BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001C18

Length=533
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004245615.1|  PREDICTED: glutathione S-transferase T1-like       240   4e-76   Solanum lycopersicum
ref|XP_006343997.1|  PREDICTED: glutathione S-transferase T1-like       236   8e-75   Solanum tuberosum [potatoes]
ref|XP_009600810.1|  PREDICTED: glutathione S-transferase T1-like       235   2e-74   Nicotiana tomentosiformis
ref|XP_009599399.1|  PREDICTED: glutathione S-transferase T1-like       234   3e-74   Nicotiana tomentosiformis
ref|XP_009796155.1|  PREDICTED: glutathione S-transferase T1-like       233   1e-73   Nicotiana sylvestris
gb|EYU23489.1|  hypothetical protein MIMGU_mgv1a012760mg                226   5e-71   Erythranthe guttata [common monkey flower]
ref|XP_006360687.1|  PREDICTED: glutathione S-transferase T1-like       225   2e-70   Solanum tuberosum [potatoes]
ref|XP_011080977.1|  PREDICTED: glutathione S-transferase T1-like       223   1e-69   Sesamum indicum [beniseed]
ref|XP_004252589.1|  PREDICTED: glutathione S-transferase T1            221   3e-69   Solanum lycopersicum
ref|XP_007160052.1|  hypothetical protein PHAVU_002G288600g             221   7e-69   Phaseolus vulgaris [French bean]
ref|XP_004503735.1|  PREDICTED: tRNA 2'-phosphotransferase 1-like...    221   8e-69   Cicer arietinum [garbanzo]
emb|CDP09756.1|  unnamed protein product                                221   9e-69   Coffea canephora [robusta coffee]
ref|XP_011072471.1|  PREDICTED: glutathione S-transferase T1            220   1e-68   Sesamum indicum [beniseed]
ref|XP_010053279.1|  PREDICTED: glutathione S-transferase T1            220   2e-68   Eucalyptus grandis [rose gum]
ref|XP_011072506.1|  PREDICTED: glutathione S-transferase T1-like       219   2e-68   Sesamum indicum [beniseed]
gb|AAF64449.1|AF239927_1  glutathione S-transferase                     219   3e-68   Euphorbia esula [wolf's milk]
ref|XP_007040202.1|  Glutathione S-transferase THETA 1                  216   3e-68   
ref|XP_011029250.1|  PREDICTED: glutathione S-transferase T1-like       219   3e-68   Populus euphratica
gb|KDP25451.1|  hypothetical protein JCGZ_20607                         218   1e-67   Jatropha curcas
ref|XP_006827675.1|  hypothetical protein AMTR_s00009p00255220          216   3e-67   Amborella trichopoda
ref|XP_009339919.1|  PREDICTED: glutathione S-transferase T1            217   3e-67   Pyrus x bretschneideri [bai li]
ref|XP_003630525.1|  Glutathione transferase                            214   4e-67   
gb|EYU38357.1|  hypothetical protein MIMGU_mgv1a012529mg                215   1e-66   Erythranthe guttata [common monkey flower]
emb|CDP09752.1|  unnamed protein product                                215   2e-66   Coffea canephora [robusta coffee]
ref|XP_002298040.2|  glutathione S-transferase family protein           215   2e-66   Populus trichocarpa [western balsam poplar]
gb|AFK47457.1|  unknown                                                 215   2e-66   Medicago truncatula
ref|XP_003630524.1|  Glutathione transferase                            215   2e-66   Medicago truncatula
ref|XP_002509785.1|  glutathione-s-transferase theta, gst, putative     213   1e-65   Ricinus communis
ref|XP_008794197.1|  PREDICTED: glutathione S-transferase T1 isof...    212   3e-65   Phoenix dactylifera
ref|XP_009386058.1|  PREDICTED: glutathione S-transferase T1-like       212   3e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007209508.1|  hypothetical protein PRUPE_ppa010414mg             212   4e-65   Prunus persica
ref|XP_011463848.1|  PREDICTED: glutathione S-transferase T1            211   5e-65   Fragaria vesca subsp. vesca
ref|XP_002509786.1|  glutathione-s-transferase theta, gst, putative     211   6e-65   Ricinus communis
ref|XP_008238862.1|  PREDICTED: glutathione S-transferase T1            211   7e-65   Prunus mume [ume]
gb|KJB52089.1|  hypothetical protein B456_008G246300                    210   1e-64   Gossypium raimondii
gb|ADB11337.1|  theta class glutathione transferase GSTT1               210   2e-64   Populus trichocarpa [western balsam poplar]
ref|XP_010255416.1|  PREDICTED: glutathione S-transferase T1            210   2e-64   Nelumbo nucifera [Indian lotus]
ref|XP_010909100.1|  PREDICTED: glutathione S-transferase T1 isof...    209   3e-64   Elaeis guineensis
gb|KHG19174.1|  Glutathione S-transferase T1 -like protein              209   4e-64   Gossypium arboreum [tree cotton]
ref|XP_009777222.1|  PREDICTED: glutathione S-transferase T1-like       208   8e-64   Nicotiana sylvestris
gb|AFK36240.1|  unknown                                                 208   1e-63   Lotus japonicus
ref|XP_004146527.1|  PREDICTED: glutathione S-transferase T1-like       207   1e-63   Cucumis sativus [cucumbers]
gb|ACC93946.1|  glutathione S-transferase                               207   2e-63   Panax ginseng [Asiatic ginseng]
gb|KJB39646.1|  hypothetical protein B456_007G023300                    207   2e-63   Gossypium raimondii
ref|XP_006476596.1|  PREDICTED: glutathione S-transferase T1-like       207   2e-63   Citrus sinensis [apfelsine]
gb|KDP25450.1|  hypothetical protein JCGZ_20606                         206   2e-63   Jatropha curcas
ref|XP_004503770.1|  PREDICTED: glutathione S-transferase T1-like       207   4e-63   Cicer arietinum [garbanzo]
ref|XP_002304489.1|  glutathione S-transferase family protein           205   8e-63   Populus trichocarpa [western balsam poplar]
ref|XP_008452024.1|  PREDICTED: glutathione S-transferase T1            205   9e-63   Cucumis melo [Oriental melon]
gb|ADB11338.1|  theta class glutathione transferase GSTT2               205   1e-62   Populus trichocarpa [western balsam poplar]
ref|XP_010553511.1|  PREDICTED: glutathione S-transferase T1            205   1e-62   Tarenaya hassleriana [spider flower]
ref|XP_011022714.1|  PREDICTED: glutathione S-transferase T1            204   1e-62   Populus euphratica
ref|XP_006439583.1|  hypothetical protein CICLE_v10021831mg             205   2e-62   Citrus clementina [clementine]
ref|NP_198937.1|  glutathione S-transferase THETA 1                     204   2e-62   Arabidopsis thaliana [mouse-ear cress]
emb|CDP09754.1|  unnamed protein product                                204   2e-62   Coffea canephora [robusta coffee]
gb|KDP36315.1|  hypothetical protein JCGZ_09530                         205   2e-62   Jatropha curcas
ref|XP_002868607.1|  hypothetical protein ARALYDRAFT_916086             204   5e-62   Arabidopsis lyrata subsp. lyrata
gb|KHG14410.1|  Glutathione S-transferase T1 -like protein              210   5e-62   Gossypium arboreum [tree cotton]
ref|XP_002272455.1|  PREDICTED: glutathione S-transferase T1            203   7e-62   
emb|CBI34681.3|  unnamed protein product                                204   7e-62   Vitis vinifera
gb|EMS35634.1|  Glutathione S-transferase theta-1                       202   1e-61   Triticum urartu
gb|AGC13145.1|  theta class glutathione S-transferase                   202   2e-61   Pinus tabuliformis [southern Chinese pine]
ref|NP_001068175.1|  Os11g0588300                                       202   2e-61   
ref|XP_006579426.1|  PREDICTED: uncharacterized protein LOC100799...    200   8e-61   
gb|KHN23653.1|  Glutathione S-transferase T1                            200   2e-60   Glycine soja [wild soybean]
ref|XP_006579425.1|  PREDICTED: uncharacterized protein LOC100799...    200   2e-60   
gb|AHA46533.1|  theta class glutathione S-transferase                   199   2e-60   Larix kaempferi [karamatsu]
ref|XP_010447179.1|  PREDICTED: glutathione S-transferase T1-like       199   2e-60   Camelina sativa [gold-of-pleasure]
gb|KHG21896.1|  Glutathione S-transferase T1 -like protein              199   2e-60   Gossypium arboreum [tree cotton]
ref|NP_001242886.1|  uncharacterized protein LOC100799229               198   4e-60   
gb|AET05003.2|  glutathione S-transferase, amino-terminal domain ...    199   4e-60   Medicago truncatula
ref|XP_003630527.1|  Glutathione S-transferase theta                    199   4e-60   
gb|KJB25823.1|  hypothetical protein B456_004G211100                    199   5e-60   Gossypium raimondii
gb|KJB25822.1|  hypothetical protein B456_004G211100                    198   6e-60   Gossypium raimondii
gb|AEB77874.1|  glutathione S-transferase protein                       197   1e-59   Bruguiera gymnorhiza [Burma mangrove]
ref|XP_010441287.1|  PREDICTED: glutathione S-transferase T1-like       197   1e-59   Camelina sativa [gold-of-pleasure]
ref|XP_006439582.1|  hypothetical protein CICLE_v10021879mg             197   2e-59   Citrus clementina [clementine]
ref|XP_003563992.1|  PREDICTED: glutathione S-transferase T1            198   2e-59   Brachypodium distachyon [annual false brome]
ref|XP_010436071.1|  PREDICTED: glutathione S-transferase T1            197   2e-59   Camelina sativa [gold-of-pleasure]
ref|XP_006405381.1|  hypothetical protein EUTSA_v10027900mg             196   3e-59   Eutrema salsugineum [saltwater cress]
gb|KHN23652.1|  Glutathione S-transferase T1                            196   5e-59   Glycine soja [wild soybean]
ref|NP_001236903.1|  glutathione S-transferase GST 23                   196   6e-59   
gb|KFK33026.1|  hypothetical protein AALP_AA6G320800                    196   6e-59   Arabis alpina [alpine rockcress]
ref|XP_003532409.1|  PREDICTED: glutathione S-transferase T2-like...    195   9e-59   
ref|NP_001152125.1|  glutathione S-transferase theta-1                  195   1e-58   Zea mays [maize]
gb|EMT22242.1|  hypothetical protein F775_32578                         195   1e-58   
emb|CDY71891.1|  BnaC06g42280D                                          194   1e-58   Brassica napus [oilseed rape]
ref|XP_004980948.1|  PREDICTED: glutathione S-transferase T1-like       194   2e-58   Setaria italica
emb|CAA10662.1|  glutathione transferase, GST 10b                       194   2e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009125179.1|  PREDICTED: glutathione S-transferase T1-like       194   2e-58   Brassica rapa
gb|ADE75690.1|  unknown                                                 194   3e-58   Picea sitchensis
emb|CDX67492.1|  BnaA07g15320D                                          194   3e-58   
ref|XP_006282694.1|  hypothetical protein CARUB_v10005614mg             192   1e-57   Capsella rubella
ref|XP_009386057.1|  PREDICTED: glutathione S-transferase T1-like       191   2e-57   
gb|EPS65585.1|  hypothetical protein M569_09192                         191   2e-57   Genlisea aurea
ref|XP_010676473.1|  PREDICTED: glutathione S-transferase T1            191   6e-57   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAB11100.1|  glutathione transferase                                190   7e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009140078.1|  PREDICTED: glutathione S-transferase T1-like       190   9e-57   Brassica rapa
emb|CDY39752.1|  BnaA04g11010D                                          189   2e-56   Brassica napus [oilseed rape]
ref|NP_198940.3|  glutathione S-transferase THETA 2                     197   3e-56   Arabidopsis thaliana [mouse-ear cress]
emb|CDY46386.1|  BnaC04g33050D                                          188   4e-56   Brassica napus [oilseed rape]
ref|XP_007160051.1|  hypothetical protein PHAVU_002G288500g             188   6e-56   Phaseolus vulgaris [French bean]
ref|XP_004245614.1|  PREDICTED: glutathione S-transferase T1            188   6e-56   Solanum lycopersicum
ref|XP_002449793.1|  hypothetical protein SORBIDRAFT_05g023450          187   1e-55   Sorghum bicolor [broomcorn]
emb|CDP09755.1|  unnamed protein product                                186   2e-55   Coffea canephora [robusta coffee]
ref|XP_008651869.1|  PREDICTED: LOW QUALITY PROTEIN: glutathione ...    182   3e-55   
ref|XP_002967178.1|  hypothetical protein SELMODRAFT_144252             186   3e-55   Selaginella moellendorffii
ref|XP_002960542.1|  hypothetical protein SELMODRAFT_74927              186   3e-55   
tpg|DAA43810.1|  TPA: hypothetical protein ZEAMMB73_384133              179   5e-54   
ref|NP_198938.1|  glutathione S-transferase THETA 3                     191   7e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006343999.1|  PREDICTED: glutathione S-transferase T1-like...    180   1e-53   
gb|KJB52088.1|  hypothetical protein B456_008G246300                    181   3e-53   Gossypium raimondii
ref|XP_006343998.1|  PREDICTED: glutathione S-transferase T1-like...    181   4e-53   Solanum tuberosum [potatoes]
ref|XP_001778018.1|  predicted protein                                  179   2e-52   
ref|XP_008794198.1|  PREDICTED: glutathione S-transferase T1 isof...    178   2e-52   
gb|KJB52086.1|  hypothetical protein B456_008G246300                    175   2e-51   Gossypium raimondii
emb|CDP09753.1|  unnamed protein product                                172   2e-51   Coffea canephora [robusta coffee]
ref|XP_002966830.1|  hypothetical protein SELMODRAFT_144283             175   5e-51   Selaginella moellendorffii
ref|XP_002961176.1|  hypothetical protein SELMODRAFT_270213             174   6e-51   Selaginella moellendorffii
gb|AFV96155.1|  glutathion-S-transferase theta                          174   6e-51   Brassica oleracea
ref|XP_002509787.1|  glutathione-s-transferase theta, gst, putative     174   8e-51   
ref|XP_010676472.1|  PREDICTED: glutathione S-transferase T1-like       173   3e-50   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003630526.1|  Glutathione transferase                            169   6e-50   
gb|KJB25825.1|  hypothetical protein B456_004G211100                    167   7e-48   Gossypium raimondii
gb|KJB52087.1|  hypothetical protein B456_008G246300                    166   1e-47   Gossypium raimondii
gb|ACI16511.1|  glutathione S-transferase                               161   2e-46   Cucumis sativus [cucumbers]
ref|XP_006584714.1|  PREDICTED: glutathione S-transferase T2-like...    162   5e-46   Glycine max [soybeans]
gb|KCW77543.1|  hypothetical protein EUGRSUZ_D01861                     159   4e-45   Eucalyptus grandis [rose gum]
ref|XP_002960536.1|  hypothetical protein SELMODRAFT_402877             157   4e-44   
gb|KJB25824.1|  hypothetical protein B456_004G211100                    157   4e-44   Gossypium raimondii
ref|XP_002967183.1|  hypothetical protein SELMODRAFT_407994             157   4e-44   
ref|XP_009774395.1|  PREDICTED: glutathione S-transferase T1-like       148   3e-41   Nicotiana sylvestris
ref|XP_008678005.1|  PREDICTED: glutathione S-transferase T1-like       147   4e-40   Zea mays [maize]
ref|XP_006663010.1|  PREDICTED: glutathione S-transferase T1-like       139   1e-37   
ref|XP_009769998.1|  PREDICTED: glutathione S-transferase T1-like       134   5e-37   Nicotiana sylvestris
ref|XP_008794199.1|  PREDICTED: glutathione S-transferase T1 isof...    137   1e-36   
gb|AFZ39143.1|  theta class glutathione S-transferase                   137   5e-36   Physcomitrella patens
ref|XP_001767888.1|  predicted protein                                  135   5e-36   
gb|AEB91980.1|  glutathione S-transferase theta 1                       135   7e-36   Locusta migratoria
ref|XP_005848771.1|  hypothetical protein CHLNCDRAFT_57549              135   1e-35   Chlorella variabilis
emb|CDP22238.1|  unnamed protein product                                130   3e-35   Coffea canephora [robusta coffee]
gb|EWS75951.1|  glutathione S-transferase, amine-terminal domain ...    132   1e-34   Tetrahymena thermophila SB210
ref|XP_010573725.1|  PREDICTED: glutathione S-transferase theta-1...    132   2e-34   Haliaeetus leucocephalus
ref|XP_003727085.1|  PREDICTED: glutathione S-transferase theta-1...    132   2e-34   Strongylocentrotus purpuratus [purple urchin]
ref|XP_005524538.1|  PREDICTED: glutathione S-transferase theta-1...    132   2e-34   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_006822345.1|  PREDICTED: glutathione S-transferase theta-1...    131   3e-34   Saccoglossus kowalevskii
ref|XP_002157119.2|  PREDICTED: glutathione S-transferase T1-like       131   3e-34   Hydra vulgaris
ref|XP_002463456.1|  hypothetical protein SORBIDRAFT_01g000230          129   7e-34   
ref|XP_009006212.1|  PREDICTED: glutathione S-transferase theta-1...    130   1e-33   Callithrix jacchus [common marmoset]
gb|ELK15601.1|  Glutathione S-transferase theta-1                       130   1e-33   Pteropus alecto
ref|XP_011072496.1|  PREDICTED: glutathione S-transferase T1-like       129   1e-33   
ref|XP_010909099.1|  PREDICTED: glutathione S-transferase T1 isof...    129   1e-33   
ref|XP_007973334.1|  PREDICTED: glutathione S-transferase theta-1       130   1e-33   Chlorocebus sabaeus
ref|XP_006908737.1|  PREDICTED: glutathione S-transferase theta-1...    129   2e-33   Pteropus alecto
ref|XP_003485831.1|  PREDICTED: glutathione S-transferase theta-1...    129   2e-33   
emb|CDW81275.1|  glutathione s-transferase theta-1                      129   3e-33   Stylonychia lemnae
ref|XP_010396446.1|  PREDICTED: glutathione S-transferase theta-1...    129   3e-33   Corvus cornix cornix
ref|XP_005595439.1|  PREDICTED: glutathione S-transferase theta-1...    129   3e-33   
ref|XP_003919137.1|  PREDICTED: glutathione S-transferase theta-1...    129   3e-33   Papio anubis [baboon]
ref|XP_010368118.1|  PREDICTED: glutathione S-transferase theta-1...    129   3e-33   Rhinopithecus roxellana
ref|XP_008500992.1|  PREDICTED: LOW QUALITY PROTEIN: glutathione ...    129   4e-33   Calypte anna
ref|XP_005054826.1|  PREDICTED: glutathione S-transferase theta-1...    129   4e-33   Ficedula albicollis
ref|XP_004346352.1|  glutathione S-transferase domain-containing ...    128   7e-33   Capsaspora owczarzaki ATCC 30864
ref|XP_001489453.1|  PREDICTED: glutathione S-transferase theta-1...    128   7e-33   Equus caballus [domestic horse]
ref|XP_004607625.1|  PREDICTED: glutathione S-transferase theta-1...    128   8e-33   Sorex araneus [Eurasian shrew]
ref|XP_004680982.1|  PREDICTED: glutathione S-transferase theta-1...    128   8e-33   
ref|XP_003397510.1|  PREDICTED: glutathione S-transferase theta-1...    128   9e-33   
ref|XP_005334521.1|  PREDICTED: glutathione S-transferase theta-1...    128   9e-33   Ictidomys tridecemlineatus
ref|XP_005023587.1|  PREDICTED: glutathione S-transferase theta-1...    128   9e-33   Anas platyrhynchos [duck]
ref|XP_006106312.1|  PREDICTED: glutathione S-transferase theta-1...    127   1e-32   Myotis lucifugus
ref|XP_002830963.1|  PREDICTED: glutathione S-transferase theta-1...    127   1e-32   
ref|XP_003639976.1|  PREDICTED: glutathione S-transferase theta-1...    127   1e-32   Canis lupus familiaris [dogs]
ref|XP_006130307.1|  PREDICTED: glutathione S-transferase theta-1...    127   1e-32   
gb|EHH25431.1|  hypothetical protein EGK_21202                          127   1e-32   Macaca mulatta [rhesus macaque]
ref|XP_003994894.3|  PREDICTED: glutathione S-transferase theta-1       127   1e-32   
ref|XP_002200008.1|  PREDICTED: glutathione S-transferase theta-1...    127   1e-32   Taeniopygia guttata
ref|XP_007092375.1|  PREDICTED: glutathione S-transferase theta-1...    127   1e-32   Panthera tigris altaica
gb|EHH61703.1|  hypothetical protein EGM_19746                          127   2e-32   Macaca fascicularis [crab eating macaque]
ref|XP_007957332.1|  PREDICTED: glutathione S-transferase theta-1...    127   2e-32   Orycteropus afer afer
ref|XP_001089367.1|  PREDICTED: glutathione S-transferase theta-1...    127   2e-32   
ref|XP_008566801.1|  PREDICTED: glutathione S-transferase theta-1...    127   2e-32   Galeopterus variegatus [Malayan flying lemur]
ref|XP_001929409.1|  PREDICTED: glutathione S-transferase theta-1...    127   2e-32   
ref|XP_004742534.1|  PREDICTED: glutathione S-transferase theta-1...    127   2e-32   Mustela putorius furo [black ferret]
gb|AII00841.1|  glutathione S-transferase theta 1                       127   2e-32   Canis lupus familiaris [dogs]
ref|XP_005886352.1|  PREDICTED: glutathione S-transferase theta-1...    127   2e-32   Myotis brandtii
ref|XP_534751.3|  PREDICTED: glutathione S-transferase theta-1          127   2e-32   Canis lupus familiaris [dogs]
ref|XP_008066997.1|  PREDICTED: glutathione S-transferase theta-1       126   3e-32   Carlito syrichta
gb|AHH29314.1|  glutathione S-transferase T1                            126   3e-32   Macaca mulatta [rhesus macaque]
gb|AHH29313.1|  glutathione S-transferase T1                            126   3e-32   Macaca fascicularis [crab eating macaque]
gb|AAV38754.1|  glutathione S-transferase theta 1                       126   3e-32   Homo sapiens [man]
pdb|2C3Q|A  Chain A, Human Glutathione-S-Transferase T1-1 W234r M...    126   3e-32   Homo sapiens [man]
ref|NP_000844.2|  glutathione S-transferase theta-1 isoform a           126   3e-32   Homo sapiens [man]
ref|XP_008961689.1|  PREDICTED: glutathione S-transferase theta-1...    126   4e-32   Pan paniscus [bonobo]
ref|XP_004063215.1|  PREDICTED: glutathione S-transferase theta-1       126   4e-32   Gorilla gorilla gorilla [lowland gorilla]
ref|XP_008155438.1|  PREDICTED: glutathione S-transferase theta-1       126   4e-32   Eptesicus fuscus
ref|XP_004636372.1|  PREDICTED: glutathione S-transferase theta-1...    126   4e-32   Octodon degus
pdb|2C3N|A  Chain A, Human Glutathione-S-Transferase T1-1, Apo Form     126   4e-32   Homo sapiens [man]
ref|XP_003938575.1|  PREDICTED: glutathione S-transferase theta-1...    126   4e-32   Saimiri boliviensis boliviensis
ref|XP_008248399.1|  PREDICTED: glutathione S-transferase theta-1...    125   5e-32   
emb|CAA55935.1|  glutathione transferase T1                             126   5e-32   Homo sapiens [man]
ref|XP_008248398.1|  PREDICTED: glutathione S-transferase theta-1...    125   5e-32   
ref|XP_010953752.1|  PREDICTED: glutathione S-transferase theta-2...    125   5e-32   Camelus bactrianus [camel]
ref|XP_003803343.1|  PREDICTED: glutathione S-transferase theta-1...    125   6e-32   Otolemur garnettii
ref|XP_011400420.1|  Glutathione S-transferase theta-2B                 131   6e-32   Auxenochlorella protothecoides
ref|XP_004466461.1|  PREDICTED: glutathione S-transferase theta-1...    125   7e-32   Dasypus novemcinctus
ref|XP_009090481.1|  PREDICTED: glutathione S-transferase theta-1...    125   1e-31   Serinus canaria [canary]
ref|XP_010953754.1|  PREDICTED: glutathione S-transferase theta-2...    125   1e-31   Camelus bactrianus [camel]
ref|XP_007063803.1|  PREDICTED: glutathione S-transferase theta-1...    125   1e-31   Chelonia mydas [green seaturtle]
ref|XP_004400592.1|  PREDICTED: glutathione S-transferase theta-1...    125   1e-31   Odobenus rosmarus divergens
ref|XP_010985617.1|  PREDICTED: glutathione S-transferase theta-1...    125   1e-31   Camelus dromedarius [camel]
ref|XP_006746108.1|  PREDICTED: glutathione S-transferase theta-1...    125   1e-31   Leptonychotes weddellii
gb|AHC08064.1|  theta glutathione S-transferase                         124   1e-31   Locusta migratoria
ref|NP_956815.1|  glutathione S-transferase theta-like                  125   1e-31   
ref|XP_004318777.1|  PREDICTED: glutathione S-transferase theta-1...    124   1e-31   
ref|XP_006513055.1|  PREDICTED: glutathione S-transferase, theta ...    124   1e-31   
ref|XP_007092374.1|  PREDICTED: glutathione S-transferase theta-1...    124   1e-31   Panthera tigris altaica
ref|XP_003994893.1|  PREDICTED: glutathione S-transferase theta-1...    124   2e-31   Felis catus [cat]
ref|XP_005147828.1|  PREDICTED: glutathione S-transferase theta-1...    124   2e-31   Melopsittacus undulatus
ref|XP_790223.2|  PREDICTED: glutathione S-transferase theta-1-like     124   2e-31   Strongylocentrotus purpuratus [purple urchin]
ref|XP_004466459.1|  PREDICTED: glutathione S-transferase theta-1...    125   2e-31   
ref|XP_004742533.1|  PREDICTED: glutathione S-transferase theta-1...    126   2e-31   
ref|XP_006213356.1|  PREDICTED: glutathione S-transferase theta-1...    124   2e-31   Vicugna pacos
ref|XP_003803344.1|  PREDICTED: glutathione S-transferase theta-1...    124   2e-31   Otolemur garnettii
ref|XP_005288627.1|  PREDICTED: glutathione S-transferase theta-1...    124   2e-31   Chrysemys picta bellii
ref|XP_005396465.1|  PREDICTED: glutathione S-transferase theta-1...    124   2e-31   Chinchilla lanigera
ref|XP_007451118.1|  PREDICTED: glutathione S-transferase theta-1...    124   2e-31   Lipotes vexillifer [baiji]
ref|NP_598755.1|  glutathione S-transferase, theta 3                    124   3e-31   Mus musculus [mouse]
ref|XP_006874993.1|  PREDICTED: glutathione S-transferase theta-1...    124   3e-31   Chrysochloris asiatica
ref|XP_005334522.1|  PREDICTED: glutathione S-transferase theta-1...    124   3e-31   Ictidomys tridecemlineatus
gb|AAX29474.1|  glutathione S-transferase theta 1                       124   3e-31   synthetic construct
gb|AAH07065.1|  Glutathione S-transferase theta 1                       124   3e-31   Homo sapiens [man]
ref|XP_007127246.1|  PREDICTED: glutathione S-transferase theta-1...    124   3e-31   Physeter catodon
gb|KFO57915.1|  Glutathione S-transferase theta-1                       124   3e-31   Corvus brachyrhynchos
ref|XP_008630325.1|  PREDICTED: glutathione S-transferase theta-1...    124   4e-31   Corvus brachyrhynchos
dbj|BAB22023.1|  unnamed protein product                                123   4e-31   Mus musculus [mouse]
emb|CAA66665.1|  glutathione S-transferase theta                        123   4e-31   Mus musculus [mouse]
ref|XP_003508143.1|  PREDICTED: glutathione S-transferase theta-1       123   4e-31   Cricetulus griseus [Chinese hamsters]
ref|NP_032211.3|  glutathione S-transferase theta-1                     123   5e-31   Mus musculus [mouse]
gb|AAH62201.1|  Glutathione S-transferase, theta 3                      123   5e-31   Mus musculus [mouse]
ref|XP_797684.3|  PREDICTED: glutathione S-transferase theta-1-like     123   5e-31   Strongylocentrotus purpuratus [purple urchin]
ref|XP_003281783.1|  PREDICTED: glutathione S-transferase theta-1...    123   6e-31   Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_005288626.1|  PREDICTED: glutathione S-transferase theta-1...    123   6e-31   Chrysemys picta bellii
gb|ABQ82132.1|  glutathione S-transferase theta                         122   6e-31   Alitta succinea
ref|XP_005360257.1|  PREDICTED: glutathione S-transferase theta-1...    124   6e-31   Microtus ochrogaster [prairie voles]
ref|NP_445745.1|  glutathione S-transferase theta-1                     123   7e-31   Rattus norvegicus [brown rat]
ref|XP_005396466.1|  PREDICTED: glutathione S-transferase theta-1...    123   7e-31   Chinchilla lanigera
ref|XP_005987168.1|  PREDICTED: glutathione S-transferase theta-1...    123   7e-31   
ref|XP_004887553.1|  PREDICTED: glutathione S-transferase theta-1...    122   8e-31   
ref|XP_004843627.1|  PREDICTED: glutathione S-transferase theta-1...    122   8e-31   Heterocephalus glaber [naked mole rat]
ref|XP_004742535.1|  PREDICTED: glutathione S-transferase theta-1...    122   9e-31   Mustela putorius furo [black ferret]
ref|XP_004466458.1|  PREDICTED: glutathione S-transferase theta-1...    122   9e-31   Dasypus novemcinctus
ref|XP_006213357.1|  PREDICTED: glutathione S-transferase theta-1...    122   9e-31   Vicugna pacos
ref|XP_007646923.1|  PREDICTED: glutathione S-transferase theta-1       122   9e-31   Cricetulus griseus [Chinese hamsters]
ref|XP_004681155.1|  PREDICTED: glutathione S-transferase theta-1...    122   1e-30   Condylura cristata
ref|XP_008122745.1|  PREDICTED: LOW QUALITY PROTEIN: glutathione ...    123   1e-30   
ref|XP_006157221.1|  PREDICTED: glutathione S-transferase theta-1...    122   1e-30   Tupaia chinensis
ref|XP_010985616.1|  PREDICTED: glutathione S-transferase theta-1       122   1e-30   Camelus dromedarius [camel]
gb|EJY86624.1|  Glutathione S-transferase T1                            122   1e-30   Oxytricha trifallax
ref|XP_005070806.1|  PREDICTED: glutathione S-transferase theta-1...    122   1e-30   Mesocricetus auratus [Syrian golden hamster]
gb|EMP32140.1|  Glutathione S-transferase theta-1                       125   1e-30   Chelonia mydas [green seaturtle]
gb|EJY80394.1|  Glutathione S-transferase T1                            122   1e-30   Oxytricha trifallax
ref|XP_007973333.1|  PREDICTED: LOW QUALITY PROTEIN: glutathione ...    122   1e-30   Chlorocebus sabaeus
ref|XP_004276138.1|  PREDICTED: glutathione S-transferase theta-1...    122   2e-30   
ref|XP_008695753.1|  PREDICTED: glutathione S-transferase theta-1...    122   2e-30   Ursus maritimus [white bear]
ref|XP_005987166.1|  PREDICTED: glutathione S-transferase theta-1...    122   2e-30   Latimeria chalumnae
ref|XP_006048174.1|  PREDICTED: glutathione S-transferase theta-1...    122   2e-30   Bubalus bubalis [domestic water buffalo]
ref|XP_008825395.1|  PREDICTED: glutathione S-transferase theta-1...    119   2e-30   
ref|XP_010858349.1|  PREDICTED: glutathione S-transferase theta-1...    122   2e-30   Bison bison bison
ref|XP_007196373.1|  PREDICTED: glutathione S-transferase theta-1...    122   2e-30   Balaenoptera acutorostrata scammoni
ref|XP_001929405.1|  PREDICTED: glutathione S-transferase theta-1       121   2e-30   
ref|NP_001039697.1|  glutathione S-transferase theta-1                  121   2e-30   Bos taurus [bovine]
gb|AAB03534.1|  glutathione transferase theta class type 2              121   2e-30   Mus musculus [mouse]
ref|NP_034491.2|  glutathione S-transferase theta-2                     121   2e-30   Mus musculus [mouse]
ref|XP_001195869.2|  PREDICTED: glutathione S-transferase theta-1...    121   2e-30   Strongylocentrotus purpuratus [purple urchin]
gb|KDD76756.1|  hypothetical protein H632_c117p3                        124   3e-30   Helicosporidium sp. ATCC 50920
ref|NP_036928.1|  glutathione S-transferase theta-2                     121   3e-30   Rattus norvegicus [brown rat]
ref|XP_004362055.1|  hypothetical protein DFA_06351                     120   3e-30   Cavenderia fasciculata
ref|XP_003478005.2|  PREDICTED: glutathione S-transferase theta-1...    121   3e-30   Cavia porcellus [guinea pig]
ref|XP_006277068.1|  PREDICTED: glutathione S-transferase theta-1...    121   3e-30   Alligator mississippiensis
ref|XP_006019954.1|  PREDICTED: glutathione S-transferase theta-1...    121   3e-30   
ref|XP_006979147.1|  PREDICTED: glutathione S-transferase theta-1...    121   4e-30   
ref|NP_001131115.1|  glutathione S-transferase, theta 3                 120   4e-30   
ref|XP_003919135.1|  PREDICTED: glutathione S-transferase theta-2B      120   5e-30   
ref|XP_010602226.1|  PREDICTED: glutathione S-transferase theta-1...    120   5e-30   
ref|XP_004592181.1|  PREDICTED: glutathione S-transferase theta-1...    120   5e-30   
ref|XP_005360258.1|  PREDICTED: glutathione S-transferase theta-1...    120   6e-30   
ref|XP_008248397.1|  PREDICTED: LOW QUALITY PROTEIN: glutathione ...    120   6e-30   
ref|XP_006121722.1|  PREDICTED: glutathione S-transferase theta-1...    120   7e-30   
ref|XP_006997739.1|  PREDICTED: glutathione S-transferase theta-2...    120   7e-30   
ref|XP_006768810.1|  PREDICTED: glutathione S-transferase theta-1...    120   8e-30   
ref|XP_006874994.1|  PREDICTED: glutathione S-transferase theta-1...    120   8e-30   
ref|XP_008566800.1|  PREDICTED: glutathione S-transferase theta-1...    122   9e-30   
ref|XP_005070805.1|  PREDICTED: glutathione S-transferase theta-1...    120   1e-29   
ref|XP_004887554.1|  PREDICTED: glutathione S-transferase theta-1...    120   1e-29   
ref|XP_004443156.1|  PREDICTED: glutathione S-transferase theta-1...    120   1e-29   
ref|XP_011332867.1|  PREDICTED: glutathione S-transferase theta-1...    119   1e-29   
ref|XP_008838833.1|  PREDICTED: glutathione S-transferase theta-1...    119   1e-29   
ref|XP_003419175.1|  PREDICTED: glutathione S-transferase theta-1...    119   1e-29   
ref|XP_004337203.1|  glutathione Stransferase, C-terminal domain ...    120   1e-29   
ref|XP_004670992.1|  PREDICTED: glutathione S-transferase theta-1...    119   2e-29   
gb|KGL79187.1|  Glutathione S-transferase theta-1                       119   2e-29   
ref|XP_002925099.1|  PREDICTED: glutathione S-transferase theta-1       119   2e-29   
ref|XP_010718625.1|  PREDICTED: glutathione S-transferase theta-1...    119   2e-29   
ref|XP_797671.3|  PREDICTED: glutathione S-transferase theta-1-like     119   2e-29   
ref|XP_780216.3|  PREDICTED: glutathione S-transferase theta-1-like     119   2e-29   
ref|XP_007520872.1|  PREDICTED: glutathione S-transferase theta-1...    119   2e-29   
ref|XP_005334523.1|  PREDICTED: glutathione S-transferase theta-2...    120   2e-29   
gb|EHH16568.1|  hypothetical protein EGK_11862                          119   2e-29   
ref|XP_001106578.1|  PREDICTED: glutathione S-transferase theta-2...    119   2e-29   
gb|EHH62577.1|  hypothetical protein EGM_20970                          119   2e-29   
ref|NP_001244563.1|  glutathione S-transferase theta 2                  119   2e-29   
ref|XP_001106693.1|  PREDICTED: glutathione S-transferase theta-2...    119   2e-29   
ref|XP_004670993.1|  PREDICTED: glutathione S-transferase theta-2...    119   3e-29   
ref|XP_007063835.1|  PREDICTED: glutathione S-transferase theta-1...    119   3e-29   
ref|XP_006048173.1|  PREDICTED: glutathione S-transferase theta-1...    119   3e-29   
ref|XP_001426880.1|  hypothetical protein                               118   3e-29   
ref|XP_006640254.1|  PREDICTED: glutathione S-transferase theta-1...    118   3e-29   
ref|XP_007906035.1|  PREDICTED: LOW QUALITY PROTEIN: glutathione ...    118   3e-29   
ref|NP_001069206.1|  glutathione S-transferase theta-2                  118   3e-29   
ref|XP_010602224.1|  PREDICTED: glutathione S-transferase theta-1...    118   4e-29   
ref|XP_005901647.1|  PREDICTED: glutathione S-transferase theta-1...    118   4e-29   
gb|ELR52175.1|  Glutathione S-transferase theta-1                       118   4e-29   
ref|XP_006140270.1|  PREDICTED: glutathione S-transferase theta-1...    115   5e-29   
ref|XP_010953749.1|  PREDICTED: glutathione S-transferase theta-1...    118   7e-29   
ref|XP_002925113.1|  PREDICTED: glutathione S-transferase theta-1...    117   7e-29   
ref|XP_003730181.1|  PREDICTED: glutathione S-transferase theta-1...    117   7e-29   
ref|XP_011354287.1|  PREDICTED: glutathione S-transferase theta-1...    117   8e-29   
ref|XP_006908738.1|  PREDICTED: glutathione S-transferase theta-1...    117   8e-29   
ref|XP_004017553.1|  PREDICTED: glutathione S-transferase theta-1...    117   8e-29   
ref|XP_008695752.1|  PREDICTED: glutathione S-transferase theta-1...    117   9e-29   
ref|XP_005691800.1|  PREDICTED: glutathione S-transferase theta-1...    117   9e-29   
ref|XP_797660.1|  PREDICTED: glutathione S-transferase theta-1-like     117   9e-29   
ref|XP_010215724.1|  PREDICTED: glutathione S-transferase theta-1...    119   1e-28   
emb|CDW75647.1|  glutathione s-transferase domain-containing protein    117   1e-28   
ref|XP_001659668.2|  AAEL009016-PA                                      117   1e-28   
ref|XP_004400591.1|  PREDICTED: glutathione S-transferase theta-1...    117   1e-28   
ref|XP_005959724.1|  PREDICTED: glutathione S-transferase theta-1...    117   1e-28   
ref|XP_004887550.1|  PREDICTED: glutathione S-transferase theta-1...    117   1e-28   
gb|AAV68400.1|  glutathione S-transferase theta 2                       116   1e-28   
gb|ACI34093.1|  Glutathione S-transferase theta-1                       116   2e-28   
gb|ADO27893.1|  glutathione S-transferase theta-1                       117   2e-28   
gb|EHB04748.1|  Glutathione S-transferase theta-1                       117   2e-28   
ref|XP_005503935.1|  PREDICTED: glutathione S-transferase theta-1...    117   2e-28   
gb|EHB04747.1|  Glutathione S-transferase theta-1                       116   2e-28   
ref|XP_006901484.1|  PREDICTED: glutathione S-transferase theta-2...    116   2e-28   
ref|XP_004887549.1|  PREDICTED: glutathione S-transferase theta-1...    116   2e-28   
ref|XP_003508145.1|  PREDICTED: glutathione S-transferase theta-2       116   2e-28   
ref|XP_006901483.1|  PREDICTED: glutathione S-transferase theta-2...    116   2e-28   
ref|XP_004742536.1|  PREDICTED: glutathione S-transferase theta-1...    114   2e-28   
ref|XP_007657957.1|  PREDICTED: glutathione S-transferase theta-1...    116   3e-28   
ref|XP_780137.3|  PREDICTED: glutathione S-transferase theta-1-like     115   3e-28   
gb|KDD76755.1|  hypothetical protein H632_c117p2                        115   3e-28   
ref|XP_003478006.2|  PREDICTED: glutathione S-transferase theta-1...    116   3e-28   
gb|EFB19466.1|  hypothetical protein PANDA_014538                       112   3e-28   
ref|XP_008566796.1|  PREDICTED: glutathione S-transferase theta-2...    116   3e-28   
emb|CDQ65962.1|  unnamed protein product                                115   3e-28   
ref|XP_008534717.1|  PREDICTED: glutathione S-transferase theta-1...    115   3e-28   
ref|XP_004607626.1|  PREDICTED: glutathione S-transferase theta-1...    115   3e-28   
ref|XP_004354059.1|  glutathione transferase family protein             115   4e-28   
ref|XP_004636371.1|  PREDICTED: glutathione S-transferase theta-1...    115   4e-28   
ref|XP_005360260.1|  PREDICTED: glutathione S-transferase theta-2...    115   5e-28   
ref|XP_005167246.1|  PREDICTED: glutathione S-transferase theta-1...    114   5e-28   
gb|KJB52085.1|  hypothetical protein B456_008G246200                    111   6e-28   
ref|XP_004716394.1|  PREDICTED: glutathione S-transferase theta-1...    115   6e-28   
ref|NP_001279515.1|  glutathione S-transferase theta-1-like             115   7e-28   
emb|CCQ19302.1|  GST-theta                                              114   8e-28   
ref|XP_010875032.1|  PREDICTED: glutathione S-transferase theta-1...    114   9e-28   
ref|XP_005901654.1|  PREDICTED: glutathione S-transferase theta-1...    114   9e-28   
gb|ELR52176.1|  Glutathione S-transferase theta-1                       114   9e-28   
gb|KDR15740.1|  Glutathione S-transferase theta-1                       114   1e-27   
gb|EJY66553.1|  hypothetical protein OXYTRI_13160                       114   1e-27   
ref|XP_002605845.1|  hypothetical protein BRAFLDRAFT_123804             114   1e-27   
ref|NP_001187546.1|  glutathione S-transferase theta-1                  114   1e-27   
emb|CDW75323.1|  glutathione s-transferase domain-containing protein    114   1e-27   
ref|XP_009909247.1|  PREDICTED: glutathione S-transferase theta-2       114   1e-27   
ref|NP_001006811.1|  glutathione S-transferase theta 1                  114   1e-27   
ref|XP_011241675.1|  PREDICTED: glutathione S-transferase theta-2...    114   1e-27   
ref|XP_003387291.1|  PREDICTED: glutathione S-transferase T1-like       114   1e-27   
ref|XP_001231971.3|  PREDICTED: glutathione S-transferase theta-1...    115   2e-27   
ref|XP_007520826.1|  PREDICTED: glutathione S-transferase theta-1...    114   2e-27   
emb|CDW72288.1|  glutathione s-transferase domain-containing protein    114   2e-27   
gb|EJY80586.1|  Glutathione S-transferase                               114   2e-27   
ref|XP_692427.1|  PREDICTED: glutathione S-transferase theta-1 is...    114   2e-27   
gb|ABD67512.1|  glutathione S-transferase theta                         111   2e-27   
ref|XP_011430263.1|  PREDICTED: glutathione S-transferase theta-1...    113   2e-27   
ref|XP_006768844.1|  PREDICTED: glutathione S-transferase theta-1...    114   2e-27   
gb|AFO69981.1|  GST_theta-like protein                                  113   3e-27   
ref|XP_008400753.1|  PREDICTED: glutathione S-transferase theta-1...    113   3e-27   
ref|XP_003478004.2|  PREDICTED: glutathione S-transferase theta-2       113   3e-27   
ref|XP_004742538.1|  PREDICTED: glutathione S-transferase theta-1...    113   3e-27   
ref|XP_009090484.1|  PREDICTED: glutathione S-transferase theta-1...    113   3e-27   
gb|AGO58894.1|  glutathione S-transferase theta 1a                      113   4e-27   
ref|XP_006620387.1|  PREDICTED: glutathione S-transferase theta-1...    112   4e-27   
ref|XP_004085257.1|  PREDICTED: glutathione S-transferase theta-1...    112   4e-27   
ref|XP_002115221.1|  expressed hypothetical protein                     112   4e-27   
gb|EJY70920.1|  Glutathione S-transferase domain-containing protein     113   4e-27   
ref|XP_011136696.1|  PREDICTED: glutathione S-transferase theta-1...    112   4e-27   
ref|XP_004817175.1|  PREDICTED: LOW QUALITY PROTEIN: glutathione ...    113   5e-27   
gb|AEA86294.1|  putative glutathione S-transferase theta-2              110   5e-27   
ref|XP_008155437.1|  PREDICTED: glutathione S-transferase theta-1...    112   5e-27   
ref|XP_004400589.1|  PREDICTED: glutathione S-transferase theta-1...    112   5e-27   
ref|NP_001156289.1|  glutathione S-transferase, theta class-like        112   5e-27   
gb|AAB03533.1|  theta class glutathione transferase type 2              112   6e-27   
ref|XP_002115231.1|  hypothetical protein TRIADDRAFT_59204              112   6e-27   
ref|XP_003230207.2|  PREDICTED: glutathione S-transferase theta-1...    114   6e-27   
ref|XP_003387275.1|  PREDICTED: glutathione S-transferase theta-2...    112   7e-27   
gb|ACI66391.1|  Glutathione S-transferase theta-1                       112   7e-27   
ref|XP_002931957.2|  PREDICTED: glutathione S-transferase theta-1       112   7e-27   
gb|EPQ20308.1|  Glutathione S-transferase theta-1                       108   9e-27   
gb|KFO23710.1|  Calcineurin-binding protein cabin-1                     118   9e-27   
ref|NP_001085203.1|  glutathione S-transferase theta 1                  112   9e-27   
ref|XP_002429863.1|  GSTD1-5 protein, putative                          111   9e-27   
gb|AFJ75807.1|  glutathione s-transferase T1                            112   1e-26   
ref|XP_004503732.1|  PREDICTED: tRNA 2'-phosphotransferase 1-like...    113   1e-26   
gb|AAH87825.1|  gstt1-prov protein                                      112   1e-26   
ref|XP_007578350.1|  PREDICTED: glutathione S-transferase theta-1...    111   1e-26   
ref|XP_007520874.1|  PREDICTED: glutathione S-transferase theta-1...    112   1e-26   
pdb|4MPG|A  Chain A, Crystal Structure Of Human Glutathione Trans...    112   1e-26   
ref|XP_011159137.1|  PREDICTED: glutathione S-transferase theta-1...    111   1e-26   
ref|NP_001165927.1|  glutathione S-transferase T3                       111   1e-26   
ref|XP_002834662.1|  PREDICTED: glutathione S-transferase theta-2B      111   1e-26   
ref|XP_004607499.1|  PREDICTED: glutathione S-transferase theta-2...    111   2e-26   
gb|ELK26410.1|  Glutathione S-transferase theta-1                       113   2e-26   
ref|XP_011293522.1|  PREDICTED: LOW QUALITY PROTEIN: glutathione ...    111   2e-26   
ref|XP_005261772.1|  PREDICTED: glutathione S-transferase theta-2...    110   2e-26   
ref|XP_006938700.1|  PREDICTED: glutathione S-transferase theta-1...    111   2e-26   
gb|AEW26632.1|  GSTT2                                                   111   2e-26   
gb|AAV38755.1|  glutathione S-transferase theta 2                       111   2e-26   
ref|XP_004063211.1|  PREDICTED: glutathione S-transferase theta-2...    110   2e-26   
ref|XP_780057.1|  PREDICTED: glutathione S-transferase theta-1-like     110   2e-26   
ref|NP_001289599.1|  glutathione S-transferase theta-2 isoform b        110   2e-26   
gb|AAC13317.1|  glutathione S-transferase theta 2                       111   2e-26   
pdb|4MPF|A  Chain A, Crystal Structure Of Human Glutathione Trans...    111   2e-26   
ref|XP_004063210.1|  PREDICTED: glutathione S-transferase theta-2...    111   2e-26   
ref|NP_000845.2|  glutathione S-transferase theta-2 isoform a           111   2e-26   
ref|NP_001074312.1|  glutathione S-transferase theta-2B                 111   3e-26   
ref|XP_007092376.1|  PREDICTED: glutathione S-transferase theta-1...    110   3e-26   
ref|XP_005815453.1|  PREDICTED: glutathione S-transferase theta-1...    107   3e-26   
ref|XP_002115230.1|  hypothetical protein TRIADDRAFT_59202              110   3e-26   
ref|XP_002925097.1|  PREDICTED: glutathione S-transferase theta-2B      110   3e-26   
emb|CDW86738.1|  glutathione transferase 10                             110   3e-26   
ref|XP_003811116.1|  PREDICTED: glutathione S-transferase theta-2...    110   3e-26   
gb|AEW26637.1|  GSTT2B                                                  110   3e-26   
gb|AEW26633.1|  GSTT2B                                                  110   3e-26   
ref|XP_515243.2|  PREDICTED: glutathione S-transferase theta-2          110   3e-26   
ref|XP_316865.2|  AGAP000888-PA                                         110   3e-26   
ref|XP_006746107.1|  PREDICTED: glutathione S-transferase theta-1...    110   4e-26   
emb|CDQ72597.1|  unnamed protein product                                110   4e-26   
ref|XP_003811115.1|  PREDICTED: glutathione S-transferase theta-2...    110   4e-26   
dbj|BAH70628.1|  ACYPI007233                                            107   4e-26   
ref|XP_006019953.1|  PREDICTED: glutathione S-transferase theta-1...    110   4e-26   
emb|CAG33210.1|  GSTT2                                                  110   4e-26   
ref|XP_003693859.1|  PREDICTED: glutathione S-transferase theta-1...    110   4e-26   
ref|XP_006277069.1|  PREDICTED: glutathione S-transferase theta-1...    110   5e-26   
ref|XP_009090483.1|  PREDICTED: glutathione S-transferase theta-1...    110   5e-26   
ref|XP_004742540.1|  PREDICTED: LOW QUALITY PROTEIN: glutathione ...    112   5e-26   
ref|XP_008196475.1|  PREDICTED: glutathione S-transferase theta-1       110   5e-26   
ref|XP_010003090.1|  PREDICTED: glutathione S-transferase theta-1...    110   5e-26   
ref|XP_311299.1|  AGAP000761-PA                                         110   5e-26   
ref|XP_003282572.1|  PREDICTED: glutathione S-transferase theta-2...    110   6e-26   
ref|NP_001290604.1|  glutathione S-transferase theta-1                  110   6e-26   
ref|XP_003282573.1|  PREDICTED: glutathione S-transferase theta-2...    109   6e-26   
dbj|BAG34980.1|  unnamed protein product                                110   6e-26   
ref|XP_011159136.1|  PREDICTED: glutathione S-transferase theta-1...    111   6e-26   
gb|ACQ58539.1|  Glutathione S-transferase theta-1                       110   6e-26   
ref|XP_004517788.1|  PREDICTED: glutathione S-transferase theta-1...    109   7e-26   
ref|XP_006121720.1|  PREDICTED: glutathione S-transferase theta-1...    110   7e-26   
gb|ABW96271.1|  glutathione S-transferase theta                         108   8e-26   
gb|ACQ57872.1|  Glutathione S-transferase theta-1                       109   9e-26   
ref|XP_002114013.1|  expressed hypothetical protein                     109   9e-26   
ref|XP_002113711.1|  expressed hypothetical protein                     109   1e-25   
ref|XP_002722606.1|  PREDICTED: glutathione S-transferase theta-2...    109   1e-25   
ref|XP_008179163.1|  PREDICTED: glutathione S-transferase theta-1...    109   1e-25   
ref|XP_006640322.1|  PREDICTED: glutathione S-transferase theta-1...    109   1e-25   
ref|XP_005886381.1|  PREDICTED: glutathione S-transferase theta-1...    110   1e-25   
gb|KFV63272.1|  Glutathione S-transferase theta-1                       109   1e-25   
ref|XP_003387292.1|  PREDICTED: glutathione S-transferase theta-2...    108   1e-25   
gb|EHJ70012.1|  glutathione S-transferase theta 1                       108   1e-25   
ref|NP_956878.1|  glutathione S-transferase theta 1b                    109   1e-25   
ref|XP_004680984.1|  PREDICTED: glutathione S-transferase theta-2...    108   1e-25   
ref|XP_009062390.1|  hypothetical protein LOTGIDRAFT_207042             108   2e-25   
ref|XP_001369983.1|  PREDICTED: glutathione S-transferase theta-2...    108   2e-25   
ref|XP_005709172.1|  hypothetical protein Gasu_00240                    113   2e-25   
ref|XP_006822361.1|  PREDICTED: glutathione S-transferase theta-1...    107   2e-25   
ref|XP_006140272.1|  PREDICTED: glutathione S-transferase theta-1...    108   2e-25   
ref|XP_007490766.1|  PREDICTED: glutathione S-transferase theta-2...    108   2e-25   
ref|XP_011255352.1|  PREDICTED: glutathione S-transferase theta-1...    108   2e-25   
ref|XP_008285263.1|  PREDICTED: glutathione S-transferase theta-1...    108   2e-25   
ref|XP_008285264.1|  PREDICTED: glutathione S-transferase theta-1...    108   3e-25   
ref|XP_624692.1|  PREDICTED: glutathione S-transferase theta-4          108   3e-25   
ref|XP_002049289.1|  GJ21509                                            107   3e-25   
ref|XP_004443158.1|  PREDICTED: glutathione S-transferase theta-2...    108   3e-25   
ref|XP_010785251.1|  PREDICTED: glutathione S-transferase theta-1...    105   3e-25   
ref|XP_003974574.1|  PREDICTED: glutathione S-transferase theta-1...    107   4e-25   
ref|XP_787201.1|  PREDICTED: glutathione S-transferase theta-1-like     107   4e-25   
emb|CAG09655.1|  unnamed protein product                                107   5e-25   
gb|ACQ58896.1|  Glutathione S-transferase theta-1                       107   5e-25   
gb|AEW26630.1|  GSTT2                                                   107   5e-25   
ref|XP_004742539.1|  PREDICTED: glutathione S-transferase theta-1...    106   6e-25   
ref|XP_005886350.1|  PREDICTED: glutathione S-transferase theta-2...    107   6e-25   



>ref|XP_004245615.1| PREDICTED: glutathione S-transferase T1-like [Solanum lycopersicum]
Length=250

 Score =   240 bits (612),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 125/144 (87%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +KLYVDRMSQPSRA++IFCK NGIDFEE+ I ++K Q  +PE+  INPMKQVPA++DG
Sbjct  1    MTLKLYVDRMSQPSRAVIIFCKLNGIDFEEIHINLSKRQQLSPEFKEINPMKQVPAIIDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             FKLFESHA L+YLA A  G+ADHWYPADL KRAKVDSV DWHHSNLRRGAAGY+FNT L
Sbjct  61   RFKLFESHAILRYLACAFPGIADHWYPADLYKRAKVDSVLDWHHSNLRRGAAGYIFNTVL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            APAFGLP NP AAAEAEKVLLASL
Sbjct  121  APAFGLPLNPQAAAEAEKVLLASL  144



>ref|XP_006343997.1| PREDICTED: glutathione S-transferase T1-like [Solanum tuberosum]
Length=250

 Score =   236 bits (603),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 124/144 (86%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +KLYVDRMSQPSRA++IFCK NGIDFEE+ I ++K Q  +PE+  INPMKQVPA++DG
Sbjct  1    MTLKLYVDRMSQPSRAVIIFCKLNGIDFEEIHINLSKRQQLSPEFKEINPMKQVPAIMDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             FKLFESHA L+YLA A  G+ADHWYPADL KRAKVDSV DWHHSNLRRG AGY+FNT L
Sbjct  61   RFKLFESHAILRYLACAFPGIADHWYPADLYKRAKVDSVLDWHHSNLRRGTAGYIFNTVL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            APAFGLP NP AAAEA+KVLLASL
Sbjct  121  APAFGLPLNPQAAAEAKKVLLASL  144



>ref|XP_009600810.1| PREDICTED: glutathione S-transferase T1-like [Nicotiana tomentosiformis]
Length=250

 Score =   235 bits (600),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 123/144 (85%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +KLYVDRMSQPSRALLIFCK NGIDFEEV I ++K QH +PE+  +NPMKQVPA++DG
Sbjct  1    MTLKLYVDRMSQPSRALLIFCKLNGIDFEEVYINLSKRQHLSPEFKEVNPMKQVPAIMDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             FKLFESHA L+YLA A  GVADHWYPADL KRAKVDSV DWHHSNLRRGAA YVF+T  
Sbjct  61   RFKLFESHAILRYLACAFPGVADHWYPADLYKRAKVDSVLDWHHSNLRRGAAAYVFSTVF  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            APAFGLP N  AAAEAEKVLLASL
Sbjct  121  APAFGLPLNQQAAAEAEKVLLASL  144



>ref|XP_009599399.1| PREDICTED: glutathione S-transferase T1-like [Nicotiana tomentosiformis]
Length=236

 Score =   234 bits (598),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 126/144 (88%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M++KLYVDR+SQPSRA+LIFCK NGI+FEEV I+++KGQHR+PE+A INPMKQVPA+V G
Sbjct  1    MSLKLYVDRLSQPSRAILIFCKLNGIEFEEVPIELSKGQHRSPEFAEINPMKQVPAIVHG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             FKLFESHA L+YLA+A   VADHWYP+DLQKRAK++SV DWHHSNLRRG+ GYV N+ L
Sbjct  61   SFKLFESHAILRYLASAFPEVADHWYPSDLQKRAKIESVLDWHHSNLRRGSVGYVLNSTL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            APA GLP NP AAAE EKVL ASL
Sbjct  121  APALGLPLNPQAAAEGEKVLSASL  144



>ref|XP_009796155.1| PREDICTED: glutathione S-transferase T1-like [Nicotiana sylvestris]
Length=236

 Score =   233 bits (594),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 125/144 (87%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M++KLYVDR+SQPSRALLIFCK NGI+FEEV I+++KGQHR+PE+A INPMKQVPA+V G
Sbjct  1    MSLKLYVDRLSQPSRALLIFCKLNGIEFEEVPIELSKGQHRSPEFAEINPMKQVPAIVHG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             F LFESHA L+YLA+A   VADHWYP+DLQKRAK++SV DWHHSNLRRG+ GYV N+ L
Sbjct  61   SFTLFESHAILRYLASAFPEVADHWYPSDLQKRAKIESVLDWHHSNLRRGSVGYVLNSTL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            APA GLP NP AAAE EK+L ASL
Sbjct  121  APALGLPLNPQAAAEGEKILSASL  144



>gb|EYU23489.1| hypothetical protein MIMGU_mgv1a012760mg [Erythranthe guttata]
Length=241

 Score =   226 bits (577),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 122/144 (85%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y DRMSQPSRA+LIFCKANG++FEEV IQ+AK QH +PE+A INPMKQVPA+V G
Sbjct  1    MELKVYADRMSQPSRAILIFCKANGLEFEEVPIQLAKKQHHSPEFAEINPMKQVPAIVHG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
            DFKLFESHA L YLA+A  GVADHWYPAD +KRAK+ SV DWHHSNLRRG+ GY+FN  +
Sbjct  61   DFKLFESHAILIYLASAFPGVADHWYPADARKRAKIHSVLDWHHSNLRRGSVGYIFNNTI  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            A AFGLP NP A AE EK+LLASL
Sbjct  121  ALAFGLPLNPKAEAEGEKLLLASL  144



>ref|XP_006360687.1| PREDICTED: glutathione S-transferase T1-like [Solanum tuberosum]
Length=236

 Score =   225 bits (573),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 121/144 (84%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M++K+YVDR+SQPSRA+LIFCK NGI+FEEV I ++KGQHRTPEY  +N MKQVPA+V  
Sbjct  1    MSLKIYVDRLSQPSRAILIFCKLNGIEFEEVNIDLSKGQHRTPEYQEVNIMKQVPAIVHD  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             FKLFESHA L+YLA+A    ADHWYP DLQKRA V+ V DWHHSNLRRG+AGYVFNT L
Sbjct  61   TFKLFESHAILRYLASAFPETADHWYPKDLQKRANVECVLDWHHSNLRRGSAGYVFNTIL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            APAFGLP NP AAAE +K+L ASL
Sbjct  121  APAFGLPLNPQAAAEGKKLLSASL  144



>ref|XP_011080977.1| PREDICTED: glutathione S-transferase T1-like [Sesamum indicum]
Length=236

 Score =   223 bits (567),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 123/144 (85%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +KLYVDR+SQPSRA+LIFCKANGI+FEEV+I +AK QH  PE+A +NPMKQVPA+V G
Sbjct  1    MELKLYVDRISQPSRAILIFCKANGIEFEEVKIDLAKKQHHFPEFAEVNPMKQVPAIVHG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
            DFKLFESHA L YLA+A  GVA HWYPAD+QKRAK+ SV DWHHSNLRRG+ GY+FNTA+
Sbjct  61   DFKLFESHAILIYLASAFPGVAHHWYPADVQKRAKIHSVLDWHHSNLRRGSVGYIFNTAV  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            A A GLP NP AAAE E+++ ASL
Sbjct  121  ALALGLPANPQAAAEGEELMSASL  144



>ref|XP_004252589.1| PREDICTED: glutathione S-transferase T1 [Solanum lycopersicum]
Length=236

 Score =   221 bits (564),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 120/144 (83%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M++K+YVDR+SQPSRA+LIFCK NGI+FEEV I +AKGQHRTPEY  +N MKQVPA+V  
Sbjct  1    MSLKVYVDRLSQPSRAILIFCKLNGIEFEEVNIDLAKGQHRTPEYQEVNIMKQVPAIVHD  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             FKLFESHA L+YLA+A    ADHWYP DLQKRA V+ V DWHH+NLRRG+AGYVFNT L
Sbjct  61   TFKLFESHAILRYLASAFPETADHWYPKDLQKRANVECVLDWHHANLRRGSAGYVFNTIL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            APAFGLP NP AAAE + +L ASL
Sbjct  121  APAFGLPLNPQAAAEGKNLLSASL  144



>ref|XP_007160052.1| hypothetical protein PHAVU_002G288600g [Phaseolus vulgaris]
 gb|ESW32046.1| hypothetical protein PHAVU_002G288600g [Phaseolus vulgaris]
Length=250

 Score =   221 bits (564),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 121/144 (84%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y DRMSQPSRA+LIFCK NGIDFEE++++++K QH +PE+ AINP+ QVPA+VDG
Sbjct  1    MKLKVYADRMSQPSRAILIFCKVNGIDFEEIKVELSKRQHLSPEFRAINPLGQVPAIVDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             FKLFESHA L YLA+A  GVADHWYPADL +RA++ SV DWHH NLRRGAAG+V NT L
Sbjct  61   RFKLFESHAILIYLASAFPGVADHWYPADLSRRARIHSVLDWHHQNLRRGAAGFVLNTVL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            AP  GLP N  AAAEAEK+L++SL
Sbjct  121  APLLGLPLNQQAAAEAEKILISSL  144



>ref|XP_004503735.1| PREDICTED: tRNA 2'-phosphotransferase 1-like isoform X4 [Cicer 
arietinum]
Length=250

 Score =   221 bits (563),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 121/144 (84%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y DRMSQPSRA+LIFCK NGIDFEE+QI+++K QH +PE+ AINP K+VPA+VDG
Sbjct  1    MKLKVYTDRMSQPSRAILIFCKVNGIDFEEIQIELSKRQHLSPEFQAINPFKKVPAIVDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             FKLFESHA L YLA+A  GVADHWYPAD+ +RAK+ +V DWHH NLRRGAAGYV NT L
Sbjct  61   RFKLFESHAILIYLASAFPGVADHWYPADVSRRAKIHAVLDWHHLNLRRGAAGYVLNTVL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            AP  GLP N  AAAEAEKVL++SL
Sbjct  121  APFLGLPLNKQAAAEAEKVLVSSL  144



>emb|CDP09756.1| unnamed protein product [Coffea canephora]
Length=250

 Score =   221 bits (563),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 121/144 (84%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +KLY DRMSQPSRA+LIFC+ NGIDF+EV++ I+K Q  TPE+A INPMK+VPA+VDG
Sbjct  1    MKLKLYADRMSQPSRAVLIFCRVNGIDFDEVKVDISKRQQLTPEFAEINPMKKVPAIVDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             FKLFESHA L+YLA+A  GVADHWYPADL KRAK++SV DWHHSNLRRGAA  V N AL
Sbjct  61   RFKLFESHAILQYLASAFPGVADHWYPADLFKRAKINSVLDWHHSNLRRGAAPLVLNKAL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            APA GLP NP AAAEAE +L ASL
Sbjct  121  APALGLPLNPKAAAEAEIILSASL  144



>ref|XP_011072471.1| PREDICTED: glutathione S-transferase T1 [Sesamum indicum]
Length=250

 Score =   220 bits (561),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 119/144 (83%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y DRMSQPSRA++IFCK NGIDFEEV++ ++K QH TPE+  INPMK++PA+VDG
Sbjct  1    MTLKVYADRMSQPSRAVIIFCKLNGIDFEEVRVDLSKRQHLTPEFREINPMKKLPAIVDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             FKLFESHA L YLA    GVADHWYPADL KRAK+ SV DWHHSNLRRGAA YVFN+AL
Sbjct  61   RFKLFESHAILIYLACVFPGVADHWYPADLFKRAKIHSVLDWHHSNLRRGAATYVFNSAL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            APA G+P NP  AAE EK+L ASL
Sbjct  121  APALGMPLNPEVAAEGEKLLSASL  144



>ref|XP_010053279.1| PREDICTED: glutathione S-transferase T1 [Eucalyptus grandis]
 gb|KCW77542.1| hypothetical protein EUGRSUZ_D01861 [Eucalyptus grandis]
Length=248

 Score =   220 bits (560),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 118/144 (82%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y DRMSQPSRA++IFCK NGIDFEEV+I +AK QHR+PE+  +NPM QVPA+VDG
Sbjct  1    MTLKVYADRMSQPSRAVIIFCKVNGIDFEEVKIDLAKRQHRSPEFKDVNPMGQVPAIVDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             FKLFESHA L YL+ +  GVADHWYPADL +RAK+ S  DWHHSNLRRGAA YV NT L
Sbjct  61   RFKLFESHAILIYLSCSFPGVADHWYPADLSRRAKIHSALDWHHSNLRRGAAAYVLNTTL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            APA GLP NP AAAE EK+L +SL
Sbjct  121  APALGLPLNPAAAAEGEKLLSSSL  144



>ref|XP_011072506.1| PREDICTED: glutathione S-transferase T1-like [Sesamum indicum]
Length=236

 Score =   219 bits (559),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 121/144 (84%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +KLYVDR+SQPSRA+LIFCKAN I+FEEV I++ K QHR+PEYA INPMKQVPA+V G
Sbjct  1    MELKLYVDRLSQPSRAVLIFCKANEIEFEEVSIKLGKLQHRSPEYAEINPMKQVPAIVHG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
            DFKL ESHA L YLA+A  GVADHWYPAD+ KRAK+ SV DWHHSNLRRG+ GY FNT +
Sbjct  61   DFKLSESHAILIYLASAFPGVADHWYPADVHKRAKIHSVLDWHHSNLRRGSLGYHFNTGI  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            A AFGLP +P AAAE EK+L ASL
Sbjct  121  ALAFGLPLDPKAAAEGEKLLSASL  144



>gb|AAF64449.1|AF239927_1 glutathione S-transferase [Euphorbia esula]
Length=238

 Score =   219 bits (559),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 120/144 (83%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            MA+KLYV R+SQPSRAL+IFCK+NGI+FEE  I + K QH++P++  INPM QVP++V G
Sbjct  1    MALKLYVHRVSQPSRALVIFCKSNGIEFEEAHIDLMKKQHKSPDFLEINPMGQVPSMVHG  60

Query  283  DFKLFESHAALKYLAAAN-GVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
            DFKLFESHA L YL AA   VADHWYP+D+++RAKV SV DWHHSNLRRGA GY+FN+ L
Sbjct  61   DFKLFESHAILTYLTAAYPEVADHWYPSDIKQRAKVQSVLDWHHSNLRRGAVGYIFNSKL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            APAFG+P NP AAAE EK LLASL
Sbjct  121  APAFGIPLNPQAAAEGEKTLLASL  144



>ref|XP_007040202.1| Glutathione S-transferase THETA 1 [Theobroma cacao]
 gb|EOY24703.1| Glutathione S-transferase THETA 1 [Theobroma cacao]
Length=165

 Score =   216 bits (551),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 119/144 (83%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y +RMSQPSRA++IFCK NGID+EE+++ I+K QH TPE+A INPMK+VPA+VDG
Sbjct  1    MKLKVYAERMSQPSRAVIIFCKVNGIDYEEIKVDISKRQHLTPEFADINPMKKVPAIVDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             FKLFESHA L YLA A  GVADHWYPADL KR+K+ SV DWHHSNLR GA  YV NT L
Sbjct  61   RFKLFESHAILIYLACAFPGVADHWYPADLFKRSKIHSVLDWHHSNLRHGAVTYVLNTTL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            APA GLP NP AAAEAEK+L +SL
Sbjct  121  APALGLPLNPRAAAEAEKLLTSSL  144



>ref|XP_011029250.1| PREDICTED: glutathione S-transferase T1-like [Populus euphratica]
Length=247

 Score =   219 bits (559),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 118/144 (82%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y DRMSQPSRA+LIFCK N IDFEEV++ I+K QH TPE+  INPM++VP +VDG
Sbjct  1    MKLKVYADRMSQPSRAVLIFCKVNRIDFEEVRVDISKRQHLTPEFKEINPMRKVPTIVDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             FKLFESHA L YLA    GVADHWYPADL KRAK++SV DWHHSNLRRGAA YV NT L
Sbjct  61   RFKLFESHAILIYLACVFPGVADHWYPADLFKRAKINSVLDWHHSNLRRGAAEYVKNTTL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            APA GLP +P AAAEAEKVL +SL
Sbjct  121  APALGLPLDPQAAAEAEKVLFSSL  144



>gb|KDP25451.1| hypothetical protein JCGZ_20607 [Jatropha curcas]
Length=250

 Score =   218 bits (555),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 117/144 (81%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y DRMSQPSRA+LIFCK NGIDFEEV+I I+K Q  + E+  INPM +VPA+VDG
Sbjct  1    MKLKIYADRMSQPSRAVLIFCKVNGIDFEEVKIDISKRQQLSHEFKEINPMGKVPAIVDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             FKLFESHA L YLA A  GVADHWYPADL KRAK+ SV DWHHSNLR GA  YV NTAL
Sbjct  61   RFKLFESHAILTYLACAFRGVADHWYPADLSKRAKIQSVLDWHHSNLREGARKYVVNTAL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            APA GLP NP AAA+AE+VLL+SL
Sbjct  121  APALGLPLNPRAAAKAEEVLLSSL  144



>ref|XP_006827675.1| hypothetical protein AMTR_s00009p00255220 [Amborella trichopoda]
 gb|ERM95091.1| hypothetical protein AMTR_s00009p00255220 [Amborella trichopoda]
Length=233

 Score =   216 bits (551),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 118/144 (82%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +++Y DRMSQPSRA++IFCK NGIDFEEV+I I+K QH  PE+ AINPM QVPA+VDG
Sbjct  1    MKLRVYTDRMSQPSRAVIIFCKTNGIDFEEVRIDISKRQHLQPEFKAINPMGQVPALVDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
              KLFESHA L+YL+ A  G+ DHWYP DL +RAK++SV DWHHSNLRRGAAGYV N AL
Sbjct  61   KLKLFESHAILRYLSYAFPGIPDHWYPGDLSRRAKIESVLDWHHSNLRRGAAGYVLNKAL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            APA GL  NP AAAEAE++L +SL
Sbjct  121  APALGLQLNPQAAAEAEQILCSSL  144



>ref|XP_009339919.1| PREDICTED: glutathione S-transferase T1 [Pyrus x bretschneideri]
Length=263

 Score =   217 bits (553),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 120/147 (82%), Gaps = 1/147 (1%)
 Frame = +1

Query  94   REEMAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAV  273
            +EEM +K+YVDR+SQPSRA+LIF K NGI+FEE+++ I+K QH +PE+  INPM QVPA+
Sbjct  11   KEEMKLKVYVDRLSQPSRAILIFLKVNGIEFEEIKMDISKRQHLSPEFKKINPMGQVPAI  70

Query  274  VDGDFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFN  450
             DG F LFESHA L YLA A  GVADHWYPADL +RAK++SV DWHHSNLRRGAA YV N
Sbjct  71   ADGRFNLFESHAILVYLACAFPGVADHWYPADLFRRAKINSVLDWHHSNLRRGAAPYVLN  130

Query  451  TALAPAFGLPCNPHAAAEAEKVLLASL  531
            T LAP  GLP NP AAAEAEK+L +SL
Sbjct  131  TVLAPVLGLPLNPQAAAEAEKLLSSSL  157



>ref|XP_003630525.1| Glutathione transferase [Medicago truncatula]
 gb|AET05001.1| glutathione S-transferase theta [Medicago truncatula]
Length=188

 Score =   214 bits (546),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 119/144 (83%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y DRMSQPSRA+LIFCK NGIDFEE+ I+++K QH +PE+ AINP K+VPA+VDG
Sbjct  1    MKLKVYADRMSQPSRAILIFCKVNGIDFEEIHIELSKRQHLSPEFQAINPFKKVPAIVDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             FKLFESHA L YLA+A  GVA HWYPAD+ +RA++ +V DWHH NLRRGAAG+V NT L
Sbjct  61   RFKLFESHAILIYLASAFPGVAHHWYPADVSRRARIQAVLDWHHLNLRRGAAGFVLNTVL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            AP  GLP N  AAAEAEKVL++SL
Sbjct  121  APLLGLPLNKQAAAEAEKVLISSL  144



>gb|EYU38357.1| hypothetical protein MIMGU_mgv1a012529mg [Erythranthe guttata]
Length=248

 Score =   215 bits (548),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 116/144 (81%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +KLY DRMSQPSRA++IFCK NGIDFEEV+I +++ QH TPE+  INPMK+VPA+VDG
Sbjct  1    MTLKLYADRMSQPSRAIIIFCKLNGIDFEEVKIDLSRRQHLTPEFREINPMKKVPAMVDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             FKL ESHA L YLA    GVADHWYPAD+  RAK+ SV DWHHSNLRRGAA YV N+ L
Sbjct  61   RFKLSESHAILMYLACVFPGVADHWYPADVFTRAKIHSVLDWHHSNLRRGAASYVLNSTL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            APA GLP NP AAAE EK+L ASL
Sbjct  121  APALGLPLNPEAAAEGEKLLSASL  144



>emb|CDP09752.1| unnamed protein product [Coffea canephora]
Length=242

 Score =   215 bits (547),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/145 (69%), Positives = 122/145 (84%), Gaps = 2/145 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAV-VD  279
            M +K++ DR SQPSRA+LIFCKANGI+FEEVQIQ+AKG+H++PEY AINPMKQVPA+ VD
Sbjct  1    MKLKVFADRGSQPSRAVLIFCKANGIEFEEVQIQLAKGEHKSPEYEAINPMKQVPAIEVD  60

Query  280  GDFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTA  456
            G F+LFESHA L++LA A  G+A+HWYPAD+ KRA++DS  DWHHS +RRG+ G V NT 
Sbjct  61   GKFRLFESHAILRFLATAFPGIAEHWYPADVFKRAQIDSALDWHHSTIRRGSVGVVLNTT  120

Query  457  LAPAFGLPCNPHAAAEAEKVLLASL  531
            LAP FG P +P AAAEAEK+L ASL
Sbjct  121  LAPLFGQPLDPQAAAEAEKLLSASL  145



>ref|XP_002298040.2| glutathione S-transferase family protein [Populus trichocarpa]
 gb|EEE82845.2| glutathione S-transferase family protein [Populus trichocarpa]
Length=247

 Score =   215 bits (548),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 117/144 (81%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y DRMSQPSRA+LIFCK N IDFEEV++ I+K QH TPE+  INPM+++PA+VDG
Sbjct  1    MKLKVYADRMSQPSRAVLIFCKVNRIDFEEVRVDISKRQHLTPEFKEINPMRKLPAIVDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             FKLFESHA L YLA    GVADHWYPADL KRAK++SV DWHHSNLR GAA YV NT L
Sbjct  61   RFKLFESHAILIYLACVFPGVADHWYPADLFKRAKINSVLDWHHSNLRHGAAEYVKNTTL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            AP  GLP +P AAAEAEKVL +SL
Sbjct  121  APVLGLPLDPQAAAEAEKVLFSSL  144



>gb|AFK47457.1| unknown [Medicago truncatula]
Length=250

 Score =   215 bits (548),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 119/144 (83%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y DRMSQPSRA+LIFCK NGIDFEE+ I+++K QH +PE+ AINP K+VPA+VDG
Sbjct  1    MKLKVYADRMSQPSRAILIFCKVNGIDFEEIHIELSKRQHLSPEFQAINPFKKVPAIVDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             FKLFESHA L YLA+A  GVA HWYPAD+ +RA++ +V DWHH NLRRGAAG+V NT L
Sbjct  61   RFKLFESHAILIYLASAFPGVAHHWYPADVSRRARIQAVLDWHHLNLRRGAAGFVLNTVL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            AP  GLP N  AAAEAEKVL++SL
Sbjct  121  APLLGLPLNKQAAAEAEKVLISSL  144



>ref|XP_003630524.1| Glutathione transferase [Medicago truncatula]
 gb|AET05000.1| glutathione S-transferase theta [Medicago truncatula]
Length=250

 Score =   215 bits (548),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 119/144 (83%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y DRMSQPSRA+LIFCK NGIDFEE+ I+++K QH +PE+ AINP K+VPA+VDG
Sbjct  1    MKLKVYADRMSQPSRAILIFCKVNGIDFEEIHIELSKRQHLSPEFQAINPFKKVPAIVDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             FKLFESHA L YLA+A  GVA HWYPAD+ +RA++ +V DWHH NLRRGAAG+V NT L
Sbjct  61   RFKLFESHAILIYLASAFPGVAHHWYPADVSRRARIQAVLDWHHLNLRRGAAGFVLNTVL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            AP  GLP N  AAAEAEKVL++SL
Sbjct  121  APLLGLPLNKQAAAEAEKVLISSL  144



>ref|XP_002509785.1| glutathione-s-transferase theta, gst, putative [Ricinus communis]
 gb|EEF51172.1| glutathione-s-transferase theta, gst, putative [Ricinus communis]
Length=250

 Score =   213 bits (542),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 116/144 (81%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y DRMSQPSRA+LIFCK N IDFEEV+I IA  Q  +PE+  INPM +VPA+VDG
Sbjct  1    MKLKVYGDRMSQPSRAVLIFCKVNRIDFEEVRIDIANRQQLSPEFKDINPMGKVPAIVDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             FKLFESHA L YLA A  GV DHWYPADL KRAK+ SV DWHHSNLRRGAA +V NTAL
Sbjct  61   RFKLFESHAILIYLACAFPGVPDHWYPADLFKRAKIHSVLDWHHSNLRRGAAAFVLNTAL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            APA GLP NP AAAEAEK+L ASL
Sbjct  121  APALGLPLNPQAAAEAEKILSASL  144



>ref|XP_008794197.1| PREDICTED: glutathione S-transferase T1 isoform X1 [Phoenix dactylifera]
Length=250

 Score =   212 bits (539),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 115/144 (80%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y DR+SQPSRA++IFCK NGIDFEEV I + K QHR+PE+  INPM QVPA+VDG
Sbjct  1    MKLKVYADRLSQPSRAIVIFCKLNGIDFEEVPIDLTKRQHRSPEFKEINPMGQVPAIVDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             FKLFESHA L+YLA A  GV+DHWYPADL  RAK+DSV DWHH NLRRGAA Y  N+ +
Sbjct  61   RFKLFESHAILRYLACAFPGVSDHWYPADLFNRAKIDSVLDWHHLNLRRGAAFYALNSVI  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            AP FGLP N  AA EAEKVL +SL
Sbjct  121  APVFGLPLNSQAANEAEKVLRSSL  144



>ref|XP_009386058.1| PREDICTED: glutathione S-transferase T1-like [Musa acuminata 
subsp. malaccensis]
Length=248

 Score =   212 bits (539),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 114/144 (79%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y DRMSQPSRA++IFCK NGIDFEEV+I + K QHR+PE+  INPM QVPAVVDG
Sbjct  1    MTLKVYADRMSQPSRAIIIFCKVNGIDFEEVRIDLVKRQHRSPEFKEINPMGQVPAVVDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             +KLFESHA L YL+ A  G+ DHWYPADL  RAK+ S+ DWHH+NLRRGAA +V N AL
Sbjct  61   RYKLFESHAILSYLSCAFPGIPDHWYPADLFTRAKIQSILDWHHTNLRRGAATFVLNRAL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
             PA GLP NP AA EAE +L ASL
Sbjct  121  GPALGLPLNPQAANEAEIILRASL  144



>ref|XP_007209508.1| hypothetical protein PRUPE_ppa010414mg [Prunus persica]
 gb|EMJ10707.1| hypothetical protein PRUPE_ppa010414mg [Prunus persica]
Length=250

 Score =   212 bits (539),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 117/144 (81%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+YVDRMSQPSRA+LIF KANGI+FEEV+I IAK QH++PE+  INPM QVPA+ DG
Sbjct  1    MKLKVYVDRMSQPSRAILIFLKANGIEFEEVKIDIAKRQHKSPEFKKINPMGQVPAISDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             F LFESHA L YLA A  GVAD WYP+DL  RAK++SV DWHHSNLRRG+A +V +T L
Sbjct  61   RFNLFESHAILTYLACAFPGVADSWYPSDLFARAKINSVLDWHHSNLRRGSATFVLHTVL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            AP FGLP NP AAAEAE +L +SL
Sbjct  121  APVFGLPSNPQAAAEAETLLSSSL  144



>ref|XP_011463848.1| PREDICTED: glutathione S-transferase T1 [Fragaria vesca subsp. 
vesca]
Length=249

 Score =   211 bits (538),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 115/144 (80%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y DRMSQPSRA+LIFCK NGI+FEEVQ+ +AK Q  +PE+  INPM QVPA+ DG
Sbjct  1    MKLKVYADRMSQPSRAILIFCKVNGIEFEEVQMNLAKRQQLSPEFKKINPMGQVPAIADG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             F LFESHA L YLA A  G+ADHWYPADL +RAK++SV DWHHSNLRRGAA YV NT L
Sbjct  61   KFNLFESHAILVYLACAFPGIADHWYPADLFRRAKINSVLDWHHSNLRRGAAAYVLNTVL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            AP  G+P +P AA EAE++L ASL
Sbjct  121  APVLGIPASPQAAVEAERLLSASL  144



>ref|XP_002509786.1| glutathione-s-transferase theta, gst, putative [Ricinus communis]
 gb|EEF51173.1| glutathione-s-transferase theta, gst, putative [Ricinus communis]
Length=237

 Score =   211 bits (536),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 114/144 (79%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +KLY  R+SQPSRAL+ FCK NG++FEE+ I ++K QH++PE+  INPM QVPA+V G
Sbjct  1    MELKLYTHRVSQPSRALITFCKMNGLEFEEIVIDLSKRQHKSPEFKEINPMGQVPAIVHG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
            DFKLFESHA L YLA+A  GVADHWYP DLQKRAK+ SV DWHHSNLRRG+  Y+ NT L
Sbjct  61   DFKLFESHACLIYLASAFPGVADHWYPIDLQKRAKIHSVLDWHHSNLRRGSVMYILNTKL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
             P FGLP NP AAAE EK+L  SL
Sbjct  121  GPVFGLPLNPQAAAEGEKLLSCSL  144



>ref|XP_008238862.1| PREDICTED: glutathione S-transferase T1 [Prunus mume]
Length=250

 Score =   211 bits (537),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 117/144 (81%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+YVDR+SQPSRA+LIF KANGI+FEEV+I IAK QH++PE+  INPM QVPA+ DG
Sbjct  1    MKLKVYVDRLSQPSRAILIFLKANGIEFEEVKIDIAKRQHKSPEFKKINPMGQVPAISDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             FKLFESHA L YLA A  GVAD WYP+DL  RAK++S+ DWHHSNLRRG+A YV +T L
Sbjct  61   RFKLFESHAILTYLACAFPGVADSWYPSDLFARAKINSILDWHHSNLRRGSATYVLHTVL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            AP  GLP NP AAAEAE +L +SL
Sbjct  121  APVLGLPSNPQAAAEAETLLSSSL  144



>gb|KJB52089.1| hypothetical protein B456_008G246300 [Gossypium raimondii]
Length=250

 Score =   210 bits (535),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 114/139 (82%), Gaps = 1/139 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y DRMSQPSRA++IFCK NGID+EE+++ I+KGQH TPE+A INPMKQ+PA+ DG
Sbjct  1    MKLKVYADRMSQPSRAVIIFCKVNGIDYEEIKVHISKGQHLTPEFAEINPMKQLPAIADG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             FKLFESHA L YLA A  GVAD WYPAD+ KR+K+ SV DWHHSNLRRGAA YVFNT +
Sbjct  61   RFKLFESHAILIYLACAFPGVADQWYPADVFKRSKIHSVLDWHHSNLRRGAAPYVFNTTI  120

Query  460  APAFGLPCNPHAAAEAEKV  516
            AP  G P NP AAAEAE +
Sbjct  121  APILGRPLNPQAAAEAEII  139



>gb|ADB11337.1| theta class glutathione transferase GSTT1 [Populus trichocarpa]
Length=247

 Score =   210 bits (534),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 116/144 (81%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y DRMSQPSRA+LIFCK N IDFEEV++ I+K QH TPE+  INPM+++PA+VDG
Sbjct  1    MKLKVYADRMSQPSRAVLIFCKVNRIDFEEVRVDISKRQHLTPEFKEINPMRKLPAIVDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             FKLFESHA L YLA    GVADH YPADL KRAK++SV DWHHSNLR GAA YV NT L
Sbjct  61   RFKLFESHAILIYLACVFPGVADHRYPADLFKRAKINSVLDWHHSNLRHGAAEYVKNTTL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            AP  GLP +P AAAEAEKVL +SL
Sbjct  121  APVLGLPLDPQAAAEAEKVLFSSL  144



>ref|XP_010255416.1| PREDICTED: glutathione S-transferase T1 [Nelumbo nucifera]
Length=250

 Score =   210 bits (534),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 115/142 (81%), Gaps = 1/142 (1%)
 Frame = +1

Query  109  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDF  288
            +K+Y DRMSQPSRA++IFCK NGI+FEE+++ ++K QH +PE+  INPM+QVPA++DG F
Sbjct  2    LKVYADRMSQPSRAVIIFCKVNGIEFEEIKVDLSKRQHISPEFKEINPMRQVPAIIDGRF  61

Query  289  KLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAP  465
            KLFESHA L YLA A  GVADHWYP DL +RAK++SV DWHHSNLRRGAA +V NT L P
Sbjct  62   KLFESHAILSYLACAFPGVADHWYPTDLFRRAKINSVLDWHHSNLRRGAAPFVLNTVLGP  121

Query  466  AFGLPCNPHAAAEAEKVLLASL  531
            A GL  NP   AEAEK+L +SL
Sbjct  122  ALGLKSNPKVTAEAEKILTSSL  143



>ref|XP_010909100.1| PREDICTED: glutathione S-transferase T1 isoform X2 [Elaeis guineensis]
Length=250

 Score =   209 bits (533),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 115/144 (80%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y DR+SQPSRA++IFCK NGIDFEEV+I +AKGQHR+PE+  INPM +VPA+VDG
Sbjct  1    MKLKVYADRLSQPSRAIVIFCKLNGIDFEEVRIDLAKGQHRSPEFKRINPMGKVPAIVDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             FKLFESHA L+YLA A  GV+DHWYPADL  RAK+DS+ DWHHSNLR GA   V N+ L
Sbjct  61   RFKLFESHAILRYLACAFPGVSDHWYPADLFSRAKIDSILDWHHSNLRYGAVSLVQNSVL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            AP FG P N  AA EAEKVL  SL
Sbjct  121  APIFGRPLNSQAANEAEKVLNLSL  144



>gb|KHG19174.1| Glutathione S-transferase T1 -like protein [Gossypium arboreum]
Length=250

 Score =   209 bits (532),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 113/139 (81%), Gaps = 1/139 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y DRMSQP RA++IFCK NGID+EE+++ I+KGQH TPE+A INPMKQ+PA+ DG
Sbjct  1    MKLKVYADRMSQPCRAVIIFCKVNGIDYEEIKVHISKGQHLTPEFAEINPMKQLPAIADG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             FKLFESHA L YLA A  GVADHWYPAD+ KR+K+ SV DWHHSNLRRGAA YVFNT +
Sbjct  61   RFKLFESHAILIYLACAFPGVADHWYPADVFKRSKIHSVLDWHHSNLRRGAAPYVFNTTI  120

Query  460  APAFGLPCNPHAAAEAEKV  516
            AP  G P NP  AAEAE +
Sbjct  121  APILGRPLNPQVAAEAEII  139



>ref|XP_009777222.1| PREDICTED: glutathione S-transferase T1-like [Nicotiana sylvestris]
Length=256

 Score =   208 bits (530),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 112/131 (85%), Gaps = 1/131 (1%)
 Frame = +1

Query  142  SRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDFKLFESHAALKY  321
            SRALLIFCK NGIDFEEV I ++K QH +PE+  +NP+KQVPA++DG FKLFESHA L+Y
Sbjct  29   SRALLIFCKLNGIDFEEVYINLSKRQHLSPEFKEVNPLKQVPAIMDGRFKLFESHAILRY  88

Query  322  LAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAPAFGLPCNPHAA  498
            LA A  GVADHWYPADL KRAKVDSV DWHHSNLRRGAA YVF+T LAPAFGLP N  AA
Sbjct  89   LACAFPGVADHWYPADLYKRAKVDSVLDWHHSNLRRGAAVYVFSTVLAPAFGLPLNQQAA  148

Query  499  AEAEKVLLASL  531
            AEAEKVLLASL
Sbjct  149  AEAEKVLLASL  159



>gb|AFK36240.1| unknown [Lotus japonicus]
Length=251

 Score =   208 bits (529),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 116/144 (81%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y DRMSQPSRA+LIFCK NGIDFEE++I+++K QH +PE+ AINP K+VPA+VDG
Sbjct  2    MKLKVYADRMSQPSRAVLIFCKVNGIDFEEIKIELSKRQHLSPEFHAINPFKKVPAIVDG  61

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             FKLFESHA L YLA A  GVADHWYP+D+ +RA++ SV DWHH NLR GAA YV NT L
Sbjct  62   RFKLFESHAILIYLACAFPGVADHWYPSDISRRARIQSVLDWHHLNLRPGAASYVLNTVL  121

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            AP  G   N  AAAEAEKVL++SL
Sbjct  122  APLLGRQLNQQAAAEAEKVLISSL  145



>ref|XP_004146527.1| PREDICTED: glutathione S-transferase T1-like [Cucumis sativus]
 ref|XP_004165234.1| PREDICTED: glutathione S-transferase T1-like [Cucumis sativus]
 gb|KGN53344.1| Glutathione S-transferase [Cucumis sativus]
Length=238

 Score =   207 bits (527),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 115/144 (80%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            MA+K+Y DRMSQPSRA+LIFCK NGI FEEV++ ++K +H TPE+  INPM +VP +VDG
Sbjct  1    MALKVYADRMSQPSRAVLIFCKVNGIAFEEVKVTLSKFEHLTPEFKEINPMGKVPVIVDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             FKLFESHA L Y++ A  GVADHWYPADL +RAK+ SV DWHHSNLR GAA  +FNT L
Sbjct  61   RFKLFESHAILIYISCAFPGVADHWYPADLFRRAKIHSVLDWHHSNLRSGAAPLIFNTVL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            AP FG P NP AAAEAEK+L  SL
Sbjct  121  APLFGRPLNPQAAAEAEKLLSKSL  144



>gb|ACC93946.1| glutathione S-transferase [Panax ginseng]
Length=250

 Score =   207 bits (528),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 114/144 (79%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y DRMSQPSRA+LIFCK NGI+F+E++ +I+K Q ++PEY  INPM  VPA+VDG
Sbjct  1    MKLKVYADRMSQPSRAVLIFCKVNGIEFDEIKTEISKKQQKSPEYKEINPMGNVPAIVDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             FKLFESHA L YLA A  GVADHWYPADL KRAK+DSV  WHH+ LRRGAA  V N+ L
Sbjct  61   KFKLFESHAILVYLACAFPGVADHWYPADLFKRAKIDSVLHWHHTTLRRGAAPLVLNSRL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            AP FGLP N  AAAEAEKVL  SL
Sbjct  121  APVFGLPLNLQAAAEAEKVLTRSL  144



>gb|KJB39646.1| hypothetical protein B456_007G023300 [Gossypium raimondii]
Length=251

 Score =   207 bits (527),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 113/144 (78%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +KLY DRMSQP RA++IFCK NGIDFEE+++ IAK Q+ TPEYA INPMKQ+PA+VDG
Sbjct  1    MKLKLYADRMSQPVRAVIIFCKKNGIDFEEIRVDIAKRQNLTPEYAEINPMKQLPAIVDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             FKLFESHA L YLA++  GVADHWYPAD+ KR+K+  V DWHHSNLRRG    V NT L
Sbjct  61   RFKLFESHAILVYLASSFPGVADHWYPADVFKRSKIHLVLDWHHSNLRRGPTTIVRNTVL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            AP  G P NP AAAE EK L ASL
Sbjct  121  APVLGRPLNPEAAAEGEKFLSASL  144



>ref|XP_006476596.1| PREDICTED: glutathione S-transferase T1-like [Citrus sinensis]
Length=252

 Score =   207 bits (527),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 116/144 (81%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y DRMSQPSRA++IFCK NG+DFEE+++++AK +  +PE+  INPM +VPA+VDG
Sbjct  1    MKLKVYADRMSQPSRAVIIFCKVNGLDFEEIEVRLAKREQYSPEFKEINPMAKVPAIVDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
              KLFESHA L YLA A  G+ADHWYP DL KRA++ SV DWHHSNLR GAA +V N  L
Sbjct  61   RLKLFESHAILIYLACAFPGIADHWYPNDLSKRARIHSVLDWHHSNLRFGAAKFVLNKKL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            APAFGLP NP AAAEAEK+L +SL
Sbjct  121  APAFGLPLNPEAAAEAEKILSSSL  144



>gb|KDP25450.1| hypothetical protein JCGZ_20606 [Jatropha curcas]
Length=230

 Score =   206 bits (525),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 112/144 (78%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            MA+K+Y  R+SQPSRA++IFCK NGI+FEE+ I ++K QH+TPE+  INPM QVPA+V  
Sbjct  1    MALKVYGHRVSQPSRAVMIFCKVNGIEFEEITIDLSKKQHKTPEFKEINPMGQVPAIVHD  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
            DFKLFESHA L YLA A  GV DHWYPADL+KRAKV SV DWHHS LRRG+  YV N  L
Sbjct  61   DFKLFESHAVLTYLACAFPGVTDHWYPADLRKRAKVQSVLDWHHSTLRRGSVTYVINAKL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            AP FG P NP AAAE EK+L  +L
Sbjct  121  APVFGQPLNPQAAAEGEKILTCAL  144



>ref|XP_004503770.1| PREDICTED: glutathione S-transferase T1-like [Cicer arietinum]
Length=252

 Score =   207 bits (526),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 116/142 (82%), Gaps = 1/142 (1%)
 Frame = +1

Query  109  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDF  288
            +K+YVDRMSQPSRA+LIFC+ NGIDFEEVQI ++K  H +P++  +NP+++VPA++ G+F
Sbjct  5    LKVYVDRMSQPSRAILIFCRLNGIDFEEVQIDLSKRHHLSPQFTEVNPLQKVPAILHGNF  64

Query  289  KLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAP  465
             LFESHA L YLA+A  G+ADHWYP D+ +RAK++SV DWHHSNLR GA  YV NT L P
Sbjct  65   NLFESHAILAYLASAFPGIADHWYPTDVFRRAKINSVLDWHHSNLRYGAVNYVINTVLGP  124

Query  466  AFGLPCNPHAAAEAEKVLLASL  531
            A G P NP AAAEAEKVLL+SL
Sbjct  125  ALGRPLNPKAAAEAEKVLLSSL  146



>ref|XP_002304489.1| glutathione S-transferase family protein [Populus trichocarpa]
 gb|EEE79468.1| glutathione S-transferase family protein [Populus trichocarpa]
Length=232

 Score =   205 bits (522),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 117/145 (81%), Gaps = 2/145 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPA-VVD  279
            M +K+YVDR+SQPSRA++IFCK N IDFEEV I++ KGQH TPE+  INPM +VPA VVD
Sbjct  1    MELKVYVDRLSQPSRAIVIFCKVNKIDFEEVGIELLKGQHLTPEFKEINPMGKVPAIVVD  60

Query  280  GDFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTA  456
            G FKLFESHA L +LA+A  GVADHWYPADL +RA++ S+ DWHHSNLRRG+  ++ NT 
Sbjct  61   GKFKLFESHAILIFLASAFPGVADHWYPADLYRRAEIHSILDWHHSNLRRGSVEFIQNTL  120

Query  457  LAPAFGLPCNPHAAAEAEKVLLASL  531
            LAP FG P NP AAAE EKVL +SL
Sbjct  121  LAPFFGRPLNPQAAAEGEKVLSSSL  145



>ref|XP_008452024.1| PREDICTED: glutathione S-transferase T1 [Cucumis melo]
Length=238

 Score =   205 bits (522),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 114/144 (79%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            MA+K+Y DR+SQPSRA+LIFCK NGI FEEV++ ++K +H TPE+  INPM +VP +VDG
Sbjct  1    MALKVYADRLSQPSRAVLIFCKVNGIAFEEVKVALSKFEHLTPEFKEINPMVKVPVIVDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             FKLFESHA L YL+ A  GVADHWYP+DL +RAK+ SV DWHHSNLR GAA  +FNT L
Sbjct  61   RFKLFESHAILIYLSCAFPGVADHWYPSDLFRRAKIHSVLDWHHSNLRSGAAPLIFNTVL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            AP FG P NP  AAEAEK+L  SL
Sbjct  121  APLFGRPLNPQVAAEAEKILSKSL  144



>gb|ADB11338.1| theta class glutathione transferase GSTT2 [Populus trichocarpa]
Length=232

 Score =   205 bits (521),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 117/145 (81%), Gaps = 2/145 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPA-VVD  279
            M +K+YVDR+SQPSRA++IFCK N IDFEEV I++ KGQH TPE+  INPM +VPA VVD
Sbjct  1    MELKVYVDRLSQPSRAIVIFCKVNKIDFEEVGIELLKGQHLTPEFKEINPMGKVPAIVVD  60

Query  280  GDFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTA  456
            G FKLFESHA L +LA+A  GVADHWYPADL +RA++ S+ DWHHSNLRRG+  ++ NT 
Sbjct  61   GKFKLFESHAILIFLASAFPGVADHWYPADLYRRAEIHSILDWHHSNLRRGSVEFIQNTL  120

Query  457  LAPAFGLPCNPHAAAEAEKVLLASL  531
            LAP FG P NP AAAE EKVL +SL
Sbjct  121  LAPFFGRPLNPQAAAEGEKVLSSSL  145



>ref|XP_010553511.1| PREDICTED: glutathione S-transferase T1 [Tarenaya hassleriana]
Length=245

 Score =   205 bits (521),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 111/137 (81%), Gaps = 1/137 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y DRMSQPSRA++IFCK NGI+FEEV + +AK +H +PE+  INPM +VPA+VDG
Sbjct  1    MKLKVYSDRMSQPSRAVIIFCKVNGIEFEEVVLSLAKRKHLSPEFKEINPMGKVPAIVDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             FKLFESHA L YL++A  G+ DHWYP DL KRAK+ SV DWHHSNLR GAAGYV NT L
Sbjct  61   RFKLFESHAILIYLSSAFPGIPDHWYPNDLSKRAKIHSVLDWHHSNLRAGAAGYVLNTVL  120

Query  460  APAFGLPCNPHAAAEAE  510
            AP+ GLP NP AAAEAE
Sbjct  121  APSLGLPLNPRAAAEAE  137



>ref|XP_011022714.1| PREDICTED: glutathione S-transferase T1 [Populus euphratica]
Length=232

 Score =   204 bits (520),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 117/145 (81%), Gaps = 2/145 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPA-VVD  279
            M +K+YVDR+SQPSRA++IFCKAN IDFEEV I++ KGQH TPE+  INPM +VPA VVD
Sbjct  1    MELKVYVDRLSQPSRAIVIFCKANKIDFEEVGIELLKGQHLTPEFKEINPMGKVPAIVVD  60

Query  280  GDFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTA  456
            G FKLFESH  L +LA+A  GVADHWYPADL +RA++ S+ DWHHSNLRRG+  ++ N  
Sbjct  61   GKFKLFESHTILIFLASAFPGVADHWYPADLYRRAEIHSILDWHHSNLRRGSTEFIQNAL  120

Query  457  LAPAFGLPCNPHAAAEAEKVLLASL  531
            LAP FG P NP AAAEAEKVL +SL
Sbjct  121  LAPFFGRPLNPQAAAEAEKVLSSSL  145



>ref|XP_006439583.1| hypothetical protein CICLE_v10021831mg [Citrus clementina]
 gb|ESR52823.1| hypothetical protein CICLE_v10021831mg [Citrus clementina]
Length=252

 Score =   205 bits (522),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 115/144 (80%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y DRMSQPSRA++IFCK NG+DFEE+++++AK +  +PE+  INPM +VPA++DG
Sbjct  1    MKLKVYADRMSQPSRAVIIFCKVNGLDFEEIEVRLAKREQYSPEFKEINPMAKVPAIIDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
              KLFESHA L YLA A  GVADHWYP DL KRA++ SV DWHHSNLR GAA +V N  L
Sbjct  61   RLKLFESHAILIYLACAFPGVADHWYPNDLSKRARIHSVLDWHHSNLRFGAAKFVLNKKL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            APA GLP NP AAAEAEK+L +SL
Sbjct  121  APALGLPLNPEAAAEAEKILSSSL  144



>ref|NP_198937.1| glutathione S-transferase THETA 1 [Arabidopsis thaliana]
 sp|Q9ZRT5.1|GSTT1_ARATH RecName: Full=Glutathione S-transferase T1; Short=AtGSTT1; AltName: 
Full=GST class-theta member 1; AltName: Full=Glutathione 
S-transferase 10 [Arabidopsis thaliana]
 emb|CAA10457.1| glutathione transferase AtGST 10 [Arabidopsis thaliana]
 dbj|BAB09723.1| glutathione transferase AtGST 10 [Arabidopsis thaliana]
 gb|AAK96850.1| glutathione transferase AtGST 10 [Arabidopsis thaliana]
 gb|AAL66881.1| glutathione transferase AtGST 10 [Arabidopsis thaliana]
 gb|AED94654.1| glutathione S-transferase THETA 1 [Arabidopsis thaliana]
Length=245

 Score =   204 bits (520),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 113/144 (78%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y DRMSQPSRA++IFCK NGI F+EV I +AK Q  +PE+  INP+ +VPA+VDG
Sbjct  2    MKLKVYADRMSQPSRAVIIFCKVNGIQFDEVLISLAKRQQLSPEFKDINPLGKVPAIVDG  61

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
              KLFESHA L YL++A   VADHWYP DL KRAK+ SV DWHH+NLRRGAAGYV N+ L
Sbjct  62   RLKLFESHAILIYLSSAFPSVADHWYPNDLSKRAKIHSVLDWHHTNLRRGAAGYVLNSVL  121

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
             PA GLP NP AAAEAE++L  SL
Sbjct  122  GPALGLPLNPKAAAEAEQLLTKSL  145



>emb|CDP09754.1| unnamed protein product [Coffea canephora]
Length=234

 Score =   204 bits (519),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 121/145 (83%), Gaps = 2/145 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAV-VD  279
            M +KL+V R+SQPSRA+LIFCK N I+FEEVQI ++KG+H +PE+  INPM +VPA+ VD
Sbjct  1    MKLKLFVHRLSQPSRAVLIFCKLNKIEFEEVQIDLSKGEHLSPEFKEINPMHKVPAMEVD  60

Query  280  GDFKLFESHAALKYLAAAN-GVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTA  456
            G FKLFESHA L++LA A+ GVADHWYPADL KRA+++SV DWHH+NLR G+AG VF++ 
Sbjct  61   GGFKLFESHAILRFLACASPGVADHWYPADLFKRAEINSVLDWHHANLRHGSAGLVFHSK  120

Query  457  LAPAFGLPCNPHAAAEAEKVLLASL  531
            LAP FGLP +  AAAE EKVLLASL
Sbjct  121  LAPLFGLPSDVQAAAECEKVLLASL  145



>gb|KDP36315.1| hypothetical protein JCGZ_09530 [Jatropha curcas]
Length=250

 Score =   205 bits (521),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 112/144 (78%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y DR SQP+RA+LIFCK NGIDFEE+ I + K Q  +PE+  INP+ +VPA+VDG
Sbjct  1    MKLKIYADRRSQPARAVLIFCKVNGIDFEEINIDLTKRQQLSPEFKEINPIGKVPAIVDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             FKLFESHA L YLA A  GVADHWYPADL KRAK+ SV DWHH NLR GA  YV NTA+
Sbjct  61   RFKLFESHAILSYLACAFPGVADHWYPADLFKRAKIQSVLDWHHLNLRLGALTYVVNTAM  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            APA GLP NP AAA+ EK+L +SL
Sbjct  121  APALGLPLNPRAAAKGEKILFSSL  144



>ref|XP_002868607.1| hypothetical protein ARALYDRAFT_916086 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44866.1| hypothetical protein ARALYDRAFT_916086 [Arabidopsis lyrata subsp. 
lyrata]
Length=245

 Score =   204 bits (518),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 112/144 (78%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y DRMSQPSRA++IFCK NGI F+EV I +AK Q  +PE+  INPM +VPA+VDG
Sbjct  2    MKLKVYADRMSQPSRAVIIFCKVNGIQFDEVLISLAKRQQLSPEFKDINPMGKVPAIVDG  61

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
              KLFESHA L YL++A   VADHWYP DL KRAK+ SV DWHH+NLR GAAGYV N+ L
Sbjct  62   RLKLFESHAILIYLSSAFPSVADHWYPNDLSKRAKIHSVMDWHHTNLRPGAAGYVLNSVL  121

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            APA GLP NP AA EAEK+L  SL
Sbjct  122  APALGLPLNPKAAVEAEKLLTKSL  145



>gb|KHG14410.1| Glutathione S-transferase T1 -like protein [Gossypium arboreum]
Length=485

 Score =   210 bits (535),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 114/144 (79%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +KLY DRMSQP RA++IFCK NGIDFEE+++ IAK QH TPEYA INPMKQ+PA+VDG
Sbjct  235  MKLKLYADRMSQPVRAVIIFCKKNGIDFEEIRVDIAKRQHLTPEYAEINPMKQLPAIVDG  294

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             F+LFESHA L YLA++  GVADHWYPAD+ KR+K+ SV DWHHSNLRRG    V NT L
Sbjct  295  RFELFESHAILVYLASSFPGVADHWYPADVFKRSKIHSVLDWHHSNLRRGPTTIVRNTVL  354

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            AP  G P NP AAAE EK L ASL
Sbjct  355  APVLGRPLNPEAAAEGEKFLSASL  378


 Score =   190 bits (482),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 112/144 (78%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y DR+SQP RA++IFC+ NGI++EE+++ +A  +H TPE++ INPM+Q+PA+V G
Sbjct  1    MKLKVYADRLSQPVRAVIIFCEVNGIEYEEIKVDLANREHLTPEFSEINPMQQLPAIVHG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             FKLFESHA L YLA++  GVADHWYPAD+ KR+K+ SV DWHHSNLRRG    V N+ L
Sbjct  61   TFKLFESHAILIYLASSFPGVADHWYPADVYKRSKIHSVLDWHHSNLRRGPITIVQNSIL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            AP F  P NP A AE EK+L A+L
Sbjct  121  APVFRRPLNPEAVAEGEKILSAAL  144



>ref|XP_002272455.1| PREDICTED: glutathione S-transferase T1 [Vitis vinifera]
Length=248

 Score =   203 bits (517),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 115/144 (80%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y DRMSQPSRA++IFCK N IDFEEV++ +AK QH +P++  +NPM QVPA+VDG
Sbjct  1    MKLKIYADRMSQPSRAIIIFCKVNRIDFEEVRVDLAKRQHLSPDFKVVNPMGQVPAIVDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             F+LFESHA L YLA A  G+AD+WYP DL KRAK+ SV DWHHSNLRRGAA ++ NT L
Sbjct  61   RFQLFESHAILIYLACAFPGIADNWYPNDLFKRAKIHSVLDWHHSNLRRGAAPFLLNTVL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
             PA G+  NP AAAEAEK+L +SL
Sbjct  121  GPALGIKVNPQAAAEAEKLLFSSL  144



>emb|CBI34681.3| unnamed protein product [Vitis vinifera]
Length=265

 Score =   204 bits (518),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 115/144 (80%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y DRMSQPSRA++IFCK N IDFEEV++ +AK QH +P++  +NPM QVPA+VDG
Sbjct  1    MKLKIYADRMSQPSRAIIIFCKVNRIDFEEVRVDLAKRQHLSPDFKVVNPMGQVPAIVDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             F+LFESHA L YLA A  G+AD+WYP DL KRAK+ SV DWHHSNLRRGAA ++ NT L
Sbjct  61   RFQLFESHAILIYLACAFPGIADNWYPNDLFKRAKIHSVLDWHHSNLRRGAAPFLLNTVL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
             PA G+  NP AAAEAEK+L +SL
Sbjct  121  GPALGIKVNPQAAAEAEKLLFSSL  144



>gb|EMS35634.1| Glutathione S-transferase theta-1 [Triticum urartu]
Length=233

 Score =   202 bits (515),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 110/142 (77%), Gaps = 1/142 (1%)
 Frame = +1

Query  109  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDF  288
            +K+Y DR+SQPSRA++I CK N IDF+E+ + +AKGQHR PE+  INPM QVP +VDG F
Sbjct  4    LKVYADRLSQPSRAIIILCKVNRIDFQELTVDLAKGQHRAPEFTKINPMAQVPTIVDGRF  63

Query  289  KLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAP  465
            KLFESHA L+YLA    GV DHWYPADL  RAK++SV DWHHSNLRRGAA YV +TAL P
Sbjct  64   KLFESHAILRYLATVFPGVPDHWYPADLFTRAKLESVLDWHHSNLRRGAATYVLHTALGP  123

Query  466  AFGLPCNPHAAAEAEKVLLASL  531
            A GL  NP  A EAEK+L  SL
Sbjct  124  ALGLTPNPETAKEAEKLLSRSL  145



>gb|AGC13145.1| theta class glutathione S-transferase [Pinus tabuliformis]
Length=249

 Score =   202 bits (514),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 113/142 (80%), Gaps = 1/142 (1%)
 Frame = +1

Query  109  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDF  288
            +++YVDRMSQPSRA+LIFCK N I+FEE  + + K +H+ PE+ AINP+  VPA+ DG F
Sbjct  4    LRVYVDRMSQPSRAVLIFCKVNKIEFEEHLVNLGKKEHKQPEFRAINPLGLVPAIHDGGF  63

Query  289  KLFESHAALKYLAAAN-GVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAP  465
            KLFESHA LKYLA A   V DHWYPADL KRAK+DSV DWHHSNLRRG+AG V N ALAP
Sbjct  64   KLFESHAILKYLACAYPSVPDHWYPADLSKRAKIDSVLDWHHSNLRRGSAGLVLNRALAP  123

Query  466  AFGLPCNPHAAAEAEKVLLASL  531
            A GLP NP AA+EAE +L +SL
Sbjct  124  ALGLPLNPQAASEAEILLKSSL  145



>ref|NP_001068175.1| Os11g0588300 [Oryza sativa Japonica Group]
 gb|AAK98534.1|AF402793_1 putative glutathione S-transferase OsGSTT1 [Oryza sativa Japonica 
Group]
 gb|ABA94506.1| Glutathione S-transferase, N-terminal domain containing protein, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF28538.1| Os11g0588300 [Oryza sativa Japonica Group]
 gb|EAY81560.1| hypothetical protein OsI_36725 [Oryza sativa Indica Group]
 gb|EAZ18961.1| hypothetical protein OsJ_34497 [Oryza sativa Japonica Group]
 dbj|BAG96917.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87358.1| unnamed protein product [Oryza sativa Japonica Group]
Length=246

 Score =   202 bits (513),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 112/142 (79%), Gaps = 1/142 (1%)
 Frame = +1

Query  109  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDF  288
            +K+Y DR SQPSRA++IFC+ N IDFEEV + + K +H +PE+  INPM QVPA+VDG F
Sbjct  5    LKVYADRRSQPSRAIIIFCRVNRIDFEEVTVDLFKREHLSPEFKKINPMGQVPAIVDGRF  64

Query  289  KLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAP  465
            +LFESHA L+YLA    GVADHWYPADL  RAK++++ DWHHSNLRRGAA ++ NT LAP
Sbjct  65   RLFESHAILRYLATVFPGVADHWYPADLFTRAKLEAILDWHHSNLRRGAATFILNTVLAP  124

Query  466  AFGLPCNPHAAAEAEKVLLASL  531
            + GLP +P AA EAEKVL  SL
Sbjct  125  SLGLPSSPQAAKEAEKVLFRSL  146



>ref|XP_006579426.1| PREDICTED: uncharacterized protein LOC100799229 isoform X2 [Glycine 
max]
Length=239

 Score =   200 bits (509),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 113/142 (80%), Gaps = 1/142 (1%)
 Frame = +1

Query  109  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDF  288
            +K+Y DRMSQPSRA+LIFC+ NGIDFEE+++ I+K  H +PE+  +NP+++VPA+V G F
Sbjct  5    LKVYADRMSQPSRAVLIFCRFNGIDFEEIKVDISKRHHLSPEFREVNPLQKVPAIVHGSF  64

Query  289  KLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAP  465
             L ESHA L YLA+A  G+ADHWYP+DL +RAK+ SV DWHHSNLR GA  YV NT L P
Sbjct  65   NLSESHAILVYLASAFPGIADHWYPSDLYRRAKIISVMDWHHSNLRHGAVNYVINTVLGP  124

Query  466  AFGLPCNPHAAAEAEKVLLASL  531
            A G P NP AAAEAEKVLL+SL
Sbjct  125  ATGRPLNPKAAAEAEKVLLSSL  146



>gb|KHN23653.1| Glutathione S-transferase T1 [Glycine soja]
Length=252

 Score =   200 bits (508),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 113/142 (80%), Gaps = 1/142 (1%)
 Frame = +1

Query  109  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDF  288
            +K+Y DRMSQPSRA+LIFC+ NGIDFEE+++ I+K  H +PE+  +NP+++VPA+V G F
Sbjct  5    LKVYADRMSQPSRAVLIFCRFNGIDFEEIKVDISKRHHLSPEFREVNPLQKVPAIVHGSF  64

Query  289  KLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAP  465
             L ESHA L YLA+A  G+ADHWYP+DL +RAK+ SV DWHHSNLR GA  YV NT L P
Sbjct  65   NLSESHAILVYLASAFPGIADHWYPSDLYRRAKIISVMDWHHSNLRHGAVNYVINTVLGP  124

Query  466  AFGLPCNPHAAAEAEKVLLASL  531
            A G P NP AAAEAEKVLL+SL
Sbjct  125  ATGRPLNPKAAAEAEKVLLSSL  146



>ref|XP_006579425.1| PREDICTED: uncharacterized protein LOC100799229 isoform X1 [Glycine 
max]
 gb|AJE59642.1| theta class glutathione S-transferase [Glycine max]
Length=252

 Score =   200 bits (508),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 113/142 (80%), Gaps = 1/142 (1%)
 Frame = +1

Query  109  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDF  288
            +K+Y DRMSQPSRA+LIFC+ NGIDFEE+++ I+K  H +PE+  +NP+++VPA+V G F
Sbjct  5    LKVYADRMSQPSRAVLIFCRFNGIDFEEIKVDISKRHHLSPEFREVNPLQKVPAIVHGSF  64

Query  289  KLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAP  465
             L ESHA L YLA+A  G+ADHWYP+DL +RAK+ SV DWHHSNLR GA  YV NT L P
Sbjct  65   NLSESHAILVYLASAFPGIADHWYPSDLYRRAKIISVMDWHHSNLRHGAVNYVINTVLGP  124

Query  466  AFGLPCNPHAAAEAEKVLLASL  531
            A G P NP AAAEAEKVLL+SL
Sbjct  125  ATGRPLNPKAAAEAEKVLLSSL  146



>gb|AHA46533.1| theta class glutathione S-transferase [Larix kaempferi]
Length=249

 Score =   199 bits (507),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 111/140 (79%), Gaps = 1/140 (1%)
 Frame = +1

Query  115  LYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDFKL  294
            +YVDRMSQPSRA+LIFC  N I+FEE  + + K +H+ PEY AINP++QVPA+ DG FKL
Sbjct  6    VYVDRMSQPSRAVLIFCMVNRIEFEERLVNLGKREHKRPEYGAINPLQQVPAIDDGGFKL  65

Query  295  FESHAALKYLAAAN-GVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAPAF  471
            FESHA L+YLA A   V DHWYPADL KRAK+DSV DWHHS+LRRG+AG V N  LAPA 
Sbjct  66   FESHAILRYLACAYPRVPDHWYPADLSKRAKIDSVLDWHHSSLRRGSAGLVLNRVLAPAL  125

Query  472  GLPCNPHAAAEAEKVLLASL  531
            GLP NP AA+EAE +L +SL
Sbjct  126  GLPLNPQAASEAEILLKSSL  145



>ref|XP_010447179.1| PREDICTED: glutathione S-transferase T1-like [Camelina sativa]
Length=244

 Score =   199 bits (507),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 112/144 (78%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y DRMSQPSRA++IFCK NGI F+E+ I ++K Q  TPE+  INPM +VPA+VDG
Sbjct  1    MKLKVYADRMSQPSRAVIIFCKVNGIQFDEILIILSKRQQLTPEFKDINPMGKVPAIVDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
              KLFESHA L YL++A   V DHWYP DL KRAK+ SV DWHH++LR GAAGYV N+ L
Sbjct  61   RLKLFESHAILIYLSSAFPSVVDHWYPNDLSKRAKIHSVLDWHHTSLRPGAAGYVLNSVL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            APA GLP NP AAA+AEK+L  SL
Sbjct  121  APALGLPLNPKAAADAEKLLTKSL  144



>gb|KHG21896.1| Glutathione S-transferase T1 -like protein [Gossypium arboreum]
Length=250

 Score =   199 bits (507),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 113/144 (78%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +++Y DRMSQPSRA++IFCK NGID+ E+++ I+K +H TPE+A INPMKQ+PA+VDG
Sbjct  1    MKLEVYADRMSQPSRAVIIFCKVNGIDYTELKVDISKREHLTPEFAEINPMKQLPAIVDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             FKLFESH+ L YLA A  GVADHWYPADL KR+K+ SV  WHHSNLRR A  YV NT +
Sbjct  61   KFKLFESHSILIYLACAFPGVADHWYPADLFKRSKIHSVLYWHHSNLRRAAGTYVINTTI  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
             PA G P N  AA EAEK L++SL
Sbjct  121  LPALGYPSNQQAADEAEKFLVSSL  144



>ref|NP_001242886.1| uncharacterized protein LOC100799229 [Glycine max]
 gb|ACU20910.1| unknown [Glycine max]
Length=227

 Score =   198 bits (504),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 112/142 (79%), Gaps = 1/142 (1%)
 Frame = +1

Query  109  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDF  288
            +K+Y DRMSQPSRA+LIFC+ NGIDFEE+++ I+K  H +PE+  +NP+++VPA+V G F
Sbjct  5    LKVYADRMSQPSRAVLIFCRFNGIDFEEIKVDISKRHHLSPEFREVNPLQKVPAIVHGSF  64

Query  289  KLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAP  465
             L ESHA L YL +A  G+ADHWYP+DL +RAK+ SV DWHHSNLR GA  YV NT L P
Sbjct  65   NLSESHAILVYLVSAFPGIADHWYPSDLYRRAKIISVMDWHHSNLRHGAVNYVINTVLGP  124

Query  466  AFGLPCNPHAAAEAEKVLLASL  531
            A G P NP AAAEAEKVLL+SL
Sbjct  125  ATGRPLNPKAAAEAEKVLLSSL  146



>gb|AET05003.2| glutathione S-transferase, amino-terminal domain protein [Medicago 
truncatula]
Length=252

 Score =   199 bits (505),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 113/142 (80%), Gaps = 1/142 (1%)
 Frame = +1

Query  109  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDF  288
            +K+Y DRMSQPSRA+LIFC+ NGIDFEE+++ ++K  H +PE+  +NP+ +VPA++ G+F
Sbjct  5    LKVYADRMSQPSRAVLIFCRFNGIDFEEIKVDLSKRHHLSPEFTEVNPLHKVPAILHGNF  64

Query  289  KLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAP  465
             LFESHA L YL++A  GVADHWYP D+ +R K++SV DWHHSNLR GA  YV NT L P
Sbjct  65   NLFESHAILVYLSSAFPGVADHWYPTDVFRRVKINSVLDWHHSNLRYGAVNYVSNTVLGP  124

Query  466  AFGLPCNPHAAAEAEKVLLASL  531
            A G P NP AAAEAEKVLL+SL
Sbjct  125  ALGRPLNPEAAAEAEKVLLSSL  146



>ref|XP_003630527.1| Glutathione S-transferase theta [Medicago truncatula]
Length=251

 Score =   199 bits (505),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 113/142 (80%), Gaps = 1/142 (1%)
 Frame = +1

Query  109  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDF  288
            +K+Y DRMSQPSRA+LIFC+ NGIDFEE+++ ++K  H +PE+  +NP+ +VPA++ G+F
Sbjct  4    LKVYADRMSQPSRAVLIFCRFNGIDFEEIKVDLSKRHHLSPEFTEVNPLHKVPAILHGNF  63

Query  289  KLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAP  465
             LFESHA L YL++A  GVADHWYP D+ +R K++SV DWHHSNLR GA  YV NT L P
Sbjct  64   NLFESHAILVYLSSAFPGVADHWYPTDVFRRVKINSVLDWHHSNLRYGAVNYVSNTVLGP  123

Query  466  AFGLPCNPHAAAEAEKVLLASL  531
            A G P NP AAAEAEKVLL+SL
Sbjct  124  ALGRPLNPEAAAEAEKVLLSSL  145



>gb|KJB25823.1| hypothetical protein B456_004G211100 [Gossypium raimondii]
Length=278

 Score =   199 bits (507),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 115/145 (79%), Gaps = 1/145 (1%)
 Frame = +1

Query  100  EMAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVD  279
            +M +++Y DRMSQPSRA++IFCK NGID+ E+++ I+K +H TPE+A INPMKQ+PA+VD
Sbjct  28   KMKLEVYADRMSQPSRAVIIFCKVNGIDYTELKVDISKREHLTPEFAEINPMKQLPAIVD  87

Query  280  GDFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTA  456
            G FKLFESH+ L YLA A  GVADHWYPA+L KR+K+ SV  WHHSNLRR A  YV NT 
Sbjct  88   GKFKLFESHSILIYLACAFPGVADHWYPANLFKRSKIHSVLYWHHSNLRRAADTYVTNTT  147

Query  457  LAPAFGLPCNPHAAAEAEKVLLASL  531
            + PA G P N  AAAEAEK+L +SL
Sbjct  148  ILPALGHPSNQQAAAEAEKLLFSSL  172



>gb|KJB25822.1| hypothetical protein B456_004G211100 [Gossypium raimondii]
Length=250

 Score =   198 bits (504),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 114/144 (79%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +++Y DRMSQPSRA++IFCK NGID+ E+++ I+K +H TPE+A INPMKQ+PA+VDG
Sbjct  1    MKLEVYADRMSQPSRAVIIFCKVNGIDYTELKVDISKREHLTPEFAEINPMKQLPAIVDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             FKLFESH+ L YLA A  GVADHWYPA+L KR+K+ SV  WHHSNLRR A  YV NT +
Sbjct  61   KFKLFESHSILIYLACAFPGVADHWYPANLFKRSKIHSVLYWHHSNLRRAADTYVTNTTI  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
             PA G P N  AAAEAEK+L +SL
Sbjct  121  LPALGHPSNQQAAAEAEKLLFSSL  144



>gb|AEB77874.1| glutathione S-transferase protein [Bruguiera gymnorhiza]
Length=250

 Score =   197 bits (502),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 112/144 (78%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K++ DR SQPSRA+++FCK NGIDFEE+++ + + +  +PE+  INPM +VPA+VDG
Sbjct  1    MKLKVFADRKSQPSRAVILFCKVNGIDFEEIKVDLMQKKQFSPEFKEINPMGKVPAIVDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             FKLFESHA L YLA A  GVADHWYPADL KRAK+ SV DWHHS LRRG+ G V N  L
Sbjct  61   RFKLFESHAILIYLACAFPGVADHWYPADLFKRAKIHSVLDWHHSYLRRGSVGIVLNGKL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
             PA GLP NP AAAEAEK+L +SL
Sbjct  121  GPALGLPLNPQAAAEAEKLLSSSL  144



>ref|XP_010441287.1| PREDICTED: glutathione S-transferase T1-like [Camelina sativa]
Length=244

 Score =   197 bits (501),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 111/144 (77%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y DRMSQPSRA++IFCK NGI F+E  I ++K Q  TPE+  INPM +VPA+VDG
Sbjct  1    MMLKVYADRMSQPSRAVIIFCKVNGIQFDENLIILSKRQQLTPEFKDINPMGKVPAIVDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
              KLFESHA L YL++A   V DHWYP DL KRAK+ SV DWHH++LR GAAGYV N+ L
Sbjct  61   RLKLFESHAILIYLSSAFPSVVDHWYPNDLSKRAKIHSVLDWHHTSLRPGAAGYVLNSVL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            APA GLP NP AAA+AEK+L  SL
Sbjct  121  APALGLPLNPKAAADAEKLLTKSL  144



>ref|XP_006439582.1| hypothetical protein CICLE_v10021879mg [Citrus clementina]
 ref|XP_006476593.1| PREDICTED: glutathione S-transferase T1-like [Citrus sinensis]
 gb|ESR52822.1| hypothetical protein CICLE_v10021879mg [Citrus clementina]
Length=247

 Score =   197 bits (501),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 111/144 (77%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y DR+SQPSRA++IFCK NGIDFEE+++++A  +  +PE+  INPM +VPA+VDG
Sbjct  1    MKLKVYADRLSQPSRAVIIFCKVNGIDFEEIEVKLANREQHSPEFKDINPMAKVPAIVDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
              KLFESHA L YL+ A  GVADHWYP DL KRAK+ SV DWHHSNLR G   YVFN  L
Sbjct  61   RLKLFESHAILTYLSCAFPGVADHWYPNDLLKRAKIHSVLDWHHSNLRLGTVKYVFNHKL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            AP  GLP NP AAA+ +K+L +SL
Sbjct  121  APVVGLPLNPEAAAKGKKILSSSL  144



>ref|XP_003563992.1| PREDICTED: glutathione S-transferase T1 [Brachypodium distachyon]
Length=274

 Score =   198 bits (503),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 112/143 (78%), Gaps = 2/143 (1%)
 Frame = +1

Query  109  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAA-INPMKQVPAVVDGD  285
            +K+Y DR SQPSRA++IFC+AN IDF+EV + + K QH TPE+ + INPM QVPA+VDG 
Sbjct  38   LKVYADRRSQPSRAIIIFCRANRIDFDEVTVDLFKAQHLTPEFKSKINPMGQVPAIVDGR  97

Query  286  FKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            FKLFESHA L+YLA+   GV DHWYPADL  RAK++S+ DWHHSNLRRGA  +V NT L 
Sbjct  98   FKLFESHAILRYLASVFPGVPDHWYPADLFTRAKIESILDWHHSNLRRGAVTFVLNTVLG  157

Query  463  PAFGLPCNPHAAAEAEKVLLASL  531
            P+ GLP +P AA E EK+L+ SL
Sbjct  158  PSLGLPTSPEAAKEGEKLLVRSL  180



>ref|XP_010436071.1| PREDICTED: glutathione S-transferase T1 [Camelina sativa]
Length=244

 Score =   197 bits (500),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 111/144 (77%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y DRMSQPSRA++IFCK NGI F+E  I ++K Q  TPE+  INPM +VPA+VDG
Sbjct  1    MKLKVYADRMSQPSRAVIIFCKVNGIQFDENLIILSKRQQLTPEFKDINPMGKVPAIVDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
              KLFESHA L YL++A   V DHWYP DL KRAK+ SV DWHH++LR GAAGYV N+ L
Sbjct  61   RLKLFESHAILIYLSSAFPSVVDHWYPNDLSKRAKIHSVLDWHHTSLRPGAAGYVLNSVL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            APA GLP NP AAA+AEK+L  SL
Sbjct  121  APALGLPLNPKAAADAEKLLTKSL  144



>ref|XP_006405381.1| hypothetical protein EUTSA_v10027900mg [Eutrema salsugineum]
 dbj|BAJ34350.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ46834.1| hypothetical protein EUTSA_v10027900mg [Eutrema salsugineum]
Length=244

 Score =   196 bits (499),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 112/144 (78%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y DRMSQPSRA++IFCK NGI F+E+ I +AK Q   PE+  INP+ +VPA+VDG
Sbjct  1    MKLKVYTDRMSQPSRAVIIFCKVNGIQFDEILISLAKRQQLAPEFKDINPLGKVPAIVDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
              KLFESHA L YL++A   VADHWYP DL KRAK+ SV DWHH+NLR GAAGYV N+ L
Sbjct  61   RLKLFESHAILIYLSSAFPSVADHWYPNDLSKRAKIHSVLDWHHTNLRPGAAGYVLNSVL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            AP+ GLP +P AA++A+K+L  SL
Sbjct  121  APSLGLPLDPQAASKADKLLTKSL  144



>gb|KHN23652.1| Glutathione S-transferase T1 [Glycine soja]
 gb|AJE59641.1| theta class glutathione S-transferase [Glycine max]
Length=250

 Score =   196 bits (498),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 118/144 (82%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y DRMSQPSRA+LIFCK NGIDFEE+++ ++K Q  +PE+ A+NP+++VPA+VDG
Sbjct  1    MKLKVYADRMSQPSRAVLIFCKVNGIDFEEIKVDLSKRQQLSPEFRAVNPLRKVPAIVDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             FKLFESHA L YLA+A  GVADHWYPADL +RA++ SV DWHH NLRRGAA +V NT L
Sbjct  61   RFKLFESHAILIYLASAFPGVADHWYPADLSRRARIHSVLDWHHQNLRRGAASFVLNTVL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            AP  GL  N  AAAEAEK+L++SL
Sbjct  121  APLLGLRANQQAAAEAEKILISSL  144



>ref|NP_001236903.1| glutathione S-transferase GST 23 [Glycine max]
 gb|AAG34813.1|AF243378_1 glutathione S-transferase GST 23 [Glycine max]
Length=250

 Score =   196 bits (498),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 118/144 (82%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y DRMSQPSRA+LIFCK NGIDFEE+++ ++K Q  +PE+ A+NP+++VPA+VDG
Sbjct  1    MKLKVYADRMSQPSRAVLIFCKVNGIDFEEIKVDLSKRQQLSPEFRAVNPLRKVPAIVDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             FKLFESHA L YLA+A  GVADHWYPADL +RA++ SV DWHH NLRRGAA +V NT L
Sbjct  61   RFKLFESHAILIYLASAFPGVADHWYPADLSRRARIHSVLDWHHQNLRRGAASFVLNTVL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            AP  GL  N  AAAEAEK+L++SL
Sbjct  121  APLLGLRANQQAAAEAEKILISSL  144



>gb|KFK33026.1| hypothetical protein AALP_AA6G320800 [Arabis alpina]
Length=244

 Score =   196 bits (497),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 110/144 (76%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y DRMSQPSRA++IFCK NGI F+E+ I ++K Q  +PE+  INP+ +VPA+VDG
Sbjct  1    MKLKVYTDRMSQPSRAIIIFCKVNGIQFDEISIILSKRQQLSPEFKEINPLGKVPAIVDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
              KLFESHA L YLA+A   V DHWYP DL KRAK+ SV DWHH+NLR GAAGYV NT L
Sbjct  61   RLKLFESHAILIYLASAFPSVLDHWYPNDLSKRAKIHSVMDWHHTNLRPGAAGYVMNTVL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            AP  GL  +P AAA+AEK+L  SL
Sbjct  121  APHLGLTLDPQAAAKAEKLLTQSL  144



>ref|XP_003532409.1| PREDICTED: glutathione S-transferase T2-like isoform X1 [Glycine 
max]
 gb|AJE59643.1| theta class glutathione S-transferase [Glycine max]
Length=252

 Score =   195 bits (496),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 115/142 (81%), Gaps = 1/142 (1%)
 Frame = +1

Query  109  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDF  288
            +K+Y D+MSQPSRA+LIFC+ NGIDFEE+++ I+K  H +PE+  INP+++VPA+V G F
Sbjct  5    LKVYADQMSQPSRAVLIFCRFNGIDFEEIKVDISKRHHLSPEFREINPLQKVPAIVHGSF  64

Query  289  KLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAP  465
             L ESHA L YLA+A  G+ADHWYP++L +RAK++SV DWHHSNL+ GAA YV NT L P
Sbjct  65   NLSESHAILVYLASAFPGIADHWYPSNLFRRAKINSVMDWHHSNLQHGAANYVINTVLGP  124

Query  466  AFGLPCNPHAAAEAEKVLLASL  531
            A G P +P AAAEAEKVLL+SL
Sbjct  125  ATGRPLSPKAAAEAEKVLLSSL  146



>ref|NP_001152125.1| glutathione S-transferase theta-1 [Zea mays]
 gb|ACG45968.1| glutathione S-transferase theta-1 [Zea mays]
 gb|ACN25412.1| unknown [Zea mays]
 tpg|DAA52620.1| TPA: glutathione S-transferase theta-1 [Zea mays]
Length=249

 Score =   195 bits (495),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 110/142 (77%), Gaps = 1/142 (1%)
 Frame = +1

Query  109  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDF  288
            VK+Y DR SQPSRA++IFC+ N IDFEEV + + K QH TPE+  INPM QVPA+VDG F
Sbjct  4    VKVYADRRSQPSRAVIIFCRVNQIDFEEVTVDLFKSQHLTPEFKKINPMGQVPAIVDGRF  63

Query  289  KLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAP  465
            KLFESHA L+YLA+   GVADHWYP+DL  RAK++S+ DWHHSNLRRGAA  V +TALAP
Sbjct  64   KLFESHAILRYLASVFPGVADHWYPSDLFTRAKIESILDWHHSNLRRGAATLVMHTALAP  123

Query  466  AFGLPCNPHAAAEAEKVLLASL  531
              GL  +  A  +AEK+++ SL
Sbjct  124  FLGLTTSHEAVKQAEKLVMQSL  145



>gb|EMT22242.1| hypothetical protein F775_32578 [Aegilops tauschii]
Length=242

 Score =   195 bits (495),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/149 (62%), Positives = 110/149 (74%), Gaps = 8/149 (5%)
 Frame = +1

Query  109  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDF  288
            +K+Y DR+SQPSRA++I CK N IDF+E+ + +A+GQHR PE+  INPM QVP +VDG F
Sbjct  5    LKVYADRLSQPSRAIIILCKVNRIDFQELTVDLARGQHRAPEFTKINPMAQVPTIVDGRF  64

Query  289  KLFE-------SHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYV  444
            KLFE       SHA L+YLA    GV DHWYPADL  RAK++SV DWHHSNLRRGAA YV
Sbjct  65   KLFESMFLLPVSHAILRYLATVFPGVPDHWYPADLFTRAKLESVLDWHHSNLRRGAATYV  124

Query  445  FNTALAPAFGLPCNPHAAAEAEKVLLASL  531
             +TAL PA GL  NP  A EAEK+L  SL
Sbjct  125  LHTALGPALGLTPNPETAKEAEKLLSRSL  153



>emb|CDY71891.1| BnaC06g42280D [Brassica napus]
Length=241

 Score =   194 bits (494),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 110/144 (76%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y DRMSQPSRA++IFCK NGI+F+EV I +AK Q  +PE+  INP+ +VP +VDG
Sbjct  1    MKLKVYADRMSQPSRAVIIFCKVNGIEFDEVLIILAKRQQLSPEFKEINPLGKVPTIVDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             FKLFESHA L YLA+A   VADHWYP DL KRAK+ SV DWHH+NLR GAAGYV NT L
Sbjct  61   RFKLFESHAILIYLASAFPSVADHWYPNDLSKRAKIHSVLDWHHTNLRPGAAGYVMNTVL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            AP  G   +  AAAEAEK+L  SL
Sbjct  121  APFLGRSLDSKAAAEAEKILTKSL  144



>ref|XP_004980948.1| PREDICTED: glutathione S-transferase T1-like [Setaria italica]
Length=250

 Score =   194 bits (494),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 110/142 (77%), Gaps = 1/142 (1%)
 Frame = +1

Query  109  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDF  288
            +K+Y DR SQPSRA++IFC+ N IDFEEV + + K QH TP++  INP+ QVPA+VDG F
Sbjct  4    IKVYADRRSQPSRAVIIFCRVNQIDFEEVTVDLFKSQHLTPQFRKINPLGQVPAIVDGRF  63

Query  289  KLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAP  465
            KLFESHA L+YLA+   GVADHWYPADL  RAK++S+ DWHHSNLRRGAA  V +TALAP
Sbjct  64   KLFESHAILRYLASVFPGVADHWYPADLFTRAKIESILDWHHSNLRRGAATLVMHTALAP  123

Query  466  AFGLPCNPHAAAEAEKVLLASL  531
              GL  +P A  +AEK+L  SL
Sbjct  124  FLGLTTSPDAVKQAEKLLSQSL  145



>emb|CAA10662.1| glutathione transferase, GST 10b [Arabidopsis thaliana]
Length=245

 Score =   194 bits (494),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 108/144 (75%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y D+MSQPSRA+LIFCK N I F+E+ I + K Q  +PE+  INPM +VPA+VDG
Sbjct  2    MKLKVYADKMSQPSRAVLIFCKVNEIQFDEILISLGKRQQLSPEFKEINPMGKVPAIVDG  61

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
              KLFESHA L YL++A   V DHWYP DL KRAK+ SV DWHH+NLR GA+GYV N+ L
Sbjct  62   RLKLFESHAILIYLSSAYASVVDHWYPNDLSKRAKIHSVLDWHHTNLRPGASGYVLNSVL  121

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            APA  LP NP AAAEAE +L  SL
Sbjct  122  APALSLPLNPKAAAEAENILTNSL  145



>ref|XP_009125179.1| PREDICTED: glutathione S-transferase T1-like [Brassica rapa]
Length=241

 Score =   194 bits (493),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 111/144 (77%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y DRMSQPSRA++IFCK NGI+F+EV I +AK Q  +PE+  INP+ +VP++VDG
Sbjct  1    MKLKVYADRMSQPSRAIIIFCKVNGIEFDEVLIILAKRQQLSPEFKEINPLGKVPSIVDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             FKLFESHA L YLA+A   VADHWYP D+ KRAK+ SV DWHH+NLR GAAGYV NT L
Sbjct  61   RFKLFESHAILIYLASAFPSVADHWYPNDVSKRAKIHSVLDWHHTNLRPGAAGYVMNTVL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            AP  G   +  AAAEAEK+L  SL
Sbjct  121  APFLGRSLDSKAAAEAEKILTKSL  144



>gb|ADE75690.1| unknown [Picea sitchensis]
Length=248

 Score =   194 bits (493),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 109/142 (77%), Gaps = 1/142 (1%)
 Frame = +1

Query  109  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDF  288
            +++YVDRMSQPSRA+LIFC  N I+FEE  + + K +H+ PE+ AINP+  VP + DG F
Sbjct  4    LRVYVDRMSQPSRAVLIFCMVNKIEFEEHLVNLGKKEHKQPEFRAINPLGLVPTIDDGGF  63

Query  289  KLFESHAALKYLAAAN-GVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAP  465
            KLFESHA LKYLA A   V DHWYPADL KRAK+DSV DWHHSNLRRG+AG V N  LAP
Sbjct  64   KLFESHAILKYLACAYPRVPDHWYPADLSKRAKIDSVLDWHHSNLRRGSAGLVLNRVLAP  123

Query  466  AFGLPCNPHAAAEAEKVLLASL  531
            A GLP N  AA+EAE +L +SL
Sbjct  124  ALGLPLNSQAASEAEILLKSSL  145



>emb|CDX67492.1| BnaA07g15320D [Brassica napus]
Length=241

 Score =   194 bits (492),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 110/144 (76%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y DRMSQPSRA++IFCK NGI+F+EV I +AK Q  +PE+  INP+ +VP++VDG
Sbjct  1    MKLKVYADRMSQPSRAVIIFCKVNGIEFDEVLIILAKRQQFSPEFKEINPLGKVPSIVDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             FKLFESH  L YLA+A   VADHWYP DL KRAK+ SV DWHH+NLR GAAGYV NT L
Sbjct  61   RFKLFESHTILIYLASAFPSVADHWYPNDLSKRAKIHSVLDWHHTNLRPGAAGYVMNTVL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            AP  G   +  AAAEAEK+L  SL
Sbjct  121  APFLGRSLDSKAAAEAEKILTKSL  144



>ref|XP_006282694.1| hypothetical protein CARUB_v10005614mg [Capsella rubella]
 gb|EOA15592.1| hypothetical protein CARUB_v10005614mg [Capsella rubella]
Length=244

 Score =   192 bits (488),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 109/144 (76%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+YVDRMSQPSRA++IFCK NGI F+E  I +AK Q  T E+  INP+ +VPA+VDG
Sbjct  1    MKLKVYVDRMSQPSRAVIIFCKVNGIQFDETLISLAKRQQLTSEFKDINPIGKVPAIVDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
              KLFESHA L YL++A   V DHWYP DL +RAK+ SV DWHH++LR GAAGYV  + L
Sbjct  61   RLKLFESHAILIYLSSAFPSVVDHWYPNDLSQRAKIHSVLDWHHTSLRPGAAGYVLYSVL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            APA GLP NP  AAEAEK+L  SL
Sbjct  121  APALGLPLNPEKAAEAEKLLTKSL  144



>ref|XP_009386057.1| PREDICTED: glutathione S-transferase T1-like [Musa acuminata 
subsp. malaccensis]
Length=232

 Score =   191 bits (486),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 106/144 (74%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y  R+SQPSRA++IFCK NGIDFEEV I    G+HR P++  INPM +VPA+V G
Sbjct  1    MTLKVYGHRLSQPSRAIIIFCKVNGIDFEEVTIDFTTGKHRLPDFKEINPMAEVPAIVHG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
            D KLFESHA L YLA+A  GV D WYPAD+  RAK+ S+ DWHHSNLRRGA  Y  N+AL
Sbjct  61   DLKLFESHAILCYLASAFPGVPDGWYPADIISRAKIQSILDWHHSNLRRGALNYCINSAL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
             P   LP NP AA E EK+L ASL
Sbjct  121  GPVRSLPLNPQAAIEDEKILSASL  144



>gb|EPS65585.1| hypothetical protein M569_09192 [Genlisea aurea]
Length=237

 Score =   191 bits (486),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 111/144 (77%), Gaps = 2/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +KLY DRMSQPSRA++IFCK NGI+FEEV+I ++K Q+ TPE+  INPMK+VPA+VDG
Sbjct  1    MCLKLYADRMSQPSRAVIIFCKMNGIEFEEVRIDLSKRQNLTPEFIEINPMKKVPALVDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             FKLFESHA L YLA+   GVADHWYPADL KRAK+ SV DWHH N  R A  YV N+ +
Sbjct  61   RFKLFESHAILIYLASVFPGVADHWYPADLFKRAKIHSVLDWHHLN-SRQAGSYVLNSTI  119

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            APA G P +  A AEAEK L ASL
Sbjct  120  APALGWPHSAVATAEAEKALSASL  143



>ref|XP_010676473.1| PREDICTED: glutathione S-transferase T1 [Beta vulgaris subsp. 
vulgaris]
Length=247

 Score =   191 bits (484),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 111/144 (77%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K++ DRMSQPSRA+++FCK N I+FEEV+I + K QH + E+A INP++QVPA+VDG
Sbjct  1    MTLKVFADRMSQPSRAVILFCKLNKINFEEVRIVLFKRQHFSQEFAEINPLRQVPAIVDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             FKL+ESHA L YL+ A  GVADHWYPAD+ KRAK+ SV DWHH NLR GA  YV NT L
Sbjct  61   RFKLYESHAILIYLSCAFPGVADHWYPADVSKRAKIHSVLDWHHLNLRYGAMRYVVNTTL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
             PA G P +  AAA AEKVL +SL
Sbjct  121  GPALGRPLDSQAAARAEKVLDSSL  144



>dbj|BAB11100.1| glutathione transferase [Arabidopsis thaliana]
Length=242

 Score =   190 bits (483),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 107/144 (74%), Gaps = 3/144 (2%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y DRMSQPSRA+LIFCK N I F+E+ I + K Q  +PE+  INPM +VPA+VDG
Sbjct  1    MKLKVYADRMSQPSRAVLIFCKVNEIQFDEILISLGKRQQLSPEFKEINPMGKVPAIVDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
              KLFESHA L YL++A   V DHWYP DL KRAK+ SV DWHH+NLR   AGYV N+ L
Sbjct  61   RLKLFESHAILIYLSSAYASVVDHWYPNDLSKRAKIHSVLDWHHTNLR--PAGYVLNSVL  118

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            APA GLP NP AAAEAE +L  SL
Sbjct  119  APALGLPLNPKAAAEAENILTNSL  142



>ref|XP_009140078.1| PREDICTED: glutathione S-transferase T1-like [Brassica rapa]
Length=246

 Score =   190 bits (483),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 109/144 (76%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y DRMSQPSRA++IFCK NGI+F+EV I +AK Q  +PE+  INP+ +VP +VDG
Sbjct  1    MKLKVYADRMSQPSRAVIIFCKVNGIEFDEVLIILAKRQQLSPEFKEINPLGKVPTIVDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
              KLFESHA L YL++A   VADHWYP DL KRAK+ SV DWHHSNLR GAAGYV N+ L
Sbjct  61   RLKLFESHAILIYLSSAFPSVADHWYPNDLSKRAKIHSVLDWHHSNLRPGAAGYVMNSVL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            AP  G   +  AAAEAE++L  SL
Sbjct  121  APFLGRSLDSKAAAEAEQILTKSL  144



>emb|CDY39752.1| BnaA04g11010D [Brassica napus]
Length=246

 Score =   189 bits (480),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 109/144 (76%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y DRMSQPSRA++IFCK NGI+F+EV I +AK Q  +PE+  INP+ +VP +VDG
Sbjct  1    MKLKVYADRMSQPSRAVIIFCKVNGIEFDEVLIILAKRQQLSPEFKEINPLGKVPTIVDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
              KLFESHA L YL++A   VADHWYP DL KRAK+ SV DWHHSNLR GAAGYV N+ L
Sbjct  61   RLKLFESHAILIYLSSAFPSVADHWYPNDLSKRAKIHSVLDWHHSNLRPGAAGYVMNSVL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            AP  G   +  AAAEAE++L  SL
Sbjct  121  APFLGGSLDSKAAAEAEQILTKSL  144



>ref|NP_198940.3| glutathione S-transferase THETA 2 [Arabidopsis thaliana]
 sp|Q8L727.1|GSTT2_ARATH RecName: Full=Glutathione S-transferase T2; Short=AtGSTT2; AltName: 
Full=GST class-theta member 2; AltName: Full=Glutathione 
S-transferase 10B [Arabidopsis thaliana]
 gb|AAM98138.1| glutathione transferase [Arabidopsis thaliana]
 gb|AAP37720.1| At5g41240 [Arabidopsis thaliana]
 gb|AED94656.1| glutathione S-transferase THETA 2 [Arabidopsis thaliana]
Length=591

 Score =   197 bits (502),  Expect = 3e-56, Method: Composition-based stats.
 Identities = 92/144 (64%), Positives = 109/144 (76%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y DRMSQPSRA+LIFCK N I F+E+ I + K Q  +PE+  INPM +VPA+VDG
Sbjct  1    MKLKVYADRMSQPSRAVLIFCKVNEIQFDEILISLGKRQQLSPEFKEINPMGKVPAIVDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
              KLFESHA L YL++A   V DHWYP DL KRAK+ SV DWHH+NLR GA+GYV N+ L
Sbjct  61   RLKLFESHAILIYLSSAYASVVDHWYPNDLSKRAKIHSVLDWHHTNLRPGASGYVLNSVL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            APA GLP NP AAAEAE +L  SL
Sbjct  121  APALGLPLNPKAAAEAENILTNSL  144



>emb|CDY46386.1| BnaC04g33050D [Brassica napus]
Length=245

 Score =   188 bits (478),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 109/144 (76%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y DRMSQPSRA++IFCK NGI+F+EV I +AK Q  +PE+  INP+ +VP +VDG
Sbjct  1    MKLKVYADRMSQPSRAVIIFCKVNGIEFDEVLIILAKRQQLSPEFKEINPLGKVPTIVDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
              KLFESHA L YL++A   VADHWYP DL KRAK+ SV DWHH+NLR GAAGYV N+ L
Sbjct  61   RLKLFESHAILIYLSSAFPSVADHWYPNDLSKRAKIHSVLDWHHTNLRPGAAGYVMNSVL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            AP  G   +  AAAEAE++L  SL
Sbjct  121  APFLGGSLDSKAAAEAEQILTKSL  144



>ref|XP_007160051.1| hypothetical protein PHAVU_002G288500g [Phaseolus vulgaris]
 gb|ESW32045.1| hypothetical protein PHAVU_002G288500g [Phaseolus vulgaris]
Length=253

 Score =   188 bits (478),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 108/142 (76%), Gaps = 1/142 (1%)
 Frame = +1

Query  109  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDF  288
            +K+Y DRMSQPSRA+LIFC+ NGI F E+++ I+KG H + E+  +NP+++VPA+V G F
Sbjct  6    LKVYADRMSQPSRAVLIFCRLNGIGFVEIKVDISKGHHLSSEFTEVNPLQKVPAIVHGSF  65

Query  289  KLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAP  465
             L ESHA L YL +A  G+ADHWYP+D+ +RAK++SV DWHHSNLR GA  YV NT L P
Sbjct  66   NLSESHAILVYLNSAFPGIADHWYPSDIFRRAKINSVMDWHHSNLRNGAVSYVINTVLGP  125

Query  466  AFGLPCNPHAAAEAEKVLLASL  531
            A G   NP  AAEAEKVL +SL
Sbjct  126  ATGRTLNPKTAAEAEKVLFSSL  147



>ref|XP_004245614.1| PREDICTED: glutathione S-transferase T1 [Solanum lycopersicum]
Length=250

 Score =   188 bits (477),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 105/144 (73%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +KLYVDRMSQ  R ++IFCK NGIDFEEV I ++K Q  +PEY  INP++Q+PA++DG
Sbjct  1    MTLKLYVDRMSQACREVIIFCKLNGIDFEEVHIDLSKRQQLSPEYREINPIRQIPAIMDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             FKL ESHA LKYLA A   +ADHWYPADL KRAKV+SV DWH +N  RG   Y F + L
Sbjct  61   RFKLSESHAILKYLACAFPRIADHWYPADLYKRAKVESVLDWHRTNFPRGPGSYTFYSVL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            AP  GLP N  AAA  EK+ +A L
Sbjct  121  APTVGLPLNTKAAARTEKMFIACL  144



>ref|XP_002449793.1| hypothetical protein SORBIDRAFT_05g023450 [Sorghum bicolor]
 gb|EES08781.1| hypothetical protein SORBIDRAFT_05g023450 [Sorghum bicolor]
Length=252

 Score =   187 bits (476),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 106/142 (75%), Gaps = 1/142 (1%)
 Frame = +1

Query  109  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDF  288
            +K+Y  R SQP RA++IFC+AN IDFEEV + + K Q+ TPE+  INPM QVPA+VDG F
Sbjct  4    IKVYAHRWSQPCRAVIIFCRANKIDFEEVTVDLFKSQNLTPEFRKINPMAQVPAIVDGRF  63

Query  289  KLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAP  465
            KLFESHA L+YLA    GVADHWYPADL  RAK++S+ DWHHSNLR GA  +V+ TALAP
Sbjct  64   KLFESHAILRYLATVFPGVADHWYPADLFTRAKIESILDWHHSNLRLGAGTFVYYTALAP  123

Query  466  AFGLPCNPHAAAEAEKVLLASL  531
              GL   P A   AEKVL+ SL
Sbjct  124  FLGLRPRPEATKHAEKVLMQSL  145



>emb|CDP09755.1| unnamed protein product [Coffea canephora]
Length=234

 Score =   186 bits (472),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 116/145 (80%), Gaps = 2/145 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAV-VD  279
            M +KL+VDR+SQP RA+LIFCK N I+FEEV+I+++KG+  +PE+  INPM++VPA+ VD
Sbjct  1    MKLKLFVDRLSQPCRAILIFCKMNEIEFEEVRIELSKGEQLSPEFKEINPMQKVPAMKVD  60

Query  280  GDFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTA  456
              F+LFESHA L++LA A  GVADHWYPADL KRA++DSV DWHH+NLR G+AG VF++ 
Sbjct  61   ERFRLFESHAILRFLAGAFPGVADHWYPADLFKRAEIDSVLDWHHANLRHGSAGLVFHSK  120

Query  457  LAPAFGLPCNPHAAAEAEKVLLASL  531
            LA   G P +  AAA+ EKVL ASL
Sbjct  121  LARLSGRPLDLRAAADCEKVLSASL  145



>ref|XP_008651869.1| PREDICTED: LOW QUALITY PROTEIN: glutathione S-transferase T1-like 
[Zea mays]
Length=140

 Score =   182 bits (463),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 104/137 (76%), Gaps = 1/137 (1%)
 Frame = +1

Query  109  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDF  288
            VK+Y DR SQPSRA++IFC+ N IDFEEV + + K QH TPE+  INPM QVPA+VDG F
Sbjct  4    VKVYADRRSQPSRAVIIFCRVNQIDFEEVTVDLFKSQHLTPEFKKINPMGQVPAIVDGRF  63

Query  289  KLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAP  465
            KLFESHA L+YLA+   GVADHWYP+DL  RAK++S+ DWHHSNLRRGAA  V +TAL P
Sbjct  64   KLFESHAILRYLASVFPGVADHWYPSDLFTRAKIESILDWHHSNLRRGAATLVMHTALLP  123

Query  466  AFGLPCNPHAAAEAEKV  516
            +  L  +  A  +AE +
Sbjct  124  SLVLRQSXEAVKQAESL  140



>ref|XP_002967178.1| hypothetical protein SELMODRAFT_144252 [Selaginella moellendorffii]
 gb|EFJ31777.1| hypothetical protein SELMODRAFT_144252 [Selaginella moellendorffii]
Length=250

 Score =   186 bits (473),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 113/152 (74%), Gaps = 4/152 (3%)
 Frame = +1

Query  79   PPERDREEMAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMK  258
            P +RD +   + LYVD MSQPSRA+LIFC+ N ID E   + +AKGQ RTPE+ AINPM 
Sbjct  6    PHKRDSK---LHLYVDFMSQPSRAILIFCRINNIDAEIHVVNVAKGQQRTPEFKAINPMG  62

Query  259  QVPAVVDGDFKLFESHAALKYLAAAN-GVADHWYPADLQKRAKVDSVCDWHHSNLRRGAA  435
            QVPA+VD  FKLFESHA L+YLAA    V DHWYP+DL +RA++DS+ DWHH+NLRRGAA
Sbjct  63   QVPAIVDHGFKLFESHAILRYLAATYPKVPDHWYPSDLSRRARIDSILDWHHANLRRGAA  122

Query  436  GYVFNTALAPAFGLPCNPHAAAEAEKVLLASL  531
            G V    LAP  GL  +P  A+++EK+L +SL
Sbjct  123  GLVMALVLAPVLGLSKDPKLASDSEKLLRSSL  154



>ref|XP_002960542.1| hypothetical protein SELMODRAFT_74927 [Selaginella moellendorffii]
 gb|EFJ38081.1| hypothetical protein SELMODRAFT_74927 [Selaginella moellendorffii]
Length=248

 Score =   186 bits (473),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 113/152 (74%), Gaps = 4/152 (3%)
 Frame = +1

Query  79   PPERDREEMAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMK  258
            P +RD +   + LYVD MSQPSRA+LIFC+ N ID E   + +AKGQ RTPE+ AINPM 
Sbjct  4    PHKRDSK---LHLYVDFMSQPSRAILIFCQINNIDAEIHVVNVAKGQQRTPEFKAINPMG  60

Query  259  QVPAVVDGDFKLFESHAALKYLAAAN-GVADHWYPADLQKRAKVDSVCDWHHSNLRRGAA  435
            QVPA+VD  FKLFESHA L+YLAA    V DHWYP+DL +RA++DS+ DWHH+NLRRGAA
Sbjct  61   QVPAIVDHGFKLFESHAILRYLAATYPKVPDHWYPSDLSRRARIDSILDWHHANLRRGAA  120

Query  436  GYVFNTALAPAFGLPCNPHAAAEAEKVLLASL  531
            G V    LAP  GL  +P  A+++EK+L +SL
Sbjct  121  GLVMALVLAPVLGLSKDPRLASDSEKLLRSSL  152



>tpg|DAA43810.1| TPA: hypothetical protein ZEAMMB73_384133 [Zea mays]
Length=130

 Score =   179 bits (454),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (1%)
 Frame = +1

Query  109  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDF  288
            VK+Y DR SQPSRA++IFC+ N IDFEEV + + K QH TPE+  INPM QVPA+VDG F
Sbjct  4    VKVYADRRSQPSRAVIIFCRVNQIDFEEVTVDLFKSQHLTPEFKKINPMGQVPAIVDGRF  63

Query  289  KLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAP  465
            KLFESHA L+YLA+   GVADHWYP+DL  RAK++S+ DWHHSNLRRGAA  V +TAL P
Sbjct  64   KLFESHAILRYLASVFPGVADHWYPSDLFTRAKIESILDWHHSNLRRGAATLVMHTALLP  123

Query  466  AFGL  477
            +  L
Sbjct  124  SLVL  127



>ref|NP_198938.1| glutathione S-transferase THETA 3 [Arabidopsis thaliana]
 sp|Q9FHE1.1|GSTT3_ARATH RecName: Full=Glutathione S-transferase T3; Short=AtGSTT3; AltName: 
Full=GST class-theta member 3; AltName: Full=Glutathione 
S-transferase 10C [Arabidopsis thaliana]
 dbj|BAB11098.1| glutathione transferase-like [Arabidopsis thaliana]
 gb|AED94655.1| glutathione S-transferase THETA 3 [Arabidopsis thaliana]
Length=590

 Score =   191 bits (485),  Expect = 7e-54, Method: Composition-based stats.
 Identities = 90/144 (63%), Positives = 108/144 (75%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y DRMSQPSRA+LIFCK N I F+E+ I +A  Q  +PE+  INPM +VPA+VDG
Sbjct  1    MKLKVYADRMSQPSRAVLIFCKVNEIQFDEILIYLANRQQLSPEFKDINPMGKVPAIVDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
              KL ESHA L YL++A   V DHWYP DL KRA++ SV DWHH+NLR GAAGYV N+ L
Sbjct  61   KLKLSESHAILIYLSSAYPSVVDHWYPTDLSKRARIHSVLDWHHTNLRPGAAGYVLNSVL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
             PA GLP NP AAAEAE++L  SL
Sbjct  121  GPALGLPLNPKAAAEAEQLLTKSL  144



>ref|XP_006343999.1| PREDICTED: glutathione S-transferase T1-like isoform X2 [Solanum 
tuberosum]
Length=181

 Score =   180 bits (457),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 103/144 (72%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +KLYVDRMSQ  R ++IFCK NGIDFEEV I ++K Q  +PEY  INP++Q+PA++DG
Sbjct  1    MTLKLYVDRMSQACREVIIFCKLNGIDFEEVHIDLSKRQQLSPEYREINPIRQIPAIMDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             FKL ESHA L+YLA A   +ADHWYPADL KRAKV+SV DW  +   RG   YVF + L
Sbjct  61   RFKLSESHAILRYLACAFPRIADHWYPADLYKRAKVESVLDWQRTTFPRGPGSYVFYSVL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
                G+P N  AAA  EK L+ASL
Sbjct  121  GTTVGMPLNTKAAARTEKNLIASL  144



>gb|KJB52088.1| hypothetical protein B456_008G246300 [Gossypium raimondii]
Length=232

 Score =   181 bits (458),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 101/138 (73%), Gaps = 17/138 (12%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y DRMSQPSRA++IFCK NGID+EE+++ I+KGQH TPE+A INPMKQ+PA+ DG
Sbjct  1    MKLKVYADRMSQPSRAVIIFCKVNGIDYEEIKVHISKGQHLTPEFAEINPMKQLPAIADG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
             FKLFE                  YPAD+ KR+K+ SV DWHHSNLRRGAA YVFNT +A
Sbjct  61   RFKLFER-----------------YPADVFKRSKIHSVLDWHHSNLRRGAAPYVFNTTIA  103

Query  463  PAFGLPCNPHAAAEAEKV  516
            P  G P NP AAAEAE +
Sbjct  104  PILGRPLNPQAAAEAEII  121



>ref|XP_006343998.1| PREDICTED: glutathione S-transferase T1-like isoform X1 [Solanum 
tuberosum]
Length=250

 Score =   181 bits (458),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 103/144 (72%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +KLYVDRMSQ  R ++IFCK NGIDFEEV I ++K Q  +PEY  INP++Q+PA++DG
Sbjct  1    MTLKLYVDRMSQACREVIIFCKLNGIDFEEVHIDLSKRQQLSPEYREINPIRQIPAIMDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             FKL ESHA L+YLA A   +ADHWYPADL KRAKV+SV DW  +   RG   YVF + L
Sbjct  61   RFKLSESHAILRYLACAFPRIADHWYPADLYKRAKVESVLDWQRTTFPRGPGSYVFYSVL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
                G+P N  AAA  EK L+ASL
Sbjct  121  GTTVGMPLNTKAAARTEKNLIASL  144



>ref|XP_001778018.1| predicted protein [Physcomitrella patens]
 gb|EDQ57127.1| predicted protein [Physcomitrella patens]
 gb|AFZ39142.1| theta class glutathione S-transferase [Physcomitrella patens]
Length=257

 Score =   179 bits (455),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 105/142 (74%), Gaps = 1/142 (1%)
 Frame = +1

Query  109  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDF  288
            +KLY D MSQPSRA+L+FC+ N ID ++  I I KG H+TPE+ AINP+ +VP +VDG F
Sbjct  7    LKLYADLMSQPSRAVLLFCRVNNIDVDQQLINIQKGDHKTPEFKAINPLGKVPCIVDGRF  66

Query  289  KLFESHAALKYLAAAN-GVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAP  465
            KL ESHA ++YLAA   GVADHWYP D+Q+R+K++SV DWHH NLRRG+   VF+  LAP
Sbjct  67   KLAESHAIMEYLAATRPGVADHWYPTDVQRRSKINSVLDWHHLNLRRGSMTLVFHKVLAP  126

Query  466  AFGLPCNPHAAAEAEKVLLASL  531
              G+  +P AAAE   +L  SL
Sbjct  127  IVGVKADPRAAAEGLSILQQSL  148



>ref|XP_008794198.1| PREDICTED: glutathione S-transferase T1 isoform X2 [Phoenix dactylifera]
Length=232

 Score =   178 bits (452),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 100/143 (70%), Gaps = 17/143 (12%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y DR+SQPSRA++IFCK NGIDFEEV I + K QHR+PE+  INPM QVPA+VDG
Sbjct  1    MKLKVYADRLSQPSRAIVIFCKLNGIDFEEVPIDLTKRQHRSPEFKEINPMGQVPAIVDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
             FKLFE                  YPADL  RAK+DSV DWHH NLRRGAA Y  N+ +A
Sbjct  61   RFKLFER-----------------YPADLFNRAKIDSVLDWHHLNLRRGAAFYALNSVIA  103

Query  463  PAFGLPCNPHAAAEAEKVLLASL  531
            P FGLP N  AA EAEKVL +SL
Sbjct  104  PVFGLPLNSQAANEAEKVLRSSL  126



>gb|KJB52086.1| hypothetical protein B456_008G246300 [Gossypium raimondii]
Length=214

 Score =   175 bits (444),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 95/114 (83%), Gaps = 1/114 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y DRMSQPSRA++IFCK NGID+EE+++ I+KGQH TPE+A INPMKQ+PA+ DG
Sbjct  1    MKLKVYADRMSQPSRAVIIFCKVNGIDYEEIKVHISKGQHLTPEFAEINPMKQLPAIADG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGY  441
             FKLFESHA L YLA A  GVAD WYPAD+ KR+K+ SV DWHHSNLRRGA  +
Sbjct  61   RFKLFESHAILIYLACAFPGVADQWYPADVFKRSKIHSVLDWHHSNLRRGAESF  114



>emb|CDP09753.1| unnamed protein product [Coffea canephora]
Length=131

 Score =   172 bits (437),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 99/124 (80%), Gaps = 2/124 (2%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAV-VD  279
            M +KL+VDR+SQP RA+LIFCK NGI+FEEV I   K ++ +PEY  INPM+ VPA+ VD
Sbjct  1    MKLKLFVDRLSQPCRAILIFCKLNGIEFEEVTIDFCKRENISPEYQKINPMQLVPAIEVD  60

Query  280  GDFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTA  456
            G+FKLFESHA L++LA+A  GVADHWYPADL +RA++DSV DW HSNLR G  G VFN+ 
Sbjct  61   GEFKLFESHAILRFLASAFPGVADHWYPADLFERAQIDSVLDWRHSNLRHGTTGLVFNST  120

Query  457  LAPA  468
            + PA
Sbjct  121  VGPA  124



>ref|XP_002966830.1| hypothetical protein SELMODRAFT_144283 [Selaginella moellendorffii]
 gb|EFJ31429.1| hypothetical protein SELMODRAFT_144283 [Selaginella moellendorffii]
Length=224

 Score =   175 bits (443),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 104/144 (72%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            MA+ LY+D +SQPSRA+ IFC+ N I+ E   + + KG+H+TPEY A+NPM QVPA+VD 
Sbjct  1    MALHLYIDLLSQPSRAIYIFCRVNNIEAEIHHLDLMKGEHQTPEYKAVNPMGQVPAIVDN  60

Query  283  DFKLFESHAALKYLAAAN-GVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             FKLFESHA L+YLA    GV+ +WYP+D  + A++DSV DWHH NLRRGAAG  FN  L
Sbjct  61   GFKLFESHAILRYLATTKPGVSSNWYPSDPLRGARIDSVLDWHHGNLRRGAAGLFFNEVL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            AP  G+P +    AE +K L AS+
Sbjct  121  APYLGIPKDESKLAEFDKTLQASV  144



>ref|XP_002961176.1| hypothetical protein SELMODRAFT_270213 [Selaginella moellendorffii]
 gb|EFJ38715.1| hypothetical protein SELMODRAFT_270213 [Selaginella moellendorffii]
Length=224

 Score =   174 bits (442),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 104/144 (72%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            MA+ LY+D +SQPSRA+ IFC+ N I+ E   + + K +H+TPEY A+NPM QVPA+VD 
Sbjct  1    MALHLYIDLLSQPSRAIYIFCRVNNIEAEIHHLDLMKREHQTPEYKAVNPMGQVPAIVDN  60

Query  283  DFKLFESHAALKYLAAAN-GVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  459
             FKLFESHA L+YLA    GV+ +WYP+D  +RA++DSV DWHH NLRRGAAG  FN  L
Sbjct  61   GFKLFESHAILRYLATTKPGVSSNWYPSDPLRRARIDSVLDWHHGNLRRGAAGLFFNEVL  120

Query  460  APAFGLPCNPHAAAEAEKVLLASL  531
            AP  G+P +    AE +K L AS+
Sbjct  121  APYLGIPKDESKLAEFDKTLQASV  144



>gb|AFV96155.1| glutathion-S-transferase theta, partial [Brassica oleracea]
Length=200

 Score =   174 bits (440),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 101/134 (75%), Gaps = 1/134 (1%)
 Frame = +1

Query  133  SQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDFKLFESHAA  312
            SQPSRA++IFCK NGI+F+EV I +AK Q  +PE+  INP+ +VP +VDG  KLFESHA 
Sbjct  1    SQPSRAVIIFCKVNGIEFDEVLIILAKRQQLSPEFKEINPLGKVPTIVDGRLKLFESHAI  60

Query  313  LKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAPAFGLPCNP  489
            L YL++A   VADHWYP DL KRAK+ SV DWHH+NLR GAAGYV N+ LAP  G   + 
Sbjct  61   LIYLSSAFPSVADHWYPNDLSKRAKIHSVLDWHHTNLRPGAAGYVMNSVLAPFLGGSLDS  120

Query  490  HAAAEAEKVLLASL  531
             AAAEAE++L  SL
Sbjct  121  KAAAEAEQILTKSL  134



>ref|XP_002509787.1| glutathione-s-transferase theta, gst, putative [Ricinus communis]
 gb|EEF51174.1| glutathione-s-transferase theta, gst, putative [Ricinus communis]
Length=238

 Score =   174 bits (442),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 85/145 (59%), Positives = 104/145 (72%), Gaps = 2/145 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +KLYV R+S+PSRAL+ FCK NGI+FEE++I + KGQH++PE+  I   +   +  + 
Sbjct  1    MELKLYVHRLSEPSRALIAFCKLNGIEFEEIEIDLVKGQHKSPEFKVITETEYHASKFEK  60

Query  283  DF-KLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTA  456
             + +    HA L YLA+A  GVADHWYPADLQKRAKV +V DWHHSNLRRG+  YV NT 
Sbjct  61   LYHRTMYCHAILGYLASAFPGVADHWYPADLQKRAKVHAVLDWHHSNLRRGSVMYVLNTK  120

Query  457  LAPAFGLPCNPHAAAEAEKVLLASL  531
            L P  GLP NP AAAE EKVL  SL
Sbjct  121  LGPVLGLPVNPQAAAEGEKVLSCSL  145



>ref|XP_010676472.1| PREDICTED: glutathione S-transferase T1-like [Beta vulgaris subsp. 
vulgaris]
Length=239

 Score =   173 bits (438),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 106/143 (74%), Gaps = 1/143 (1%)
 Frame = +1

Query  106  AVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGD  285
             +K+Y DR SQP+RA+++FC  NGI+FEE  I++   +H +PE+  INP++++P +  GD
Sbjct  5    VLKIYGDRKSQPTRAVMLFCNLNGIEFEEHTIELFNQEHLSPEFQEINPVREIPVIFHGD  64

Query  286  FKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
             +LFESHA L YLA+    VA+HWYPAD +KRA V SV DWHH +LRRGA GY+ NT LA
Sbjct  65   LRLFESHAILIYLASVFPDVANHWYPADAKKRALVHSVLDWHHCHLRRGAMGYLLNTILA  124

Query  463  PAFGLPCNPHAAAEAEKVLLASL  531
            PA GL  NP +AAE EK+L ++L
Sbjct  125  PARGLTMNPQSAAECEKILNSAL  147



>ref|XP_003630526.1| Glutathione transferase [Medicago truncatula]
Length=126

 Score =   169 bits (427),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 98/125 (78%), Gaps = 2/125 (2%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y DRMSQPSRA+LIFCK NGIDFEE+ I+++K QH +PE+ AINP K+VPA+VDG
Sbjct  1    MKLKVYADRMSQPSRAILIFCKVNGIDFEEIHIELSKRQHLSPEFQAINPFKKVPAIVDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGA-AGYVFNTA  456
             FKLFESHA L YLA+A  GVA HWYPAD+ +RA++ +V DWHH NLRRGA A Y  N  
Sbjct  61   RFKLFESHAILIYLASAFPGVAHHWYPADVSRRARIQAVLDWHHLNLRRGAGALYCRNNP  120

Query  457  LAPAF  471
            L   F
Sbjct  121  LFIFF  125



>gb|KJB25825.1| hypothetical protein B456_004G211100 [Gossypium raimondii]
Length=232

 Score =   167 bits (422),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 100/143 (70%), Gaps = 17/143 (12%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +++Y DRMSQPSRA++IFCK NGID+ E+++ I+K +H TPE+A INPMKQ+PA+VDG
Sbjct  1    MKLEVYADRMSQPSRAVIIFCKVNGIDYTELKVDISKREHLTPEFAEINPMKQLPAIVDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
             FKLFE                  YPA+L KR+K+ SV  WHHSNLRR A  YV NT + 
Sbjct  61   KFKLFER-----------------YPANLFKRSKIHSVLYWHHSNLRRAADTYVTNTTIL  103

Query  463  PAFGLPCNPHAAAEAEKVLLASL  531
            PA G P N  AAAEAEK+L +SL
Sbjct  104  PALGHPSNQQAAAEAEKLLFSSL  126



>gb|KJB52087.1| hypothetical protein B456_008G246300 [Gossypium raimondii]
Length=225

 Score =   166 bits (420),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 90/107 (84%), Gaps = 1/107 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y DRMSQPSRA++IFCK NGID+EE+++ I+KGQH TPE+A INPMKQ+PA+ DG
Sbjct  1    MKLKVYADRMSQPSRAVIIFCKVNGIDYEEIKVHISKGQHLTPEFAEINPMKQLPAIADG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNL  420
             FKLFESHA L YLA A  GVAD WYPAD+ KR+K+ SV DWHHSNL
Sbjct  61   RFKLFESHAILIYLACAFPGVADQWYPADVFKRSKIHSVLDWHHSNL  107



>gb|ACI16511.1| glutathione S-transferase [Cucumis sativus]
Length=184

 Score =   161 bits (408),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 91/117 (78%), Gaps = 1/117 (1%)
 Frame = +1

Query  184  FEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDFKLFESHAALKYLAAA-NGVADHWYP  360
            FEEV++ ++K +H TPE+  INPM +VP +VDG FKLFESHA L Y++ A  GVADHWYP
Sbjct  1    FEEVKVTLSKFEHLTPEFKEINPMGKVPVIVDGRFKLFESHAILIYISCAFPGVADHWYP  60

Query  361  ADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAPAFGLPCNPHAAAEAEKVLLASL  531
            ADL +RAK+ SV DWHHSNLR GAA  +FNT LAP FG P NP AAAEAEK+L  SL
Sbjct  61   ADLFRRAKIHSVLDWHHSNLRSGAAPLIFNTVLAPLFGRPLNPQAAAEAEKLLSKSL  117



>ref|XP_006584714.1| PREDICTED: glutathione S-transferase T2-like isoform X2 [Glycine 
max]
 gb|KHN16830.1| Glutathione S-transferase T2 [Glycine soja]
Length=234

 Score =   162 bits (410),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 100/141 (71%), Gaps = 17/141 (12%)
 Frame = +1

Query  109  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDF  288
            +K+Y D+MSQPSRA+LIFC+ NGIDFEE+++ I+K  H +PE+  INP+++VPA+V G F
Sbjct  5    LKVYADQMSQPSRAVLIFCRFNGIDFEEIKVDISKRHHLSPEFREINPLQKVPAIVHGSF  64

Query  289  KLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAPA  468
             L E                  YP++L +RAK++SV DWHHSNL+ GAA YV NT L PA
Sbjct  65   NLSER-----------------YPSNLFRRAKINSVMDWHHSNLQHGAANYVINTVLGPA  107

Query  469  FGLPCNPHAAAEAEKVLLASL  531
             G P +P AAAEAEKVLL+SL
Sbjct  108  TGRPLSPKAAAEAEKVLLSSL  128



>gb|KCW77543.1| hypothetical protein EUGRSUZ_D01861 [Eucalyptus grandis]
Length=212

 Score =   159 bits (402),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 90/143 (63%), Gaps = 35/143 (24%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+Y DRMSQPSRA++IFCK NGIDFEEV+I +AK QHR+PE+               
Sbjct  1    MTLKVYADRMSQPSRAVIIFCKVNGIDFEEVKIDLAKRQHRSPEF---------------  45

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
                                 DHWYPADL +RAK+ S  DWHHSNLRRGAA YV NT LA
Sbjct  46   --------------------KDHWYPADLSRRAKIHSALDWHHSNLRRGAAAYVLNTTLA  85

Query  463  PAFGLPCNPHAAAEAEKVLLASL  531
            PA GLP NP AAAE EK+L +SL
Sbjct  86   PALGLPLNPAAAAEGEKLLSSSL  108



>ref|XP_002960536.1| hypothetical protein SELMODRAFT_402877 [Selaginella moellendorffii]
 gb|EFJ38075.1| hypothetical protein SELMODRAFT_402877 [Selaginella moellendorffii]
Length=239

 Score =   157 bits (398),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 100/147 (68%), Gaps = 8/147 (5%)
 Frame = +1

Query  115  LYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDFKL  294
            LYV+ +SQPSRA++IFCK N I+ E   + I KG+H+T E+ AINPM QVPA+V+  FKL
Sbjct  10   LYVNIISQPSRAIIIFCKLNNIEAEVHHLDILKGEHKTTEFKAINPMGQVPAIVENGFKL  69

Query  295  FE-------SHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFN  450
            FE       SHA LKYLA    GV D+WYP+D Q+RA++DS+ DWHH NLRRGA G    
Sbjct  70   FERLTSKIRSHAILKYLAGTCPGVPDNWYPSDPQQRAQIDSILDWHHGNLRRGATGLFMA  129

Query  451  TALAPAFGLPCNPHAAAEAEKVLLASL  531
              + P  G P +  A A+AEK L ++L
Sbjct  130  EVIFPMNGAPKDTKAIADAEKTLQSAL  156



>gb|KJB25824.1| hypothetical protein B456_004G211100 [Gossypium raimondii]
Length=229

 Score =   157 bits (397),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 89/107 (83%), Gaps = 1/107 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +++Y DRMSQPSRA++IFCK NGID+ E+++ I+K +H TPE+A INPMKQ+PA+VDG
Sbjct  1    MKLEVYADRMSQPSRAVIIFCKVNGIDYTELKVDISKREHLTPEFAEINPMKQLPAIVDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNL  420
             FKLFESH+ L YLA A  GVADHWYPA+L KR+K+ SV  WHHSNL
Sbjct  61   KFKLFESHSILIYLACAFPGVADHWYPANLFKRSKIHSVLYWHHSNL  107



>ref|XP_002967183.1| hypothetical protein SELMODRAFT_407994 [Selaginella moellendorffii]
 gb|EFJ31782.1| hypothetical protein SELMODRAFT_407994 [Selaginella moellendorffii]
Length=239

 Score =   157 bits (397),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 100/147 (68%), Gaps = 8/147 (5%)
 Frame = +1

Query  115  LYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDFKL  294
            LYV+ +SQPSRA++IFCK N I+ E   + I KG+H+T E+ AINPM QVPA+V+  FKL
Sbjct  10   LYVNIISQPSRAIIIFCKLNNIEAEVHHLDILKGEHKTTEFKAINPMGQVPAIVENGFKL  69

Query  295  FE-------SHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFN  450
            FE       SHA LKYLA    GV D+WYP+D Q+RA++DS+ DWHH NLRRGA G    
Sbjct  70   FERLTSRLCSHAILKYLAGTCPGVPDNWYPSDPQQRAQIDSILDWHHGNLRRGATGLFLA  129

Query  451  TALAPAFGLPCNPHAAAEAEKVLLASL  531
              + P  G P +  A A+AEK L ++L
Sbjct  130  EVIFPMNGAPKDTKAIADAEKTLQSAL  156



>ref|XP_009774395.1| PREDICTED: glutathione S-transferase T1-like, partial [Nicotiana 
sylvestris]
Length=172

 Score =   148 bits (373),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 96/145 (66%), Gaps = 24/145 (17%)
 Frame = +1

Query  139  PSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDFKLFESHAALK  318
            PSRALLIFCK NGIDFEEV I ++K QH +PE+  +NP+KQVPA++DG FKLFESHA L+
Sbjct  1    PSRALLIFCKLNGIDFEEVYINLSKRQHLSPEFKEVNPLKQVPAIMDGRFKLFESHAILR  60

Query  319  YLAAAN-GVADHWYPADLQKRAKVDSVCDWH-------------HSNLRRGAAGYVFNTA  456
            YLA A  GVADH +           + CD++                +   +A YVF+T 
Sbjct  61   YLACAFPGVADHCF----------QTFCDYYLLICHTFSCFLQCSEAVLMFSAVYVFSTV  110

Query  457  LAPAFGLPCNPHAAAEAEKVLLASL  531
            LAPAFGLP N  AAAEAEKVLLASL
Sbjct  111  LAPAFGLPLNQQAAAEAEKVLLASL  135



>ref|XP_008678005.1| PREDICTED: glutathione S-transferase T1-like [Zea mays]
Length=237

 Score =   147 bits (370),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 86/141 (61%), Gaps = 17/141 (12%)
 Frame = +1

Query  109  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDF  288
            +K+Y  R S PSRA++IFC+ N IDFEEV + + K +HRTPE+  INPM QVP +VDG F
Sbjct  4    IKVYAHRWSSPSRAVIIFCRVNKIDFEEVTVDLFKSRHRTPEFKKINPMAQVPVIVDGRF  63

Query  289  KLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAPA  468
            KLFE                  YP DL  RAK++S+ DWHHSNL  GA  +V+ TALAP 
Sbjct  64   KLFER-----------------YPTDLFSRAKIESILDWHHSNLHFGAGTFVYYTALAPF  106

Query  469  FGLPCNPHAAAEAEKVLLASL  531
             G    P     AEK L+ SL
Sbjct  107  LGFRPRPETTKHAEKSLMQSL  127



>ref|XP_006663010.1| PREDICTED: glutathione S-transferase T1-like [Oryza brachyantha]
Length=194

 Score =   139 bits (351),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 75/94 (80%), Gaps = 1/94 (1%)
 Frame = +1

Query  253  MKQVPAVVDGDFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRG  429
            M QVPA+VDG F+LFESHA L+YLA    GVADHWYPADL  RAK+++V DWHH+NLRRG
Sbjct  1    MGQVPAIVDGRFRLFESHAILRYLATVFPGVADHWYPADLFTRAKIEAVLDWHHTNLRRG  60

Query  430  AAGYVFNTALAPAFGLPCNPHAAAEAEKVLLASL  531
            AA YV NT LAP+ GLP +P AA EAEK+L  SL
Sbjct  61   AATYVLNTVLAPSLGLPSSPEAAKEAEKLLFRSL  94



>ref|XP_009769998.1| PREDICTED: glutathione S-transferase T1-like [Nicotiana sylvestris]
Length=85

 Score =   134 bits (337),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 72/85 (85%), Gaps = 1/85 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +KLYVDRMSQPSRALLIFCK NGIDFEEV I ++K QH +PE+  +NP+KQVPA++DG
Sbjct  1    MTLKLYVDRMSQPSRALLIFCKLNGIDFEEVYINLSKRQHLSPEFKEVNPLKQVPAIMDG  60

Query  283  DFKLFESHAALKYLAAA-NGVADHW  354
             FKLFESHA L+YLA A  GVADHW
Sbjct  61   RFKLFESHAILRYLACAFPGVADHW  85



>ref|XP_008794199.1| PREDICTED: glutathione S-transferase T1 isoform X3 [Phoenix dactylifera]
Length=200

 Score =   137 bits (345),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 74/94 (79%), Gaps = 1/94 (1%)
 Frame = +1

Query  253  MKQVPAVVDGDFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRG  429
            M QVPA+VDG FKLFESHA L+YLA A  GV+DHWYPADL  RAK+DSV DWHH NLRRG
Sbjct  1    MGQVPAIVDGRFKLFESHAILRYLACAFPGVSDHWYPADLFNRAKIDSVLDWHHLNLRRG  60

Query  430  AAGYVFNTALAPAFGLPCNPHAAAEAEKVLLASL  531
            AA Y  N+ +AP FGLP N  AA EAEKVL +SL
Sbjct  61   AAFYALNSVIAPVFGLPLNSQAANEAEKVLRSSL  94



>gb|AFZ39143.1| theta class glutathione S-transferase [Physcomitrella patens]
Length=251

 Score =   137 bits (344),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 88/150 (59%), Gaps = 9/150 (6%)
 Frame = +1

Query  97   EEMAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVV  276
            E   +KLYVD  SQP+RA+ IFC+ N I+  E+ + + K ++RTPE+  INPM  VP + 
Sbjct  8    ETGGLKLYVDLGSQPARAVTIFCRVNKIEAHEIGVDLRKLENRTPEFRKINPMGLVPCID  67

Query  277  DGDFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTA  456
            D  FKL ESHA ++YLA  + VADHWYP D QKRA VD+  DWHH NLR+  +  V N  
Sbjct  68   DHGFKLHESHAIMRYLATTHNVADHWYPKDPQKRALVDAALDWHHLNLRKYGSQLVINRV  127

Query  457  LA---------PAFGLPCNPHAAAEAEKVL  519
            L          P  G       A +A K L
Sbjct  128  LVKVPAHKNFFPNLGEETRKSLADDASKTL  157



>ref|XP_001767888.1| predicted protein [Physcomitrella patens]
 gb|EDQ67402.1| predicted protein, partial [Physcomitrella patens]
Length=224

 Score =   135 bits (341),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 68/146 (47%), Positives = 87/146 (60%), Gaps = 9/146 (6%)
 Frame = +1

Query  109  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDF  288
            +KLYVD  SQP+RA+ IFC+ N I+  E+ + + K ++RTPE+  INPM  VP + D  F
Sbjct  1    LKLYVDLGSQPARAVTIFCRVNKIEAHEIGVDLRKLENRTPEFRKINPMGLVPCIDDHGF  60

Query  289  KLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA--  462
            KL ESHA ++YLA  + VADHWYP D QKRA VD+  DWHH NLR+  +  V N  L   
Sbjct  61   KLHESHAIMRYLATTHNVADHWYPKDPQKRALVDAALDWHHLNLRKYGSQLVINRVLVKV  120

Query  463  -------PAFGLPCNPHAAAEAEKVL  519
                   P  G       A +A K L
Sbjct  121  PAHKNFFPNLGEETRKSLADDASKTL  146



>gb|AEB91980.1| glutathione S-transferase theta 1 [Locusta migratoria]
Length=231

 Score =   135 bits (341),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 91/144 (63%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M++K+Y D +SQPSRA+++F  AN I +E  +I +  G+  + E+A +NPMK+VP + DG
Sbjct  1    MSLKVYYDLLSQPSRAVVLFLLANDIPYEAREINVLHGEQFSEEFAKLNPMKKVPVIKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L+YL     V DHWYPAD +K+A+VD   +W H+N R   A Y  N  + 
Sbjct  61   DFTLTESVAILRYLCRERDVPDHWYPADSKKQARVDEYLEWQHTNTRSNCALYFLNKFML  120

Query  463  PAF-GLPCNPHAAAEAEKVLLASL  531
            PA  G   NP   A  E+ ++A+L
Sbjct  121  PAIKGTQPNPETVARRERKMVATL  144



>ref|XP_005848771.1| hypothetical protein CHLNCDRAFT_57549 [Chlorella variabilis]
 gb|EFN56669.1| hypothetical protein CHLNCDRAFT_57549 [Chlorella variabilis]
Length=243

 Score =   135 bits (340),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 84/125 (67%), Gaps = 0/125 (0%)
 Frame = +1

Query  112  KLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDFK  291
            KL+VDR+SQPSR  LIFC+  GI FEE  + + K +   PE+ A+NP+ +VPA+ DG F 
Sbjct  7    KLFVDRLSQPSRTCLIFCRVAGIPFEEKVVTLGKKEQLRPEFLAVNPLGKVPALQDGAFC  66

Query  292  LFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAPAF  471
            L ES A LKYL  +   ADHWYP DL+ RA++D+V  WH S+LR G+   V+N A++   
Sbjct  67   LPESSAILKYLCGSRRAADHWYPRDLRARAQLDAVMAWHASSLRIGSMLVVWNRAISLNL  126

Query  472  GLPCN  486
            G P N
Sbjct  127  GFPSN  131



>emb|CDP22238.1| unnamed protein product [Coffea canephora]
Length=86

 Score =   130 bits (326),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 75/86 (87%), Gaps = 2/86 (2%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAV-VD  279
            M +K++ DR SQPSRA+LI CKANGI+FEEVQIQ+AKG+H++PEY AINPMKQVPA+ VD
Sbjct  1    MKLKVFADRGSQPSRAVLILCKANGIEFEEVQIQLAKGEHKSPEYEAINPMKQVPAIEVD  60

Query  280  GDFKLFESHAALKYLAAA-NGVADHW  354
            G F+LFESHA L++LA A  G+A+HW
Sbjct  61   GKFRLFESHAILRFLATAFPGIAEHW  86



>gb|EWS75951.1| glutathione S-transferase, amine-terminal domain protein [Tetrahymena 
thermophila SB210]
Length=229

 Score =   132 bits (333),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 85/129 (66%), Gaps = 3/129 (2%)
 Frame = +1

Query  97   EEMAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVV  276
            ++  + LY+D MSQPSR + IFC  N I  +  +++I KGQ R+ EY  INP  +VP + 
Sbjct  4    QQQTLSLYMDWMSQPSRCVAIFCMINKIPVDISEVKILKGQLRSQEYKRINPNMRVPTIK  63

Query  277  DGDFKLFESHAALKYLAA--ANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFN  450
            DG F L+ESHA LKYL A  A  + +HWYP D+++RA VD   DWHH+N+ R A  Y+FN
Sbjct  64   DGKFVLYESHAILKYLIASRAQYIPEHWYPKDIKERALVDQYLDWHHTNI-RNAGMYIFN  122

Query  451  TALAPAFGL  477
              + P+ G+
Sbjct  123  YFVLPSLGI  131



>ref|XP_010573725.1| PREDICTED: glutathione S-transferase theta-1-like [Haliaeetus 
leucocephalus]
Length=244

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 83/131 (63%), Gaps = 1/131 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RAL IF ++NGI FE  Q+++ KGQHRT E+  +N + +VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRALYIFARSNGIPFEFKQVELMKGQHRTEEFRKVNVLMKVPALRDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLR-RGAAGYVFNTAL  459
             F L ES A L YLA      DHWYP+DLQKRA+VD    W H N+R +G+  ++    L
Sbjct  61   SFTLAESIAILLYLARKFKTPDHWYPSDLQKRARVDEYLSWQHVNIRGKGSKLFLMKVLL  120

Query  460  APAFGLPCNPH  492
                G P  P 
Sbjct  121  PLLTGQPLPPE  131



>ref|XP_003727085.1| PREDICTED: glutathione S-transferase theta-1-like isoform 2 [Strongylocentrotus 
purpuratus]
Length=224

 Score =   132 bits (331),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 86/134 (64%), Gaps = 1/134 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M+VK++ D MSQP+R++L+F +AN I +    I + K +H++ EYAA+NPMK++PA+ DG
Sbjct  1    MSVKIFYDLMSQPARSVLMFARANKIPYTPCPIAMRKSEHQSEEYAAVNPMKKIPAMQDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            +FKL ES A +KYL A +   DHWYP+DLQ RAKVD    W H N R   A       + 
Sbjct  61   EFKLTESIAIVKYLQAKHACPDHWYPSDLQTRAKVDEYLAWQHMNTRINVAKVFLKEVIF  120

Query  463  PAF-GLPCNPHAAA  501
            P   G P +P A A
Sbjct  121  PRMTGTPADPAALA  134



>ref|XP_005524538.1| PREDICTED: glutathione S-transferase theta-1-like [Pseudopodoces 
humilis]
Length=244

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 87/144 (60%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RAL IF +AN I FE  ++Q++KGQH+T E+  +N + +VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRALYIFARANNIPFEFKRVQLSKGQHKTEEFQKVNVLMKVPALRDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
             F L ES A L YL       DHWYP+DLQKRA+VD    W H+N+R  A+      AL 
Sbjct  61   SFTLAESIAILLYLVRKFKTPDHWYPSDLQKRARVDEYLSWQHANIRAKASKLFITKALL  120

Query  463  PAF-GLPCNPHAAAEAEKVLLASL  531
            P   G P  P     A + L  +L
Sbjct  121  PLLTGQPLPPEKLESATEELNVAL  144



>ref|XP_006822345.1| PREDICTED: glutathione S-transferase theta-1-like [Saccoglossus 
kowalevskii]
Length=228

 Score =   131 bits (330),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 79/121 (65%), Gaps = 0/121 (0%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M + +Y D MSQP R++L+FC+ NGI +E+  + I KG+H + E++ INP  ++PA+ DG
Sbjct  1    MVLTVYYDVMSQPCRSVLLFCEVNGIPYEKEVVSIGKGEHMSEEFSQINPENKLPAIKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
             F L ES A LKYLAA    ADHWYP DLQKRAKVD    WHH N R+ A    +   L 
Sbjct  61   LFCLRESVAILKYLAAKYNTADHWYPRDLQKRAKVDEYLAWHHGNTRKDAIFVFWTEVLI  120

Query  463  P  465
            P
Sbjct  121  P  121



>ref|XP_002157119.2| PREDICTED: glutathione S-transferase T1-like [Hydra vulgaris]
Length=222

 Score =   131 bits (329),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 79/123 (64%), Gaps = 0/123 (0%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M++K++ D MSQPSR++L+F K   I +  V ++IAKG  RT EY  I+P ++VPA+ DG
Sbjct  1    MSLKIFYDAMSQPSRSVLLFLKCTKIPYVPVLVEIAKGGTRTAEYKLISPSQKVPAMQDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A LKYL     V  HWYP +  +R+KVD    WHH NLR GA+G VF +   
Sbjct  61   DFLLMESSAILKYLCETRDVDSHWYPKNQMERSKVDEYLAWHHLNLRSGASGIVFKSIFK  120

Query  463  PAF  471
            P  
Sbjct  121  PML  123



>ref|XP_002463456.1| hypothetical protein SORBIDRAFT_01g000230 [Sorghum bicolor]
 gb|EER90454.1| hypothetical protein SORBIDRAFT_01g000230 [Sorghum bicolor]
Length=200

 Score =   129 bits (325),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 74/94 (79%), Gaps = 1/94 (1%)
 Frame = +1

Query  253  MKQVPAVVDGDFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRG  429
            M QVPA+VDG FKLFESHA L+YLA+   GV+DHWYPADL  RAK++S+ DWHH+NLRRG
Sbjct  1    MGQVPAIVDGRFKLFESHAILRYLASVFPGVSDHWYPADLFTRAKIESILDWHHTNLRRG  60

Query  430  AAGYVFNTALAPAFGLPCNPHAAAEAEKVLLASL  531
            AA  V +TALAP  GL  +P A  +AEK+L+ SL
Sbjct  61   AATLVQHTALAPFLGLTTSPEAVKQAEKLLMQSL  94



>ref|XP_009006212.1| PREDICTED: glutathione S-transferase theta-1 isoform X1 [Callithrix 
jacchus]
Length=230

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 83/134 (62%), Gaps = 1/134 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K NGI FE   + + KGQH +  ++ +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAIYIFAKKNGIPFELRTVDLIKGQHLSDAFSQVNPLKKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL     V DHWYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLSESVAILLYLTHKYKVPDHWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMF  120

Query  463  PAF-GLPCNPHAAA  501
            P F G P +P   A
Sbjct  121  PVFLGEPVSPQTLA  134



>gb|ELK15601.1| Glutathione S-transferase theta-1 [Pteropus alecto]
Length=226

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 84/134 (63%), Gaps = 1/134 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K NGI FE   +++ KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRTVELLKGQHLSNAFAQVNPLKKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL     V DHWYP DLQ RA+VD    W H+ LRR     +++ A+ 
Sbjct  61   DFILTESVAILLYLTRKYKVPDHWYPQDLQARARVDEYLAWQHTTLRRNCLRALWHKAMF  120

Query  463  PAF-GLPCNPHAAA  501
              F G P +P   A
Sbjct  121  SVFLGEPVSPEMLA  134



>ref|XP_011072496.1| PREDICTED: glutathione S-transferase T1-like [Sesamum indicum]
Length=189

 Score =   129 bits (323),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 74/94 (79%), Gaps = 1/94 (1%)
 Frame = +1

Query  253  MKQVPAVVDGDFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRG  429
            M++VPA++  DFKLFESHA L YLA+A  GVADHWYPAD+ KRAK+ SV DWHHSNLRRG
Sbjct  1    MRKVPAIMHADFKLFESHAILVYLASAFPGVADHWYPADVHKRAKIHSVLDWHHSNLRRG  60

Query  430  AAGYVFNTALAPAFGLPCNPHAAAEAEKVLLASL  531
            +  Y+FNT +AP FGLP +  AA   EK+L ASL
Sbjct  61   SVEYLFNTLVAPEFGLPLDQKAADVGEKLLSASL  94



>ref|XP_010909099.1| PREDICTED: glutathione S-transferase T1 isoform X1 [Elaeis guineensis]
Length=200

 Score =   129 bits (324),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = +1

Query  253  MKQVPAVVDGDFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRG  429
            M +VPA+VDG FKLFESHA L+YLA A  GV+DHWYPADL  RAK+DS+ DWHHSNLR G
Sbjct  1    MGKVPAIVDGRFKLFESHAILRYLACAFPGVSDHWYPADLFSRAKIDSILDWHHSNLRYG  60

Query  430  AAGYVFNTALAPAFGLPCNPHAAAEAEKVLLASL  531
            A   V N+ LAP FG P N  AA EAEKVL  SL
Sbjct  61   AVSLVQNSVLAPIFGRPLNSQAANEAEKVLNLSL  94



>ref|XP_007973334.1| PREDICTED: glutathione S-transferase theta-1 [Chlorocebus sabaeus]
Length=240

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 84/134 (63%), Gaps = 1/134 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K NGI FE   + + KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL     V D+WYP DLQ RA+VD    W H+ LRR     +++ A+ 
Sbjct  61   DFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKAMF  120

Query  463  PAF-GLPCNPHAAA  501
            P F G P +P   A
Sbjct  121  PVFLGEPVSPQTLA  134



>ref|XP_006908737.1| PREDICTED: glutathione S-transferase theta-1-like [Pteropus alecto]
Length=240

 Score =   129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 84/134 (63%), Gaps = 1/134 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K NGI FE   +++ KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRTVELLKGQHLSNAFAQVNPLKKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL     V DHWYP DLQ RA+VD    W H+ LRR     +++ A+ 
Sbjct  61   DFILTESVAILLYLTRKYKVPDHWYPQDLQARARVDEYLAWQHTTLRRNCLRALWHKAMF  120

Query  463  PAF-GLPCNPHAAA  501
              F G P +P   A
Sbjct  121  SVFLGEPVSPEMLA  134



>ref|XP_003485831.1| PREDICTED: glutathione S-transferase theta-1-like [Bombus impatiens]
Length=239

 Score =   129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 85/144 (59%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M++KLY D +SQPSRAL IF K   I FE   + +AKG+H  PEY  I+P ++VPA+   
Sbjct  1    MSLKLYYDLLSQPSRALYIFLKVCDIPFEGKFVNLAKGEHLNPEYQRIHPFQKVPAIEHN  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
             F + ES A L+YL     +ADHWYP DL+++ KVD   +W H N R   A Y F   + 
Sbjct  61   GFNMMESVAILRYLCRKFKIADHWYPEDLKRQLKVDEYLEWQHLNTRLNCASYFFMKYMK  120

Query  463  PAF-GLPCNPHAAAEAEKVLLASL  531
            P   G   NP +  + EK ++ +L
Sbjct  121  PLLTGKSMNPESLTQYEKRMIQTL  144



>emb|CDW81275.1| glutathione s-transferase theta-1 [Stylonychia lemnae]
Length=238

 Score =   129 bits (324),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 82/134 (61%), Gaps = 1/134 (1%)
 Frame = +1

Query  109  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDF  288
            + LY D  SQP+RA  +F K N + FE  Q+++ K +  +PE+  INP  +VPA+ DGD 
Sbjct  7    ITLYGDYASQPTRACYVFLKYNKVPFEFKQVRVTKLEQYSPEFKKINPNAKVPALTDGDI  66

Query  289  KLFESHAALKYLAAANGVADHWYP-ADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAP  465
             +FESH  L+YL  +  + DHWYP  D ++RAK+D   DWHH+ +R GA GY+F   ++ 
Sbjct  67   SMFESHTILRYLHESRKLPDHWYPRTDFRERAKIDEYLDWHHNGIRLGAGGYIFRKYMSS  126

Query  466  AFGLPCNPHAAAEA  507
              G P    +  E+
Sbjct  127  LTGKPAPKESINES  140



>ref|XP_010396446.1| PREDICTED: glutathione S-transferase theta-1-like [Corvus cornix 
cornix]
Length=244

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 80/131 (61%), Gaps = 1/131 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RAL IF ++N I FE  ++Q+AKGQH+T E+  +N + +VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRALYIFARSNNIPFEFKRVQLAKGQHKTEEFQKVNVLMKVPALRDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
             F L ES A L YL       DHWYP+DLQKRA+VD    W H+N+R   +       L 
Sbjct  61   SFTLAESIAILLYLVQKFKTPDHWYPSDLQKRARVDEYLSWQHANIRAKGSKLFLTKVLL  120

Query  463  PAF-GLPCNPH  492
            P   G P  P 
Sbjct  121  PLLTGQPLPPE  131



>ref|XP_005595439.1| PREDICTED: glutathione S-transferase theta-1 isoform X1 [Macaca 
fascicularis]
Length=240

 Score =   129 bits (324),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 83/134 (62%), Gaps = 1/134 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K NGI FE   + + KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL     V D+WYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMF  120

Query  463  PAF-GLPCNPHAAA  501
            P F G P +P   A
Sbjct  121  PVFLGEPVSPQTLA  134



>ref|XP_003919137.1| PREDICTED: glutathione S-transferase theta-1 isoform X1 [Papio 
anubis]
Length=240

 Score =   129 bits (324),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 83/134 (62%), Gaps = 1/134 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K NGI FE   + + KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL     V D+WYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMF  120

Query  463  PAF-GLPCNPHAAA  501
            P F G P +P   A
Sbjct  121  PVFLGEPVSPQTLA  134



>ref|XP_010368118.1| PREDICTED: glutathione S-transferase theta-1 isoform X1 [Rhinopithecus 
roxellana]
Length=240

 Score =   129 bits (324),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 83/134 (62%), Gaps = 1/134 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K NGI FE   + + KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRVVDLIKGQHLSDAFAQVNPLKKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL     V D+WYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKMMF  120

Query  463  PAF-GLPCNPHAAA  501
            P F G P +P   A
Sbjct  121  PVFLGEPVSPQTLA  134



>ref|XP_008500992.1| PREDICTED: LOW QUALITY PROTEIN: glutathione S-transferase theta-1-like 
[Calypte anna]
Length=242

 Score =   129 bits (323),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 80/131 (61%), Gaps = 1/131 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RAL IF + N I FE  ++++ KGQHRT E+  +N + +VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRALYIFARNNNIPFEFKKVELMKGQHRTEEFRKVNILMKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
             F L ES A L YLA      DHWYP+DL+KRA+VD    W H N+R   +      AL 
Sbjct  61   SFTLSESIAILLYLARKFKTPDHWYPSDLEKRARVDEYLSWQHINIRGKGSKLFLTKALV  120

Query  463  PAF-GLPCNPH  492
            P   G P +P 
Sbjct  121  PVLTGQPLSPE  131



>ref|XP_005054826.1| PREDICTED: glutathione S-transferase theta-1-like [Ficedula albicollis]
Length=241

 Score =   129 bits (323),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 83/131 (63%), Gaps = 1/131 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RAL IF ++N I FE  ++Q+AKGQH+T E+  +N + +VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRALYIFARSNNIPFEFKKVQLAKGQHKTEEFRKVNVLMKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLR-RGAAGYVFNTAL  459
             F L ES A L YL       DHWYP+DLQKRA+VD    W H+N+R +G+  ++    L
Sbjct  61   SFTLAESIAILLYLVQKFKTPDHWYPSDLQKRARVDEYLSWQHANIRAKGSKLFLTKVML  120

Query  460  APAFGLPCNPH  492
                G P  P 
Sbjct  121  PLITGQPLPPE  131



>ref|XP_004346352.1| glutathione S-transferase domain-containing protein [Capsaspora 
owczarzaki ATCC 30864]
 gb|KJE95201.1| glutathione S-transferase domain-containing protein [Capsaspora 
owczarzaki ATCC 30864]
Length=231

 Score =   128 bits (321),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 83/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  106  AVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGD  285
             + LY D MSQPSRA+LI  +AN + F    I + KG    PE+  INP K++P + D  
Sbjct  4    GLSLYFDAMSQPSRAVLILLRANNLPFTPKIINVVKGDQYKPEFKKINPNKKIPVIDDNG  63

Query  286  FKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAP  465
            F LFESHA L+YL     + DHWYP D QKRA VD   DWHH+   R AA +     +AP
Sbjct  64   FVLFESHAILRYLCNKYNLPDHWYPKDPQKRALVDQYLDWHHT-YTRTAAHHFREKYMAP  122

Query  466  AFGLPCNPHAAAEAEKVLLASL  531
             FG+  +  ++AE+ K    +L
Sbjct  123  RFGIQIDEKSSAESFKTFQFAL  144



>ref|XP_001489453.1| PREDICTED: glutathione S-transferase theta-1-like [Equus caballus]
Length=240

 Score =   128 bits (321),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 82/134 (61%), Gaps = 1/134 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K NGI FE   +++ KGQH + ++A +NP+K+VP + DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRTVELLKGQHFSADFAQLNPLKKVPVLKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL       DHWYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLTESVAILLYLTRKYKTPDHWYPQDLQARARVDEYLAWQHTALRRNCLRTLWHKLML  120

Query  463  PAF-GLPCNPHAAA  501
            P F G P  P   A
Sbjct  121  PVFMGEPVAPEMLA  134



>ref|XP_004607625.1| PREDICTED: glutathione S-transferase theta-1-like [Sorex araneus]
Length=240

 Score =   128 bits (321),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 81/134 (60%), Gaps = 1/134 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K NGI FE   +++ KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFEMRTVELLKGQHHSDAFAQVNPLKKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL+      DHWYP DLQ RA+VD    W H+ LR      ++   + 
Sbjct  61   DFTLAESVAILLYLSRKFETPDHWYPQDLQARARVDEYLAWQHTTLRTSCTRALWQKMII  120

Query  463  PAF-GLPCNPHAAA  501
            P F G P  P   A
Sbjct  121  PKFVGQPVPPEVLA  134



>ref|XP_004680982.1| PREDICTED: glutathione S-transferase theta-1-like [Condylura 
cristata]
Length=240

 Score =   128 bits (321),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 79/123 (64%), Gaps = 0/123 (0%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K NGI FE   +++ KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRTVELLKGQHLSDAFAQVNPLKKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            +F L ES A L YL     V DHWYP DLQ RA+VD    W H  LRR     +++  + 
Sbjct  61   NFTLTESVAILLYLTHKYKVPDHWYPPDLQTRARVDEYLAWQHQTLRRNCLRALWHKVMF  120

Query  463  PAF  471
            PAF
Sbjct  121  PAF  123



>ref|XP_003397510.1| PREDICTED: glutathione S-transferase theta-1-like [Bombus terrestris]
Length=239

 Score =   128 bits (321),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 84/144 (58%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M++KLY D +SQPSRAL IF K   I FE   + +AKG+H  PEY  I+P ++VPA+   
Sbjct  1    MSLKLYYDLLSQPSRALYIFLKVCDIPFEGKFVNLAKGEHLNPEYQRIHPFQKVPAIEHN  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
             F + ES A L+YL     VADHWYP DL+ + KVD   +W H N R   A Y F   + 
Sbjct  61   GFNMMESVAILRYLCREFKVADHWYPQDLKLQLKVDEYLEWQHLNTRLNCASYFFMKYMK  120

Query  463  PAF-GLPCNPHAAAEAEKVLLASL  531
            P   G   NP +  + EK ++ +L
Sbjct  121  PLLTGKSMNPESLMQYEKRMMQTL  144



>ref|XP_005334521.1| PREDICTED: glutathione S-transferase theta-1-like [Ictidomys 
tridecemlineatus]
Length=240

 Score =   128 bits (321),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 80/134 (60%), Gaps = 1/134 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D MSQP RA+ IF K NGI F+   +++ KGQH T  +  +NP+++VPA+ DG
Sbjct  1    MGLELYLDLMSQPCRAVYIFAKKNGIPFQLRTVELLKGQHYTDSFGQVNPLRKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL+      DHWYP DLQ RA+VD    W H+ LR      ++   L 
Sbjct  61   DFTLAESVAILLYLSRKYKAPDHWYPQDLQARARVDEYLSWQHTTLRSCCTRAMWQKMLF  120

Query  463  PAF-GLPCNPHAAA  501
            P F G P  P   A
Sbjct  121  PVFLGQPVPPETLA  134



>ref|XP_005023587.1| PREDICTED: glutathione S-transferase theta-1-like [Anas platyrhynchos]
Length=242

 Score =   128 bits (321),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 78/130 (60%), Gaps = 1/130 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RAL IF + N I FE   +++ KGQHRT E+  +N + +VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRALYIFARTNNIPFEFKHVELMKGQHRTEEFRKVNMLMKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
             F L ES A L YLA      DHWYP+DLQKRA+VD    W H N+R   +       L 
Sbjct  61   SFTLAESIAILLYLARKFKTPDHWYPSDLQKRARVDEYLSWQHVNIRGKGSKLFLTKVLL  120

Query  463  PAF-GLPCNP  489
            P   G P +P
Sbjct  121  PLLTGQPLSP  130



>ref|XP_006106312.1| PREDICTED: glutathione S-transferase theta-1-like [Myotis lucifugus]
Length=240

 Score =   127 bits (320),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 86/144 (60%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K NGI FE   +++ KGQH +  +  +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRTVELLKGQHLSDAFVQVNPLKKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL     V DHWYP +LQ RA+VD    W H+ LR+     ++   + 
Sbjct  61   DFTLTESVAILLYLTRKFKVPDHWYPQELQARARVDEYMAWQHTTLRKNCLRTLWYKVMF  120

Query  463  PAF-GLPCNPHAAAEAEKVLLASL  531
            P F G P +P   A     L A+L
Sbjct  121  PVFLGEPVSPETLAATLAELDATL  144



>ref|XP_002830963.1| PREDICTED: glutathione S-transferase theta-1 isoform X1 [Pongo 
abelii]
Length=240

 Score =   127 bits (320),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 82/134 (61%), Gaps = 1/134 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K N I FE   + + KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNDIAFELRMVDLIKGQHLSDAFAQVNPLKKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL     + DHWYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLTESVAILLYLTRKYKLPDHWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKMMF  120

Query  463  PAF-GLPCNPHAAA  501
            P F G P +P   A
Sbjct  121  PVFLGEPVSPQTLA  134



>ref|XP_003639976.1| PREDICTED: glutathione S-transferase theta-1-like [Canis lupus 
familiaris]
Length=240

 Score =   127 bits (320),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 79/123 (64%), Gaps = 0/123 (0%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K NGI FE   +++ KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRPVELLKGQHHSDAFAQVNPLKKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL+    V DHWYP DLQ RA+VD    W H+ LR      ++   ++
Sbjct  61   DFTLAESVAILLYLSRKYEVPDHWYPQDLQARARVDEYLAWQHTTLRSSCTRAMWQKMMS  120

Query  463  PAF  471
            P F
Sbjct  121  PVF  123



>ref|XP_006130307.1| PREDICTED: glutathione S-transferase theta-1-like [Pelodiscus 
sinensis]
Length=239

 Score =   127 bits (320),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 81/138 (59%), Gaps = 1/138 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M V+L++D +SQP RAL IF K N I FE   +++ KGQH + E+  +N +K+VPA+ DG
Sbjct  1    MVVELFLDLLSQPCRALFIFAKKNNIPFEFKHVELIKGQHLSEEFGKVNVLKKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
             F L ES A L YL       DHWYP+DL+KRA+VD    W H+ +R       F   L 
Sbjct  61   TFTLAESIAILLYLRRKFNTPDHWYPSDLRKRARVDEYLSWQHTAIREKGCRIFFTKVLM  120

Query  463  P-AFGLPCNPHAAAEAEK  513
            P A G P +P    EA K
Sbjct  121  PLAVGQPFSPDKLEEAVK  138



>gb|EHH25431.1| hypothetical protein EGK_21202 [Macaca mulatta]
Length=240

 Score =   127 bits (320),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 83/134 (62%), Gaps = 1/134 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K NGI FE   + + KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL     V D+WYP +LQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLTESVAILLYLTCKYKVPDYWYPQNLQARARVDEYLAWQHTTLRRSCLRALWHKVMF  120

Query  463  PAF-GLPCNPHAAA  501
            P F G P +P   A
Sbjct  121  PVFLGEPVSPQTLA  134



>ref|XP_003994894.3| PREDICTED: glutathione S-transferase theta-1 [Felis catus]
Length=240

 Score =   127 bits (320),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 83/134 (62%), Gaps = 1/134 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K N I FE   +++ KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAIYIFAKKNRIPFEMRTVELLKGQHLSDAFAQVNPLKKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL     VADHWYP DLQ  A+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLAESVAILLYLTRKYKVADHWYPQDLQACARVDEYLAWQHTTLRRSCLRALWHKVMF  120

Query  463  PAF-GLPCNPHAAA  501
            P F G P +P   A
Sbjct  121  PVFLGEPVSPEMLA  134



>ref|XP_002200008.1| PREDICTED: glutathione S-transferase theta-1-like [Taeniopygia 
guttata]
Length=241

 Score =   127 bits (319),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 80/131 (61%), Gaps = 1/131 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RAL IF ++N I FE  ++Q+AKGQH+T E+  +N + +VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRALYIFARSNKIPFEFKRVQLAKGQHKTEEFRKVNVLMKVPALRDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
             F L ES A L YL       DHWYP+DLQKRA+VD    W H N+R   +    +  L 
Sbjct  61   SFTLAESIAILLYLVQKFKTPDHWYPSDLQKRARVDEYLSWQHVNIRAKGSKLFLSKVLL  120

Query  463  PAF-GLPCNPH  492
            P   G P  P 
Sbjct  121  PLITGQPLPPE  131



>ref|XP_007092375.1| PREDICTED: glutathione S-transferase theta-1-like [Panthera tigris 
altaica]
Length=240

 Score =   127 bits (319),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 83/134 (62%), Gaps = 1/134 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K N I FE   +++ KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAIYIFAKKNRIPFEMRTVELLKGQHLSDAFAQVNPLKKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL     VADHWYP DLQ  A+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLAESVAILLYLTRKYKVADHWYPQDLQACARVDEYLAWQHTTLRRSCLRALWHKVMF  120

Query  463  PAF-GLPCNPHAAA  501
            P F G P +P   A
Sbjct  121  PVFLGEPVSPEMLA  134



>gb|EHH61703.1| hypothetical protein EGM_19746 [Macaca fascicularis]
Length=240

 Score =   127 bits (319),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 83/134 (62%), Gaps = 1/134 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K NGI FE   + + KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL     V D+WYP +LQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLTESVAILLYLTRKYKVPDYWYPQNLQARARVDEYLAWQHTTLRRSCLRALWHKVMF  120

Query  463  PAF-GLPCNPHAAA  501
            P F G P +P   A
Sbjct  121  PVFLGEPVSPQTLA  134



>ref|XP_007957332.1| PREDICTED: glutathione S-transferase theta-1-like [Orycteropus 
afer afer]
Length=240

 Score =   127 bits (319),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 79/123 (64%), Gaps = 0/123 (0%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K NGI FE   +++ KGQH++  +A +NPM++VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRTVELLKGQHQSDAFAQVNPMQKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL+      DHWYP DLQ RA+VD    W H+ LR   A   ++  + 
Sbjct  61   DFTLAESVAILLYLSRKYQTPDHWYPQDLQTRARVDEYLAWQHTGLRNSFALPTYHQVMI  120

Query  463  PAF  471
            P F
Sbjct  121  PVF  123



>ref|XP_001089367.1| PREDICTED: glutathione S-transferase theta-1 isoform 2 [Macaca 
mulatta]
Length=240

 Score =   127 bits (319),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 82/134 (61%), Gaps = 1/134 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K NGI FE   + + KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL     V D+WYP DLQ RA+VD    W H  +RR     +++  + 
Sbjct  61   DFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHMTMRRSCLRALWHKVMF  120

Query  463  PAF-GLPCNPHAAA  501
            P F G P +P   A
Sbjct  121  PVFLGEPVSPQTLA  134



>ref|XP_008566801.1| PREDICTED: glutathione S-transferase theta-1 isoform X1 [Galeopterus 
variegatus]
Length=240

 Score =   127 bits (319),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 83/134 (62%), Gaps = 1/134 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF + NGI FE   +++ KGQH +  +A +NPMK+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFARKNGIPFELRTVELLKGQHLSDAFAQVNPMKKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL     V D+WYP DLQ  A+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLTESVAILLYLMRKYKVPDYWYPQDLQACARVDEYLAWQHTTLRRNCLRALWHKVML  120

Query  463  PAF-GLPCNPHAAA  501
            P F G P +P   A
Sbjct  121  PVFLGEPVSPQMLA  134



>ref|XP_001929409.1| PREDICTED: glutathione S-transferase theta-1-like isoform X1 
[Sus scrofa]
Length=240

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 82/136 (60%), Gaps = 1/136 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K NGI FE   + + KGQH + ++A +NP+++VPA+ DG
Sbjct  1    MVLELYLDLLSQPCRAVYIFAKKNGIPFELRTVDLLKGQHFSDDFAQVNPLRKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL+      DHWYP DLQ RA+VD    W H++L+      ++   L 
Sbjct  61   DFTLAESVAILLYLSRKYEAPDHWYPQDLQTRARVDEYLSWQHTDLQTSCIRTMWQKMLL  120

Query  463  PAF-GLPCNPHAAAEA  507
            P F G P  P   A  
Sbjct  121  PVFLGQPVPPETLAST  136



>ref|XP_004742534.1| PREDICTED: glutathione S-transferase theta-1-like isoform X2 
[Mustela putorius furo]
 ref|XP_004817181.1| PREDICTED: glutathione S-transferase theta-1-like [Mustela putorius 
furo]
Length=240

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 79/123 (64%), Gaps = 0/123 (0%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K NGI FE  Q+++ KGQH +  +A +NP+++VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRQVELLKGQHHSDAFAQVNPLRKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL+    V DHWYP DLQ RA+VD    W H+ LR      ++   + 
Sbjct  61   DFTLAESVAILLYLSRKYEVPDHWYPQDLQARARVDEYLAWQHTALRSSCTRAMWQKMMF  120

Query  463  PAF  471
            P F
Sbjct  121  PVF  123



>gb|AII00841.1| glutathione S-transferase theta 1 [Canis lupus familiaris]
Length=240

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 87/144 (60%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K NGI FE   +++ KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKRNGIPFELRPVELRKGQHLSDAFAQVNPLKKVPALRDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL     V DHWYP DLQ  A+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLTESVAILLYLNRKYKVPDHWYPQDLQACARVDEYLAWQHTTLRRNCLRALWHKVMF  120

Query  463  PAF-GLPCNPHAAAEAEKVLLASL  531
            P F G P +P   A     L A+L
Sbjct  121  PVFLGEPVSPEMLAATLAELDATL  144



>ref|XP_005886352.1| PREDICTED: glutathione S-transferase theta-1-like [Myotis brandtii]
 gb|EPQ20307.1| Glutathione S-transferase theta-1 [Myotis brandtii]
Length=240

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 87/144 (60%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF + NGI FE   +++ KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFRQENGIPFELRTVELLKGQHLSDAFAQVNPLKKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL     V DHWYP +LQ RA+VD    W H+ LR+     ++   + 
Sbjct  61   DFTLTESVAILLYLTRKFKVPDHWYPQELQARARVDEYMAWQHTTLRKNCLRTLWYKVMF  120

Query  463  PAF-GLPCNPHAAAEAEKVLLASL  531
            P F G P +P   A     L A+L
Sbjct  121  PVFLGEPVSPETLAATLAELDATL  144



>ref|XP_534751.3| PREDICTED: glutathione S-transferase theta-1 [Canis lupus familiaris]
Length=240

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 87/144 (60%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K NGI FE   +++ KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKRNGIPFELRPVELRKGQHLSDAFAQVNPLKKVPALRDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL     V DHWYP DLQ  A+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLTESVAILLYLNRKYKVPDHWYPQDLQACARVDEYLAWQHTTLRRNCLRALWHKVMF  120

Query  463  PAF-GLPCNPHAAAEAEKVLLASL  531
            P F G P +P   A     L A+L
Sbjct  121  PVFLGEPVSPEMLAATLAELDATL  144



>ref|XP_008066997.1| PREDICTED: glutathione S-transferase theta-1 [Tarsius syrichta]
Length=240

 Score =   126 bits (317),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 83/134 (62%), Gaps = 1/134 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K NGI FE   +++ +GQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRPVELIRGQHLSDAFAQVNPLKKVPALRDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL     V D+WYP DLQ RA VD    W H+ LRR     +++  + 
Sbjct  61   DFTLTESVAILLYLTRKYKVPDYWYPQDLQARALVDEYLAWQHTALRRNCLRTLWHKVMF  120

Query  463  PAF-GLPCNPHAAA  501
            P F G P +P   A
Sbjct  121  PVFMGEPVSPQMLA  134



>gb|AHH29314.1| glutathione S-transferase T1 [Macaca mulatta]
Length=240

 Score =   126 bits (317),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 82/134 (61%), Gaps = 1/134 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K NGI FE   + + KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL     V D+WYP DLQ  A+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLTESVAILLYLTRKYKVPDYWYPQDLQASARVDEYLAWQHTTLRRSCLRALWHKVMF  120

Query  463  PAF-GLPCNPHAAA  501
            P F G P +P   A
Sbjct  121  PVFLGEPVSPQTLA  134



>gb|AHH29313.1| glutathione S-transferase T1 [Macaca fascicularis]
Length=240

 Score =   126 bits (317),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 82/134 (61%), Gaps = 1/134 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K NGI FE   + + KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL     V D+WYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMF  120

Query  463  PAF-GLPCNPHAAA  501
            P F   P +P   A
Sbjct  121  PVFLDEPVSPQTLA  134



>gb|AAV38754.1| glutathione S-transferase theta 1 [Homo sapiens]
Length=240

 Score =   126 bits (317),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 82/134 (61%), Gaps = 1/134 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K N I FE   + + KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL     V D+WYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMF  120

Query  463  PAF-GLPCNPHAAA  501
            P F G P +P   A
Sbjct  121  PVFLGEPVSPQTLA  134



>pdb|2C3Q|A Chain A, Human Glutathione-S-Transferase T1-1 W234r Mutant, Complex 
With S-Hexylglutathione
 pdb|2C3Q|B Chain B, Human Glutathione-S-Transferase T1-1 W234r Mutant, Complex 
With S-Hexylglutathione
 pdb|2C3Q|C Chain C, Human Glutathione-S-Transferase T1-1 W234r Mutant, Complex 
With S-Hexylglutathione
 pdb|2C3Q|D Chain D, Human Glutathione-S-Transferase T1-1 W234r Mutant, Complex 
With S-Hexylglutathione
 pdb|2C3T|A Chain A, Human Glutathione-S-Transferase T1-1, W234r Mutant, 
Apo Form
 pdb|2C3T|B Chain B, Human Glutathione-S-Transferase T1-1, W234r Mutant, 
Apo Form
 pdb|2C3T|C Chain C, Human Glutathione-S-Transferase T1-1, W234r Mutant, 
Apo Form
 pdb|2C3T|D Chain D, Human Glutathione-S-Transferase T1-1, W234r Mutant, 
Apo Form
Length=247

 Score =   126 bits (317),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 82/134 (61%), Gaps = 1/134 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K N I FE   + + KGQH +  +A +NP+K+VPA+ DG
Sbjct  8    MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDG  67

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL     V D+WYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  68   DFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMF  127

Query  463  PAF-GLPCNPHAAA  501
            P F G P +P   A
Sbjct  128  PVFLGEPVSPQTLA  141



>ref|NP_000844.2| glutathione S-transferase theta-1 isoform a [Homo sapiens]
 ref|XP_525647.2| PREDICTED: glutathione S-transferase theta-1 isoform X1 [Pan 
troglodytes]
 sp|P30711.4|GSTT1_HUMAN RecName: Full=Glutathione S-transferase theta-1; AltName: Full=GST 
class-theta-1; AltName: Full=Glutathione transferase T1-1 
[Homo sapiens]
 gb|AAL31549.1|AF435971_1 glutathione transferase T1-1 [Homo sapiens]
 gb|AAG02374.1| glutathione S-transferase theta 1 [Homo sapiens]
 dbj|BAB39498.1| glutathione S-transferase TT1 [Homo sapiens]
 gb|EAW59631.1| glutathione S-transferase theta 1, isoform CRA_c [Homo sapiens]
Length=240

 Score =   126 bits (317),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 82/134 (61%), Gaps = 1/134 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K N I FE   + + KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL     V D+WYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMF  120

Query  463  PAF-GLPCNPHAAA  501
            P F G P +P   A
Sbjct  121  PVFLGEPVSPQTLA  134



>ref|XP_008961689.1| PREDICTED: glutathione S-transferase theta-1 isoform X1 [Pan 
paniscus]
Length=240

 Score =   126 bits (317),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 82/134 (61%), Gaps = 1/134 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K N I FE   + + KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL     V D+WYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMF  120

Query  463  PAF-GLPCNPHAAA  501
            P F G P +P   A
Sbjct  121  PVFLGEPVSPQTLA  134



>ref|XP_004063215.1| PREDICTED: glutathione S-transferase theta-1 [Gorilla gorilla 
gorilla]
Length=240

 Score =   126 bits (317),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 82/134 (61%), Gaps = 1/134 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K N I FE   + + KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL     V D+WYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMF  120

Query  463  PAF-GLPCNPHAAA  501
            P F G P +P   A
Sbjct  121  PVFLGEPVSPQTLA  134



>ref|XP_008155438.1| PREDICTED: glutathione S-transferase theta-1 [Eptesicus fuscus]
Length=240

 Score =   126 bits (316),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 86/144 (60%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K N I FE   +++ KGQH + ++A +NP K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNRIPFELRTVELLKGQHLSDDFAQVNPNKKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL     V DHWYP +LQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLTESVAILLYLTRKFKVPDHWYPQELQARARVDEYLAWQHTTLRRNCLRTLWHKVMF  120

Query  463  PAF-GLPCNPHAAAEAEKVLLASL  531
            P F G P  P   A     L A+L
Sbjct  121  PVFLGEPVAPETLAATLAELDATL  144



>ref|XP_004636372.1| PREDICTED: glutathione S-transferase theta-1-like [Octodon degus]
Length=240

 Score =   126 bits (316),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 77/122 (63%), Gaps = 0/122 (0%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D MSQP RA+ IFCK NGI F+   +++ KGQH T  +A +NP+++VPA+ DG
Sbjct  1    MGLELYLDLMSQPCRAVYIFCKKNGIPFQLRPVELLKGQHYTDSFAQVNPLRKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL+      DHWYP DLQ RA+VD    W H+ LR      ++   + 
Sbjct  61   DFTLAESVAILLYLSRKYKTPDHWYPQDLQARARVDEFLSWQHTALRSCCLRAMWQKMMF  120

Query  463  PA  468
            P 
Sbjct  121  PV  122



>pdb|2C3N|A Chain A, Human Glutathione-S-Transferase T1-1, Apo Form
 pdb|2C3N|B Chain B, Human Glutathione-S-Transferase T1-1, Apo Form
 pdb|2C3N|C Chain C, Human Glutathione-S-Transferase T1-1, Apo Form
 pdb|2C3N|D Chain D, Human Glutathione-S-Transferase T1-1, Apo Form
Length=247

 Score =   126 bits (317),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 82/134 (61%), Gaps = 1/134 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K N I FE   + + KGQH +  +A +NP+K+VPA+ DG
Sbjct  8    MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDG  67

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL     V D+WYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  68   DFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMF  127

Query  463  PAF-GLPCNPHAAA  501
            P F G P +P   A
Sbjct  128  PVFLGEPVSPQTLA  141



>ref|XP_003938575.1| PREDICTED: glutathione S-transferase theta-1 isoform X1 [Saimiri 
boliviensis boliviensis]
Length=240

 Score =   126 bits (316),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 83/134 (62%), Gaps = 1/134 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K NGI FE   + + KGQ+ +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRTVDLIKGQNLSDAFARVNPLKKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL     V D+WYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLSESVAILLYLTHKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMF  120

Query  463  PAF-GLPCNPHAAA  501
            P F G P +P   A
Sbjct  121  PVFLGEPVSPQTLA  134



>ref|XP_008248399.1| PREDICTED: glutathione S-transferase theta-1-like isoform X2 
[Oryctolagus cuniculus]
Length=198

 Score =   125 bits (313),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/139 (45%), Positives = 80/139 (58%), Gaps = 3/139 (2%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D MSQP RA+ IF K NGI F+   + + KGQH T  +  +NP+++VPA+ DG
Sbjct  1    MGLELYLDLMSQPCRAVYIFAKKNGIPFQLCPVDLLKGQHYTESFTQVNPLRKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL+      DHWYP DLQ RA+VD    W H+ LR       +   L 
Sbjct  61   DFTLAESVAILLYLSRKYKAPDHWYPQDLQARARVDEYLSWQHTTLRSCCTRATWQKLLF  120

Query  463  PAF---GLPCNPHAAAEAE  510
            P F    +P    AA  AE
Sbjct  121  PVFLGQAVPPETLAATLAE  139



>emb|CAA55935.1| glutathione transferase T1 [Homo sapiens]
Length=240

 Score =   126 bits (316),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 82/134 (61%), Gaps = 1/134 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K N I FE   + + KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL     V D+WYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMF  120

Query  463  PAF-GLPCNPHAAA  501
            P F G P +P   A
Sbjct  121  PVFLGGPVSPQTLA  134



>ref|XP_008248398.1| PREDICTED: glutathione S-transferase theta-1-like isoform X1 
[Oryctolagus cuniculus]
Length=208

 Score =   125 bits (314),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/139 (45%), Positives = 80/139 (58%), Gaps = 3/139 (2%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D MSQP RA+ IF K NGI F+   + + KGQH T  +  +NP+++VPA+ DG
Sbjct  1    MGLELYLDLMSQPCRAVYIFAKKNGIPFQLCPVDLLKGQHYTESFTQVNPLRKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL+      DHWYP DLQ RA+VD    W H+ LR       +   L 
Sbjct  61   DFTLAESVAILLYLSRKYKAPDHWYPQDLQARARVDEYLSWQHTTLRSCCTRATWQKLLF  120

Query  463  PAF---GLPCNPHAAAEAE  510
            P F    +P    AA  AE
Sbjct  121  PVFLGQAVPPETLAATLAE  139



>ref|XP_010953752.1| PREDICTED: glutathione S-transferase theta-2 isoform X1 [Camelus 
bactrianus]
 ref|XP_010985618.1| PREDICTED: glutathione S-transferase theta-1-like isoform X2 
[Camelus dromedarius]
Length=208

 Score =   125 bits (313),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 77/123 (63%), Gaps = 0/123 (0%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K NGI FE   + + KGQH + ++A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRTVDLLKGQHHSDDFAQVNPLKKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL+      DHWYP DLQ RA+VD    W H+ LR      ++   + 
Sbjct  61   DFTLAESVAILLYLSRKYETPDHWYPQDLQARARVDEYLAWQHTALRTSCTRTLWQKMMF  120

Query  463  PAF  471
            P F
Sbjct  121  PVF  123



>ref|XP_003803343.1| PREDICTED: glutathione S-transferase theta-1-like [Otolemur garnettii]
Length=240

 Score =   125 bits (315),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 82/134 (61%), Gaps = 1/134 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K N I FE   +++ KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MVLELYLDLLSQPCRAIYIFAKKNRIPFEMRTVELLKGQHLSDAFAQVNPLKKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL     V D+WYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   DFILTESVAILLYLTRKYQVPDYWYPQDLQARARVDEYLAWQHTALRRNCLRALWHKVML  120

Query  463  PAF-GLPCNPHAAA  501
            P F G P  P   A
Sbjct  121  PVFLGEPVPPQTLA  134



>ref|XP_011400420.1| Glutathione S-transferase theta-2B [Auxenochlorella protothecoides]
 gb|KFM27453.1| Glutathione S-transferase theta-2B [Auxenochlorella protothecoides]
Length=702

 Score =   131 bits (329),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 90/141 (64%), Gaps = 2/141 (1%)
 Frame = +1

Query  70   RWSPPER-DREEMAVK-LYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAA  243
            R +P +R DR  M    LY D +SQP RA+++ C+ NGID E   I I +G+HR+ ++ A
Sbjct  448  RSNPRDRPDRSTMPRPVLYADMLSQPCRAVVVLCQQNGIDVEIKPISIGRGEHRSADFKA  507

Query  244  INPMKQVPAVVDGDFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLR  423
            +NP+ ++P +VDGD  + +S A L YL   N V D+WYPAD  K+A+V++V  WH S LR
Sbjct  508  VNPLCKLPYLVDGDVHIGDSIAILIYLCTVNRVPDNWYPADPVKQARVNTVLGWHGSTLR  567

Query  424  RGAAGYVFNTALAPAFGLPCN  486
             G+   +FN  LAP  G P N
Sbjct  568  TGSTITIFNRVLAPLRGTPSN  588



>ref|XP_004466461.1| PREDICTED: glutathione S-transferase theta-1-like isoform 3 [Dasypus 
novemcinctus]
Length=240

 Score =   125 bits (315),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 84/144 (58%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K NGI FE   + + KG+H +  +  +NP+K VP + DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKRNGIPFELHPVDLRKGEHLSQGFVQVNPLKMVPVLKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL     V DHWYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   DFVLTESVAILLYLTRKYKVPDHWYPQDLQARARVDEYLAWQHTTLRRNCLRSLWHKVML  120

Query  463  PAF-GLPCNPHAAAEAEKVLLASL  531
            P F G P +P   A     L A+L
Sbjct  121  PVFLGEPVSPETLAATLADLEATL  144



>ref|XP_009090481.1| PREDICTED: glutathione S-transferase theta-1-like [Serinus canaria]
Length=241

 Score =   125 bits (314),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 79/131 (60%), Gaps = 1/131 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +++Y+D +SQP RAL IF ++N I FE  ++Q+ KGQH+T E+  +N + +VPA+ DG
Sbjct  1    MGLEMYLDLLSQPCRALYIFARSNNIPFEFKRVQLTKGQHKTEEFRQVNVLMKVPALRDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
             F L ES A L YLA      DHWYPADLQKRA+VD    W H ++R        +  L 
Sbjct  61   SFTLAESIAILLYLAQKFKTPDHWYPADLQKRARVDEYLSWQHVSIRAKGIKLFLSKVLL  120

Query  463  PAF-GLPCNPH  492
            P   G P  P 
Sbjct  121  PLITGQPLPPE  131



>ref|XP_010953754.1| PREDICTED: glutathione S-transferase theta-2 isoform X2 [Camelus 
bactrianus]
Length=240

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 77/123 (63%), Gaps = 0/123 (0%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K NGI FE   + + KGQH + ++A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRTVDLLKGQHHSDDFAQVNPLKKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL+      DHWYP DLQ RA+VD    W H+ LR      ++   + 
Sbjct  61   DFTLAESVAILLYLSRKYETPDHWYPQDLQARARVDEYLAWQHTALRTSCTRTLWQKMMF  120

Query  463  PAF  471
            P F
Sbjct  121  PVF  123



>ref|XP_007063803.1| PREDICTED: glutathione S-transferase theta-1-like [Chelonia mydas]
Length=242

 Score =   125 bits (314),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 83/144 (58%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP R + IF K N I FE   +++ KGQH   E+  +N +K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRTVYIFAKKNNIPFEFKHVELFKGQHYREEFGKVNILKKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
             F L ES A L YL+      DHWYP+D+QKRA+VD    WHH+N+R  A   ++   L 
Sbjct  61   VFTLAESTAILLYLSRKYNTPDHWYPSDIQKRARVDEYLSWHHTNIRANAPKTLWIKVLI  120

Query  463  PAF-GLPCNPHAAAEAEKVLLASL  531
            P F G    P    E    L  SL
Sbjct  121  PLFTGQTLPPEKLQEVMDELAISL  144



>ref|XP_004400592.1| PREDICTED: glutathione S-transferase theta-1-like [Odobenus rosmarus 
divergens]
Length=240

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 78/123 (63%), Gaps = 0/123 (0%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQPSRA+ IF K NGI FE   +++ KGQ  +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPSRAVYIFAKKNGIPFELRSVELLKGQQHSDAFAQVNPLKKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL+    V DHWYP DLQ RA+VD    W H+ LR      ++   + 
Sbjct  61   DFTLAESVAILLYLSRKYEVPDHWYPQDLQARARVDEYLAWQHTALRSSCTRAMWQKMMF  120

Query  463  PAF  471
            P F
Sbjct  121  PVF  123



>ref|XP_010985617.1| PREDICTED: glutathione S-transferase theta-1-like isoform X1 
[Camelus dromedarius]
 gb|AHN49806.1| glutahione S-transferase theta [synthetic construct]
Length=240

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 77/123 (63%), Gaps = 0/123 (0%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K NGI FE   + + KGQH + ++A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRTVDLLKGQHHSDDFAQVNPLKKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL+      DHWYP DLQ RA+VD    W H+ LR      ++   + 
Sbjct  61   DFTLAESVAILLYLSRKYETPDHWYPQDLQARARVDEYLAWQHTALRTSCTRTLWQKMMF  120

Query  463  PAF  471
            P F
Sbjct  121  PVF  123



>ref|XP_006746108.1| PREDICTED: glutathione S-transferase theta-1-like [Leptonychotes 
weddellii]
Length=240

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 78/123 (63%), Gaps = 0/123 (0%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K NGI FE   +++ KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRPVELLKGQHHSDAFAQVNPLKKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL+    V DHWYP DLQ RA+VD    W H+ LR      ++   + 
Sbjct  61   DFTLAESVAILLYLSRKYEVPDHWYPQDLQARARVDEYLAWQHTALRSSCTRAMWQKMMF  120

Query  463  PAF  471
            P F
Sbjct  121  PVF  123



>gb|AHC08064.1| theta glutathione S-transferase [Locusta migratoria]
Length=231

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 84/140 (60%), Gaps = 5/140 (4%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M++K Y D  SQPSRA+L+  K N I FE  +I + KG+H + EYA INP ++VP +V G
Sbjct  1    MSLKFYYDIFSQPSRAVLLLLKLNKIPFESKKINLLKGEHFSEEYAKINPFQKVPVIVHG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF LFES A L+YL     VADHWYP D + +AKVD   +W H  +R     Y F T   
Sbjct  61   DFALFESVAILRYLCREFEVADHWYPKDSKAQAKVDEYVEWQHIEIRANLVNY-FRT---  116

Query  463  PAFGLPCNPHAAAEAEKVLL  522
              F LP      A+ +KV++
Sbjct  117  -KFLLPVVTGRPADGKKVIV  135



>ref|NP_956815.1| glutathione S-transferase theta-like [Danio rerio]
 gb|AAH55612.1| Zgc:66350 [Danio rerio]
 gb|AAI65095.1| Zgc:66350 protein [Danio rerio]
Length=242

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 81/139 (58%), Gaps = 4/139 (3%)
 Frame = +1

Query  106  AVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGD  285
            AVK Y+D MSQP RA+LIF K N I     QI I KG+ +TPE+  +NPM++VP + D  
Sbjct  6    AVKAYLDLMSQPCRAVLIFLKHNKIPHTVEQIAIRKGEQKTPEFTKLNPMQKVPVLEDNG  65

Query  286  FKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAP  465
            F L ES A LKYLA    V DHWYP   +KRA+VD    WHH N R  AA   +   L P
Sbjct  66   FVLTESDAILKYLATTYKVPDHWYPKLPEKRARVDEYTAWHHMNTRMHAATVFWQEVLLP  125

Query  466  AF-GLPCNPHAAAEAEKVL  519
               G P N    A+ EK L
Sbjct  126  LMTGQPAN---TAKLEKAL  141



>ref|XP_004318777.1| PREDICTED: glutathione S-transferase theta-1-like, partial [Tursiops 
truncatus]
Length=239

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 76/123 (62%), Gaps = 0/123 (0%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K NGI FE   + + KGQH + ++A +NP+++VPA+ DG
Sbjct  1    MGLQLYLDLLSQPCRAVYIFAKKNGIPFELRTVDLLKGQHYSDDFAQVNPLRKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL       DHWYP DLQ RA+VD    W H+ LR      ++   L 
Sbjct  61   DFTLAESVAILLYLTRKYETPDHWYPQDLQARARVDEYLAWQHTALRTSCTRTMWQKMLL  120

Query  463  PAF  471
            P F
Sbjct  121  PVF  123



>ref|XP_006513055.1| PREDICTED: glutathione S-transferase, theta 3 isoform X1 [Mus 
musculus]
Length=200

 Score =   124 bits (310),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 80/136 (59%), Gaps = 1/136 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D MSQP RA+ IF K NGI F+   I++ KGQ  T  +A +NP+++VPA+ DG
Sbjct  1    MGLELYLDLMSQPCRAVYIFAKKNGIPFQLRTIELLKGQQYTDSFAQVNPLRKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL+      DHWYP DLQ RA+VD    W H+ LR      ++   + 
Sbjct  61   DFVLAESVAILLYLSRKYKAPDHWYPQDLQTRARVDEYLAWQHTALRSCCTRAMWQKMMF  120

Query  463  PAF-GLPCNPHAAAEA  507
            P F G P  P   A  
Sbjct  121  PVFLGQPVPPEMLAST  136



>ref|XP_007092374.1| PREDICTED: glutathione S-transferase theta-1-like [Panthera tigris 
altaica]
Length=240

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 77/123 (63%), Gaps = 0/123 (0%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K NGI FE   +++ KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLISQPCRAVYIFAKKNGIPFELRTVELLKGQHHSDAFAQVNPLKKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL     V DHWYP DLQ RA+VD    W H+ LR      ++   + 
Sbjct  61   DFTLAESVAILLYLCRKYEVPDHWYPQDLQARARVDEYLAWQHTALRNSCTRAMWQKMMF  120

Query  463  PAF  471
            P F
Sbjct  121  PVF  123



>ref|XP_003994893.1| PREDICTED: glutathione S-transferase theta-1-like [Felis catus]
Length=240

 Score =   124 bits (312),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 77/123 (63%), Gaps = 0/123 (0%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K NGI FE   +++ KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLISQPCRAVYIFAKKNGIPFELRTVELLKGQHHSDAFAQVNPLKKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL     V DHWYP DLQ RA+VD    W H+ LR      ++   + 
Sbjct  61   DFTLAESVAILLYLCRKYEVPDHWYPQDLQARARVDEYLAWQHTALRNSCTRAMWQKMMF  120

Query  463  PAF  471
            P F
Sbjct  121  PVF  123



>ref|XP_005147828.1| PREDICTED: glutathione S-transferase theta-1-like [Melopsittacus 
undulatus]
Length=242

 Score =   124 bits (312),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 81/131 (62%), Gaps = 1/131 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RAL IF ++N I FE  Q+++ KG+H+T E+  +N + +VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRALYIFARSNNIPFEFKQVELIKGEHKTEEFQKVNLLMKVPAMRDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLR-RGAAGYVFNTAL  459
             F L ES A L Y+       DHWYP+DLQKRA+VD    W H N+R +G+  ++    L
Sbjct  61   SFTLAESIAILLYMVRKFKTPDHWYPSDLQKRARVDEYLSWQHVNIRGKGSKVFLMKVLL  120

Query  460  APAFGLPCNPH  492
                G P  P 
Sbjct  121  PLLTGQPLPPE  131



>ref|XP_790223.2| PREDICTED: glutathione S-transferase theta-1-like [Strongylocentrotus 
purpuratus]
Length=227

 Score =   124 bits (311),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 84/146 (58%), Gaps = 3/146 (2%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M +K+YVD  SQP RAL++F K + I  E V++ + KG  + PE+AAINP+KQ PA+ DG
Sbjct  1    MVIKVYVDLGSQPCRALVVFLKHSSIPHEIVELDLGKGDQKKPEFAAINPLKQFPAIKDG  60

Query  283  DFKLFESHAALKYLAAA--NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTA  456
            DF L E+ A  +YL        +DHWYPAD  +RAKVD    +HH  +R           
Sbjct  61   DFCLAETVAIFRYLTTQFPKSFSDHWYPADPHRRAKVDEYLSFHHQGIRAPVDAVFMTEV  120

Query  457  LAPAF-GLPCNPHAAAEAEKVLLASL  531
            + P   G P +P    E EKV+  +L
Sbjct  121  MLPIITGKPLSPEKMKEEEKVMREAL  146



>ref|XP_004466459.1| PREDICTED: glutathione S-transferase theta-1-like isoform 1 [Dasypus 
novemcinctus]
Length=259

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 84/144 (58%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K NGI FE   + + KG+H +  +  +NP+K VP + DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKRNGIPFELHPVDLRKGEHLSQGFVQVNPLKMVPVLKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL     V DHWYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   DFVLTESVAILLYLTRKYKVPDHWYPQDLQARARVDEYLAWQHTTLRRNCLRSLWHKVML  120

Query  463  PAF-GLPCNPHAAAEAEKVLLASL  531
            P F G P +P   A     L A+L
Sbjct  121  PVFLGEPVSPETLAATLADLEATL  144



>ref|XP_004742533.1| PREDICTED: glutathione S-transferase theta-1-like isoform X1 
[Mustela putorius furo]
Length=333

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 79/123 (64%), Gaps = 0/123 (0%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K NGI FE  Q+++ KGQH +  +A +NP+++VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRQVELLKGQHHSDAFAQVNPLRKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL+    V DHWYP DLQ RA+VD    W H+ LR      ++   + 
Sbjct  61   DFTLAESVAILLYLSRKYEVPDHWYPQDLQARARVDEYLAWQHTALRSSCTRAMWQKMMF  120

Query  463  PAF  471
            P F
Sbjct  121  PVF  123



>ref|XP_006213356.1| PREDICTED: glutathione S-transferase theta-1-like isoform X1 
[Vicugna pacos]
Length=240

 Score =   124 bits (312),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 81/134 (60%), Gaps = 1/134 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K N I FE   + + KGQH +  +A I+P+++VP + DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNSIPFELRTVDLRKGQHLSDAFAQISPLQKVPVLKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL     V DHWYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLTESVAILLYLTRKYKVPDHWYPQDLQARARVDEYLAWQHTALRRNCLRALWHKVML  120

Query  463  PAF-GLPCNPHAAA  501
            P F G P +P   A
Sbjct  121  PVFLGEPVSPEMLA  134



>ref|XP_003803344.1| PREDICTED: glutathione S-transferase theta-1-like [Otolemur garnettii]
Length=240

 Score =   124 bits (311),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 80/134 (60%), Gaps = 1/134 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K N I FE   +++ KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MVLELYLDLVSQPCRAVYIFAKKNSIPFEMRTVELLKGQHYSDAFAQVNPLKKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL+      DHWYP DLQ RA+VD    W H+ LR      ++   + 
Sbjct  61   DFTLAESVAILLYLSRKYKAPDHWYPQDLQARARVDEYLSWQHTALRSSCTRAMWQKMMF  120

Query  463  PAF-GLPCNPHAAA  501
            P F G P  P   A
Sbjct  121  PVFLGEPVPPETLA  134



>ref|XP_005288627.1| PREDICTED: glutathione S-transferase theta-1-like [Chrysemys 
picta bellii]
Length=242

 Score =   124 bits (311),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 83/144 (58%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K N + FE   +++ KGQH   E+  +N +K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNNVPFEFKHVELFKGQHYREEFGKVNILKKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
             F L ES A L YL+      DHWYP+D QKRA+VD    WHH+N+R  A   ++   L 
Sbjct  61   VFTLAESTAILLYLSRKYNTPDHWYPSDTQKRARVDEYLSWHHTNIRGNAGKALWIKVLI  120

Query  463  PAF-GLPCNPHAAAEAEKVLLASL  531
            P F G    P    E    L  SL
Sbjct  121  PLFTGQTLPPEKLQEVMDELAISL  144



>ref|XP_005396465.1| PREDICTED: glutathione S-transferase theta-1-like [Chinchilla 
lanigera]
Length=240

 Score =   124 bits (311),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 77/122 (63%), Gaps = 0/122 (0%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D MSQP RA+ IF K NGI F+   +++ KGQH T  +A INP+++VPA+ DG
Sbjct  1    MGLELYLDLMSQPCRAVYIFAKKNGIPFQLRTVELLKGQHYTDSFAQINPLRKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL+      DHWYP DLQ RA+VD    W H+ LR   +  ++   + 
Sbjct  61   DFTLAESVAILLYLSRKYKTPDHWYPQDLQARARVDEFLSWQHTALRSCCSRAMWQKMMF  120

Query  463  PA  468
            P 
Sbjct  121  PV  122



>ref|XP_007451118.1| PREDICTED: glutathione S-transferase theta-1-like [Lipotes vexillifer]
Length=240

 Score =   124 bits (311),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 76/123 (62%), Gaps = 0/123 (0%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K NGI FE   + + KGQH + ++A +NP+++VPA+ DG
Sbjct  1    MGLQLYLDLLSQPCRAVYIFAKKNGIPFELRTVDLLKGQHYSDDFAQVNPLRKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL       DHWYP DLQ RA+VD    W H+ LR      ++   L 
Sbjct  61   DFTLAESVAILLYLTCKYEAPDHWYPQDLQARARVDEYLAWQHTALRTSCTRTMWQKMLF  120

Query  463  PAF  471
            P F
Sbjct  121  PVF  123



>ref|NP_598755.1| glutathione S-transferase, theta 3 [Mus musculus]
 gb|AAM33420.1|AF508157_1 glutathione S-transferase theta 3 [Mus musculus]
 gb|AAH03903.1| Glutathione S-transferase, theta 3 [Mus musculus]
 gb|AAH57964.1| Glutathione S-transferase, theta 3 [Mus musculus]
 dbj|BAE32415.1| unnamed protein product [Mus musculus]
 dbj|BAE40180.1| unnamed protein product [Mus musculus]
 dbj|BAE23741.1| unnamed protein product [Mus musculus]
 gb|EDL31889.1| glutathione S-transferase, theta 3 [Mus musculus]
Length=241

 Score =   124 bits (311),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 80/136 (59%), Gaps = 1/136 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D MSQP RA+ IF K NGI F+   I++ KGQ  T  +A +NP+++VPA+ DG
Sbjct  1    MGLELYLDLMSQPCRAVYIFAKKNGIPFQLRTIELLKGQQYTDSFAQVNPLRKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL+      DHWYP DLQ RA+VD    W H+ LR      ++   + 
Sbjct  61   DFVLAESVAILLYLSRKYKAPDHWYPQDLQTRARVDEYLAWQHTALRSCCTRAMWQKMMF  120

Query  463  PAF-GLPCNPHAAAEA  507
            P F G P  P   A  
Sbjct  121  PVFLGQPVPPEMLAST  136



>ref|XP_006874993.1| PREDICTED: glutathione S-transferase theta-1-like [Chrysochloris 
asiatica]
Length=240

 Score =   124 bits (311),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 80/134 (60%), Gaps = 1/134 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++L++D +SQP RA+ IF K N I FE   +++ KGQH +  +A +NPM+QVPA+ DG
Sbjct  1    MGLELFLDLLSQPCRAVYIFAKRNRIPFELRTVELLKGQHHSDAFAQVNPMRQVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL+      DHWYP DLQ RA+VD    W H+ LR      ++   + 
Sbjct  61   DFTLAESVAILLYLSRKYQTPDHWYPQDLQTRARVDEYLAWQHTALRYSCTRALWQKVMF  120

Query  463  PAF-GLPCNPHAAA  501
            P F G P  P   A
Sbjct  121  PVFLGEPVPPEMLA  134



>ref|XP_005334522.1| PREDICTED: glutathione S-transferase theta-1-like [Ictidomys 
tridecemlineatus]
Length=240

 Score =   124 bits (311),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 78/123 (63%), Gaps = 0/123 (0%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K NGI F+   +++ KGQH +  +  +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFQLRTVELLKGQHLSDAFVQVNPLKKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL     V +HWYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   DFILTESVAILLYLTHKYKVPEHWYPQDLQTRARVDEYLAWQHTTLRRNCLRALWHKVML  120

Query  463  PAF  471
            P F
Sbjct  121  PNF  123



>gb|AAX29474.1| glutathione S-transferase theta 1 [synthetic construct]
Length=241

 Score =   124 bits (311),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 81/134 (60%), Gaps = 1/134 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K N I FE   + + KGQH +   A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDACAQVNPLKKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL     V D+WYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMF  120

Query  463  PAF-GLPCNPHAAA  501
            P F G P +P   A
Sbjct  121  PVFLGEPVSPQTLA  134



>gb|AAH07065.1| Glutathione S-transferase theta 1 [Homo sapiens]
 gb|ABM84406.1| glutathione S-transferase theta 1 [synthetic construct]
 gb|ABM87756.1| glutathione S-transferase theta 1 [synthetic construct]
 gb|AIC54513.1| GSTT1, partial [synthetic construct]
Length=240

 Score =   124 bits (311),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 81/134 (60%), Gaps = 1/134 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K N I FE   + + KGQH +   A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDACAQVNPLKKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL     V D+WYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMF  120

Query  463  PAF-GLPCNPHAAA  501
            P F G P +P   A
Sbjct  121  PVFLGEPVSPQTLA  134



>ref|XP_007127246.1| PREDICTED: glutathione S-transferase theta-1-like [Physeter catodon]
Length=240

 Score =   124 bits (310),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 76/123 (62%), Gaps = 0/123 (0%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K NGI FE   + + KGQH + ++A +NP+++VPA+ DG
Sbjct  1    MGLQLYLDLLSQPCRAVYIFAKKNGIPFELRTVDLLKGQHYSDDFAQVNPLRKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL       DHWYP DLQ RA+VD    W H+ LR      ++   L 
Sbjct  61   DFTLAESVAILLYLTRKYEAPDHWYPQDLQARARVDEYLAWQHTALRTSCTRTMWQKMLF  120

Query  463  PAF  471
            P F
Sbjct  121  PVF  123



>gb|KFO57915.1| Glutathione S-transferase theta-1, partial [Corvus brachyrhynchos]
Length=240

 Score =   124 bits (310),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 78/131 (60%), Gaps = 1/131 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RAL IF ++N    E  ++Q+AKGQH+T E+  +N + +VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRALYIFARSNNNPLEFKRVQLAKGQHKTEEFQKVNVLMKVPALRDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
             F L ES A L YL       DHWYP+DLQKRA+VD    W H+N+R   +       L 
Sbjct  61   SFTLAESIAILLYLVQKFKTPDHWYPSDLQKRARVDEYLSWQHANIRAKGSKLFLTKVLL  120

Query  463  PAF-GLPCNPH  492
            P   G P  P 
Sbjct  121  PLLTGQPLPPE  131



>ref|XP_008630325.1| PREDICTED: glutathione S-transferase theta-1-like [Corvus brachyrhynchos]
Length=244

 Score =   124 bits (310),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 78/131 (60%), Gaps = 1/131 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RAL IF ++N    E  ++Q+AKGQH+T E+  +N + +VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRALYIFARSNNNPLEFKRVQLAKGQHKTEEFQKVNVLMKVPALRDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
             F L ES A L YL       DHWYP+DLQKRA+VD    W H+N+R   +       L 
Sbjct  61   SFTLAESIAILLYLVQKFKTPDHWYPSDLQKRARVDEYLSWQHANIRAKGSKLFLTKVLL  120

Query  463  PAF-GLPCNPH  492
            P   G P  P 
Sbjct  121  PLLTGQPLPPE  131



>dbj|BAB22023.1| unnamed protein product [Mus musculus]
Length=240

 Score =   123 bits (309),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/139 (45%), Positives = 85/139 (61%), Gaps = 3/139 (2%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K N I F+   +++ KG+H +  +A +NPMK+VPA++DG
Sbjct  1    MVLELYLDLLSQPRRAIYIFAKKNNIPFQMHTVELRKGEHLSDAFARVNPMKRVPAMMDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
             F L ES A L YLA    V DHWYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   GFTLCESVAILLYLAHKYKVPDHWYPQDLQARARVDEYLAWQHTGLRRSCLRALWHKVMF  120

Query  463  PAF---GLPCNPHAAAEAE  510
            P F    +P    AA  AE
Sbjct  121  PVFLGEQIPPETLAATLAE  139



>emb|CAA66665.1| glutathione S-transferase theta [Mus musculus]
Length=240

 Score =   123 bits (309),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/139 (45%), Positives = 85/139 (61%), Gaps = 3/139 (2%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K N I F+   +++ KG+H +  +A +NPMK+VPA++DG
Sbjct  1    MVLELYLDLLSQPCRAIYIFAKKNNIPFQMHTVELRKGEHLSDAFARVNPMKKVPAMMDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
             F L ES A L YLA    V DHWYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   GFTLCESVAILLYLAHKYKVPDHWYPQDLQARARVDEYLAWQHTGLRRSCLRALWHKVMF  120

Query  463  PAF---GLPCNPHAAAEAE  510
            P F    +P    AA  AE
Sbjct  121  PVFLGEQIPPETLAATLAE  139



>ref|XP_003508143.1| PREDICTED: glutathione S-transferase theta-1 [Cricetulus griseus]
 ref|XP_007619964.1| PREDICTED: glutathione S-transferase theta-1 [Cricetulus griseus]
 gb|EGW12153.1| Glutathione S-transferase theta-1 [Cricetulus griseus]
 gb|ERE92753.1| glutathione S-transferase theta-1-like protein [Cricetulus griseus]
Length=241

 Score =   123 bits (309),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 81/134 (60%), Gaps = 1/134 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D MSQP RA+ IF K N I F+   I++ KGQH T ++A +NP+++VPA+ DG
Sbjct  1    MGLELYLDLMSQPCRAVYIFAKKNDIPFQLRTIELLKGQHYTDDFAQVNPLRKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL+      DHWYP DLQ RA+VD    W H+ LR      ++   + 
Sbjct  61   DFILAESVAILLYLSRKYKAPDHWYPQDLQARARVDEYLSWQHTALRSCCTRAMWQKMMF  120

Query  463  PAF-GLPCNPHAAA  501
            P + G P  P   A
Sbjct  121  PKYLGQPVAPETLA  134



>ref|NP_032211.3| glutathione S-transferase theta-1 [Mus musculus]
 sp|Q64471.4|GSTT1_MOUSE RecName: Full=Glutathione S-transferase theta-1; AltName: Full=GST 
class-theta-1 [Mus musculus]
 gb|AAH12254.1| Glutathione S-transferase, theta 1 [Mus musculus]
 gb|AAH55020.1| Glutathione S-transferase, theta 1 [Mus musculus]
 gb|EDL31888.1| glutathione S-transferase, theta 1, isoform CRA_c [Mus musculus]
Length=240

 Score =   123 bits (309),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 62/139 (45%), Positives = 85/139 (61%), Gaps = 3/139 (2%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K N I F+   +++ KG+H +  +A +NPMK+VPA++DG
Sbjct  1    MVLELYLDLLSQPCRAIYIFAKKNNIPFQMHTVELRKGEHLSDAFARVNPMKRVPAMMDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
             F L ES A L YLA    V DHWYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   GFTLCESVAILLYLAHKYKVPDHWYPQDLQARARVDEYLAWQHTGLRRSCLRALWHKVMF  120

Query  463  PAF---GLPCNPHAAAEAE  510
            P F    +P    AA  AE
Sbjct  121  PVFLGEQIPPETLAATLAE  139



>gb|AAH62201.1| Glutathione S-transferase, theta 3 [Mus musculus]
Length=241

 Score =   123 bits (309),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 79/131 (60%), Gaps = 1/131 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D MSQP RA+ IF K NGI F+   I++ KGQ  T  +A +NP+++VPA+ DG
Sbjct  1    MGLELYLDLMSQPCRAVYIFAKKNGIPFQLRTIELLKGQQYTDSFAQVNPLRKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL+      DHWYP DLQ RA+VD    W H+ LR      ++   + 
Sbjct  61   DFVLAESVAILLYLSRKYKAPDHWYPQDLQTRARVDEYLAWQHTALRSCCTRAMWQKMMF  120

Query  463  PAF-GLPCNPH  492
            P F G P  P 
Sbjct  121  PVFLGQPVPPE  131



>ref|XP_797684.3| PREDICTED: glutathione S-transferase theta-1-like [Strongylocentrotus 
purpuratus]
Length=226

 Score =   123 bits (308),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 78/125 (62%), Gaps = 2/125 (2%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M VK+YVD +SQP RAL++F K   I FE   I +  G H+ PE+  + P+  VPA+ DG
Sbjct  1    MVVKVYVDLLSQPCRALILFLKNTKIPFEIETINLNDGGHKKPEFVKMTPLCTVPAIQDG  60

Query  283  DFKLFESHAALKYLAA--ANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTA  456
            DF + E+ A ++YLA   A+ V DHWYP DL+KRA+VD    +HH+  R G  G  F+  
Sbjct  61   DFGMGETVAIIRYLATKYADLVPDHWYPKDLEKRARVDEYMAFHHTGTRGGCGGLFFSEV  120

Query  457  LAPAF  471
            L P F
Sbjct  121  LIPVF  125



>ref|XP_003281783.1| PREDICTED: glutathione S-transferase theta-1-like [Nomascus leucogenys]
Length=240

 Score =   123 bits (308),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 81/134 (60%), Gaps = 1/134 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K N I FE   + + KGQH +  +A +NP+K+VPA+ D 
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDE  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL     V D+WYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKMMF  120

Query  463  PAF-GLPCNPHAAA  501
            P F G P +P   A
Sbjct  121  PVFLGEPVSPQTLA  134



>ref|XP_005288626.1| PREDICTED: glutathione S-transferase theta-1-like [Chrysemys 
picta bellii]
Length=239

 Score =   123 bits (308),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 82/144 (57%), Gaps = 1/144 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M V+L++D  SQP RAL IF K N I FE   +++ KG H + E+  +N +K+VPA+ DG
Sbjct  1    MVVELFLDLRSQPCRALFIFAKKNNIPFEFKDVELLKGHHLSEEFGKVNVLKKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
             F L ES A L YL+      DHWYP+DLQKRA+VD    W H+ +R           L 
Sbjct  61   AFTLAESIAILLYLSRKFNTPDHWYPSDLQKRARVDEYLSWQHTTIREKGCKIFITKVLV  120

Query  463  P-AFGLPCNPHAAAEAEKVLLASL  531
            P   G P +P    EA + L ++L
Sbjct  121  PLVVGQPFSPEKLEEAVEELNSAL  144



>gb|ABQ82132.1| glutathione S-transferase theta [Alitta succinea]
Length=226

 Score =   122 bits (307),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 62/142 (44%), Positives = 87/142 (61%), Gaps = 1/142 (1%)
 Frame = +1

Query  109  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDF  288
            +KLY D MSQPSRA+ IF KA GI FEE  + + KG+H+T E+A INP + VP + DG F
Sbjct  4    LKLYFDLMSQPSRAVWIFLKATGIPFEEKPVALRKGEHQTEEFAKINPFQLVPVIDDGGF  63

Query  289  KLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAP-  465
             L+ES +  KYLA +  +ADHWYP++L+ RA+++S   WH   +R  A+       + P 
Sbjct  64   VLYESLSICKYLAKSRNLADHWYPSELKHRARIESYLQWHCLMVRLFASQVFRIQVIEPR  123

Query  466  AFGLPCNPHAAAEAEKVLLASL  531
            A   P +    A+ E +L   L
Sbjct  124  AMNKPVDRQRLAKYENILSVVL  145



>ref|XP_005360257.1| PREDICTED: glutathione S-transferase theta-1-like [Microtus ochrogaster]
Length=298

 Score =   124 bits (311),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 81/136 (60%), Gaps = 1/136 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D MSQP RA+ IF K N I F+   I++ KGQH T ++A +NP+++VPA+ DG
Sbjct  58   MGLELYLDLMSQPCRAVYIFAKKNNIPFQLRTIELLKGQHYTDDFAQVNPLRKVPALKDG  117

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL+      DHWYP DLQ RA+VD    W H+ LR      ++   + 
Sbjct  118  DFVLAESVAILLYLSRKYKAPDHWYPQDLQARARVDEYLSWQHTALRSCCTRAMWQKMMF  177

Query  463  PAF-GLPCNPHAAAEA  507
            P F G P  P   A  
Sbjct  178  PKFLGQPVPPEMLAST  193



>ref|NP_445745.1| glutathione S-transferase theta-1 [Rattus norvegicus]
 sp|Q01579.2|GSTT1_RAT RecName: Full=Glutathione S-transferase theta-1; AltName: Full=GST 
5-5; AltName: Full=GST class-theta-1; AltName: Full=Glutathione 
S-transferase 5 [Rattus norvegicus]
 emb|CAA47896.1| glutathione transferase [Rattus norvegicus]
 gb|AAH86426.1| Glutathione S-transferase theta 1 [Rattus norvegicus]
 gb|EDL97185.1| glutathione S-transferase theta 1, isoform CRA_a [Rattus norvegicus]
 gb|ACI32125.1| glutathione S-transferase theta 1 [Rattus norvegicus]
Length=240

 Score =   123 bits (308),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 78/123 (63%), Gaps = 0/123 (0%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K N I F+   +++ KG+H +  +A +NPMK+VPA+ DG
Sbjct  1    MVLELYLDLLSQPCRAIYIFAKKNNIPFQMHTVELRKGEHLSDAFAQVNPMKKVPAMKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
             F L ES A L YLA    V DHWYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   GFTLCESVAILLYLAHKYKVPDHWYPQDLQARARVDEYLAWQHTTLRRSCLRTLWHKVMF  120

Query  463  PAF  471
            P F
Sbjct  121  PVF  123



>ref|XP_005396466.1| PREDICTED: glutathione S-transferase theta-1-like [Chinchilla 
lanigera]
Length=240

 Score =   123 bits (308),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 79/123 (64%), Gaps = 0/123 (0%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+  +SQP RA+ IF K NGI F++  +++ KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLHLLSQPCRAIYIFAKKNGIPFQQRTVELLKGQHLSDAFAQVNPLKKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL     V D+WYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   DFILTESVAILLYLVRKYKVPDYWYPQDLQARARVDEYLAWQHTALRRNCLRALWHKVMF  120

Query  463  PAF  471
            P F
Sbjct  121  PVF  123



>ref|XP_005987168.1| PREDICTED: glutathione S-transferase theta-1-like isoform X3 
[Latimeria chalumnae]
Length=242

 Score =   123 bits (308),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 81/136 (60%), Gaps = 1/136 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            MA++LY D +SQP RAL IF +  G+ +   +  + +G+H++ EYA INPM+ +PA+V+ 
Sbjct  1    MALELYSDLLSQPCRALAIFLRVLGVPYTTRKTSLLEGEHKSAEYARINPMQSIPAMVEE  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
             F L ES A +KYLAA     DHWYPAD+++RAKVD    WHH   RR A        L 
Sbjct  61   GFVLTESVAIIKYLAARYNAPDHWYPADVRRRAKVDEYLAWHHLQTRRHAMKVFILEGLL  120

Query  463  PAF-GLPCNPHAAAEA  507
            P   GLP      A A
Sbjct  121  PKLTGLPVEEEKLATA  136



>ref|XP_004887553.1| PREDICTED: glutathione S-transferase theta-1-like isoform X1 
[Heterocephalus glaber]
Length=240

 Score =   122 bits (307),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 77/123 (63%), Gaps = 0/123 (0%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K NGI F+   + + KGQH +  +  +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAIYIFAKKNGIPFQLRTVDLLKGQHLSDAFVQVNPLKKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL     V D+WYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTALRRNCLRALWHKVMF  120

Query  463  PAF  471
            P F
Sbjct  121  PVF  123



>ref|XP_004843627.1| PREDICTED: glutathione S-transferase theta-1-like [Heterocephalus 
glaber]
Length=240

 Score =   122 bits (307),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 77/123 (63%), Gaps = 0/123 (0%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K NGI F+   + + KGQH +  +  +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAIYIFAKKNGIPFQLRTVDLLKGQHLSDAFVQVNPLKKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL     V D+WYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTALRRNCLRALWHKVMF  120

Query  463  PAF  471
            P F
Sbjct  121  PVF  123



>ref|XP_004742535.1| PREDICTED: glutathione S-transferase theta-1-like isoform X1 
[Mustela putorius furo]
 ref|XP_004817179.1| PREDICTED: glutathione S-transferase theta-1-like isoform X1 
[Mustela putorius furo]
Length=240

 Score =   122 bits (307),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 81/134 (60%), Gaps = 1/134 (1%)
 Frame = +1

Query  103  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  282
            M ++LY+D +SQP RA+ IF K N I FE   + + KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAIYIFAKKNRIPFELRPVDLLKGQHLSDAFARVNPLKKVPALKDG  60

Query  283  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  462
            DF L ES A L YL     V +HWYP D+Q RA VD    W H+ LRR     +++  + 
Sbjct  61   DFTLAESVAILLYLTRKYKVPEHWYPQDVQARALVDEYLAWQHTTLRRSCLRALWHKVMF  120

Query  463  PAF-GLPCNPHAAA  501
            P F G P +P   A
Sbjct  121  PVFLGEPVSPEMLA  134



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 556507818200