_006294682.1| hypothetical protein CARUB_v10023719mg, partial [Capsella rubella]
 gb|EOA27580.1| hypothetical protein CARUB_v10023719mg, partial [Capsella rubella]
Length=103

 Score = 97.1 bits (240),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +1

Query  76   ADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRH  255
             DED LIRQVV + E+  +L+++ HF LFK K+GK   + EEH YR SVFKANLRRA   
Sbjct  24   GDEDVLIRQVVDETEEPKVLSSEDHFALFKKKFGKVSGSHEEHHYRFSVFKANLRRAMGQ  83

Query  256  QLLDPSAVHGVTKFSDLT  309
            Q +DP A HGVT+FSDLT
Sbjct  84   QKMDPDARHGVTQFSDLT  101



>ref|XP_006404590.1| hypothetical protein EUTSA_v10000210mg [Eutrema salsugineum]
 gb|ESQ46043.1| hypothetical protein EUTSA_v10000210mg [Eutrema salsugineum]
Length=363

 Score =   101 bits (251),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 49/85 (58%), Positives = 62/85 (73%), Gaps = 1/85 (1%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            +D LIRQVV+  E   +L+++ HF LFK K+GK Y + EEH +RLS+F+ NL RA  HQ 
Sbjct  28   DDLLIRQVVNVTEP-RVLSSEDHFALFKRKFGKVYGSVEEHYHRLSIFRRNLLRAMHHQR  86

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            +DP A HGVT+FSDLTP EFRR  L
Sbjct  87   MDPFASHGVTQFSDLTPSEFRRMHL  111



>gb|KHN25481.1| Cysteine proteinase 15A [Glycine soja]
Length=224

 Score = 99.8 bits (247),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 62/95 (65%), Gaps = 8/95 (8%)
 Frame = +1

Query  64   CVVRADEDPLIRQVVSDG--------EDDALLNADHHFTLFKSKYGKSYATQEEHDYRLS  219
             V    +D LIRQVV D         ++D LLN +HHFT FK+K+GK Y T+EEH+ R  
Sbjct  17   VVTSTTDDILIRQVVPDAVSEATEKEDEDHLLNEEHHFTSFKAKFGKKYVTKEEHNRRFG  76

Query  220  VFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFR  324
            VFK+NL RA+ H  LDPS VH +TK SDLT  EFR
Sbjct  77   VFKSNLHRARLHAKLDPSVVHNITKLSDLTSTEFR  111



>gb|EMS64962.1| Cysteine proteinase 1 [Triticum urartu]
Length=302

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +1

Query  133  LNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTP  312
            L  D  F  F  ++GK+Y   EEH +RLSVFKANLRRA+RHQ+LDPSA HGVTKFSDL P
Sbjct  39   LELDSQFLGFVQRFGKTYRDAEEHAHRLSVFKANLRRARRHQMLDPSAEHGVTKFSDLAP  98

Query  313  KEFRRTFL  336
             EFRRTFL
Sbjct  99   AEFRRTFL  106



>ref|XP_009117680.1| PREDICTED: probable cysteine proteinase A494 [Brassica rapa]
Length=357

 Score = 97.8 bits (242),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 46/85 (54%), Positives = 59/85 (69%), Gaps = 1/85 (1%)
 Frame = +1

Query  85   DPLIRQVVSDGEDD-ALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            D LIRQVV+  E +  +++ + HF LFK KYGK Y + EEH +R  +F++N  RA RHQ 
Sbjct  27   DILIRQVVNGSESEPTVMSWEDHFALFKRKYGKVYNSHEEHQHRFWIFRSNFMRATRHQR  86

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            +DP A HGVT+FSDLT  EFRR  L
Sbjct  87   MDPFARHGVTQFSDLTHSEFRRKHL  111



>ref|XP_006653265.1| PREDICTED: cysteine proteinase 1-like, partial [Oryza brachyantha]
Length=366

 Score = 97.8 bits (242),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 53/99 (54%), Positives = 64/99 (65%), Gaps = 9/99 (9%)
 Frame = +1

Query  67   VVRA--DEDPLIRQVVSDG-------EDDALLNADHHFTLFKSKYGKSYATQEEHDYRLS  219
            VVR+  +ED LI QVV  G       E   LL+A+ HF  F+ ++G++Y           
Sbjct  9    VVRSAEEEDALIEQVVGGGDGDGDDRELGELLDAEAHFASFERRFGRTYRDAXXXXXXXX  68

Query  220  VFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            VFKANLRRA+RHQLLDPSA HGVTKFSDLTP EFR  +L
Sbjct  69   VFKANLRRARRHQLLDPSASHGVTKFSDLTPAEFRERYL  107



>emb|CDX99593.1| BnaC04g33500D [Brassica napus]
Length=343

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 40/63 (63%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +1

Query  148  HFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRR  327
            HF+LFK ++GK Y + EEH +R +VF++NL+RA RHQ +DPSA HGVT+FSDLTP EFRR
Sbjct  30   HFSLFKRRFGKVYGSLEEHHHRFAVFRSNLQRAMRHQRMDPSARHGVTQFSDLTPSEFRR  89

Query  328  TFL  336
              L
Sbjct  90   MHL  92



>gb|ABK21238.1| unknown [Picea sitchensis]
 gb|ABR16087.1| unknown [Picea sitchensis]
 gb|ABR17330.1| unknown [Picea sitchensis]
 gb|ABR17545.1| unknown [Picea sitchensis]
 gb|ACN40765.1| unknown [Picea sitchensis]
Length=366

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 51/96 (53%), Positives = 61/96 (64%), Gaps = 9/96 (9%)
 Frame = +1

Query  73   RADEDPLIRQVVSDGEDD--------ALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFK  228
            R D+D LIRQV  +   D        AL NA+ HF  F  +YGK Y+  EEH++R  VFK
Sbjct  24   RPDDD-LIRQVTDEVVSDPQILDARSALFNAEVHFRHFIRRYGKKYSGPEEHEHRFGVFK  82

Query  229  ANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            +NL RA  HQ LDP A HGVTKFSDLT +EFR  +L
Sbjct  83   SNLLRALEHQKLDPRASHGVTKFSDLTQEEFRHQYL  118



>gb|ABK24688.1| unknown [Picea sitchensis]
 gb|ACN39791.1| unknown [Picea sitchensis]
 gb|ACN40241.1| unknown [Picea sitchensis]
Length=366

 Score = 95.9 bits (237),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 49/93 (53%), Positives = 59/93 (63%), Gaps = 8/93 (9%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDD--------ALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANL  237
            +D LIRQV  +   D        AL NA+ HF  F  +YGK Y+  EEH++R  VFK+NL
Sbjct  26   DDDLIRQVTDEVVSDPQILDARSALFNAEVHFRHFIRRYGKKYSGPEEHEHRFGVFKSNL  85

Query  238  RRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
             RA  HQ LDP A HGVTKFSDLT +EFR  +L
Sbjct  86   LRALEHQKLDPRASHGVTKFSDLTQEEFRHQYL  118



>ref|XP_002960585.1| hypothetical protein SELMODRAFT_266583 [Selaginella moellendorffii]
 gb|EFJ38124.1| hypothetical protein SELMODRAFT_266583 [Selaginella moellendorffii]
Length=330

 Score = 94.7 bits (234),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +1

Query  103  VVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLLDPSAVH  282
            VV +G+  ALL+ + HF  F +++GK+YAT E + +RL VF+ANL RA  HQ LDPSAVH
Sbjct  5    VVDNGDRSALLDVETHFKSFIARFGKAYATAEAYAHRLKVFEANLVRAVSHQALDPSAVH  64

Query  283  GVTKFSDLTPKEFRRTFL  336
            G+T+FSDLT +EF++ FL
Sbjct  65   GITQFSDLTEEEFKQQFL  82



>ref|XP_010534431.1| PREDICTED: cysteine proteinase 15A [Tarenaya hassleriana]
Length=379

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 46/91 (51%), Positives = 59/91 (65%), Gaps = 1/91 (1%)
 Frame = +1

Query  64   CVVRADEDPLIRQVVSDGEDDAL-LNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLR  240
            CV    ED  IRQV  D     +  + +  F  F S+YGKSY T+EE+ +RL VF  N+ 
Sbjct  28   CVASDHEDLAIRQVTEDHRKTLVGTHTESRFRAFMSEYGKSYETREEYVHRLGVFARNVL  87

Query  241  RAKRHQLLDPSAVHGVTKFSDLTPKEFRRTF  333
            RA  HQ++DP+AVHGVT+FSDLT +EF R F
Sbjct  88   RAAEHQMMDPTAVHGVTQFSDLTEEEFERMF  118



>ref|XP_002969223.1| hypothetical protein SELMODRAFT_91274 [Selaginella moellendorffii]
 gb|EFJ29311.1| hypothetical protein SELMODRAFT_91274 [Selaginella moellendorffii]
Length=367

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 46/93 (49%), Positives = 62/93 (67%), Gaps = 9/93 (10%)
 Frame = +1

Query  85   DPLIRQVVSDGEDD---------ALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANL  237
            D  IR+V     D+         ALL+ + HF  F +++GK+YAT E + +RL VF+ANL
Sbjct  27   DSGIREVTDTARDESNGRLDAAKALLDVETHFKSFIARFGKAYATAEAYAHRLKVFEANL  86

Query  238  RRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
             RA  HQ LDPSAVHG+T+FSDLT +EF++ FL
Sbjct  87   VRAVSHQALDPSAVHGITQFSDLTEEEFKQQFL  119



>gb|ACN40679.1| unknown [Picea sitchensis]
Length=366

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 50/96 (52%), Positives = 60/96 (63%), Gaps = 9/96 (9%)
 Frame = +1

Query  73   RADEDPLIRQVVSDGEDD--------ALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFK  228
            R D+D LIRQV  +   D        AL NA+ HF  F  +YGK Y+  EEH++R  VFK
Sbjct  24   RPDDD-LIRQVTDEVVSDPQILDARSALFNAEVHFRHFIRRYGKKYSGPEEHEHRFGVFK  82

Query  229  ANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            +NL RA  HQ LDP A HGVTKFSDLT + FR  +L
Sbjct  83   SNLLRALEHQKLDPRASHGVTKFSDLTQEGFRHQYL  118



>ref|XP_008233261.1| PREDICTED: cysteine proteinase 15A [Prunus mume]
Length=377

 Score = 92.4 bits (228),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 42/86 (49%), Positives = 57/86 (66%), Gaps = 2/86 (2%)
 Frame = +1

Query  76   ADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRH  255
            A +DP+I QV  +     LL  +  F +F  KYGK Y+TQ+E+ +RL +F  N+ RA  H
Sbjct  35   ASQDPIIHQVTDNHR--PLLGTERSFQMFIEKYGKKYSTQKEYMHRLGIFAKNMVRAAEH  92

Query  256  QLLDPSAVHGVTKFSDLTPKEFRRTF  333
            Q LDP+AVHGVT FSDL+ +EF R +
Sbjct  93   QALDPTAVHGVTPFSDLSEEEFERMY  118



>emb|CAB41090.1| cysteine proteinase precursor-like protein [Arabidopsis thaliana]
Length=363

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 46/93 (49%), Positives = 64/93 (69%), Gaps = 4/93 (4%)
 Frame = +1

Query  67   VVRADEDPLIRQVVSDGED--DALL--NADHHFTLFKSKYGKSYATQEEHDYRLSVFKAN  234
            VV + ED  IRQV +D       LL  + +  F LF S YGK+Y+T+EE+ +RL +F  N
Sbjct  19   VVASVEDLTIRQVTADNRRIRPNLLGTHTESKFRLFMSDYGKNYSTREEYIHRLGIFAKN  78

Query  235  LRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTF  333
            + +A  HQ++DPSAVHGVT+FSDLT +EF+R +
Sbjct  79   VLKAAEHQMMDPSAVHGVTQFSDLTEEEFKRMY  111



>ref|NP_567010.5| Papain family cysteine protease [Arabidopsis thaliana]
 gb|AAL49820.1| putative cysteine proteinase [Arabidopsis thaliana]
 gb|AEE79316.1| Papain family cysteine protease [Arabidopsis thaliana]
Length=367

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 46/93 (49%), Positives = 64/93 (69%), Gaps = 4/93 (4%)
 Frame = +1

Query  67   VVRADEDPLIRQVVSDGED--DALL--NADHHFTLFKSKYGKSYATQEEHDYRLSVFKAN  234
            VV + ED  IRQV +D       LL  + +  F LF S YGK+Y+T+EE+ +RL +F  N
Sbjct  19   VVASVEDLTIRQVTADNRRIRPNLLGTHTESKFRLFMSDYGKNYSTREEYIHRLGIFAKN  78

Query  235  LRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTF  333
            + +A  HQ++DPSAVHGVT+FSDLT +EF+R +
Sbjct  79   VLKAAEHQMMDPSAVHGVTQFSDLTEEEFKRMY  111



>ref|XP_009116190.1| PREDICTED: probable cysteine proteinase A494 [Brassica rapa]
Length=364

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 42/85 (49%), Positives = 60/85 (71%), Gaps = 1/85 (1%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDAL-LNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  258
            ED  IRQV  D   + L  + +  F +F S YGKSY+T+EE+ +RL +F  N+ +A  HQ
Sbjct  24   EDLTIRQVTEDRLPNLLGTHTERKFRVFMSDYGKSYSTREEYIHRLGIFAKNVLKAAEHQ  83

Query  259  LLDPSAVHGVTKFSDLTPKEFRRTF  333
            ++DP+AVHGVT+FSDLT +EF+R +
Sbjct  84   MMDPTAVHGVTQFSDLTEEEFKRMY  108



>emb|CDY56961.1| BnaA09g55030D [Brassica napus]
Length=364

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 42/85 (49%), Positives = 60/85 (71%), Gaps = 1/85 (1%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDAL-LNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  258
            ED  IRQV  D   + L  + +  F +F S YGKSY+T+EE+ +RL +F  N+ +A  HQ
Sbjct  24   EDLTIRQVTEDRLPNLLGTHTERKFRVFMSDYGKSYSTREEYIHRLGIFAKNVLKAAEHQ  83

Query  259  LLDPSAVHGVTKFSDLTPKEFRRTF  333
            ++DP+AVHGVT+FSDLT +EF+R +
Sbjct  84   MMDPTAVHGVTQFSDLTEEEFKRMY  108



>ref|XP_006403513.1| hypothetical protein EUTSA_v10010475mg [Eutrema salsugineum]
 gb|ESQ44966.1| hypothetical protein EUTSA_v10010475mg [Eutrema salsugineum]
Length=367

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 43/85 (51%), Positives = 59/85 (69%), Gaps = 1/85 (1%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDAL-LNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  258
            ED  IRQV  D   + L  + +  F +F S YGKSY+T+EE+ +RL +F  N+ +A  HQ
Sbjct  24   EDLTIRQVTDDRLSNLLGTHTETKFRVFMSDYGKSYSTREEYVHRLGIFAKNVLKAAEHQ  83

Query  259  LLDPSAVHGVTKFSDLTPKEFRRTF  333
            +LDP+AVHGVT+FSDLT +EF R +
Sbjct  84   MLDPTAVHGVTRFSDLTEEEFTRMY  108



>emb|CDX73424.1| BnaC08g25790D [Brassica napus]
Length=364

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 42/85 (49%), Positives = 59/85 (69%), Gaps = 1/85 (1%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDAL-LNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  258
            ED  IRQV  D   + L  + +  F +F S YGKSY+T+EE+ +RL +F  N+ +A  HQ
Sbjct  24   EDLTIRQVTEDRLPNLLGTHTERKFRVFMSDYGKSYSTREEYIHRLGIFAKNVLKAAEHQ  83

Query  259  LLDPSAVHGVTKFSDLTPKEFRRTF  333
            ++DP+AVHGVT+FSDLT  EF+R +
Sbjct  84   MMDPTAVHGVTQFSDLTEDEFKRMY  108



>ref|XP_010034320.1| PREDICTED: cysteine proteinase 1 [Eucalyptus grandis]
 gb|KCW51545.1| hypothetical protein EUGRSUZ_J01054 [Eucalyptus grandis]
Length=367

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 43/82 (52%), Positives = 54/82 (66%), Gaps = 3/82 (4%)
 Frame = +1

Query  88   PLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLLD  267
            P I QV    E + LL  +  F +F  KYGKSY+T+EE+  RL +F  NL RA  HQ LD
Sbjct  30   PAIFQVT---EHNPLLTTERRFHIFMRKYGKSYSTREEYARRLGIFAGNLARAAEHQALD  86

Query  268  PSAVHGVTKFSDLTPKEFRRTF  333
            P+AVHGVT FSDL+P+EF   +
Sbjct  87   PTAVHGVTPFSDLSPEEFEMLY  108



>ref|XP_007218137.1| hypothetical protein PRUPE_ppa007240mg [Prunus persica]
 gb|EMJ19336.1| hypothetical protein PRUPE_ppa007240mg [Prunus persica]
Length=377

 Score = 89.7 bits (221),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 41/86 (48%), Positives = 57/86 (66%), Gaps = 2/86 (2%)
 Frame = +1

Query  76   ADEDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRH  255
            A +DP+I QV  +     LL  +  F +F  KYGK Y+T++E+ +RL +F  N+ RA  H
Sbjct  35   AAQDPIIHQVTDNHR--PLLGTERSFQMFIEKYGKKYSTRKEYMHRLGIFAKNMVRAAEH  92

Query  256  QLLDPSAVHGVTKFSDLTPKEFRRTF  333
            Q LDP+AVHGVT FSDL+ +EF R +
Sbjct  93   QALDPTAVHGVTPFSDLSEEEFERMY  118



>ref|XP_008446834.1| PREDICTED: cysteine proteinase 15A [Cucumis melo]
Length=371

 Score = 89.7 bits (221),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 42/86 (49%), Positives = 59/86 (69%), Gaps = 2/86 (2%)
 Frame = +1

Query  85   DPLIRQVVSDGE--DDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  258
            DP   + V+DGE  ++    ++  F +F  KYGKSY T++E+ +RL +F  NL RA  HQ
Sbjct  30   DPEFLRQVTDGEIFNNLPAGSERKFAMFMEKYGKSYPTRKEYLHRLGIFVKNLIRAAEHQ  89

Query  259  LLDPSAVHGVTKFSDLTPKEFRRTFL  336
             LDP+AVHGVT+FSDL+ +EF R F+
Sbjct  90   ALDPTAVHGVTQFSDLSEEEFERMFM  115



>ref|XP_010918606.1| PREDICTED: probable cysteine proteinase A494 [Elaeis guineensis]
Length=376

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 42/85 (49%), Positives = 52/85 (61%), Gaps = 0/85 (0%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQL  261
            EDP IR V        +   +  F  F  +YGK Y ++EE+ +RL VF  NL RA  HQ 
Sbjct  33   EDPKIRPVTDLAGHRRVGATERRFRAFMRRYGKEYGSREEYGHRLGVFARNLARAAEHQA  92

Query  262  LDPSAVHGVTKFSDLTPKEFRRTFL  336
            LDP+AVHG+T FSDLT +EF R FL
Sbjct  93   LDPTAVHGITPFSDLTAEEFERAFL  117



>gb|KDO48246.1| hypothetical protein CISIN_1g037577mg, partial [Citrus sinensis]
Length=161

 Score = 86.3 bits (212),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 60/86 (70%), Gaps = 3/86 (3%)
 Frame = +1

Query  82   EDPLIRQVVSDGEDDALLNA--DHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRH  255
            ++P IRQV +D     LL +  +++F +F  KY KSYAT+EE+ +RL +F  N+ RA  H
Sbjct  31   QNPTIRQV-TDNPSHLLLGSATENNFKIFMQKYEKSYATREEYVHRLGIFAKNMIRAAEH  89

Query  256  QLLDPSAVHGVTKFSDLTPKEFRRTF  333
            QLLDP+AVHGVT FSDL+ +EF   +
Sbjct  90   QLLDPTAVHGVTPFSDLSEEEFESMY  115



>ref|XP_010243268.1| PREDICTED: cysteine proteinase 15A [Nelumbo nucifera]
Length=370

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 46/89 (52%), Positives = 55/89 (62%), Gaps = 5/89 (6%)
 Frame = +1

Query  82   EDPLIRQVVSDGED-----DALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRA  246
            E+P I QV  D        D  L  +  F  F +KYGK Y+T+EE+ YRL VF  N+ RA
Sbjct  30   EEPRIFQVTDDPTSRKFGGDWHLGTERKFQSFVNKYGKKYSTREEYLYRLGVFAKNIIRA  89

Query  247  KRHQLLDPSAVHGVTKFSDLTPKEFRRTF  333
              +Q LDP+AVHGVTKFSDLT  EF R F
Sbjct  90   AENQALDPTAVHGVTKFSDLTEDEFERLF  118



>ref|XP_002876278.1| hypothetical protein ARALYDRAFT_485911 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52537.1| hypothetical protein ARALYDRAFT_485911 [Arabidopsis lyrata subsp. 
lyrata]
Length=368

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 44/93 (47%), Positives = 64/93 (69%), Gaps = 4/93 (4%)
 Frame = +1

Query  67   VVRADEDPLIRQVVSDGED--DALL--NADHHFTLFKSKYGKSYATQEEHDYRLSVFKAN  234
            VV + ED  IRQV +D       LL  + +  F +F S YGK+Y+T+EE+ +RL +F  N
Sbjct  19   VVASVEDLTIRQVTADERRVRPNLLGTHTESKFRVFMSDYGKNYSTREEYIHRLGIFAKN  78

Query  235  LRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTF  333
            + +A  HQ++DP+AVHGVT+FSDLT +EF+R +
Sbjct  79   VLKAAEHQMMDPTAVHGVTQFSDLTEEEFKRMY  111



>gb|KFK34737.1| hypothetical protein AALP_AA5G186400 [Arabis alpina]
Length=369

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 43/88 (49%), Positives = 61/88 (69%), Gaps = 4/88 (5%)
 Frame = +1

Query  82   EDPLIRQVVSDGED--DALL--NADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAK  249
            ED  IRQV  D +     LL  + +  F +F S YGKSY+T+EE+ +RL +F  N+ +A 
Sbjct  25   EDLTIRQVTDDRQRVLPNLLGTHTETKFRVFMSDYGKSYSTREEYVHRLGIFARNVLKAA  84

Query  250  RHQLLDPSAVHGVTKFSDLTPKEFRRTF  333
             HQ++DP+AVHGVT+FSDLT KEF++ +
Sbjct  85   EHQMMDPTAVHGVTRFSDLTEKEFKKMY  112



>ref|XP_006293095.1| hypothetical protein CARUB_v10019394mg [Capsella rubella]
 gb|EOA25993.1| hypothetical protein CARUB_v10019394mg [Capsella rubella]
Length=367

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 43/92 (47%), Positives = 62/92 (67%), Gaps = 4/92 (4%)
 Frame = +1

Query  70   VRADEDPLIRQVVSDGED--DALL--NADHHFTLFKSKYGKSYATQEEHDYRLSVFKANL  237
            V + +D  IRQV  DG      LL  + +  F +F S +GKSY+T+EE+ +RL +F  N+
Sbjct  20   VASVDDITIRQVTDDGRQVRPNLLGTHTESKFRVFMSDFGKSYSTREEYVHRLGIFAKNV  79

Query  238  RRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTF  333
             +A  HQ++DP+AVHGVT+FSDLT  EF+R +
Sbjct  80   LKAAEHQMMDPTAVHGVTQFSDLTEDEFKRMY  111



>ref|XP_004157559.1| PREDICTED: cysteine proteinase 15A-like [Cucumis sativus]
Length=406

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 41/86 (48%), Positives = 58/86 (67%), Gaps = 2/86 (2%)
 Frame = +1

Query  85   DPLIRQVVSDGE--DDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  258
            DP   + V+DGE  ++    ++  F +F  KYGKSY T++E+ +R  +F  NL RA  HQ
Sbjct  65   DPEFLRQVTDGEIFNNLPAGSERKFVMFMEKYGKSYPTRKEYLHRFGIFVKNLIRAAEHQ  124

Query  259  LLDPSAVHGVTKFSDLTPKEFRRTFL  336
             LDP+AVHGVT+FSDL+ +EF R F+
Sbjct  125  ALDPTAVHGVTQFSDLSEEEFERMFM  150



>ref|XP_004142497.1| PREDICTED: cysteine proteinase 15A-like [Cucumis sativus]
 gb|KGN52244.1| hypothetical protein Csa_5G622590 [Cucumis sativus]
Length=406

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 41/86 (48%), Positives = 58/86 (67%), Gaps = 2/86 (2%)
 Frame = +1

Query  85   DPLIRQVVSDGE--DDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  258
            DP   + V+DGE  ++    ++  F +F  KYGKSY T++E+ +R  +F  NL RA  HQ
Sbjct  65   DPEFLRQVTDGEIFNNLPAGSERKFVMFMEKYGKSYPTRKEYLHRFGIFVKNLIRAAEHQ  124

Query  259  LLDPSAVHGVTKFSDLTPKEFRRTFL  336
             LDP+AVHGVT+FSDL+ +EF R F+
Sbjct  125  ALDPTAVHGVTQFSDLSEEEFERMFM  150



>ref|XP_002266821.1| PREDICTED: cysteine proteinase 15A [Vitis vinifera]
Length=375

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 42/89 (47%), Positives = 57/89 (64%), Gaps = 7/89 (8%)
 Frame = +1

Query  85   DPLIRQVVSDGED------DALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRA  246
            DP I QV +DG        D +L  +  F +F  KYGK Y+++EE+ +RL +F  N+ RA
Sbjct  34   DPNIVQV-TDGHSHRKFGVDGVLGTEKEFRMFMEKYGKEYSSREEYVHRLGIFAKNMVRA  92

Query  247  KRHQLLDPSAVHGVTKFSDLTPKEFRRTF  333
              HQ LDP+A+HGVT FSDL+ +EF R F
Sbjct  93   AEHQALDPTALHGVTPFSDLSEEEFERMF  121



>emb|CAA52403.1| putative thiol protease [Arabidopsis thaliana]
Length=313

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +1

Query  157  LFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFL  336
            LFK K+GK Y + EEH YR SVFKANL RA RHQ +DPSA HGVT+FSDLT  EFRR  L
Sbjct  2    LFKKKFGKVYGSIEEHYYRFSVFKANLLRAMRHQKMDPSARHGVTQFSDLTRSEFRRKHL  61



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 560672394880